1XMQE

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmqE02
5IWAI 1A6FA 4DPUA 1U2RA 2ZM6E 2KHXA 4DUZI 3M6AA 1KTVA 1FWLA 4B3RE 2J7KA 2L2KB 1IBME 4DV7I 1WHNA 3J80C 4DR3I 4JI8E 3ADLA 3ADJA 3ADIA 4HY1A 3T1HI 2HHHE 4JI5E 1H73A 3HULA 2JY9A 3HTXA 1UHZA 2HFSA 4DR5E 2E5LE 4X64I 2UUAI 4LF8I 5CFFE 1KIJA 5IT9C 4M1KA 2DEIA 1QZRA 1EKZA 3JAMQ 1N36I 2IHR1 1EA6A 2NPFA 4JI4I 4KHPI 1WHQA 1Z0CA 4USKA 4LFAE 1N32I 2NUEA 1N34I 1XHKA 4ED4A 4PU9A 4WUBA 1FWKA 2HKEA 4AQYI 4DV4I 4DU7A 2A2DA 4YY3I 3K17A 4JI1E 4P7AA 4JI2I 4DV6I 4FWGA 4JI0I 1IBKE 1EI1A 3V5RA 4OX9I 2NA2A 4GKJE 2VQFI 2NUFA 1D6TA 3C4BA 3PYFA 1BKNA 4JI6E 1HNXE 1I94E 4GKKI 2L2NA 4YHHI 4DR4E 2NUGA 1YYOA 2MDRA 1FKAE 2L3CA 3CWVA 4NXNE 2E1RA 1XNRI 4DPYA 2V34A 4DR1I 4LF6E 3B82A 1YZ9A 2B7TA 3ADGA 4B3ME 1Z5CA 4X65E 1NHJA 4LF4E 4LF9E 3T1YI 1T4NA 4DV0E 2X7IA 3JAMC 4B3SI 1WUUA 2EFGA 4DU8A 4LFCI 2RSMA 1B63A 5FLXQ 4DPWA 1Z0GA 4X62E 1X47A 4DV1I 4PRXA 2UXBI 2UU9E 2V2VA 4LFBE 4FN5A 4LF5E 2ZITA 3PYGA 5L3JA 3C4TA 1J5EI 1PVGA 1HR0I 4MYUA 5LMUI 5BR8I 2CZ9A 1ZM3A 4LF7E 4DV3I 4XTJA 2DMYA 1XMOI 4DR6E 4JYAE 1XMQE 1IBLI 1XNQI 1ZM2A 4R1FA 3GONA 3K1JA 1O0WA 2ZBKB 4X66I 2X36A 2F4VI 1J26A 1Z0TA 2UXDE 4P52A 1YYWA 5IWAE 4DR2I 2HKJA 4NXMI 4DUZE 4I3HA 1N0VC 1HNZI 2E5LI 2UUBI 2HFUA 1N33E 1NHHA 3ZZ0A 3QT8A 4DUYE 4DV7E 4DR3E 5LMNI 3WU4A 1MG7A 3B8HA 2BV3A 4PRVA 3J81Q 3T1HE 3ZKBA 2VQEI 4K0KI 2RS7A 5FLXC 1HNWI 4Z7YA 3LPSA 3LTOA 1H74A 4X64E 2UUAE 4LF8E 4RPFA 1IBKI 1NZ0A 4JV5I 2N3HA 3VYYA 1K47A 4JI7I 4DR7I 4DPXA 2L33A 4MYTA 1N36E 4KHPE 4JI4E 3WU6A 4OOGC 1N32E 1HNXI 1RREA 4URLA 3OTOI 2LUPB 4AQYE 4DV4E 1S16A 2RTXA 1ZM4A 2HK2A 1T4OA 4YY3E 4HXZA 4DV2I 4JI2E 4DV6E 3WU3A 2RS6A 4OX9E 3QT5A 2VQFE 1FNMA 4B3TI 4JI3I 2LTSA 1ZXNA 5GMEA 2UUCI 1RR9A 3J7AG 1DI2A 3B78A 4FWHA 3J7AM 4GKKE 4HACB 4YHHE 1ZXMA 1XNRE 3J81C 1GQEA 4DR1E 3ZZTA 1QU6A 2LUQA 2ZM6I 4DV5E 2B7VA 4DXLA 4HYMA 4B3RI 1FJGE 2DB2A 1ZM9A 1IBMI 2N3GA 3QT6A 2EZ6A 1N0UA 3LNUA 1XMQI 1NHIA 4WUCA 4JI8I 4LFCE 2V2ZA 1Z5BA 3PYDA 3J7Yp 3ZZUA 4WYQB 4DKKA 1FI4A 4DV1E 2UXCE 2UXBE 2HHHI 1OJ4A 4JI5I 2AJ4A 1MU5A 4X8WA 1J5EE 2BM1A 1HR0E 1N33I 4Z7CA 5LMUE 5BR8E 2DEJA 4DR5I 1T4LB 4DV3E 2JVAA 1RC7A 3VYXA 4DUYI 3WU5A 2XEXA 3V2UC 1XMOE 4ZVIA 4FWDA 1IBLE 1XNQE 4X66E 1H72C 2F4VE 3ZKDA 5A2QQ 4DR2E 1ZBTA 1S4EA 4LFAI 1Z0WA 3D4JA 1UILA 1H7UA 4NXME 4WUDA 2R3VA 2HK3A 3F0NA 3P1XA 1HNZE 1PIEA 2VF3A 4KQVA 4UT4A 2UUBE 1KVKA 1Z0EA 4HACA 4JI1I 1Z0VA 1H7SA 2WW4A 1KKHA 3LLHA 3H4LA 1STUA 5GMDA 3QT7A 5LMNE 4DPTA 1Z0BA 4GKJI 4FW9A 2BM0A 1B62A 4JI6I 1DARA 2B3TB 1I94I 1N34E 2VQEE 4K0KE 1HNWE 4DR4I 2LBSB 4UTGA 3ZM7A 4NXNI 1VISA 4M2ZA 2L2MA 4LF6I 2LRSA 2R42A 3Q1QA 4JV5E 4JI0E 2DIXA 1UEKA 4JI7E 4B3MI 4DR7E 4X65I 4LF4I 1YYKA 2GS8A 1PKPA 3J80Q 2L3JA 4LF9I 2Q2EB 4USMA 4DV0I 2LTRA 1Z59A 4M30A 2CPNA 3OTOE 5A2QC 1Z5AA 1X49A 2OI2A 5LL6R 2LJPA 2V2QA 4DV2E 4EMDA 2LJHA 2YT4A 1MX0A 4X62I 4JG4A 2A2CA 4DV5I 2UU9I 1X48A 4LFBI 5IT9Q 1RQ0A 4LF5I 4B3TE 4JI3E 2V8PA 1FJGI 2UUCE 4LF7I 3T1YE 4B3SE 4DR6I 4JYAI 3PYEA 4WFTA 2UXDI 1ELOA 2UXCI
chains in the Genus database with same CATH superfamily
5IWAI 1A6FA 4DPUA 1U2RA 2PO0A 2ZM6E 2KHXA 3MSWA 1KJKA 4DUZI 3M6AA 3HKMA 5DROA 1X3CA 2YZTA 1KTVA 2PNZA 1FWLA 4IFDE 2EM5A 4B3RE 2J7KA 2L2KB 1IBME 4DV7I 4L5NC 2HJJA 4F2JC 2J7JA 1WHNA 3J80C 4DR3I 3DD6A 4JI8E 3ADLA 3ADJA 3ADIA 4M9VC 4HY1A 4R2QA 2BA1D 3EPJA 1AAYA 5AE3A 1NEIA 2EPMX 2EN3A 3T1HI 1G2FC 5AC5A 4RH8A 4IJDA 2HHHE 4JI5E 2EPAA 2V8QB 2LMZA 1H73A 3HULA 5K36D 4F9AB 2WCC3 3UHMA 2JY9A 2ODRC 3HTXA 4I8OA 3DJWA 3BGHA 1UHZA 1ZBQA 4DMIA 1DGCA 2C39B 2HFSA 5JEAE 4DR5E 2E5LE 3ECRA 2YRHA 4X64I 2EM8A 2UUAI 4LF8I 1T38A 5CFFE 5IT9C 1KIJA 3H09A 3Q6NA 1GTKA 5A6KA 3VK6A 4M1KA 4NBQA 2DEIA 2YWQA 4AIMA 2V87A 1QZRA 1EKZA 1Y6ZA 3JAMQ 1MGTA 1JK1A 4BS9A 1N36I 2IHR1 1EA6A 2PO0B 2IESA 2C37B 1E3HA 2NPFA 3ZZUA 1WXRA 4JI4I 1WHQA 5DNYA 2IOQA 4KHPI 4MLVA 1Z0CA 4USKA 4OO1D 4LFAE 4BA2B 2PNZB 1N32I 2NUEA 3B4TA 1PDAA 1N34I 5K36A 4BHCA 1XHKA 4ED4A 4PU9A 4WUBA 1FWKA 2HKEA 4AQYI 4IFDF 5DNLA 4DV4I 4R8OA 2DMIA 2V86A 5LLQA 4J8ZA 4DU7A 2ENHA 4R2SA 2R76A 4Q28A 2A2DA 2EL4A 1ZAAC 4YY3I 1IQOA 4BHBA 4JI1E 3K17A 2EJ4A 2EOMA 4P7AA 4DV6I 4FWGA 2PO2A 4JI0I 2EN4A 1IBKE 4JI2I 2EOOA 1YH8A 1EI1A 3V5RA 4LCGA 1EH8A 4OX9I 2NA2A 3PS1A 1AH5A 2L8TA 4GKJE 2VQFI 2NUFA 3CDJA 2NN6F 4FW6A 1D6TA 4OO1A 3C4BA 2EE8A 5IV8B 3RMPA 3PYFA 1BKNA 4U3DA 2BBGA 2EQ1A 4AIDA 4JI6E 1HNXE 1I94E 4GKKI 2L2NA 4YHHI 4DR4E 2EP3A 2NUGA 3HJCA 1YYOA 5DRRA 2EN8A 2MDRA 1FKAE 2L3CA 3CWVA 4NXNE 2E1RA 2ADRA 5C0XD 1XNRI 1R6LA 4IFDC 4FW4A 2RQLA 4DPYA 2V34A 4DR1I 4LF6E 2EMFA 2YTJA 3B82A 1YZ9A 4LCHA 3M7NG 2V89A 1KYQA 2B7TA 4BMJA 3ADGA 4ZYHA 4B3ME 3H1CA 1Z5CA 4X65E 3VHTB 1NHJA 5FWKA 4LF4E 2EOYA 2GHFA 1BBGA 5A6BD 4BA1B 4LF9E 4N3OA 2MDGA 3JU0A 3T1YI 1T4NA 2NN6C 4DV0E 2X7IA 3JAMC 4B3SI 4F9BB 1WUUA 3PS2A 3C6KA 1A1IA 1UDQA 2BA1G 2EFGA 2YU8A 2JE6A 4M0VA 5C0XA 4DU8A 4LFCI 2EOQA 2RSMA 4X66I 2YPNA 1B63A 1UDSA 5FLXQ 2PRTA 4DPWA 1Z0GA 1P47A 2EOEA 4X62E 1X47A 5A6JA 3C6MA 4DV1I 4PRXA 3GCMA 4TUGA 2EOXA 2UXBI 2WBSA 1X5WA 4OO1B 2UU9E 2JPAA 2V2VA 4KWYA 4LFBE 4FN5A 2C37A 2G7HA 4LF5E 1HK7A 2ZITA 3C4TA 2MC6A 5A6BA 1PVGA 3PYGA 5L3JA 1HR0I 4MYUA 5LMUI 5BR8I 2CZ9A 1ZM3A 1YSAC 2E1MA 2EMKA 4LF7E 4DV3I 3P76A 3KZYA 1XNQI 4XTJA 1PJSA 2DMYA 1XMOI 3HPSA 2YTEA 4OZEA 4DR6E 4JYAE 2CSHA 1X6HA 2K7IA 4ZYGA 1XMQE 4IZKB 1IBLI 1ZM2A 3L00A 2EOIA 1QNTA 1TF6A 1O0WA 4HTGA 4GZNC 2CVEA 2ZBKB 2X36A 3GONA 1ZU1A 3K1JA 2EPUA 1T39A 1J26A 2F4VI 5ADZA 1VI7A 1Z0TA 2UXDE 4P52A 1YYWA 2Z5BA 3AV0A 5IWAE 4DR2I 2HKJA 2V83A 2NN6E 4NXMI 2PO1A 2JEBA 4DUZE 1A1FA 2CGEA 1WRJA 4I3HA 1N0VC 1HNZI 5JEAB 4ZYDA 4MQYA 3KRNA 2E5LI 4FW3A 2UUBI 2HFUA 1N33E 2C38B 2JE6B 5KL2A 1NHHA 1A1KA 1Y4SA 3ZZ0A 5C0XB 3QT8A 2WZOA 4DUYE 4DV7E 5EKWA 1RMDA 4MU4A 4DR3E 1Z1BA 4R03A 2N8XA 5LMNI 1X6FA 2KONA 2Z5CB 4MU1A 2EPXA 1MG7A 5DRQA 3WU4A 2EMXA 2LVHA 3B8HA 4U3BA 2BV3A 2EL5A 4PRVA 2B9DA 3P3CA 4F6MA 4LOMA 2EMHA 2YTOA 3J81Q 3T1HE 4MDTA 4O4KA 3ZKBA 5K36F 1YUIA 2MKDA 2VQEI 4K0KI 3IWBA 1F2IG 2EMZA 2RS7A 4P7DA 2EM0A 5FLXC 1A1GA 1R6MA 4BA1A 2JYAA 3MHHC 4Z7YA 1HNWI 2GLIA 2EMIA 5AE1A 1P42A 1WJPA 3LPSA 3LTOA 2BA0D 1H74A 4X64E 2UUAE 4LF8E 2EPZA 4RPFA 1IBKI 4QNJA 5TSEA 2ELYA 1YFHA 1NZ0A 1B69A 2N3HA 4JV5I 3VYYA 1EH7A 2EN2A 3BBGA 1K47A 2Z5BB 4JI7I 4FW7A 4DR7I 1YUJA 2L33A 2GO3A 2R1FA 1N36E 4MYTA 4DPXA 1UDOA 5K36B 2EMYA 3P3EA 2PO1B 1E3PA 2JEBB 4O43A 4BBYA 4KHPE 4JI4E 4OO1F 1BB8A 4OKGA 3WU6A 4OOGC 4O24A 1N32E 1HNXI 1RREA 4URLA 2EMBA 4ZYEA 1G2DC 2LUPB 1TF3A 3OTOI 2YTFA 4AQYE 2HGHA 5K36C 4DV4E 2HC5A 5JEAD 4RHBB 2JEAB 1S16A 2RTXA 1ZM4A 2HK2A 1T4OA 2DLQA 4LPFA 4BCAA 3QG5C 2KOUA 3EPHA 2GPIA 2CT1A 4YY3E 5F3WA 4F6NA 4HXZA 4DV2I 3P3GA 4IZJD 4JI2E 2EOSA 4DV6E 4IZKA 3M85D 2I9IA 2F1DA 2EPPA 3WU3A 2RS6A 4OX9E 2WNRA 3QT5A 2BB8A 2NABA 4R2EA 2VQFE 1FNMA 2CG9A 3THOB 2YTNA 4B3TI 4JI3I 2LTSA 4R2AA 1ZXNA 5GMEA 2M9AA 2UUCI 1RR9A 3J7AG 2BR2A 1L4SA 2EM7A 5DRPA 2YRKA 1DI2A 2E72A 3B78A 5KL6A 2O1VA 4FWHA 3J7AM 4OO1C 4GKKE 5A6AA 2I13A 4HACB 1SFEA 5JEAA 5KL4A 4YHHE 1ZXMA 2YSOA 5C0XF 2LV2A 2C38A 3J81C 1XNRE 3DF6A 2EOHA 2EM9A 4IZJA 2EOFA 1JK2A 1GQEA 2EM4A 4LU9A 4DR1E 3ZZTA 3F6HA 2EPRA 1QU6A 2JXPA 2LUQA 2ZM6I 2VF1A 2GQ0A 2O1WA 2ODRD 1Y5YA 2Z5CA 5KL3A 3IWDA 1Y60A 2EM3A 4DV5E 2B7VA 4DXLA 5K36E 1SR9A 4DUYI 2RSIA 4IFDB 2EMAA 4HYMA 4B3RI 2EN1A 2YTDA 2EOZA 2YTGA 1FJGE 3GMEA 2DB2A 1ZM9A 1IBMI 2N3GA 3QT6A 2EZ6A 5DNXA 1N0UA 2YU5A 2YRMA 3LNUA 4KZSA 1XMQI 1NHIA 3UK3C 2DLKA 1IMUA 4R1FA 4WUCA 1N3GA 1DQ3A 4JI8I 4LFCE 2EN7A 2IERA 1A1LA 1USUA 2YTQA 1A1HA 1Z5BA 2V2ZA 3J7Yp 1TN9A 3PYDA 1XXEA 2ENAA 3TQMA 2F8BA 2WNRB 5C0XC 2VE7C 4WYQB 3EQ1A 4DKKA 1BBOA 1FI4A 3K6QA 4DV1E 2EPLX 1UN6B 2EWLA 5KL5A 2NN6B 2UXCE 3M7ND 4WX9A 2LT7A 2UXBE 2HHHI 1OJ4A 4JI5I 4OO1E 2BR2B 2AJ4A 1UDNA 4R2DA 1YHCA 1MU5A 4X8WA 1J5EE 2BA0G 2BM1A 4L8NA 1HR0E 1N33I 4Z7CA 2O3ZA 5LMUE 5BR8E 4BC9A 4BA2A 2DEJA 4FK5C 2EMWA 1USVA 4DR5I 2Z5EA 1T4LB 3HPZA 2EOJA 2JVAA 2LO3A 4DV3E 1RC7A 2MC5A 2EN6A 3VYXA 3L7ZB 3WU5A 2XEXA 5AE2A 3V2UC 2JP9A 1XMOE 1OYPA 4ZVIA 2O1UA 4FWDA 1A1JA 4IZJB 5EL9A 2JEAA 2IOPA 4O5GA 1IBLE 1XNQE 4X66E 2EQ0A 4IS1C 2EL6A 1H72C 2F4VE 1NCSA 2AE8A 3ZKDA 4GEQB 5A2QQ 4R2PA 3M99B 4LCFA 2FTXB 2DRPA 4DR2E 1ZBTA 1S4EA 4LFAI 1Z0WA 1PJTA 3D4JA 1UILA 1H7UA 4NXME 2GO4A 4WUDA 3K85A 2R3VA 2HK3A 3CDIA 3F0NA 3P1XA 1HNZE 3NZKA 4WXCA 1PIEA 2VF3A 4KQVA 2YTPA 4IFDD 4UT4A 2Q8UA 2UUBE 1KVKA 2LCEA 1Z0EA 3M85G 5C0XE 1LLMC 4HACA 4JI1I 3HXLA 1Z0VA 2A25A 2EM2A 1H7SA 2WW4A 1KKHA 3EPKA 3LLHA 3H4LA 1STUA 2DSYA 5GMDA 3QT7A 5LMNE 4DPTA 1Z0BA 4GKJI 1ZR9A 4FW9A 2EPOA 1MEYC 1EH6A 2YSPA 2FGGA 4MU0A 2EPKX 2VESA 2NN6D 2BM0A 3JTZA 3MHSC 4ISAA 1OYRA 4N4RB 1B62A 2MKNA 4JI6I 1DARA 2B3TB 1GZ6A 2L6MA 2L92A 4P78A 5AC4A 2VQEE 2JR1A 1N34E 2K4VA 4K0KE 1I94I 2O1TA 4IFDA 1HNWE 4DR4I 2EMGA 2JOBA 4MLQA 2LBSB 4HEIA 4UTGA 3ZM7A 2J65A 4NXNI 1VISA 3U1YA 4X9JA 4IS9A 4M2ZA 2L2MA 2M4IA 4WPYA 4LF6I 2LRSA 4MU3A 4R2RA 2R42A 3Q1QA 2V88A 4JV5E 2ELZA 2WP8A 2EPCA 2DIXA 3BF2A 3FIGA 3LMLA 4JI0E 1UEKA 2EORA 4JI7E 4B3MI 4DR7E 4X65I 2H36X 5A69A 4LF4I 1YYKA 2GS8A 1PKPA 2WBTA 1RHYA 2NN6A 3J80Q 3KWRA 4LTYA 4F54A 2ENCA 2L3JA 4LF9I 2Q2EB 4USMA 4DV0I 2LTRA 1Z59A 1PJQA 4M30A 1Y4UA 4QNKA 2CPNA 3OTOE 2M1SA 2WBUA 5A2QC 3ZOQB 5JEAF 4NHRA 1Z5AA 5KL7A 1X49A 2OI2A 1IQSA 3F6GA 3OMLA 5LL6R 4Q35B 2LJPA 3L7ZA 2V2QA 2CTDA 4DV2E 4EMDA 2LJUA 2LJHA 2YT4A 4WSGA 5T6JA 1MX0A 4X62I 3HQ1A 4GQUA 4JG4A 1OYSA 2A2CA 4TUIA 2EMLA 3THNA 3IWCA 3P06A 4DV5I 2UU9I 2RPCA 4WSPA 1X48A 2LE2A 2V85A 3KZZA 5IXMB 2EMCA 3EPLA 3PRYA 4LFBI 1RQ0A 2FV4B 4LF5I 5IT9Q 4J3DA 4B3TE 4JI3E 2DGCA 2V8PA 2UUCE 2M7QA 1FJGI 2EM6A 3PS3A 2JOXA 2PNLA 1J5EI 4LF7I 3T1YE 3BIDA 2PNMA 4NZVA 4FW5A 5ELWA 1YPNA 3AUZA 4BC7A 5AASA 4B3SE 2YTIA 2C39A 1X6EA 2JT2A 3U1KA 4DR6I 2JWOA 3GLLA 2PO2B 3PYEA 4JYAI 2D9HA 4R2CA 4AM3A 4WXDA 5JEAC 2EPNA 4F9CB 4WFTA 2WP8B 3Q6MA 2EQ3A 2VRDA 2UXDI 1UBDC 1ELOA 2UXCI
chains in the Genus database with same CATH topology
5IWAI 1A6FA 4DPUA 1U2RA 2ZM6E 2KHXA 3MSWA 4DUZI 3M6AA 2YZTA 1KTVA 1FWLA 4B3RE 2J7KA 2L2KB 1IBME 4DV7I 4L5NC 1WHNA 3J80C 4DR3I 4JI8E 3ADLA 3ADJA 3ADIA 4HY1A 5AE3A 3T1HI 2HHHE 4JI5E 1H73A 2V8QB 2LMZA 3HULA 4F9AB 2JY9A 2ODRC 3HTXA 4I8OA 3DJWA 1UHZA 1ZBQA 4DMIA 2HFSA 4DR5E 2E5LE 4X64I 2UUAI 4LF8I 5CFFE 5IT9C 1KIJA 3H09A 3Q6NA 3VK6A 4M1KA 2DEIA 2V87A 1QZRA 1EKZA 1Y6ZA 3JAMQ 4BS9A 1N36I 2IHR1 1EA6A 2NPFA 4JI4I 4KHPI 1WXRA 1WHQA 5DNYA 2IOQA 1Z0CA 4USKA 4LFAE 1N32I 2NUEA 1N34I 1XHKA 4ED4A 4PU9A 4WUBA 1FWKA 2HKEA 4AQYI 4DV4I 4R8OA 2V86A 4J8ZA 4DU7A 2A2DA 4Q28A 4YY3I 3K17A 4JI1E 4P7AA 4JI2I 4DV6I 4FWGA 4JI0I 1IBKE 1EI1A 3V5RA 4OX9I 2NA2A 2L8TA 4GKJE 2VQFI 2NUFA 1D6TA 3C4BA 3RMPA 3PYFA 1BKNA 4JI6E 1HNXE 1I94E 4GKKI 2L2NA 4YHHI 4DR4E 2NUGA 3HJCA 1YYOA 2MDRA 1FKAE 2L3CA 3CWVA 4NXNE 2E1RA 1XNRI 4DPYA 2V34A 4DR1I 4LF6E 3B82A 1YZ9A 2V89A 2B7TA 4BMJA 3ADGA 4B3ME 1Z5CA 4X65E 1NHJA 5FWKA 4LF4E 4LF9E 4N3OA 3JU0A 3T1YI 1T4NA 4DV0E 2X7IA 3JAMC 4B3SI 4F9BB 1WUUA 2EFGA 4M0VA 4DU8A 4LFCI 2RSMA 1B63A 5FLXQ 4DPWA 1Z0GA 4X62E 1X47A 4DV1I 4PRXA 4TUGA 2UXBI 2UU9E 2V2VA 4LFBE 4FN5A 2G7HA 4LF5E 1HK7A 2ZITA 3C4TA 2MC6A 1PVGA 3PYGA 5L3JA 1J5EI 1HR0I 4MYUA 5LMUI 5BR8I 2CZ9A 1ZM3A 2E1MA 4LF7E 4DV3I 4XTJA 2DMYA 1XMOI 3HPSA 4DR6E 4JYAE 1XMQE 4IZKB 1IBLI 1XNQI 1ZM2A 4R1FA 3GONA 3K1JA 1O0WA 2ZBKB 4X66I 2X36A 2F4VI 1J26A 5ADZA 1Z0TA 2UXDE 4P52A 1YYWA 2Z5BA 3AV0A 5IWAE 4DR2I 2HKJA 2V83A 4NXMI 4DUZE 2CGEA 4I3HA 1N0VC 1HNZI 2E5LI 2UUBI 2HFUA 1N33E 1NHHA 1Y4SA 3ZZ0A 3QT8A 2WZOA 4DUYE 4DV7E 4DR3E 4R03A 5LMNI 2KONA 2Z5CB 3WU4A 1MG7A 3B8HA 2BV3A 4PRVA 2B9DA 3J81Q 3T1HE 3ZKBA 2VQEI 4K0KI 3IWBA 4P7DA 2RS7A 5FLXC 1HNWI 4Z7YA 5AE1A 3LPSA 3LTOA 1H74A 4X64E 2UUAE 4LF8E 4RPFA 1IBKI 1NZ0A 4JV5I 2N3HA 3VYYA 1K47A 2Z5BB 4JI7I 4DR7I 4DPXA 2L33A 4MYTA 1N36E 4BBYA 4KHPE 4JI4E 3WU6A 4OOGC 1N32E 1HNXI 1RREA 4URLA 3OTOI 2LUPB 4AQYE 4DV4E 1S16A 2RTXA 1ZM4A 2HK2A 1T4OA 4BCAA 2KOUA 4YY3E 5F3WA 4HXZA 4DV2I 4IZJD 4JI2E 4DV6E 4IZKA 3WU3A 2RS6A 4OX9E 3QT5A 2VQFE 1FNMA 2CG9A 4B3TI 4JI3I 2LTSA 1ZXNA 5GMEA 2UUCI 1RR9A 3J7AG 1DI2A 3B78A 2O1VA 4FWHA 3J7AM 4GKKE 4HACB 4YHHE 1ZXMA 3J81C 1XNRE 3DF6A 4IZJA 1GQEA 4LU9A 4DR1E 3ZZTA 3F6HA 1QU6A 2LUQA 2ZM6I 2VF1A 2GQ0A 2O1WA 2ODRD 2Z5CA 3IWDA 4DV5E 2B7VA 4DXLA 1SR9A 4HYMA 4B3RI 1FJGE 2DB2A 1ZM9A 1IBMI 2N3GA 3QT6A 2EZ6A 1N0UA 3LNUA 4KZSA 1XMQI 1NHIA 4WUCA 1DQ3A 4JI8I 4LFCE 1USUA 2V2ZA 1Z5BA 3PYDA 3J7Yp 3ZZUA 2F8BA 2VE7C 4WYQB 4DKKA 1FI4A 3K6QA 4DV1E 2EWLA 2UXCE 2UXBE 2HHHI 1OJ4A 4JI5I 2AJ4A 1MU5A 4X8WA 1J5EE 2BM1A 4L8NA 1HR0E 1N33I 4Z7CA 5LMUE 5BR8E 4BC9A 2DEJA 4DR5I 1USVA 2Z5EA 1T4LB 3HPZA 4DV3E 3VYXA 2JVAA 1RC7A 4DUYI 2MC5A 3WU5A 2XEXA 5AE2A 3V2UC 1XMOE 4ZVIA 2O1UA 4FWDA 4IZJB 2IOPA 1IBLE 1XNQE 4X66E 1H72C 2F4VE 3ZKDA 4GEQB 5A2QQ 2FTXB 4DR2E 1ZBTA 1S4EA 4LFAI 1Z0WA 3D4JA 1UILA 1H7UA 4NXME 4WUDA 3K85A 2R3VA 2HK3A 3F0NA 3P1XA 1HNZE 1PIEA 2VF3A 4KQVA 4UT4A 2UUBE 1KVKA 1Z0EA 4HACA 4JI1I 3HXLA 1Z0VA 1H7SA 2WW4A 1KKHA 3LLHA 3H4LA 1STUA 2DSYA 5GMDA 3QT7A 5LMNE 4DPTA 1Z0BA 4GKJI 4FW9A 2FGGA 2BM0A 3JTZA 1B62A 4JI6I 1DARA 2B3TB 1GZ6A 2L6MA 2L92A 4P78A 1N34E 2VQEE 2JR1A 4K0KE 2K4VA 1I94I 2O1TA 1HNWE 4DR4I 2JOBA 2LBSB 4UTGA 3ZM7A 4NXNI 1VISA 4M2ZA 2L2MA 2M4IA 4WPYA 4LF6I 2LRSA 2R42A 3Q1QA 2V88A 4JV5E 3FIGA 2DIXA 4JI0E 3LMLA 1UEKA 4JI7E 4B3MI 4DR7E 4X65I 2H36X 4LF4I 1YYKA 2GS8A 1PKPA 3J80Q 3KWRA 4LTYA 4F54A 2L3JA 4LF9I 2Q2EB 4USMA 4DV0I 2LTRA 1Z59A 4M30A 1Y4UA 2CPNA 3OTOE 2M1SA 5A2QC 3ZOQB 1Z5AA 1X49A 2OI2A 3F6GA 3OMLA 5LL6R 2LJPA 2V2QA 4DV2E 4EMDA 2LJHA 2YT4A 5T6JA 1MX0A 4X62I 3HQ1A 4JG4A 2A2CA 4TUIA 3IWCA 3P06A 4DV5I 2UU9I 4WSPA 1X48A 2LE2A 2V85A 3PRYA 4LFBI 5IT9Q 1RQ0A 2FV4B 4LF5I 4B3TE 4JI3E 2V8PA 1FJGI 2UUCE 2M7QA 2JOXA 2PNLA 4LF7I 3T1YE 2PNMA 3AUZA 4BC7A 5AASA 4B3SE 4DR6I 4JYAI 2JWOA 3PYEA 3Q6MA 4F9CB 4WFTA 2UXDI 1ELOA 2UXCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA I;  1A6F A;  4DPU A;  1U2R A;  2ZM6 E;  2KHX A;  4DUZ I;  3M6A A;  1KTV A;  1FWL A;  4B3R E;  2J7K A;  2L2K B;  1IBM E;  4DV7 I;  1WHN A;  3J80 C;  4DR3 I;  4JI8 E;  3ADL A;  3ADJ A;  3ADI A;  4HY1 A;  3T1H I;  2HHH E;  4JI5 E;  1H73 A;  3HUL A;  2JY9 A;  3HTX A;  1UHZ A;  2HFS A;  4DR5 E;  2E5L E;  4X64 I;  2UUA I;  4LF8 I;  5CFF E;  1KIJ A;  5IT9 C;  4M1K A;  2DEI A;  1QZR A;  1EKZ A;  3JAM Q;  1N36 I;  2IHR 1;  1EA6 A;  2NPF A;  4JI4 I;  4KHP I;  1WHQ A;  1Z0C A;  4USK A;  4LFA E;  1N32 I;  2NUE A;  1N34 I;  1XHK A;  4ED4 A;  4PU9 A;  4WUB A;  1FWK A;  2HKE A;  4AQY I;  4DV4 I;  4DU7 A;  2A2D A;  4YY3 I;  3K17 A;  4JI1 E;  4P7A A;  4JI2 I;  4DV6 I;  4FWG A;  4JI0 I;  1IBK E;  1EI1 A;  3V5R A;  4OX9 I;  2NA2 A;  4GKJ E;  2VQF I;  2NUF A;  1D6T A;  3C4B A;  3PYF A;  1BKN A;  4JI6 E;  1HNX E;  1I94 E;  4GKK I;  2L2N A;  4YHH I;  4DR4 E;  2NUG A;  1YYO A;  2MDR A;  1FKA E;  2L3C A;  3CWV A;  4NXN E;  2E1R A;  1XNR I;  4DPY A;  2V34 A;  4DR1 I;  4LF6 E;  3B82 A;  1YZ9 A;  2B7T A;  3ADG A;  4B3M E;  1Z5C A;  4X65 E;  1NHJ A;  4LF4 E;  4LF9 E;  3T1Y I;  1T4N A;  4DV0 E;  2X7I A;  3JAM C;  4B3S I;  1WUU A;  2EFG A;  4DU8 A;  4LFC I;  2RSM A;  1B63 A;  5FLX Q;  4DPW A;  1Z0G A;  4X62 E;  1X47 A;  4DV1 I;  4PRX A;  2UXB I;  2UU9 E;  2V2V A;  4LFB E;  4FN5 A;  4LF5 E;  2ZIT A;  3PYG A;  5L3J A;  3C4T A;  1J5E I;  1PVG A;  1HR0 I;  4MYU A;  5LMU I;  5BR8 I;  2CZ9 A;  1ZM3 A;  4LF7 E;  4DV3 I;  4XTJ A;  2DMY A;  1XMO I;  4DR6 E;  4JYA E;  1XMQ E;  1IBL I;  1XNQ I;  1ZM2 A;  4R1F A;  3GON A;  3K1J A;  1O0W A;  2ZBK B;  4X66 I;  2X36 A;  2F4V I;  1J26 A;  1Z0T A;  2UXD E;  4P52 A;  1YYW A;  5IWA E;  4DR2 I;  2HKJ A;  4NXM I;  4DUZ E;  4I3H A;  1N0V C;  1HNZ I;  2E5L I;  2UUB I;  2HFU A;  1N33 E;  1NHH A;  3ZZ0 A;  3QT8 A;  4DUY E;  4DV7 E;  4DR3 E;  5LMN I;  3WU4 A;  1MG7 A;  3B8H A;  2BV3 A;  4PRV A;  3J81 Q;  3T1H E;  3ZKB A;  2VQE I;  4K0K I;  2RS7 A;  5FLX C;  1HNW I;  4Z7Y A;  3LPS A;  3LTO A;  1H74 A;  4X64 E;  2UUA E;  4LF8 E;  4RPF A;  1IBK I;  1NZ0 A;  4JV5 I;  2N3H A;  3VYY A;  1K47 A;  4JI7 I;  4DR7 I;  4DPX A;  2L33 A;  4MYT A;  1N36 E;  4KHP E;  4JI4 E;  3WU6 A;  4OOG C;  1N32 E;  1HNX I;  1RRE A;  4URL A;  3OTO I;  2LUP B;  4AQY E;  4DV4 E;  1S16 A;  2RTX A;  1ZM4 A;  2HK2 A;  1T4O A;  4YY3 E;  4HXZ A;  4DV2 I;  4JI2 E;  4DV6 E;  3WU3 A;  2RS6 A;  4OX9 E;  3QT5 A;  2VQF E;  1FNM A;  4B3T I;  4JI3 I;  2LTS A;  1ZXN A;  5GME A;  2UUC I;  1RR9 A;  3J7A G;  1DI2 A;  3B78 A;  4FWH A;  3J7A M;  4GKK E;  4HAC B;  4YHH E;  1ZXM A;  1XNR E;  3J81 C;  1GQE A;  4DR1 E;  3ZZT A;  1QU6 A;  2LUQ A;  2ZM6 I;  4DV5 E;  2B7V A;  4DXL A;  4HYM A;  4B3R I;  1FJG E;  2DB2 A;  1ZM9 A;  1IBM I;  2N3G A;  3QT6 A;  2EZ6 A;  1N0U A;  3LNU A;  1XMQ I;  1NHI A;  4WUC A;  4JI8 I;  4LFC E;  2V2Z A;  1Z5B A;  3PYD A;  3J7Y p;  3ZZU A;  4WYQ B;  4DKK A;  1FI4 A;  4DV1 E;  2UXC E;  2UXB E;  2HHH I;  1OJ4 A;  4JI5 I;  2AJ4 A;  1MU5 A;  4X8W A;  1J5E E;  2BM1 A;  1HR0 E;  1N33 I;  4Z7C A;  5LMU E;  5BR8 E;  2DEJ A;  4DR5 I;  1T4L B;  4DV3 E;  2JVA A;  1RC7 A;  3VYX A;  4DUY I;  3WU5 A;  2XEX A;  3V2U C;  1XMO E;  4ZVI A;  4FWD A;  1IBL E;  1XNQ E;  4X66 E;  1H72 C;  2F4V E;  3ZKD A;  5A2Q Q;  4DR2 E;  1ZBT A;  1S4E A;  4LFA I;  1Z0W A;  3D4J A;  1UIL A;  1H7U A;  4NXM E;  4WUD A;  2R3V A;  2HK3 A;  3F0N A;  3P1X A;  1HNZ E;  1PIE A;  2VF3 A;  4KQV A;  4UT4 A;  2UUB E;  1KVK A;  1Z0E A;  4HAC A;  4JI1 I;  1Z0V A;  1H7S A;  2WW4 A;  1KKH A;  3LLH A;  3H4L A;  1STU A;  5GMD A;  3QT7 A;  5LMN E;  4DPT A;  1Z0B A;  4GKJ I;  4FW9 A;  2BM0 A;  1B62 A;  4JI6 I;  1DAR A;  2B3T B;  1I94 I;  1N34 E;  2VQE E;  4K0K E;  1HNW E;  4DR4 I;  2LBS B;  4UTG A;  3ZM7 A;  4NXN I;  1VIS A;  4M2Z A;  2L2M A;  4LF6 I;  2LRS A;  2R42 A;  3Q1Q A;  4JV5 E;  4JI0 E;  2DIX A;  1UEK A;  4JI7 E;  4B3M I;  4DR7 E;  4X65 I;  4LF4 I;  1YYK A;  2GS8 A;  1PKP A;  3J80 Q;  2L3J A;  4LF9 I;  2Q2E B;  4USM A;  4DV0 I;  2LTR A;  1Z59 A;  4M30 A;  2CPN A;  3OTO E;  5A2Q C;  1Z5A A;  1X49 A;  2OI2 A;  5LL6 R;  2LJP A;  2V2Q A;  4DV2 E;  4EMD A;  2LJH A;  2YT4 A;  1MX0 A;  4X62 I;  4JG4 A;  2A2C A;  4DV5 I;  2UU9 I;  1X48 A;  4LFB I;  5IT9 Q;  1RQ0 A;  4LF5 I;  4B3T E;  4JI3 E;  2V8P A;  1FJG I;  2UUC E;  4LF7 I;  3T1Y E;  4B3S E;  4DR6 I;  4JYA I;  3PYE A;  4WFT A;  2UXD I;  1ELO A;  2UXC I; 
#chains in the Genus database with same CATH topology
 5IWA I;  1A6F A;  4DPU A;  1U2R A;  2PO0 A;  2ZM6 E;  2KHX A;  3MSW A;  1KJK A;  4DUZ I;  3M6A A;  3HKM A;  5DRO A;  1X3C A;  2YZT A;  1KTV A;  2PNZ A;  1FWL A;  4IFD E;  2EM5 A;  4B3R E;  2J7K A;  2L2K B;  1IBM E;  4DV7 I;  4L5N C;  2HJJ A;  4F2J C;  2J7J A;  1WHN A;  3J80 C;  4DR3 I;  3DD6 A;  4JI8 E;  3ADL A;  3ADJ A;  3ADI A;  4M9V C;  4HY1 A;  4R2Q A;  2BA1 D;  3EPJ A;  1AAY A;  5AE3 A;  1NEI A;  2EPM X;  2EN3 A;  3T1H I;  1G2F C;  5AC5 A;  4RH8 A;  4IJD A;  2HHH E;  4JI5 E;  2EPA A;  2V8Q B;  2LMZ A;  1H73 A;  3HUL A;  5K36 D;  4F9A B;  2WCC 3;  3UHM A;  2JY9 A;  2ODR C;  3HTX A;  4I8O A;  3DJW A;  3BGH A;  1UHZ A;  1ZBQ A;  4DMI A;  1DGC A;  2C39 B;  2HFS A;  5JEA E;  4DR5 E;  2E5L E;  3ECR A;  2YRH A;  4X64 I;  2EM8 A;  2UUA I;  4LF8 I;  1T38 A;  5CFF E;  5IT9 C;  1KIJ A;  3H09 A;  3Q6N A;  1GTK A;  5A6K A;  3VK6 A;  4M1K A;  4NBQ A;  2DEI A;  2YWQ A;  4AIM A;  2V87 A;  1QZR A;  1EKZ A;  1Y6Z A;  3JAM Q;  1MGT A;  1JK1 A;  4BS9 A;  1N36 I;  2IHR 1;  1EA6 A;  2PO0 B;  2IES A;  2C37 B;  1E3H A;  2NPF A;  3ZZU A;  1WXR A;  4JI4 I;  1WHQ A;  5DNY A;  2IOQ A;  4KHP I;  4MLV A;  1Z0C A;  4USK A;  4OO1 D;  4LFA E;  4BA2 B;  2PNZ B;  1N32 I;  2NUE A;  3B4T A;  1PDA A;  1N34 I;  5K36 A;  4BHC A;  1XHK A;  4ED4 A;  4PU9 A;  4WUB A;  1FWK A;  2HKE A;  4AQY I;  4IFD F;  5DNL A;  4DV4 I;  4R8O A;  2DMI A;  2V86 A;  5LLQ A;  4J8Z A;  4DU7 A;  2ENH A;  4R2S A;  2R76 A;  4Q28 A;  2A2D A;  2EL4 A;  1ZAA C;  4YY3 I;  1IQO A;  4BHB A;  4JI1 E;  3K17 A;  2EJ4 A;  2EOM A;  4P7A A;  4DV6 I;  4FWG A;  2PO2 A;  4JI0 I;  2EN4 A;  1IBK E;  4JI2 I;  2EOO A;  1YH8 A;  1EI1 A;  3V5R A;  4LCG A;  1EH8 A;  4OX9 I;  2NA2 A;  3PS1 A;  1AH5 A;  2L8T A;  4GKJ E;  2VQF I;  2NUF A;  3CDJ A;  2NN6 F;  4FW6 A;  1D6T A;  4OO1 A;  3C4B A;  2EE8 A;  5IV8 B;  3RMP A;  3PYF A;  1BKN A;  4U3D A;  2BBG A;  2EQ1 A;  4AID A;  4JI6 E;  1HNX E;  1I94 E;  4GKK I;  2L2N A;  4YHH I;  4DR4 E;  2EP3 A;  2NUG A;  3HJC A;  1YYO A;  5DRR A;  2EN8 A;  2MDR A;  1FKA E;  2L3C A;  3CWV A;  4NXN E;  2E1R A;  2ADR A;  5C0X D;  1XNR I;  1R6L A;  4IFD C;  4FW4 A;  2RQL A;  4DPY A;  2V34 A;  4DR1 I;  4LF6 E;  2EMF A;  2YTJ A;  3B82 A;  1YZ9 A;  4LCH A;  3M7N G;  2V89 A;  1KYQ A;  2B7T A;  4BMJ A;  3ADG A;  4ZYH A;  4B3M E;  3H1C A;  1Z5C A;  4X65 E;  3VHT B;  1NHJ A;  5FWK A;  4LF4 E;  2EOY A;  2GHF A;  1BBG A;  5A6B D;  4BA1 B;  4LF9 E;  4N3O A;  2MDG A;  3JU0 A;  3T1Y I;  1T4N A;  2NN6 C;  4DV0 E;  2X7I A;  3JAM C;  4B3S I;  4F9B B;  1WUU A;  3PS2 A;  3C6K A;  1A1I A;  1UDQ A;  2BA1 G;  2EFG A;  2YU8 A;  2JE6 A;  4M0V A;  5C0X A;  4DU8 A;  4LFC I;  2EOQ A;  2RSM A;  4X66 I;  2YPN A;  1B63 A;  1UDS A;  5FLX Q;  2PRT A;  4DPW A;  1Z0G A;  1P47 A;  2EOE A;  4X62 E;  1X47 A;  5A6J A;  3C6M A;  4DV1 I;  4PRX A;  3GCM A;  4TUG A;  2EOX A;  2UXB I;  2WBS A;  1X5W A;  4OO1 B;  2UU9 E;  2JPA A;  2V2V A;  4KWY A;  4LFB E;  4FN5 A;  2C37 A;  2G7H A;  4LF5 E;  1HK7 A;  2ZIT A;  3C4T A;  2MC6 A;  5A6B A;  1PVG A;  3PYG A;  5L3J A;  1HR0 I;  4MYU A;  5LMU I;  5BR8 I;  2CZ9 A;  1ZM3 A;  1YSA C;  2E1M A;  2EMK A;  4LF7 E;  4DV3 I;  3P76 A;  3KZY A;  1XNQ I;  4XTJ A;  1PJS A;  2DMY A;  1XMO I;  3HPS A;  2YTE A;  4OZE A;  4DR6 E;  4JYA E;  2CSH A;  1X6H A;  2K7I A;  4ZYG A;  1XMQ E;  4IZK B;  1IBL I;  1ZM2 A;  3L00 A;  2EOI A;  1QNT A;  1TF6 A;  1O0W A;  4HTG A;  4GZN C;  2CVE A;  2ZBK B;  2X36 A;  3GON A;  1ZU1 A;  3K1J A;  2EPU A;  1T39 A;  1J26 A;  2F4V I;  5ADZ A;  1VI7 A;  1Z0T A;  2UXD E;  4P52 A;  1YYW A;  2Z5B A;  3AV0 A;  5IWA E;  4DR2 I;  2HKJ A;  2V83 A;  2NN6 E;  4NXM I;  2PO1 A;  2JEB A;  4DUZ E;  1A1F A;  2CGE A;  1WRJ A;  4I3H A;  1N0V C;  1HNZ I;  5JEA B;  4ZYD A;  4MQY A;  3KRN A;  2E5L I;  4FW3 A;  2UUB I;  2HFU A;  1N33 E;  2C38 B;  2JE6 B;  5KL2 A;  1NHH A;  1A1K A;  1Y4S A;  3ZZ0 A;  5C0X B;  3QT8 A;  2WZO A;  4DUY E;  4DV7 E;  5EKW A;  1RMD A;  4MU4 A;  4DR3 E;  1Z1B A;  4R03 A;  2N8X A;  5LMN I;  1X6F A;  2KON A;  2Z5C B;  4MU1 A;  2EPX A;  1MG7 A;  5DRQ A;  3WU4 A;  2EMX A;  2LVH A;  3B8H A;  4U3B A;  2BV3 A;  2EL5 A;  4PRV A;  2B9D A;  3P3C A;  4F6M A;  4LOM A;  2EMH A;  2YTO A;  3J81 Q;  3T1H E;  4MDT A;  4O4K A;  3ZKB A;  5K36 F;  1YUI A;  2MKD A;  2VQE I;  4K0K I;  3IWB A;  1F2I G;  2EMZ A;  2RS7 A;  4P7D A;  2EM0 A;  5FLX C;  1A1G A;  1R6M A;  4BA1 A;  2JYA A;  3MHH C;  4Z7Y A;  1HNW I;  2GLI A;  2EMI A;  5AE1 A;  1P42 A;  1WJP A;  3LPS A;  3LTO A;  2BA0 D;  1H74 A;  4X64 E;  2UUA E;  4LF8 E;  2EPZ A;  4RPF A;  1IBK I;  4QNJ A;  5TSE A;  2ELY A;  1YFH A;  1NZ0 A;  1B69 A;  2N3H A;  4JV5 I;  3VYY A;  1EH7 A;  2EN2 A;  3BBG A;  1K47 A;  2Z5B B;  4JI7 I;  4FW7 A;  4DR7 I;  1YUJ A;  2L33 A;  2GO3 A;  2R1F A;  1N36 E;  4MYT A;  4DPX A;  1UDO A;  5K36 B;  2EMY A;  3P3E A;  2PO1 B;  1E3P A;  2JEB B;  4O43 A;  4BBY A;  4KHP E;  4JI4 E;  4OO1 F;  1BB8 A;  4OKG A;  3WU6 A;  4OOG C;  4O24 A;  1N32 E;  1HNX I;  1RRE A;  4URL A;  2EMB A;  4ZYE A;  1G2D C;  2LUP B;  1TF3 A;  3OTO I;  2YTF A;  4AQY E;  2HGH A;  5K36 C;  4DV4 E;  2HC5 A;  5JEA D;  4RHB B;  2JEA B;  1S16 A;  2RTX A;  1ZM4 A;  2HK2 A;  1T4O A;  2DLQ A;  4LPF A;  4BCA A;  3QG5 C;  2KOU A;  3EPH A;  2GPI A;  2CT1 A;  4YY3 E;  5F3W A;  4F6N A;  4HXZ A;  4DV2 I;  3P3G A;  4IZJ D;  4JI2 E;  2EOS A;  4DV6 E;  4IZK A;  3M85 D;  2I9I A;  2F1D A;  2EPP A;  3WU3 A;  2RS6 A;  4OX9 E;  2WNR A;  3QT5 A;  2BB8 A;  2NAB A;  4R2E A;  2VQF E;  1FNM A;  2CG9 A;  3THO B;  2YTN A;  4B3T I;  4JI3 I;  2LTS A;  4R2A A;  1ZXN A;  5GME A;  2M9A A;  2UUC I;  1RR9 A;  3J7A G;  2BR2 A;  1L4S A;  2EM7 A;  5DRP A;  2YRK A;  1DI2 A;  2E72 A;  3B78 A;  5KL6 A;  2O1V A;  4FWH A;  3J7A M;  4OO1 C;  4GKK E;  5A6A A;  2I13 A;  4HAC B;  1SFE A;  5JEA A;  5KL4 A;  4YHH E;  1ZXM A;  2YSO A;  5C0X F;  2LV2 A;  2C38 A;  3J81 C;  1XNR E;  3DF6 A;  2EOH A;  2EM9 A;  4IZJ A;  2EOF A;  1JK2 A;  1GQE A;  2EM4 A;  4LU9 A;  4DR1 E;  3ZZT A;  3F6H A;  2EPR A;  1QU6 A;  2JXP A;  2LUQ A;  2ZM6 I;  2VF1 A;  2GQ0 A;  2O1W A;  2ODR D;  1Y5Y A;  2Z5C A;  5KL3 A;  3IWD A;  1Y60 A;  2EM3 A;  4DV5 E;  2B7V A;  4DXL A;  5K36 E;  1SR9 A;  4DUY I;  2RSI A;  4IFD B;  2EMA A;  4HYM A;  4B3R I;  2EN1 A;  2YTD A;  2EOZ A;  2YTG A;  1FJG E;  3GME A;  2DB2 A;  1ZM9 A;  1IBM I;  2N3G A;  3QT6 A;  2EZ6 A;  5DNX A;  1N0U A;  2YU5 A;  2YRM A;  3LNU A;  4KZS A;  1XMQ I;  1NHI A;  3UK3 C;  2DLK A;  1IMU A;  4R1F A;  4WUC A;  1N3G A;  1DQ3 A;  4JI8 I;  4LFC E;  2EN7 A;  2IER A;  1A1L A;  1USU A;  2YTQ A;  1A1H A;  1Z5B A;  2V2Z A;  3J7Y p;  1TN9 A;  3PYD A;  1XXE A;  2ENA A;  3TQM A;  2F8B A;  2WNR B;  5C0X C;  2VE7 C;  4WYQ B;  3EQ1 A;  4DKK A;  1BBO A;  1FI4 A;  3K6Q A;  4DV1 E;  2EPL X;  1UN6 B;  2EWL A;  5KL5 A;  2NN6 B;  2UXC E;  3M7N D;  4WX9 A;  2LT7 A;  2UXB E;  2HHH I;  1OJ4 A;  4JI5 I;  4OO1 E;  2BR2 B;  2AJ4 A;  1UDN A;  4R2D A;  1YHC A;  1MU5 A;  4X8W A;  1J5E E;  2BA0 G;  2BM1 A;  4L8N A;  1HR0 E;  1N33 I;  4Z7C A;  2O3Z A;  5LMU E;  5BR8 E;  4BC9 A;  4BA2 A;  2DEJ A;  4FK5 C;  2EMW A;  1USV A;  4DR5 I;  2Z5E A;  1T4L B;  3HPZ A;  2EOJ A;  2JVA A;  2LO3 A;  4DV3 E;  1RC7 A;  2MC5 A;  2EN6 A;  3VYX A;  3L7Z B;  3WU5 A;  2XEX A;  5AE2 A;  3V2U C;  2JP9 A;  1XMO E;  1OYP A;  4ZVI A;  2O1U A;  4FWD A;  1A1J A;  4IZJ B;  5EL9 A;  2JEA A;  2IOP A;  4O5G A;  1IBL E;  1XNQ E;  4X66 E;  2EQ0 A;  4IS1 C;  2EL6 A;  1H72 C;  2F4V E;  1NCS A;  2AE8 A;  3ZKD A;  4GEQ B;  5A2Q Q;  4R2P A;  3M99 B;  4LCF A;  2FTX B;  2DRP A;  4DR2 E;  1ZBT A;  1S4E A;  4LFA I;  1Z0W A;  1PJT A;  3D4J A;  1UIL A;  1H7U A;  4NXM E;  2GO4 A;  4WUD A;  3K85 A;  2R3V A;  2HK3 A;  3CDI A;  3F0N A;  3P1X A;  1HNZ E;  3NZK A;  4WXC A;  1PIE A;  2VF3 A;  4KQV A;  2YTP A;  4IFD D;  4UT4 A;  2Q8U A;  2UUB E;  1KVK A;  2LCE A;  1Z0E A;  3M85 G;  5C0X E;  1LLM C;  4HAC A;  4JI1 I;  3HXL A;  1Z0V A;  2A25 A;  2EM2 A;  1H7S A;  2WW4 A;  1KKH A;  3EPK A;  3LLH A;  3H4L A;  1STU A;  2DSY A;  5GMD A;  3QT7 A;  5LMN E;  4DPT A;  1Z0B A;  4GKJ I;  1ZR9 A;  4FW9 A;  2EPO A;  1MEY C;  1EH6 A;  2YSP A;  2FGG A;  4MU0 A;  2EPK X;  2VES A;  2NN6 D;  2BM0 A;  3JTZ A;  3MHS C;  4ISA A;  1OYR A;  4N4R B;  1B62 A;  2MKN A;  4JI6 I;  1DAR A;  2B3T B;  1GZ6 A;  2L6M A;  2L92 A;  4P78 A;  5AC4 A;  2VQE E;  2JR1 A;  1N34 E;  2K4V A;  4K0K E;  1I94 I;  2O1T A;  4IFD A;  1HNW E;  4DR4 I;  2EMG A;  2JOB A;  4MLQ A;  2LBS B;  4HEI A;  4UTG A;  3ZM7 A;  2J65 A;  4NXN I;  1VIS A;  3U1Y A;  4X9J A;  4IS9 A;  4M2Z A;  2L2M A;  2M4I A;  4WPY A;  4LF6 I;  2LRS A;  4MU3 A;  4R2R A;  2R42 A;  3Q1Q A;  2V88 A;  4JV5 E;  2ELZ A;  2WP8 A;  2EPC A;  2DIX A;  3BF2 A;  3FIG A;  3LML A;  4JI0 E;  1UEK A;  2EOR A;  4JI7 E;  4B3M I;  4DR7 E;  4X65 I;  2H36 X;  5A69 A;  4LF4 I;  1YYK A;  2GS8 A;  1PKP A;  2WBT A;  1RHY A;  2NN6 A;  3J80 Q;  3KWR A;  4LTY A;  4F54 A;  2ENC A;  2L3J A;  4LF9 I;  2Q2E B;  4USM A;  4DV0 I;  2LTR A;  1Z59 A;  1PJQ A;  4M30 A;  1Y4U A;  4QNK A;  2CPN A;  3OTO E;  2M1S A;  2WBU A;  5A2Q C;  3ZOQ B;  5JEA F;  4NHR A;  1Z5A A;  5KL7 A;  1X49 A;  2OI2 A;  1IQS A;  3F6G A;  3OML A;  5LL6 R;  4Q35 B;  2LJP A;  3L7Z A;  2V2Q A;  2CTD A;  4DV2 E;  4EMD A;  2LJU A;  2LJH A;  2YT4 A;  4WSG A;  5T6J A;  1MX0 A;  4X62 I;  3HQ1 A;  4GQU A;  4JG4 A;  1OYS A;  2A2C A;  4TUI A;  2EML A;  3THN A;  3IWC A;  3P06 A;  4DV5 I;  2UU9 I;  2RPC A;  4WSP A;  1X48 A;  2LE2 A;  2V85 A;  3KZZ A;  5IXM B;  2EMC A;  3EPL A;  3PRY A;  4LFB I;  1RQ0 A;  2FV4 B;  4LF5 I;  5IT9 Q;  4J3D A;  4B3T E;  4JI3 E;  2DGC A;  2V8P A;  2UUC E;  2M7Q A;  1FJG I;  2EM6 A;  3PS3 A;  2JOX A;  2PNL A;  1J5E I;  4LF7 I;  3T1Y E;  3BID A;  2PNM A;  4NZV A;  4FW5 A;  5ELW A;  1YPN A;  3AUZ A;  4BC7 A;  5AAS A;  4B3S E;  2YTI A;  2C39 A;  1X6E A;  2JT2 A;  3U1K A;  4DR6 I;  2JWO A;  3GLL A;  2PO2 B;  3PYE A;  4JYA I;  2D9H A;  4R2C A;  4AM3 A;  4WXD A;  5JEA C;  2EPN A;  4F9C B;  4WFT A;  2WP8 B;  3Q6M A;  2EQ3 A;  2VRD A;  2UXD I;  1UBD C;  1ELO A;  2UXC I; 
#chains in the Genus database with same CATH homology
 5IWA I;  1A6F A;  4DPU A;  1U2R A;  2ZM6 E;  2KHX A;  3MSW A;  4DUZ I;  3M6A A;  2YZT A;  1KTV A;  1FWL A;  4B3R E;  2J7K A;  2L2K B;  1IBM E;  4DV7 I;  4L5N C;  1WHN A;  3J80 C;  4DR3 I;  4JI8 E;  3ADL A;  3ADJ A;  3ADI A;  4HY1 A;  5AE3 A;  3T1H I;  2HHH E;  4JI5 E;  1H73 A;  2V8Q B;  2LMZ A;  3HUL A;  4F9A B;  2JY9 A;  2ODR C;  3HTX A;  4I8O A;  3DJW A;  1UHZ A;  1ZBQ A;  4DMI A;  2HFS A;  4DR5 E;  2E5L E;  4X64 I;  2UUA I;  4LF8 I;  5CFF E;  5IT9 C;  1KIJ A;  3H09 A;  3Q6N A;  3VK6 A;  4M1K A;  2DEI A;  2V87 A;  1QZR A;  1EKZ A;  1Y6Z A;  3JAM Q;  4BS9 A;  1N36 I;  2IHR 1;  1EA6 A;  2NPF A;  4JI4 I;  4KHP I;  1WXR A;  1WHQ A;  5DNY A;  2IOQ A;  1Z0C A;  4USK A;  4LFA E;  1N32 I;  2NUE A;  1N34 I;  1XHK A;  4ED4 A;  4PU9 A;  4WUB A;  1FWK A;  2HKE A;  4AQY I;  4DV4 I;  4R8O A;  2V86 A;  4J8Z A;  4DU7 A;  2A2D A;  4Q28 A;  4YY3 I;  3K17 A;  4JI1 E;  4P7A A;  4JI2 I;  4DV6 I;  4FWG A;  4JI0 I;  1IBK E;  1EI1 A;  3V5R A;  4OX9 I;  2NA2 A;  2L8T A;  4GKJ E;  2VQF I;  2NUF A;  1D6T A;  3C4B A;  3RMP A;  3PYF A;  1BKN A;  4JI6 E;  1HNX E;  1I94 E;  4GKK I;  2L2N A;  4YHH I;  4DR4 E;  2NUG A;  3HJC A;  1YYO A;  2MDR A;  1FKA E;  2L3C A;  3CWV A;  4NXN E;  2E1R A;  1XNR I;  4DPY A;  2V34 A;  4DR1 I;  4LF6 E;  3B82 A;  1YZ9 A;  2V89 A;  2B7T A;  4BMJ A;  3ADG A;  4B3M E;  1Z5C A;  4X65 E;  1NHJ A;  5FWK A;  4LF4 E;  4LF9 E;  4N3O A;  3JU0 A;  3T1Y I;  1T4N A;  4DV0 E;  2X7I A;  3JAM C;  4B3S I;  4F9B B;  1WUU A;  2EFG A;  4M0V A;  4DU8 A;  4LFC I;  2RSM A;  1B63 A;  5FLX Q;  4DPW A;  1Z0G A;  4X62 E;  1X47 A;  4DV1 I;  4PRX A;  4TUG A;  2UXB I;  2UU9 E;  2V2V A;  4LFB E;  4FN5 A;  2G7H A;  4LF5 E;  1HK7 A;  2ZIT A;  3C4T A;  2MC6 A;  1PVG A;  3PYG A;  5L3J A;  1J5E I;  1HR0 I;  4MYU A;  5LMU I;  5BR8 I;  2CZ9 A;  1ZM3 A;  2E1M A;  4LF7 E;  4DV3 I;  4XTJ A;  2DMY A;  1XMO I;  3HPS A;  4DR6 E;  4JYA E;  1XMQ E;  4IZK B;  1IBL I;  1XNQ I;  1ZM2 A;  4R1F A;  3GON A;  3K1J A;  1O0W A;  2ZBK B;  4X66 I;  2X36 A;  2F4V I;  1J26 A;  5ADZ A;  1Z0T A;  2UXD E;  4P52 A;  1YYW A;  2Z5B A;  3AV0 A;  5IWA E;  4DR2 I;  2HKJ A;  2V83 A;  4NXM I;  4DUZ E;  2CGE A;  4I3H A;  1N0V C;  1HNZ I;  2E5L I;  2UUB I;  2HFU A;  1N33 E;  1NHH A;  1Y4S A;  3ZZ0 A;  3QT8 A;  2WZO A;  4DUY E;  4DV7 E;  4DR3 E;  4R03 A;  5LMN I;  2KON A;  2Z5C B;  3WU4 A;  1MG7 A;  3B8H A;  2BV3 A;  4PRV A;  2B9D A;  3J81 Q;  3T1H E;  3ZKB A;  2VQE I;  4K0K I;  3IWB A;  4P7D A;  2RS7 A;  5FLX C;  1HNW I;  4Z7Y A;  5AE1 A;  3LPS A;  3LTO A;  1H74 A;  4X64 E;  2UUA E;  4LF8 E;  4RPF A;  1IBK I;  1NZ0 A;  4JV5 I;  2N3H A;  3VYY A;  1K47 A;  2Z5B B;  4JI7 I;  4DR7 I;  4DPX A;  2L33 A;  4MYT A;  1N36 E;  4BBY A;  4KHP E;  4JI4 E;  3WU6 A;  4OOG C;  1N32 E;  1HNX I;  1RRE A;  4URL A;  3OTO I;  2LUP B;  4AQY E;  4DV4 E;  1S16 A;  2RTX A;  1ZM4 A;  2HK2 A;  1T4O A;  4BCA A;  2KOU A;  4YY3 E;  5F3W A;  4HXZ A;  4DV2 I;  4IZJ D;  4JI2 E;  4DV6 E;  4IZK A;  3WU3 A;  2RS6 A;  4OX9 E;  3QT5 A;  2VQF E;  1FNM A;  2CG9 A;  4B3T I;  4JI3 I;  2LTS A;  1ZXN A;  5GME A;  2UUC I;  1RR9 A;  3J7A G;  1DI2 A;  3B78 A;  2O1V A;  4FWH A;  3J7A M;  4GKK E;  4HAC B;  4YHH E;  1ZXM A;  3J81 C;  1XNR E;  3DF6 A;  4IZJ A;  1GQE A;  4LU9 A;  4DR1 E;  3ZZT A;  3F6H A;  1QU6 A;  2LUQ A;  2ZM6 I;  2VF1 A;  2GQ0 A;  2O1W A;  2ODR D;  2Z5C A;  3IWD A;  4DV5 E;  2B7V A;  4DXL A;  1SR9 A;  4HYM A;  4B3R I;  1FJG E;  2DB2 A;  1ZM9 A;  1IBM I;  2N3G A;  3QT6 A;  2EZ6 A;  1N0U A;  3LNU A;  4KZS A;  1XMQ I;  1NHI A;  4WUC A;  1DQ3 A;  4JI8 I;  4LFC E;  1USU A;  2V2Z A;  1Z5B A;  3PYD A;  3J7Y p;  3ZZU A;  2F8B A;  2VE7 C;  4WYQ B;  4DKK A;  1FI4 A;  3K6Q A;  4DV1 E;  2EWL A;  2UXC E;  2UXB E;  2HHH I;  1OJ4 A;  4JI5 I;  2AJ4 A;  1MU5 A;  4X8W A;  1J5E E;  2BM1 A;  4L8N A;  1HR0 E;  1N33 I;  4Z7C A;  5LMU E;  5BR8 E;  4BC9 A;  2DEJ A;  4DR5 I;  1USV A;  2Z5E A;  1T4L B;  3HPZ A;  4DV3 E;  3VYX A;  2JVA A;  1RC7 A;  4DUY I;  2MC5 A;  3WU5 A;  2XEX A;  5AE2 A;  3V2U C;  1XMO E;  4ZVI A;  2O1U A;  4FWD A;  4IZJ B;  2IOP A;  1IBL E;  1XNQ E;  4X66 E;  1H72 C;  2F4V E;  3ZKD A;  4GEQ B;  5A2Q Q;  2FTX B;  4DR2 E;  1ZBT A;  1S4E A;  4LFA I;  1Z0W A;  3D4J A;  1UIL A;  1H7U A;  4NXM E;  4WUD A;  3K85 A;  2R3V A;  2HK3 A;  3F0N A;  3P1X A;  1HNZ E;  1PIE A;  2VF3 A;  4KQV A;  4UT4 A;  2UUB E;  1KVK A;  1Z0E A;  4HAC A;  4JI1 I;  3HXL A;  1Z0V A;  1H7S A;  2WW4 A;  1KKH A;  3LLH A;  3H4L A;  1STU A;  2DSY A;  5GMD A;  3QT7 A;  5LMN E;  4DPT A;  1Z0B A;  4GKJ I;  4FW9 A;  2FGG A;  2BM0 A;  3JTZ A;  1B62 A;  4JI6 I;  1DAR A;  2B3T B;  1GZ6 A;  2L6M A;  2L92 A;  4P78 A;  1N34 E;  2VQE E;  2JR1 A;  4K0K E;  2K4V A;  1I94 I;  2O1T A;  1HNW E;  4DR4 I;  2JOB A;  2LBS B;  4UTG A;  3ZM7 A;  4NXN I;  1VIS A;  4M2Z A;  2L2M A;  2M4I A;  4WPY A;  4LF6 I;  2LRS A;  2R42 A;  3Q1Q A;  2V88 A;  4JV5 E;  3FIG A;  2DIX A;  4JI0 E;  3LML A;  1UEK A;  4JI7 E;  4B3M I;  4DR7 E;  4X65 I;  2H36 X;  4LF4 I;  1YYK A;  2GS8 A;  1PKP A;  3J80 Q;  3KWR A;  4LTY A;  4F54 A;  2L3J A;  4LF9 I;  2Q2E B;  4USM A;  4DV0 I;  2LTR A;  1Z59 A;  4M30 A;  1Y4U A;  2CPN A;  3OTO E;  2M1S A;  5A2Q C;  3ZOQ B;  1Z5A A;  1X49 A;  2OI2 A;  3F6G A;  3OML A;  5LL6 R;  2LJP A;  2V2Q A;  4DV2 E;  4EMD A;  2LJH A;  2YT4 A;  5T6J A;  1MX0 A;  4X62 I;  3HQ1 A;  4JG4 A;  2A2C A;  4TUI A;  3IWC A;  3P06 A;  4DV5 I;  2UU9 I;  4WSP A;  1X48 A;  2LE2 A;  2V85 A;  3PRY A;  4LFB I;  5IT9 Q;  1RQ0 A;  2FV4 B;  4LF5 I;  4B3T E;  4JI3 E;  2V8P A;  1FJG I;  2UUC E;  2M7Q A;  2JOX A;  2PNL A;  4LF7 I;  3T1Y E;  2PNM A;  3AUZ A;  4BC7 A;  5AAS A;  4B3S E;  4DR6 I;  4JYA I;  2JWO A;  3PYE A;  3Q6M A;  4F9C B;  4WFT A;  2UXD I;  1ELO A;  2UXC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...