1XMQE

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xmqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xmqE02
4DV0E 1WHQA 3ADLA 3F0NA 4PU9A 1MU5A 2UUAI 1FI4A 2DIXA 4K0KI 5IWAI 1ZBTA 1I94I 1N36I 4DV3I 1H74A 4JI6I 1IBME 4B3MI 4JI1I 3GONA 3Q1QA 2NUFA 4OX9I 4HYMA 1YYOA 2B7VA 4GKKE 3B8HA 1U2RA 4DPUA 2ZM6E 5CFFE 4LF4E 2V2QA 5GMEA 1FJGI 3LPSA 2BM0A 2UUCE 2DEIA 3PYGA 4YHHI 2DB2A 1S16A 4JI8E 1Z0TA 1X48A 4DPTA 1NHIA 1XMOI 4LF7E 4DV5I 3JAMQ 3H4LA 4WYQB 4DV0I 4JI7E 4AQYE 2LBSB 4DUZI 2N3HA 1WUUA 4YY3E 3J7Yp 4NXNE 1I94E 3OTOI 4HACB 4LFCE 3J81C 2LTSA 4FW9A 1IBMI 3LTOA 4HACA 4DR7I 1KVKA 2L3JA 4PRXA 2HK3A 1MX0A 4X62I 3CWVA 3B78A 4DPYA 1HNXE 4KHPI 3ADJA 1KTVA 4DKKA 2VF3A 4B3RE 2LUPB 1N34I 4USKA 4DR3E 1PKPA 1T4NA 4ZVIA 2VQFI 2UU9I 1H7SA 2NA2A 1Z59A 4LF7I 5BR8E 4LF5E 2MDRA 1NZ0A 4JI7I 4HXZA 4DUZE 1S4EA 4YY3I 1B62A 2UUBI 3K17A 4LF8I 4X8WA 4WFTA 3LLHA 4DR6E 4JI2I 2HFSA 1ZM9A 3ZZUA 3VYXA 2DMYA 2UXCE 1OJ4A 4X66E 2UXBI 3J7AM 1Z5AA 3JAMC 1A6FA 2X7IA 2LRSA 3ZKBA 2RS7A 3ZM7A 2NUEA 1DARA 1Z0BA 2E5LI 4DR3I 1UILA 3QT6A 4B3SI 3D4JA 3T1HI 1N33E 4DR2I 3J81Q 4X65I 4JYAE 3ZKDA 4JG4A 4JI4E 1FWKA 4DUYI 1UEKA 2WW4A 4HY1A 4DR5I 1PIEA 4RPFA 1T4OA 1Z0GA 4GKJI 5IWAE 4PRVA 1Z5BA 2AJ4A 2NPFA 2VQEE 2LTRA 1ZM4A 4URLA 2XEXA 4ED4A 1UHZA 1HNWE 4JI6E 4WUCA 1Z0EA 3V2UC 2A2CA 4DPXA 1YYWA 1IBKI 1FKAE 4OX9E 3QT5A 3WU3A 2LUQA 1STUA 1O0WA 2Q2EB 2YT4A 3PYEA 2UXBE 5LMNI 2UXDI 4LF4I 2X36A 2E5LE 2B3TB 2HHHI 1FJGE 4B3SE 1J5EI 5IT9C 4YHHE 4DV4E 4LFAE 4JV5I 4X65E 1IBLE 4M30A 3VYYA 4DV2I 4WUBA 1YZ9A 4JI4I 5A2QQ 1XNQE 4DR5E 4AQYI 4GKJE 1VISA 4DXLA 4DU8A 3OTOE 4NXNI 3P1XA 2VQEI 2OI2A 1N0UA 2B7TA 1K47A 3T1YE 1HNWI 4Z7CA 1H72C 4DR7E 4LF6E 2LJHA 2V2VA 1KIJA 4DR4I 1YYKA 1Z0CA 1HR0E 2V2ZA 4MYUA 4USMA 2R3VA 4LF9E 3C4BA 4B3RI 1XMQI 1N34E 1N32E 1XNRI 1QZRA 1RQ0A 4WUDA 1X49A 2VQFE 3WU6A 4DV4I 2UU9E 4LFAI 4JV5E 2R42A 1IBLI 3ADIA 2V34A 4R1FA 1D6TA 4LF5I 4JI0E 4DV7I 4KQVA 1Z0VA 4EMDA 4NXME 2L3CA 2JVAA 2LJPA 3J80C 1ZM3A 3LNUA 2RSMA 2ZBKB 4DR6I 4JI2E 4DV6E 4JI1E 2J7KA 3M6AA 4Z7YA 5LMUI 1ZM2A 4JI5E 1ELOA 5FLXQ 2RS6A 1NHJA 1MG7A 1RR9A 4DV1E 3HTXA 1HR0I 4GKKI 1WHNA 4M1KA 1N0VC 1EKZA 2BM1A 4X66I 2RTXA 4M2ZA 4LF9I 4DU7A 5LL6R 5GMDA 3HULA 1HNZI 3T1HE 1N33I 4LFBE 4DR2E 1KKHA 2E1RA 1Z5CA 4JI8I 1H73A 2HK2A 2KHXA 3C4TA 1XMOE 4DV5E 4JYAI 4JI3I 3J7AG 4X64E 3WU4A 4JI0I 3J80Q 4DV7E 4DUYE 3PYFA 4XTJA 4NXMI 1FNMA 2GS8A 3PYDA 5L3JA 4UT4A 2N3GA 2EZ6A 4LFCI 2V8PA 3ADGA 4B3TE 3WU5A 4DR1E 4DV6I 5LMUE 2L2KB 1IBKE 2NUGA 4UTGA 4JI5I 4DPWA 4X62E 2JY9A 4DV1I 3QT8A 1HNXI 4KHPE 2F4VE 5LMNE 2UXDE 1T4LB 5A2QC 4MYTA 2HHHE 1PVGA 1EA6A 3ZZ0A 1HNZE 1H7UA 1XHKA 2A2DA 2HKJA 1X47A 4LFBI 1J5EE 4FN5A 2ZITA 1B63A 4FWGA 1ZXNA 4DV2E 4FWHA 5BR8I 4JI3E 4X64I 4FWDA 1XNQI 2UUAE 4K0KE 2L2MA 2BV3A 1DI2A 2HFUA 4P7AA 2UUBE 1N36E 1J26A 3V5RA 4LF8E 4DV3E 2CPNA 4B3TI 3T1YI 4P52A 1EI1A 1ZXMA 5IT9Q 4DR1I 4LF6I 4B3ME 1GQEA 1FWLA 4DR4E 2IHR1 2CZ9A 1NHHA 2UXCI 2F4VI 2L2NA 3B82A 1BKNA 1RREA 3QT7A 2ZM6I 2DEJA 3ZZTA 1XMQE 1XNRE 1N32I 4OOGC 5FLXC 4I3HA 1QU6A 2UUCI 3K1JA 1Z0WA 2L33A 2HKEA 1RC7A 2EFGA
chains in the Genus database with same CATH superfamily
4DV0E 1WHQA 3ADLA 3F0NA 4PU9A 1MU5A 2UUAI 1FI4A 2DIXA 4K0KI 4QNJA 5IWAI 1ZBTA 1I94I 5KL4A 1N36I 2YRKA 5AC4A 3NZKA 4DV3I 2DMIA 2B9DA 1H74A 4JI6I 1IBME 4BBYA 2NN6C 1AH5A 4B3MI 5C0XC 1ZR9A 4JI1I 4LTYA 2Z5BB 2NUFA 3GONA 3Q1QA 3HPZA 3VK6A 3QG5C 4OX9I 4HYMA 2KONA 2YRMA 1A1FA 1YYOA 2ELZA 1DGCA 4NHRA 2B7VA 5DRQA 4X9JA 3UK3C 2RSIA 4GKKE 1PDAA 2BA1G 2CVEA 4IZJB 2JEAB 2EOSA 1R6LA 2AE8A 3B8HA 1MGTA 4WSGA 1U2RA 4HTGA 4DPUA 2ZM6E 2YU8A 5CFFE 4LF4E 5F3WA 2V2QA 2EPPA 5GMEA 2EL4A 1FJGI 1ZAAC 3LPSA 2MKDA 2JE6B 2BM0A 2PO0A 2UUCE 2DEIA 3PYGA 4YHHI 2DB2A 2M9AA 1S16A 3VHTB 4JI8E 2CGEA 1YSAC 1Z0TA 3H1CA 2EN7A 4U3BA 1X48A 1X6HA 2VESA 1NHIA 1UDNA 4DPTA 1XMOI 5AASA 4LF7E 4DV5I 2L8TA 3JAMQ 1X3CA 3H4LA 4WYQB 2EPOA 3P3CA 4DV0I 2EN8A 1A1HA 4JI7E 4AQYE 2LBSB 4ISAA 4DUZI 2N3HA 1JK1A 1TF3A 1WUUA 3BIDA 4BCAA 4YY3E 3CDJA 1DQ3A 3J7Yp 4FW3A 2NN6F 4NXNE 1I94E 3OTOI 2EMBA 4HACB 4IFDC 1KYQA 3F6HA 4R2CA 3J81C 4LFCE 2JYAA 2EOXA 2LTSA 2EPMX 2LT7A 3CDIA 4BA2A 2EM0A 2EJ4A 2EN4A 4FW9A 4DR7I 2EM5A 2ENAA 2C38A 3LTOA 4HACA 1IBMI 4BS9A 2EMKA 2M1SA 2EQ0A 5A6JA 3EPKA 4BC9A 1KVKA 3U1KA 2EOQA 3M85G 5K36D 2L3JA 4PRXA 5JEAF 2HK3A 2Z5EA 5A6BD 2C38B 1MX0A 4OO1C 4X62I 3BGHA 3CWVA 3P76A 3B78A 4DPYA 2Q8UA 1HNXE 5DRPA 1ZU1A 4KHPI 2M4IA 3EPHA 3ADJA 2PNZB 1KTVA 4DKKA 1UDSA 2VF3A 4WXCA 5TSEA 4FW6A 2EM3A 4MLVA 2FTXB 4B3RE 5DNYA 2LUPB 2E72A 2BA1D 4USKA 4DR3E 2PNZA 1N34I 5K36E 3JTZA 2GPIA 1G2DC 2F1DA 1PKPA 2EMGA 1BBOA 2HGHA 5C0XE 1T4NA 4ZVIA 4F9BB 1E3HA 2VQFI 5KL7A 4IS9A 2UU9I 1H7SA 2EOJA 1YH8A 5T6JA 2NA2A 1Z59A 2EP3A 2YTJA 4LF7I 5BR8E 4GZNC 1IQOA 4FK5C 2EMXA 5AC5A 4LF5E 2O1TA 4IFDF 2MDRA 1NZ0A 1YUIA 5JEAB 4JI7I 3KZZA 4HXZA 4DUZE 3H09A 2FGGA 4BHBA 5KL3A 4R2QA 1S4EA 5ELWA 4U3DA 4YY3I 2EMYA 1B62A 2JR1A 2FV4B 5KL6A 2UUBI 4IJDA 5C0XD 3K17A 3Q6NA 4LF8I 3KWRA 4MQYA 4X8WA 1OYSA 5K36A 1RMDA 4WFTA 4WXDA 4DMIA 2YWQA 1UDOA 3LLHA 2EPCA 2PO2A 4ZYDA 4DR6E 4JI2I 1TN9A 2CG9A 2HFSA 1ZM9A 2MC6A 3ZZUA 2GO3A 1EH7A 3VYXA 1BBGA 1RHYA 1G2FC 4P78A 2DMYA 2UXCE 1OJ4A 4X66E 2UXBI 3KZYA 4F9AB 3J7AM 1Z5AA 3JAMC 1A6FA 2IERA 2X7IA 2LRSA 3ZKBA 3HPSA 4KZSA 2RS7A 2PNLA 3ZM7A 2VRDA 2WBUA 2NUEA 1DARA 1SR9A 1Z0BA 4R2RA 2YTOA 2EMHA 2LMZA 4DR3I 2E5LI 1UILA 2Z5CA 1UBDC 2V83A 3QT6A 3GCMA 2YSOA 5K36F 3M7NG 1LLMC 3M99B 4AIMA 4B3SI 3D4JA 4P7DA 1N33E 1XXEA 3T1HI 4DR2I 2KOUA 3DD6A 1UN6B 3J81Q 4WSPA 2HC5A 2V86A 4X65I 2CTDA 4FW4A 2YTGA 2D9HA 2N8XA 3AV0A 4JYAE 3IWCA 1Y60A 3ZKDA 4JG4A 4JI4E 4AIDA 1FWKA 4DUYI 1UEKA 4LCFA 2EM6A 2WW4A 4HY1A 4DR5I 1PIEA 4IFDE 4RPFA 1T4OA 1Z0GA 4GKJI 5IWAE 2EOZA 5C0XB 4LPFA 4PRVA 1Z5BA 4BMJA 2J7JA 2AJ4A 3THOB 2NPFA 2VQEE 2O1WA 3EPJA 2LTRA 2JWOA 4KWYA 1VI7A 1ZM4A 2V8QB 4OZEA 2EM9A 3PS2A 1GTKA 2EN2A 1N3GA 2BA0G 2XEXA 4MU4A 4MU3A 1UHZA 2E1MA 4JI6E 1HNWE 2C39A 4WUCA 2EM8A 4ED4A 1Z0EA 1MEYC 3V2UC 3TQMA 2A2CA 4DPXA 5JEAE 4IFDD 2PO1A 1YYWA 1YUJA 1IBKI 2EM4A 1FKAE 2YTDA 4OX9E 3QT5A 3WU3A 2LUQA 1STUA 4OKGA 1O0WA 2Q2EB 2YT4A 3PYEA 5K36C 1EH6A 2LJUA 2EMLA 3RMPA 2UXBE 5LMNI 3HJCA 4MDTA 4O43A 2UXDI 2GHFA 3GLLA 2R1FA 2NN6D 2EMZA 1A1JA 2EPRA 4M0VA 1KJKA 4LF4I 1OYRA 3BF2A 2B3TB 2E5LE 2YTNA 1Y4UA 2X36A 3PS3A 4IZKA 5C0XF 2ODRC 4IFDA 3L00A 2CSHA 1FJGE 4Q28A 1PJSA 4B3SE 2VF1A 5DROA 1J5EI 5IT9C 4YHHE 2RQLA 5KL5A 4R2AA 4DV4E 1YHCA 4LFAE 4JV5I 3DJWA 1Z1BA 4X65E 3B4TA 1IBLE 3HKMA 2YTIA 5LLQA 4ZYEA 4WPYA 2EWLA 4RH8A 4M30A 3VYYA 4F6MA 2O1UA 4DV2I 4WUBA 4R8OA 1YZ9A 1ZBQA 2EM7A 4JI4I 2H36X 2LCEA 2VE7C 5A2QQ 1XNQE 3AUZA 2RPCA 4O24A 4DR5E 4LOMA 4AQYI 2EPZA 4AM3A 2DLKA 4GKJE 1VISA 4DXLA 4DU8A 2EOEA 3U1YA 3OTOE 4NXNI 3P1XA 2EN1A 2IOQA 5A6BA 2JEBB 4IS1C 2VQEI 2L6MA 2OI2A 1USUA 4BHCA 1N0UA 4LU9A 4R03A 2EMIA 2EQ1A 2B7TA 1K47A 2EMAA 4MLQA 3T1YE 1R6MA 4MU1A 3F6GA 1HNWI 4Z7CA 1H72C 4LCGA 4DR7E 4LF6E 1USVA 4ZYHA 3GMEA 2LJHA 2YU5A 1KIJA 2ODRD 2V2VA 2JEAA 4GEQB 4DR4I 1YYKA 4BA2B 3MHSC 2BB8A 1Z0CA 3PRYA 1HR0E 2V2ZA 2EN6A 2Z5BA 4MYUA 4USMA 5FWKA 2R3VA 3JU0A 2WNRA 1GZ6A 4LF9E 2V87A 2YRHA 1L4SA 3C4BA 4L5NC 1BB8A 1XMQI 4B3RI 1WRJA 3KRNA 2I9IA 2YZTA 1N34E 1A1KA 2WNRB 1N32E 1XNRI 2C39B 4NBQA 1QZRA 2V88A 4TUIA 4TUGA 5EKWA 1RQ0A 2PO1B 4N4RB 3K85A 1X49A 4WUDA 2VQFE 3WU6A 5ADZA 2UU9E 4DV4I 5A69A 2NN6B 4LFAI 4R2SA 2MDGA 4JV5E 5DNXA 2R42A 1IBLI 5IXMB 3ADIA 1IMUA 2V34A 4R1FA 5AE1A 1HK7A 2EM2A 1D6TA 2C37B 4F2JC 4LF5I 3L7ZA 3MHHC 2ELYA 4JI0E 4DV7I 2DSYA 4KQVA 1Z0VA 4EMDA 4NXME 1TF6A 2L3CA 2I13A 2C37A 1EH8A 1X6EA 3K6QA 2JVAA 5IV8B 2LJPA 2EMWA 3J80C 2WBSA 1OYPA 5JEAD 4J3DA 2EOMA 4I8OA 2V89A 2ADRA 1ZM3A 2YTPA 2YTFA 2CT1A 2EE8A 3LNUA 2RSMA 2ZBKB 4IZJA 2EPUA 4OO1E 2O1VA 2Z5CB 1T38A 4DR6I 4JI2E 2HHHI 4OO1F 1A1LA 4DV6E 4JI1E 3ECRA 2J7KA 3M6AA 2F8BA 1ZM2A 2EOIA 4Z7YA 5LMUI 4JI5E 1ELOA 5FLXQ 2RS6A 1NHJA 5C0XA 4BA1B 2BR2B 1MG7A 2DLQA 3EPLA 3HXLA 1RR9A 4DV1E 2GQ0A 2MC5A 3HTXA 1P42A 4FW5A 1HR0I 4GKKI 1WHNA 4M1KA 5JEAC 1N0VC 1EKZA 2BM1A 4X66I 2NABA 2WBTA 2RTXA 2WP8A 2LO3A 3IWBA 4M2ZA 4LF9I 4R2DA 4DU7A 2EOOA 2GO4A 3M85D 2EOYA 5LL6R 5GMDA 2O3ZA 1IQSA 2JT2A 1X5WA 3HULA 3ZOQB 1HNZI 4RHBB 1Y6ZA 2LVHA 3L7ZB 3T1HE 1N33I 4LFBE 4DR2E 5KL2A 1KKHA 2E1RA 4OO1A 1Z5CA 5DNLA 4JI8I 2JOXA 2R76A 1H73A 2HK2A 2JEBA 2KHXA 2YTEA 2DRPA 3P3EA 3C4TA 5JEAA 1XMOE 5AE2A 1F2IG 4DV5E 4JYAI 4JI3I 4OO1B 2G7HA 3J7AG 4GQUA 2IESA 4X64E 3WU4A 1QNTA 4JI0I 4DV7E 3J80Q 4DUYE 3THNA 3PYFA 4XTJA 4NXMI 2HJJA 2WCC3 1FNMA 3C6KA 2GS8A 2YTQA 3PYDA 5EL9A 5L3JA 4F9CB 4UT4A 2N3GA 3OMLA 1PJTA 2EZ6A 2NN6E 4LFCI 4HEIA 2EPXA 2V8PA 3ADGA 1JK2A 3PS1A 2EPNA 1A1GA 2EN3A 4B3TE 4IZKB 1YFHA 2EMFA 1SFEA 3WU5A 4DR1E 4DV6I 2M7QA 1B69A 1Y5YA 5LMUE 2L2KB 1IBKE 2NUGA 1E3PA 4QNKA 4UTGA 4URLA 4JI5I 4DPWA 3FIGA 2EPKX 4FW7A 4J8ZA 3P3GA 4X62E 2JY9A 4DV1I 3EQ1A 3Q6MA 3QT8A 1HNXI 1AAYA 4KHPE 2F4VE 1NEIA 5LMNE 4MU0A 5DRRA 1WXRA 2UXDE 1YPNA 2EOHA 2JXPA 5A2QC 1T4LB 4MYTA 2J65A 2BBGA 2HHHE 4O4KA 1EA6A 1PVGA 3ZZ0A 1HNZE 1H7UA 1XHKA 2A2DA 2HKJA 1Y4SA 1X47A 4LFBI 1J5EE 2MKNA 1A1IA 2ZITA 4FN5A 4R2PA 4L8NA 3MSWA 2BR2A 1B63A 2JOBA 2EL6A 4FWGA 4N3OA 1ZXNA 2BA0D 1P47A 3P06A 1NCSA 4DV2E 2DGCA 4FWHA 5BR8I 4JI3E 4IFDB 2L92A 1X6FA 2WP8B 4X64I 4NZVA 2EPLX 4FWDA 2ENCA 1XNQI 5K36B 2UUAE 4K0KE 4F54A 3DF6A 2L2MA 2BV3A 2IOPA 4BA1A 2PO0B 1DI2A 2ENHA 2HFUA 2A25A 4P7AA 2UUBE 1N36E 1J26A 3V5RA 4LF8E 3IWDA 3M7ND 4OO1D 4DV3E 3C6MA 2CPNA 2JPAA 4B3TI 3T1YI 4P52A 1EI1A 1ZXMA 5IT9Q 2GLIA 2YSPA 4B3ME 4DR1I 5A6AA 4LF6I 1GQEA 3BBGA 2JE6A 2EOFA 2WZOA 2K4VA 1FWLA 4DR4E 4O5GA 2EORA 2IHR1 4BC7A 1UDQA 2NN6A 2YPNA 5AE3A 2K7IA 2CZ9A 1PJQA 1NHHA 3HQ1A 3UHMA 2PNMA 2UXCI 2F4VI 2EQ3A 2L2NA 2PRTA 3B82A 1BKNA 1RREA 3QT7A 2ZM6I 2V85A 2EMCA 3LMLA 2DEJA 2EPAA 3ZZTA 4LCHA 4Q35B 1XMQE 1XNRE 1N32I 2LV2A 4OOGC 5FLXC 4I3HA 2JP9A 1QU6A 4IZJD 2UUCI 2LE2A 3K1JA 1Z0WA 4F6NA 2L33A 5A6KA 4M9VC 4R2EA 2EL5A 2HKEA 1T39A 1RC7A 1WJPA 2EFGA 4WX9A 4ZYGA 2PO2B
chains in the Genus database with same CATH topology
4DV0E 1WHQA 3ADLA 3F0NA 4PU9A 1MU5A 2UUAI 1FI4A 2DIXA 4K0KI 5IWAI 1ZBTA 1I94I 1N36I 4DV3I 2B9DA 1H74A 4JI6I 1IBME 4BBYA 4B3MI 4JI1I 4LTYA 2Z5BB 2NUFA 3GONA 3Q1QA 3HPZA 3VK6A 4OX9I 4HYMA 2KONA 1YYOA 2B7VA 4IZJB 4GKKE 3B8HA 1U2RA 4DPUA 2ZM6E 5CFFE 4LF4E 5F3WA 2V2QA 5GMEA 1FJGI 3LPSA 2BM0A 2UUCE 2DEIA 3PYGA 4YHHI 2DB2A 1S16A 4JI8E 2CGEA 1Z0TA 1X48A 4DPTA 1NHIA 1XMOI 5AASA 4LF7E 4DV5I 2L8TA 3JAMQ 3H4LA 4WYQB 4DV0I 4JI7E 4AQYE 2LBSB 4DUZI 2N3HA 1WUUA 4BCAA 4YY3E 1DQ3A 3J7Yp 4NXNE 1I94E 3OTOI 4HACB 3F6HA 4LFCE 3J81C 2LTSA 4FW9A 1IBMI 3LTOA 4HACA 4BS9A 2M1SA 4DR7I 1KVKA 4BC9A 2L3JA 4PRXA 2HK3A 2Z5EA 1MX0A 4X62I 3CWVA 3B78A 4DPYA 1HNXE 4KHPI 2M4IA 3ADJA 1KTVA 4DKKA 2VF3A 2FTXB 4B3RE 5DNYA 2LUPB 1N34I 4USKA 4DR3E 3JTZA 1PKPA 1T4NA 4ZVIA 4F9BB 2VQFI 2UU9I 1H7SA 5T6JA 2NA2A 1Z59A 4LF7I 5BR8E 4LF5E 2O1TA 2MDRA 1NZ0A 4JI7I 4HXZA 4DUZE 3H09A 2FGGA 1S4EA 4YY3I 1B62A 2JR1A 2FV4B 2UUBI 3K17A 3Q6NA 4LF8I 3KWRA 4X8WA 4WFTA 4DMIA 3LLHA 4DR6E 4JI2I 2CG9A 2HFSA 1ZM9A 2MC6A 3ZZUA 3VYXA 4P78A 2DMYA 2UXCE 1OJ4A 4X66E 2UXBI 4F9AB 3J7AM 1Z5AA 3JAMC 1A6FA 2X7IA 2LRSA 3ZKBA 3HPSA 4KZSA 2RS7A 2PNLA 3ZM7A 2NUEA 1DARA 1SR9A 1Z0BA 2E5LI 4DR3I 2LMZA 1UILA 2Z5CA 3QT6A 2V83A 4B3SI 3D4JA 4P7DA 1N33E 3T1HI 4DR2I 2KOUA 3J81Q 4WSPA 2V86A 4X65I 3AV0A 4JYAE 3IWCA 3ZKDA 4JG4A 4JI4E 1FWKA 4DUYI 1UEKA 2WW4A 4HY1A 4DR5I 1PIEA 4RPFA 1T4OA 1Z0GA 4GKJI 5IWAE 4PRVA 1Z5BA 4BMJA 2AJ4A 2NPFA 2VQEE 2O1WA 2LTRA 2JWOA 1ZM4A 2V8QB 4URLA 2XEXA 4ED4A 1UHZA 2E1MA 4JI6E 1HNWE 4WUCA 1Z0EA 3V2UC 2A2CA 4DPXA 1YYWA 1IBKI 1FKAE 4OX9E 3QT5A 3WU3A 2LUQA 1STUA 1O0WA 2Q2EB 2YT4A 3PYEA 3RMPA 2UXBE 5LMNI 3HJCA 2UXDI 4M0VA 4LF4I 2X36A 2E5LE 2B3TB 1Y4UA 2HHHI 4IZKA 2ODRC 1FJGE 4Q28A 4B3SE 2VF1A 1J5EI 5IT9C 4YHHE 4DV4E 4LFAE 4JV5I 3DJWA 4X65E 1IBLE 4WPYA 2EWLA 4M30A 2O1UA 3VYYA 4DV2I 4WUBA 4R8OA 1YZ9A 1ZBQA 4JI4I 2H36X 2VE7C 5A2QQ 1XNQE 3AUZA 4DR5E 4AQYI 4GKJE 1VISA 4DXLA 4DU8A 3OTOE 4NXNI 3P1XA 2IOQA 2VQEI 2L6MA 2OI2A 1USUA 1N0UA 4LU9A 4R03A 2B7TA 1K47A 3T1YE 1HNWI 3F6GA 4Z7CA 1H72C 4DR7E 4LF6E 1USVA 2LJHA 2V2VA 1KIJA 2ODRD 4GEQB 4DR4I 1YYKA 1Z0CA 3PRYA 1HR0E 2V2ZA 2Z5BA 4MYUA 4USMA 5FWKA 2R3VA 3JU0A 1GZ6A 4LF9E 2V87A 3C4BA 4L5NC 4B3RI 1XMQI 1N34E 2YZTA 1N32E 1XNRI 1QZRA 2V88A 4TUIA 4TUGA 1RQ0A 4WUDA 3K85A 1X49A 2VQFE 3WU6A 5ADZA 2UU9E 4DV4I 4LFAI 4JV5E 2R42A 1IBLI 3ADIA 2V34A 4R1FA 5AE1A 1HK7A 1D6TA 4LF5I 4JI0E 4DV7I 2DSYA 4KQVA 1Z0VA 4EMDA 4NXME 2L3CA 3K6QA 2JVAA 2LJPA 3J80C 4I8OA 2V89A 1ZM3A 3LNUA 2RSMA 2ZBKB 4IZJA 2O1VA 2Z5CB 4DR6I 4JI2E 4DV6E 4JI1E 2J7KA 3M6AA 4Z7YA 2F8BA 1ZM2A 5LMUI 4JI5E 1ELOA 5FLXQ 2RS6A 1NHJA 1MG7A 1RR9A 2GQ0A 3HXLA 4DV1E 2MC5A 3HTXA 1HR0I 4GKKI 1WHNA 4M1KA 1N0VC 1EKZA 2BM1A 4X66I 2RTXA 3IWBA 4M2ZA 4LF9I 4DU7A 5LL6R 5GMDA 3HULA 3ZOQB 1HNZI 1Y6ZA 3T1HE 1N33I 4LFBE 4DR2E 1KKHA 2E1RA 1Z5CA 4JI8I 2JOXA 1H73A 2HK2A 2KHXA 3C4TA 1XMOE 5AE2A 4DV5E 4JYAI 4JI3I 2G7HA 3J7AG 4X64E 3WU4A 4JI0I 3J80Q 4DV7E 4DUYE 3PYFA 4XTJA 4NXMI 1FNMA 2GS8A 3PYDA 5L3JA 4F9CB 4UT4A 2N3GA 3OMLA 2EZ6A 4LFCI 2V8PA 3ADGA 4B3TE 4IZKB 3WU5A 4DR1E 4DV6I 2M7QA 5LMUE 2L2KB 1IBKE 2NUGA 4UTGA 4JI5I 4DPWA 3FIGA 4J8ZA 4X62E 2JY9A 4DV1I 3Q6MA 3QT8A 1HNXI 4KHPE 2F4VE 5LMNE 1WXRA 2UXDE 5A2QC 1T4LB 4MYTA 2HHHE 1PVGA 1EA6A 3ZZ0A 1HNZE 1H7UA 1XHKA 2A2DA 2HKJA 1Y4SA 1X47A 4LFBI 1J5EE 4FN5A 2ZITA 4L8NA 3MSWA 1B63A 2JOBA 4FWGA 4N3OA 1ZXNA 3P06A 4DV2E 4FWHA 5BR8I 4JI3E 2L92A 4X64I 4FWDA 1XNQI 2UUAE 4K0KE 4F54A 3DF6A 2L2MA 2BV3A 2IOPA 1DI2A 2HFUA 4P7AA 2UUBE 1N36E 1J26A 3V5RA 4LF8E 3IWDA 4DV3E 2CPNA 4B3TI 3T1YI 4P52A 1EI1A 1ZXMA 5IT9Q 4DR1I 4LF6I 4B3ME 1GQEA 2WZOA 2K4VA 1FWLA 4DR4E 2IHR1 4BC7A 5AE3A 2CZ9A 1NHHA 3HQ1A 2UXCI 2PNMA 2F4VI 2L2NA 3B82A 1BKNA 1RREA 3QT7A 2ZM6I 2V85A 2DEJA 3LMLA 3ZZTA 1XMQE 1XNRE 1N32I 4OOGC 5FLXC 4I3HA 1QU6A 4IZJD 2UUCI 2LE2A 3K1JA 1Z0WA 2L33A 2HKEA 1RC7A 2EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  1WHQ A;  3ADL A;  3F0N A;  4PU9 A;  1MU5 A;  2UUA I;  1FI4 A;  2DIX A;  4K0K I;  5IWA I;  1ZBT A;  1I94 I;  1N36 I;  4DV3 I;  1H74 A;  4JI6 I;  1IBM E;  4B3M I;  4JI1 I;  3GON A;  3Q1Q A;  2NUF A;  4OX9 I;  4HYM A;  1YYO A;  2B7V A;  4GKK E;  3B8H A;  1U2R A;  4DPU A;  2ZM6 E;  5CFF E;  4LF4 E;  2V2Q A;  5GME A;  1FJG I;  3LPS A;  2BM0 A;  2UUC E;  2DEI A;  3PYG A;  4YHH I;  2DB2 A;  1S16 A;  4JI8 E;  1Z0T A;  1X48 A;  4DPT A;  1NHI A;  1XMO I;  4LF7 E;  4DV5 I;  3JAM Q;  3H4L A;  4WYQ B;  4DV0 I;  4JI7 E;  4AQY E;  2LBS B;  4DUZ I;  2N3H A;  1WUU A;  4YY3 E;  3J7Y p;  4NXN E;  1I94 E;  3OTO I;  4HAC B;  4LFC E;  3J81 C;  2LTS A;  4FW9 A;  1IBM I;  3LTO A;  4HAC A;  4DR7 I;  1KVK A;  2L3J A;  4PRX A;  2HK3 A;  1MX0 A;  4X62 I;  3CWV A;  3B78 A;  4DPY A;  1HNX E;  4KHP I;  3ADJ A;  1KTV A;  4DKK A;  2VF3 A;  4B3R E;  2LUP B;  1N34 I;  4USK A;  4DR3 E;  1PKP A;  1T4N A;  4ZVI A;  2VQF I;  2UU9 I;  1H7S A;  2NA2 A;  1Z59 A;  4LF7 I;  5BR8 E;  4LF5 E;  2MDR A;  1NZ0 A;  4JI7 I;  4HXZ A;  4DUZ E;  1S4E A;  4YY3 I;  1B62 A;  2UUB I;  3K17 A;  4LF8 I;  4X8W A;  4WFT A;  3LLH A;  4DR6 E;  4JI2 I;  2HFS A;  1ZM9 A;  3ZZU A;  3VYX A;  2DMY A;  2UXC E;  1OJ4 A;  4X66 E;  2UXB I;  3J7A M;  1Z5A A;  3JAM C;  1A6F A;  2X7I A;  2LRS A;  3ZKB A;  2RS7 A;  3ZM7 A;  2NUE A;  1DAR A;  1Z0B A;  2E5L I;  4DR3 I;  1UIL A;  3QT6 A;  4B3S I;  3D4J A;  3T1H I;  1N33 E;  4DR2 I;  3J81 Q;  4X65 I;  4JYA E;  3ZKD A;  4JG4 A;  4JI4 E;  1FWK A;  4DUY I;  1UEK A;  2WW4 A;  4HY1 A;  4DR5 I;  1PIE A;  4RPF A;  1T4O A;  1Z0G A;  4GKJ I;  5IWA E;  4PRV A;  1Z5B A;  2AJ4 A;  2NPF A;  2VQE E;  2LTR A;  1ZM4 A;  4URL A;  2XEX A;  4ED4 A;  1UHZ A;  1HNW E;  4JI6 E;  4WUC A;  1Z0E A;  3V2U C;  2A2C A;  4DPX A;  1YYW A;  1IBK I;  1FKA E;  4OX9 E;  3QT5 A;  3WU3 A;  2LUQ A;  1STU A;  1O0W A;  2Q2E B;  2YT4 A;  3PYE A;  2UXB E;  5LMN I;  2UXD I;  4LF4 I;  2X36 A;  2E5L E;  2B3T B;  2HHH I;  1FJG E;  4B3S E;  1J5E I;  5IT9 C;  4YHH E;  4DV4 E;  4LFA E;  4JV5 I;  4X65 E;  1IBL E;  4M30 A;  3VYY A;  4DV2 I;  4WUB A;  1YZ9 A;  4JI4 I;  5A2Q Q;  1XNQ E;  4DR5 E;  4AQY I;  4GKJ E;  1VIS A;  4DXL A;  4DU8 A;  3OTO E;  4NXN I;  3P1X A;  2VQE I;  2OI2 A;  1N0U A;  2B7T A;  1K47 A;  3T1Y E;  1HNW I;  4Z7C A;  1H72 C;  4DR7 E;  4LF6 E;  2LJH A;  2V2V A;  1KIJ A;  4DR4 I;  1YYK A;  1Z0C A;  1HR0 E;  2V2Z A;  4MYU A;  4USM A;  2R3V A;  4LF9 E;  3C4B A;  4B3R I;  1XMQ I;  1N34 E;  1N32 E;  1XNR I;  1QZR A;  1RQ0 A;  4WUD A;  1X49 A;  2VQF E;  3WU6 A;  4DV4 I;  2UU9 E;  4LFA I;  4JV5 E;  2R42 A;  1IBL I;  3ADI A;  2V34 A;  4R1F A;  1D6T A;  4LF5 I;  4JI0 E;  4DV7 I;  4KQV A;  1Z0V A;  4EMD A;  4NXM E;  2L3C A;  2JVA A;  2LJP A;  3J80 C;  1ZM3 A;  3LNU A;  2RSM A;  2ZBK B;  4DR6 I;  4JI2 E;  4DV6 E;  4JI1 E;  2J7K A;  3M6A A;  4Z7Y A;  5LMU I;  1ZM2 A;  4JI5 E;  1ELO A;  5FLX Q;  2RS6 A;  1NHJ A;  1MG7 A;  1RR9 A;  4DV1 E;  3HTX A;  1HR0 I;  4GKK I;  1WHN A;  4M1K A;  1N0V C;  1EKZ A;  2BM1 A;  4X66 I;  2RTX A;  4M2Z A;  4LF9 I;  4DU7 A;  5LL6 R;  5GMD A;  3HUL A;  1HNZ I;  3T1H E;  1N33 I;  4LFB E;  4DR2 E;  1KKH A;  2E1R A;  1Z5C A;  4JI8 I;  1H73 A;  2HK2 A;  2KHX A;  3C4T A;  1XMO E;  4DV5 E;  4JYA I;  4JI3 I;  3J7A G;  4X64 E;  3WU4 A;  4JI0 I;  3J80 Q;  4DV7 E;  4DUY E;  3PYF A;  4XTJ A;  4NXM I;  1FNM A;  2GS8 A;  3PYD A;  5L3J A;  4UT4 A;  2N3G A;  2EZ6 A;  4LFC I;  2V8P A;  3ADG A;  4B3T E;  3WU5 A;  4DR1 E;  4DV6 I;  5LMU E;  2L2K B;  1IBK E;  2NUG A;  4UTG A;  4JI5 I;  4DPW A;  4X62 E;  2JY9 A;  4DV1 I;  3QT8 A;  1HNX I;  4KHP E;  2F4V E;  5LMN E;  2UXD E;  1T4L B;  5A2Q C;  4MYT A;  2HHH E;  1PVG A;  1EA6 A;  3ZZ0 A;  1HNZ E;  1H7U A;  1XHK A;  2A2D A;  2HKJ A;  1X47 A;  4LFB I;  1J5E E;  4FN5 A;  2ZIT A;  1B63 A;  4FWG A;  1ZXN A;  4DV2 E;  4FWH A;  5BR8 I;  4JI3 E;  4X64 I;  4FWD A;  1XNQ I;  2UUA E;  4K0K E;  2L2M A;  2BV3 A;  1DI2 A;  2HFU A;  4P7A A;  2UUB E;  1N36 E;  1J26 A;  3V5R A;  4LF8 E;  4DV3 E;  2CPN A;  4B3T I;  3T1Y I;  4P52 A;  1EI1 A;  1ZXM A;  5IT9 Q;  4DR1 I;  4LF6 I;  4B3M E;  1GQE A;  1FWL A;  4DR4 E;  2IHR 1;  2CZ9 A;  1NHH A;  2UXC I;  2F4V I;  2L2N A;  3B82 A;  1BKN A;  1RRE A;  3QT7 A;  2ZM6 I;  2DEJ A;  3ZZT A;  1XMQ E;  1XNR E;  1N32 I;  4OOG C;  5FLX C;  4I3H A;  1QU6 A;  2UUC I;  3K1J A;  1Z0W A;  2L33 A;  2HKE A;  1RC7 A;  2EFG A; 
#chains in the Genus database with same CATH topology
 4DV0 E;  1WHQ A;  3ADL A;  3F0N A;  4PU9 A;  1MU5 A;  2UUA I;  1FI4 A;  2DIX A;  4K0K I;  4QNJ A;  5IWA I;  1ZBT A;  1I94 I;  5KL4 A;  1N36 I;  2YRK A;  5AC4 A;  3NZK A;  4DV3 I;  2DMI A;  2B9D A;  1H74 A;  4JI6 I;  1IBM E;  4BBY A;  2NN6 C;  1AH5 A;  4B3M I;  5C0X C;  1ZR9 A;  4JI1 I;  4LTY A;  2Z5B B;  2NUF A;  3GON A;  3Q1Q A;  3HPZ A;  3VK6 A;  3QG5 C;  4OX9 I;  4HYM A;  2KON A;  2YRM A;  1A1F A;  1YYO A;  2ELZ A;  1DGC A;  4NHR A;  2B7V A;  5DRQ A;  4X9J A;  3UK3 C;  2RSI A;  4GKK E;  1PDA A;  2BA1 G;  2CVE A;  4IZJ B;  2JEA B;  2EOS A;  1R6L A;  2AE8 A;  3B8H A;  1MGT A;  4WSG A;  1U2R A;  4HTG A;  4DPU A;  2ZM6 E;  2YU8 A;  5CFF E;  4LF4 E;  5F3W A;  2V2Q A;  2EPP A;  5GME A;  2EL4 A;  1FJG I;  1ZAA C;  3LPS A;  2MKD A;  2JE6 B;  2BM0 A;  2PO0 A;  2UUC E;  2DEI A;  3PYG A;  4YHH I;  2DB2 A;  2M9A A;  1S16 A;  3VHT B;  4JI8 E;  2CGE A;  1YSA C;  1Z0T A;  3H1C A;  2EN7 A;  4U3B A;  1X48 A;  1X6H A;  2VES A;  1NHI A;  1UDN A;  4DPT A;  1XMO I;  5AAS A;  4LF7 E;  4DV5 I;  2L8T A;  3JAM Q;  1X3C A;  3H4L A;  4WYQ B;  2EPO A;  3P3C A;  4DV0 I;  2EN8 A;  1A1H A;  4JI7 E;  4AQY E;  2LBS B;  4ISA A;  4DUZ I;  2N3H A;  1JK1 A;  1TF3 A;  1WUU A;  3BID A;  4BCA A;  4YY3 E;  3CDJ A;  1DQ3 A;  3J7Y p;  4FW3 A;  2NN6 F;  4NXN E;  1I94 E;  3OTO I;  2EMB A;  4HAC B;  4IFD C;  1KYQ A;  3F6H A;  4R2C A;  3J81 C;  4LFC E;  2JYA A;  2EOX A;  2LTS A;  2EPM X;  2LT7 A;  3CDI A;  4BA2 A;  2EM0 A;  2EJ4 A;  2EN4 A;  4FW9 A;  4DR7 I;  2EM5 A;  2ENA A;  2C38 A;  3LTO A;  4HAC A;  1IBM I;  4BS9 A;  2EMK A;  2M1S A;  2EQ0 A;  5A6J A;  3EPK A;  4BC9 A;  1KVK A;  3U1K A;  2EOQ A;  3M85 G;  5K36 D;  2L3J A;  4PRX A;  5JEA F;  2HK3 A;  2Z5E A;  5A6B D;  2C38 B;  1MX0 A;  4OO1 C;  4X62 I;  3BGH A;  3CWV A;  3P76 A;  3B78 A;  4DPY A;  2Q8U A;  1HNX E;  5DRP A;  1ZU1 A;  4KHP I;  2M4I A;  3EPH A;  3ADJ A;  2PNZ B;  1KTV A;  4DKK A;  1UDS A;  2VF3 A;  4WXC A;  5TSE A;  4FW6 A;  2EM3 A;  4MLV A;  2FTX B;  4B3R E;  5DNY A;  2LUP B;  2E72 A;  2BA1 D;  4USK A;  4DR3 E;  2PNZ A;  1N34 I;  5K36 E;  3JTZ A;  2GPI A;  1G2D C;  2F1D A;  1PKP A;  2EMG A;  1BBO A;  2HGH A;  5C0X E;  1T4N A;  4ZVI A;  4F9B B;  1E3H A;  2VQF I;  5KL7 A;  4IS9 A;  2UU9 I;  1H7S A;  2EOJ A;  1YH8 A;  5T6J A;  2NA2 A;  1Z59 A;  2EP3 A;  2YTJ A;  4LF7 I;  5BR8 E;  4GZN C;  1IQO A;  4FK5 C;  2EMX A;  5AC5 A;  4LF5 E;  2O1T A;  4IFD F;  2MDR A;  1NZ0 A;  1YUI A;  5JEA B;  4JI7 I;  3KZZ A;  4HXZ A;  4DUZ E;  3H09 A;  2FGG A;  4BHB A;  5KL3 A;  4R2Q A;  1S4E A;  5ELW A;  4U3D A;  4YY3 I;  2EMY A;  1B62 A;  2JR1 A;  2FV4 B;  5KL6 A;  2UUB I;  4IJD A;  5C0X D;  3K17 A;  3Q6N A;  4LF8 I;  3KWR A;  4MQY A;  4X8W A;  1OYS A;  5K36 A;  1RMD A;  4WFT A;  4WXD A;  4DMI A;  2YWQ A;  1UDO A;  3LLH A;  2EPC A;  2PO2 A;  4ZYD A;  4DR6 E;  4JI2 I;  1TN9 A;  2CG9 A;  2HFS A;  1ZM9 A;  2MC6 A;  3ZZU A;  2GO3 A;  1EH7 A;  3VYX A;  1BBG A;  1RHY A;  1G2F C;  4P78 A;  2DMY A;  2UXC E;  1OJ4 A;  4X66 E;  2UXB I;  3KZY A;  4F9A B;  3J7A M;  1Z5A A;  3JAM C;  1A6F A;  2IER A;  2X7I A;  2LRS A;  3ZKB A;  3HPS A;  4KZS A;  2RS7 A;  2PNL A;  3ZM7 A;  2VRD A;  2WBU A;  2NUE A;  1DAR A;  1SR9 A;  1Z0B A;  4R2R A;  2YTO A;  2EMH A;  2LMZ A;  4DR3 I;  2E5L I;  1UIL A;  2Z5C A;  1UBD C;  2V83 A;  3QT6 A;  3GCM A;  2YSO A;  5K36 F;  3M7N G;  1LLM C;  3M99 B;  4AIM A;  4B3S I;  3D4J A;  4P7D A;  1N33 E;  1XXE A;  3T1H I;  4DR2 I;  2KOU A;  3DD6 A;  1UN6 B;  3J81 Q;  4WSP A;  2HC5 A;  2V86 A;  4X65 I;  2CTD A;  4FW4 A;  2YTG A;  2D9H A;  2N8X A;  3AV0 A;  4JYA E;  3IWC A;  1Y60 A;  3ZKD A;  4JG4 A;  4JI4 E;  4AID A;  1FWK A;  4DUY I;  1UEK A;  4LCF A;  2EM6 A;  2WW4 A;  4HY1 A;  4DR5 I;  1PIE A;  4IFD E;  4RPF A;  1T4O A;  1Z0G A;  4GKJ I;  5IWA E;  2EOZ A;  5C0X B;  4LPF A;  4PRV A;  1Z5B A;  4BMJ A;  2J7J A;  2AJ4 A;  3THO B;  2NPF A;  2VQE E;  2O1W A;  3EPJ A;  2LTR A;  2JWO A;  4KWY A;  1VI7 A;  1ZM4 A;  2V8Q B;  4OZE A;  2EM9 A;  3PS2 A;  1GTK A;  2EN2 A;  1N3G A;  2BA0 G;  2XEX A;  4MU4 A;  4MU3 A;  1UHZ A;  2E1M A;  4JI6 E;  1HNW E;  2C39 A;  4WUC A;  2EM8 A;  4ED4 A;  1Z0E A;  1MEY C;  3V2U C;  3TQM A;  2A2C A;  4DPX A;  5JEA E;  4IFD D;  2PO1 A;  1YYW A;  1YUJ A;  1IBK I;  2EM4 A;  1FKA E;  2YTD A;  4OX9 E;  3QT5 A;  3WU3 A;  2LUQ A;  1STU A;  4OKG A;  1O0W A;  2Q2E B;  2YT4 A;  3PYE A;  5K36 C;  1EH6 A;  2LJU A;  2EML A;  3RMP A;  2UXB E;  5LMN I;  3HJC A;  4MDT A;  4O43 A;  2UXD I;  2GHF A;  3GLL A;  2R1F A;  2NN6 D;  2EMZ A;  1A1J A;  2EPR A;  4M0V A;  1KJK A;  4LF4 I;  1OYR A;  3BF2 A;  2B3T B;  2E5L E;  2YTN A;  1Y4U A;  2X36 A;  3PS3 A;  4IZK A;  5C0X F;  2ODR C;  4IFD A;  3L00 A;  2CSH A;  1FJG E;  4Q28 A;  1PJS A;  4B3S E;  2VF1 A;  5DRO A;  1J5E I;  5IT9 C;  4YHH E;  2RQL A;  5KL5 A;  4R2A A;  4DV4 E;  1YHC A;  4LFA E;  4JV5 I;  3DJW A;  1Z1B A;  4X65 E;  3B4T A;  1IBL E;  3HKM A;  2YTI A;  5LLQ A;  4ZYE A;  4WPY A;  2EWL A;  4RH8 A;  4M30 A;  3VYY A;  4F6M A;  2O1U A;  4DV2 I;  4WUB A;  4R8O A;  1YZ9 A;  1ZBQ A;  2EM7 A;  4JI4 I;  2H36 X;  2LCE A;  2VE7 C;  5A2Q Q;  1XNQ E;  3AUZ A;  2RPC A;  4O24 A;  4DR5 E;  4LOM A;  4AQY I;  2EPZ A;  4AM3 A;  2DLK A;  4GKJ E;  1VIS A;  4DXL A;  4DU8 A;  2EOE A;  3U1Y A;  3OTO E;  4NXN I;  3P1X A;  2EN1 A;  2IOQ A;  5A6B A;  2JEB B;  4IS1 C;  2VQE I;  2L6M A;  2OI2 A;  1USU A;  4BHC A;  1N0U A;  4LU9 A;  4R03 A;  2EMI A;  2EQ1 A;  2B7T A;  1K47 A;  2EMA A;  4MLQ A;  3T1Y E;  1R6M A;  4MU1 A;  3F6G A;  1HNW I;  4Z7C A;  1H72 C;  4LCG A;  4DR7 E;  4LF6 E;  1USV A;  4ZYH A;  3GME A;  2LJH A;  2YU5 A;  1KIJ A;  2ODR D;  2V2V A;  2JEA A;  4GEQ B;  4DR4 I;  1YYK A;  4BA2 B;  3MHS C;  2BB8 A;  1Z0C A;  3PRY A;  1HR0 E;  2V2Z A;  2EN6 A;  2Z5B A;  4MYU A;  4USM A;  5FWK A;  2R3V A;  3JU0 A;  2WNR A;  1GZ6 A;  4LF9 E;  2V87 A;  2YRH A;  1L4S A;  3C4B A;  4L5N C;  1BB8 A;  1XMQ I;  4B3R I;  1WRJ A;  3KRN A;  2I9I A;  2YZT A;  1N34 E;  1A1K A;  2WNR B;  1N32 E;  1XNR I;  2C39 B;  4NBQ A;  1QZR A;  2V88 A;  4TUI A;  4TUG A;  5EKW A;  1RQ0 A;  2PO1 B;  4N4R B;  3K85 A;  1X49 A;  4WUD A;  2VQF E;  3WU6 A;  5ADZ A;  2UU9 E;  4DV4 I;  5A69 A;  2NN6 B;  4LFA I;  4R2S A;  2MDG A;  4JV5 E;  5DNX A;  2R42 A;  1IBL I;  5IXM B;  3ADI A;  1IMU A;  2V34 A;  4R1F A;  5AE1 A;  1HK7 A;  2EM2 A;  1D6T A;  2C37 B;  4F2J C;  4LF5 I;  3L7Z A;  3MHH C;  2ELY A;  4JI0 E;  4DV7 I;  2DSY A;  4KQV A;  1Z0V A;  4EMD A;  4NXM E;  1TF6 A;  2L3C A;  2I13 A;  2C37 A;  1EH8 A;  1X6E A;  3K6Q A;  2JVA A;  5IV8 B;  2LJP A;  2EMW A;  3J80 C;  2WBS A;  1OYP A;  5JEA D;  4J3D A;  2EOM A;  4I8O A;  2V89 A;  2ADR A;  1ZM3 A;  2YTP A;  2YTF A;  2CT1 A;  2EE8 A;  3LNU A;  2RSM A;  2ZBK B;  4IZJ A;  2EPU A;  4OO1 E;  2O1V A;  2Z5C B;  1T38 A;  4DR6 I;  4JI2 E;  2HHH I;  4OO1 F;  1A1L A;  4DV6 E;  4JI1 E;  3ECR A;  2J7K A;  3M6A A;  2F8B A;  1ZM2 A;  2EOI A;  4Z7Y A;  5LMU I;  4JI5 E;  1ELO A;  5FLX Q;  2RS6 A;  1NHJ A;  5C0X A;  4BA1 B;  2BR2 B;  1MG7 A;  2DLQ A;  3EPL A;  3HXL A;  1RR9 A;  4DV1 E;  2GQ0 A;  2MC5 A;  3HTX A;  1P42 A;  4FW5 A;  1HR0 I;  4GKK I;  1WHN A;  4M1K A;  5JEA C;  1N0V C;  1EKZ A;  2BM1 A;  4X66 I;  2NAB A;  2WBT A;  2RTX A;  2WP8 A;  2LO3 A;  3IWB A;  4M2Z A;  4LF9 I;  4R2D A;  4DU7 A;  2EOO A;  2GO4 A;  3M85 D;  2EOY A;  5LL6 R;  5GMD A;  2O3Z A;  1IQS A;  2JT2 A;  1X5W A;  3HUL A;  3ZOQ B;  1HNZ I;  4RHB B;  1Y6Z A;  2LVH A;  3L7Z B;  3T1H E;  1N33 I;  4LFB E;  4DR2 E;  5KL2 A;  1KKH A;  2E1R A;  4OO1 A;  1Z5C A;  5DNL A;  4JI8 I;  2JOX A;  2R76 A;  1H73 A;  2HK2 A;  2JEB A;  2KHX A;  2YTE A;  2DRP A;  3P3E A;  3C4T A;  5JEA A;  1XMO E;  5AE2 A;  1F2I G;  4DV5 E;  4JYA I;  4JI3 I;  4OO1 B;  2G7H A;  3J7A G;  4GQU A;  2IES A;  4X64 E;  3WU4 A;  1QNT A;  4JI0 I;  4DV7 E;  3J80 Q;  4DUY E;  3THN A;  3PYF A;  4XTJ A;  4NXM I;  2HJJ A;  2WCC 3;  1FNM A;  3C6K A;  2GS8 A;  2YTQ A;  3PYD A;  5EL9 A;  5L3J A;  4F9C B;  4UT4 A;  2N3G A;  3OML A;  1PJT A;  2EZ6 A;  2NN6 E;  4LFC I;  4HEI A;  2EPX A;  2V8P A;  3ADG A;  1JK2 A;  3PS1 A;  2EPN A;  1A1G A;  2EN3 A;  4B3T E;  4IZK B;  1YFH A;  2EMF A;  1SFE A;  3WU5 A;  4DR1 E;  4DV6 I;  2M7Q A;  1B69 A;  1Y5Y A;  5LMU E;  2L2K B;  1IBK E;  2NUG A;  1E3P A;  4QNK A;  4UTG A;  4URL A;  4JI5 I;  4DPW A;  3FIG A;  2EPK X;  4FW7 A;  4J8Z A;  3P3G A;  4X62 E;  2JY9 A;  4DV1 I;  3EQ1 A;  3Q6M A;  3QT8 A;  1HNX I;  1AAY A;  4KHP E;  2F4V E;  1NEI A;  5LMN E;  4MU0 A;  5DRR A;  1WXR A;  2UXD E;  1YPN A;  2EOH A;  2JXP A;  5A2Q C;  1T4L B;  4MYT A;  2J65 A;  2BBG A;  2HHH E;  4O4K A;  1EA6 A;  1PVG A;  3ZZ0 A;  1HNZ E;  1H7U A;  1XHK A;  2A2D A;  2HKJ A;  1Y4S A;  1X47 A;  4LFB I;  1J5E E;  2MKN A;  1A1I A;  2ZIT A;  4FN5 A;  4R2P A;  4L8N A;  3MSW A;  2BR2 A;  1B63 A;  2JOB A;  2EL6 A;  4FWG A;  4N3O A;  1ZXN A;  2BA0 D;  1P47 A;  3P06 A;  1NCS A;  4DV2 E;  2DGC A;  4FWH A;  5BR8 I;  4JI3 E;  4IFD B;  2L92 A;  1X6F A;  2WP8 B;  4X64 I;  4NZV A;  2EPL X;  4FWD A;  2ENC A;  1XNQ I;  5K36 B;  2UUA E;  4K0K E;  4F54 A;  3DF6 A;  2L2M A;  2BV3 A;  2IOP A;  4BA1 A;  2PO0 B;  1DI2 A;  2ENH A;  2HFU A;  2A25 A;  4P7A A;  2UUB E;  1N36 E;  1J26 A;  3V5R A;  4LF8 E;  3IWD A;  3M7N D;  4OO1 D;  4DV3 E;  3C6M A;  2CPN A;  2JPA A;  4B3T I;  3T1Y I;  4P52 A;  1EI1 A;  1ZXM A;  5IT9 Q;  2GLI A;  2YSP A;  4B3M E;  4DR1 I;  5A6A A;  4LF6 I;  1GQE A;  3BBG A;  2JE6 A;  2EOF A;  2WZO A;  2K4V A;  1FWL A;  4DR4 E;  4O5G A;  2EOR A;  2IHR 1;  4BC7 A;  1UDQ A;  2NN6 A;  2YPN A;  5AE3 A;  2K7I A;  2CZ9 A;  1PJQ A;  1NHH A;  3HQ1 A;  3UHM A;  2PNM A;  2UXC I;  2F4V I;  2EQ3 A;  2L2N A;  2PRT A;  3B82 A;  1BKN A;  1RRE A;  3QT7 A;  2ZM6 I;  2V85 A;  2EMC A;  3LML A;  2DEJ A;  2EPA A;  3ZZT A;  4LCH A;  4Q35 B;  1XMQ E;  1XNR E;  1N32 I;  2LV2 A;  4OOG C;  5FLX C;  4I3H A;  2JP9 A;  1QU6 A;  4IZJ D;  2UUC I;  2LE2 A;  3K1J A;  1Z0W A;  4F6N A;  2L33 A;  5A6K A;  4M9V C;  4R2E A;  2EL5 A;  2HKE A;  1T39 A;  1RC7 A;  1WJP A;  2EFG A;  4WX9 A;  4ZYG A;  2PO2 B; 
#chains in the Genus database with same CATH homology
 4DV0 E;  1WHQ A;  3ADL A;  3F0N A;  4PU9 A;  1MU5 A;  2UUA I;  1FI4 A;  2DIX A;  4K0K I;  5IWA I;  1ZBT A;  1I94 I;  1N36 I;  4DV3 I;  2B9D A;  1H74 A;  4JI6 I;  1IBM E;  4BBY A;  4B3M I;  4JI1 I;  4LTY A;  2Z5B B;  2NUF A;  3GON A;  3Q1Q A;  3HPZ A;  3VK6 A;  4OX9 I;  4HYM A;  2KON A;  1YYO A;  2B7V A;  4IZJ B;  4GKK E;  3B8H A;  1U2R A;  4DPU A;  2ZM6 E;  5CFF E;  4LF4 E;  5F3W A;  2V2Q A;  5GME A;  1FJG I;  3LPS A;  2BM0 A;  2UUC E;  2DEI A;  3PYG A;  4YHH I;  2DB2 A;  1S16 A;  4JI8 E;  2CGE A;  1Z0T A;  1X48 A;  4DPT A;  1NHI A;  1XMO I;  5AAS A;  4LF7 E;  4DV5 I;  2L8T A;  3JAM Q;  3H4L A;  4WYQ B;  4DV0 I;  4JI7 E;  4AQY E;  2LBS B;  4DUZ I;  2N3H A;  1WUU A;  4BCA A;  4YY3 E;  1DQ3 A;  3J7Y p;  4NXN E;  1I94 E;  3OTO I;  4HAC B;  3F6H A;  4LFC E;  3J81 C;  2LTS A;  4FW9 A;  1IBM I;  3LTO A;  4HAC A;  4BS9 A;  2M1S A;  4DR7 I;  1KVK A;  4BC9 A;  2L3J A;  4PRX A;  2HK3 A;  2Z5E A;  1MX0 A;  4X62 I;  3CWV A;  3B78 A;  4DPY A;  1HNX E;  4KHP I;  2M4I A;  3ADJ A;  1KTV A;  4DKK A;  2VF3 A;  2FTX B;  4B3R E;  5DNY A;  2LUP B;  1N34 I;  4USK A;  4DR3 E;  3JTZ A;  1PKP A;  1T4N A;  4ZVI A;  4F9B B;  2VQF I;  2UU9 I;  1H7S A;  5T6J A;  2NA2 A;  1Z59 A;  4LF7 I;  5BR8 E;  4LF5 E;  2O1T A;  2MDR A;  1NZ0 A;  4JI7 I;  4HXZ A;  4DUZ E;  3H09 A;  2FGG A;  1S4E A;  4YY3 I;  1B62 A;  2JR1 A;  2FV4 B;  2UUB I;  3K17 A;  3Q6N A;  4LF8 I;  3KWR A;  4X8W A;  4WFT A;  4DMI A;  3LLH A;  4DR6 E;  4JI2 I;  2CG9 A;  2HFS A;  1ZM9 A;  2MC6 A;  3ZZU A;  3VYX A;  4P78 A;  2DMY A;  2UXC E;  1OJ4 A;  4X66 E;  2UXB I;  4F9A B;  3J7A M;  1Z5A A;  3JAM C;  1A6F A;  2X7I A;  2LRS A;  3ZKB A;  3HPS A;  4KZS A;  2RS7 A;  2PNL A;  3ZM7 A;  2NUE A;  1DAR A;  1SR9 A;  1Z0B A;  2E5L I;  4DR3 I;  2LMZ A;  1UIL A;  2Z5C A;  3QT6 A;  2V83 A;  4B3S I;  3D4J A;  4P7D A;  1N33 E;  3T1H I;  4DR2 I;  2KOU A;  3J81 Q;  4WSP A;  2V86 A;  4X65 I;  3AV0 A;  4JYA E;  3IWC A;  3ZKD A;  4JG4 A;  4JI4 E;  1FWK A;  4DUY I;  1UEK A;  2WW4 A;  4HY1 A;  4DR5 I;  1PIE A;  4RPF A;  1T4O A;  1Z0G A;  4GKJ I;  5IWA E;  4PRV A;  1Z5B A;  4BMJ A;  2AJ4 A;  2NPF A;  2VQE E;  2O1W A;  2LTR A;  2JWO A;  1ZM4 A;  2V8Q B;  4URL A;  2XEX A;  4ED4 A;  1UHZ A;  2E1M A;  4JI6 E;  1HNW E;  4WUC A;  1Z0E A;  3V2U C;  2A2C A;  4DPX A;  1YYW A;  1IBK I;  1FKA E;  4OX9 E;  3QT5 A;  3WU3 A;  2LUQ A;  1STU A;  1O0W A;  2Q2E B;  2YT4 A;  3PYE A;  3RMP A;  2UXB E;  5LMN I;  3HJC A;  2UXD I;  4M0V A;  4LF4 I;  2X36 A;  2E5L E;  2B3T B;  1Y4U A;  2HHH I;  4IZK A;  2ODR C;  1FJG E;  4Q28 A;  4B3S E;  2VF1 A;  1J5E I;  5IT9 C;  4YHH E;  4DV4 E;  4LFA E;  4JV5 I;  3DJW A;  4X65 E;  1IBL E;  4WPY A;  2EWL A;  4M30 A;  2O1U A;  3VYY A;  4DV2 I;  4WUB A;  4R8O A;  1YZ9 A;  1ZBQ A;  4JI4 I;  2H36 X;  2VE7 C;  5A2Q Q;  1XNQ E;  3AUZ A;  4DR5 E;  4AQY I;  4GKJ E;  1VIS A;  4DXL A;  4DU8 A;  3OTO E;  4NXN I;  3P1X A;  2IOQ A;  2VQE I;  2L6M A;  2OI2 A;  1USU A;  1N0U A;  4LU9 A;  4R03 A;  2B7T A;  1K47 A;  3T1Y E;  1HNW I;  3F6G A;  4Z7C A;  1H72 C;  4DR7 E;  4LF6 E;  1USV A;  2LJH A;  2V2V A;  1KIJ A;  2ODR D;  4GEQ B;  4DR4 I;  1YYK A;  1Z0C A;  3PRY A;  1HR0 E;  2V2Z A;  2Z5B A;  4MYU A;  4USM A;  5FWK A;  2R3V A;  3JU0 A;  1GZ6 A;  4LF9 E;  2V87 A;  3C4B A;  4L5N C;  4B3R I;  1XMQ I;  1N34 E;  2YZT A;  1N32 E;  1XNR I;  1QZR A;  2V88 A;  4TUI A;  4TUG A;  1RQ0 A;  4WUD A;  3K85 A;  1X49 A;  2VQF E;  3WU6 A;  5ADZ A;  2UU9 E;  4DV4 I;  4LFA I;  4JV5 E;  2R42 A;  1IBL I;  3ADI A;  2V34 A;  4R1F A;  5AE1 A;  1HK7 A;  1D6T A;  4LF5 I;  4JI0 E;  4DV7 I;  2DSY A;  4KQV A;  1Z0V A;  4EMD A;  4NXM E;  2L3C A;  3K6Q A;  2JVA A;  2LJP A;  3J80 C;  4I8O A;  2V89 A;  1ZM3 A;  3LNU A;  2RSM A;  2ZBK B;  4IZJ A;  2O1V A;  2Z5C B;  4DR6 I;  4JI2 E;  4DV6 E;  4JI1 E;  2J7K A;  3M6A A;  4Z7Y A;  2F8B A;  1ZM2 A;  5LMU I;  4JI5 E;  1ELO A;  5FLX Q;  2RS6 A;  1NHJ A;  1MG7 A;  1RR9 A;  2GQ0 A;  3HXL A;  4DV1 E;  2MC5 A;  3HTX A;  1HR0 I;  4GKK I;  1WHN A;  4M1K A;  1N0V C;  1EKZ A;  2BM1 A;  4X66 I;  2RTX A;  3IWB A;  4M2Z A;  4LF9 I;  4DU7 A;  5LL6 R;  5GMD A;  3HUL A;  3ZOQ B;  1HNZ I;  1Y6Z A;  3T1H E;  1N33 I;  4LFB E;  4DR2 E;  1KKH A;  2E1R A;  1Z5C A;  4JI8 I;  2JOX A;  1H73 A;  2HK2 A;  2KHX A;  3C4T A;  1XMO E;  5AE2 A;  4DV5 E;  4JYA I;  4JI3 I;  2G7H A;  3J7A G;  4X64 E;  3WU4 A;  4JI0 I;  3J80 Q;  4DV7 E;  4DUY E;  3PYF A;  4XTJ A;  4NXM I;  1FNM A;  2GS8 A;  3PYD A;  5L3J A;  4F9C B;  4UT4 A;  2N3G A;  3OML A;  2EZ6 A;  4LFC I;  2V8P A;  3ADG A;  4B3T E;  4IZK B;  3WU5 A;  4DR1 E;  4DV6 I;  2M7Q A;  5LMU E;  2L2K B;  1IBK E;  2NUG A;  4UTG A;  4JI5 I;  4DPW A;  3FIG A;  4J8Z A;  4X62 E;  2JY9 A;  4DV1 I;  3Q6M A;  3QT8 A;  1HNX I;  4KHP E;  2F4V E;  5LMN E;  1WXR A;  2UXD E;  5A2Q C;  1T4L B;  4MYT A;  2HHH E;  1PVG A;  1EA6 A;  3ZZ0 A;  1HNZ E;  1H7U A;  1XHK A;  2A2D A;  2HKJ A;  1Y4S A;  1X47 A;  4LFB I;  1J5E E;  4FN5 A;  2ZIT A;  4L8N A;  3MSW A;  1B63 A;  2JOB A;  4FWG A;  4N3O A;  1ZXN A;  3P06 A;  4DV2 E;  4FWH A;  5BR8 I;  4JI3 E;  2L92 A;  4X64 I;  4FWD A;  1XNQ I;  2UUA E;  4K0K E;  4F54 A;  3DF6 A;  2L2M A;  2BV3 A;  2IOP A;  1DI2 A;  2HFU A;  4P7A A;  2UUB E;  1N36 E;  1J26 A;  3V5R A;  4LF8 E;  3IWD A;  4DV3 E;  2CPN A;  4B3T I;  3T1Y I;  4P52 A;  1EI1 A;  1ZXM A;  5IT9 Q;  4DR1 I;  4LF6 I;  4B3M E;  1GQE A;  2WZO A;  2K4V A;  1FWL A;  4DR4 E;  2IHR 1;  4BC7 A;  5AE3 A;  2CZ9 A;  1NHH A;  3HQ1 A;  2UXC I;  2PNM A;  2F4V I;  2L2N A;  3B82 A;  1BKN A;  1RRE A;  3QT7 A;  2ZM6 I;  2V85 A;  2DEJ A;  3LML A;  3ZZT A;  1XMQ E;  1XNR E;  1N32 I;  4OOG C;  5FLX C;  4I3H A;  1QU6 A;  4IZJ D;  2UUC I;  2LE2 A;  3K1J A;  1Z0W A;  2L33 A;  2HKE A;  1RC7 A;  2EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...