1XMQQ

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmqQ00
3HOVG 1UE5A 4LF4Q 2MNAA 1NMFA 3TREA 1I94Q 4DR1Q 4IFDI 1VQ4A 2RHSB 3TS2A 4POFA 3K7UC 3T1YQ 2OQ0A 2JA7H 1Q46A 1OXUA 3J80i 3CCQA 2QA4A 5M5YH 1VQ7A 4OWWB 1B8AA 2GVAA 2JE6I 4AYBG 1YZ6A 3CCJA 2ZJPA 1CSQA 1VQHA 4DR3L 1IBLL 2ZJQA 3KLWA 3M3YH 3S1MH 1I94L 2R7DA 2Z6KC 4MZ9A 5JJLA 1A0IA 2CFMA 3JC66 1WYDA 4J15A 1SRUA 4KHZA 1XNRQ 3S1QH 5GAEC 1PVOA 5LMNQ 1Q12A 1I50H 1TWGH 3T1YL 3H0GG 1E7ZA 5C0XI 3E9HA 4A3LH 2D62A 3M85A 4JYAL 4AQYL 1A63A 4JI4L 3T1HL 2R7ZG 3I55A 1MKHA 2K5NA 3PCOB 4OO1I 3CCMA 4IOAA 2PMZE 1E1TA 1VQCA 2YTYA 4JCVE 3RN2A 3HKSA 1HNXQ 3E0EA 1WCMG 2AWOA 2GVBA 2WB1E 4JI3L 2AKWB 4BXXG 3PV0A 5M3FH 2EIFA 3AFPA 4GLAC 3SGIA 4DK3C 4HJ5A 4BY7H 4A3GH 1X3GA 5C3EG 4P71A 3RZDH 1YI2A 4UP8A 4GKKQ 3OYYA 4IFDG 4NXML 2UXDQ 4YWLA 3KF6A 1YHAA 3S1RH 3M9BA 3GDEA 3AQQA 3I4NH 2Y0SG 3G48A 3AYHB 5C44G 2Q2UA 4LWCA 1XNQL 4A93G 5HGQA 2UUCL 3M4OH 2HIXA 2DUDA 4HIKA 4BA1I 3RLFA 1K0RA 3KF6B 1YITA 4JI0L 2UUBQ 2I5HA 4RMFA 3BZCA 3U4ZA 1HZBA 4LF7L 3HOWH 1XMOQ 1E1OA 2NN6I 4LUVA 4A3DG 4X62Q 1KXLA 1TWHH 1Z47A 1Y1WG 3D31A 3TRZA 1PH6A 4DUYQ 4OWXB 2NZHA 1QZGA 2OCEA 1EYGA 3NENA 3CMAA 1K73C 4HIMA 4KI0A 4AQYQ 1VQFA 2ZM6Q 4JI4Q 3I2ZA 4X62L 1B7YB 3HOUH 2B63G 1E3PA 1YHBA 3L0OA 4DV1L 1PH2A 4GNXA 3GTQH 3I4MG 2JA5H 2F3IA 1K8AC 1M90C 1N36L 3LGJA 1HZCA 2D0PA 1OXTA 4A3MH 1PYSB 5IYCH 1JMCA 2PQAA 3KJOA 4DAMA 1Q1BA 5IP9G 2KHIA 2ZM6L 1Q86C 1JB7A 1YJNA 1MIUA 2Y0SE 1TWAH 3I4NG 1IL2A 4NXNQ 3NEMA 1VCIA 4FDBA 1PV4A 5C4JH 2I0QA 4OO1G 3CQZH 1KAWA 4JBJA 3U50C 3H15A 1QZHA 3PIOA 3S16H 4LFCQ 1VQ6A 3CC4A 2K50A 2NZOA 3BJUA 1GVPA 2JQOA 2YYZA 2RHQB 4LNQA 4X6AH 1PH5A 3WWVA 5AJ3Q 2IHFA 1LTLA 1CKNB 4OONA 4EX5A 4QQBX 1N34Q 3J81c 2NVYH 3JAMi 1XJVA 2KENA 3CC2A 4R4QA 2E2IH 4DNIA 1I3QH 4JI6Q 4LFAL 5BR8Q 3J7A5 4BBSH 2NVQH 1PHJA 2ZTEA 5GAGC 1EIYB 2OWOA 3W5OA 4QGUA 3H3VI 1XTDA 1GD7A 3I7FA 3PO3G 2BH2A 4YWMA 4GOPA 1OXVA 2N78A 1YHQA 2UXBL 2XTIA 4WJ3M 3F8TA 3TEHB 5JEAG 5IWAQ 1JJGA 5M3FG 4IO9A 3STBD 1S72A 4NXMQ 2D0OA 3L7ZC 3HOYG 2I5LX 3K0XA 4B3RQ 1X56A 1DGSA 2JEBI 2N3SA 3PUWA 2NVXH 2R92G 4KHPQ 4LW1A 3CMEA 2RF4A 4JI1L 1CKMA 3BU2A 4R4OA 5FJ8G 3K7AH 3U58A 2B29A 4XTCS 1YBYA 1HNWQ 1PH8A 2ASBA 5C4XG 4L5TA 1N36Q 2OTJA 2K5VA 1V9PA 4JI0Q 2UXBQ 3PUVA 3HKZG 4LF7Q 1EFWA 2UUAL 3M7NA 1RIPA 1S40A 4JI5Q 2VY3A 1JE5A 3FP9A 1VQIA 3J81i 4WJ4A 4MTNA 3JAMc 4BBRG 2WAQE 4A3EH 1QVFA 4A3FH 2CWAA 4JV5L 1X54A 4DPGA 5EAYA 2NVTH 4HJAA 2LXKA 3UDFA 1VQEA 3KYHC 2QEXA 1PA6A 2R7ZH 2RCNA 4OX9Q 3RN5A 2QGQA 1KD1C 2CQOA 3CCVA 3F2CA 1QVGA 4DR4Q 2AMCB 4KLKA 4JI5L 2BA1A 4GOPC 3PF4A 1IBLQ 1WFQA 1M1KC 1QUQB 2IHEA 4X65L 4JI6L 5IP9H 1KL9A 1X9NA 4JV5Q 2BA0A 1I6HH 4C3JH 5IY0A 4DV0L 1KRTA 2MO0A 4LF9Q 2KCTA 3F1ZA 1CUKA 1L1OC 1TWCH 4NXNL 3KJPA 2E8GA 2JA7G 1PYBA 2MQHA 1N33L 1JT8A 3MXNB 1K9MC 4JI7L 1CKNA 4HIDA 3H3VH 4LFCL 3A5UA 4LUOA 2K5HA 3K80C 2Z0SA 4A3CG 4LF9L 2R7FA 4BA2I 2WB1G 3CP0A 3RLOA 2WFWA 2JJQA 1OTCA 5AJ3L 1H95A 2VQEQ 3EIVA 5GAHC 3A74A 4BBRH 5JJIA 5C44H 1N34L 4A93H 1U5KA 2UUAQ 3H0GH 5DLQE 4Y7NH 1LM0A 4LFBQ 4YHHQ 4LFAQ 2PQAB 1PH3A 1HR0W 1JJ2A 1X3FA 5IE8A 3HFZB 4QJFA 4LF5L 1N9WA 1TXYA 4GLXA 4JOIC 1Q81C 4HJ9A 3S1NH 1WJJA 4QL5A 1J5EL 2UUBL 1D8LA 4GKJL 1O7IA 2Q2IA 4DKAC 4YWKA 1BKBA 2OQKA 5FLXc 2ZTDA 4B3SL 4L5RC 1XMOL 1YIJA 3CW2C 4DK6C 1NTGA 1L0WA 3UE0A 1K3RA 5E7NA 1NJIC 2JA5G 1RL2A 4JI1Q 4PMWA 3K8AA 3GTPH 1UEBA 1HZAA 1Z9FA 4X65Q 3OTOL 1YJ9A 2VS1A 4NB3A 4PG3A 5ELOA 5J3BA 4DUZQ 1AH9A 4ALPA 4P75A 2K75A 1E24A 3UDXA 2PI2A 5ELNA 4DV7L 4B3SQ 2KCMA 1Q8KA 2CWPA 1IBKQ 3I4MH 3S17H 1YNXA 5LMNW 4A3IG 4GNXC 1V43A 2PNHA 1HZ9A 3J81j 3OTOQ 3I56A 1KQSA 2OTLA 3GTLH 2BH8A 2E2HH 4A3DH 1HNZL 1VQJA 1Q82C 1VQAA 3Q8DA 4C3IH 5LMUL 4TVAB 4A3BG 4LF8L 1FVIA 3PIPA 3CPFA 2JA6G 5JJKA 1G6PA 1PH4A 1VQDA 4DR7L 4OXPA 1R9TH 3L2PA 2UXCQ 1HH2P 3S14H 1C7YA 1U0LA 2VZAA 1AE2A 3CPWA 1XPOA 2ID0A 3RZOH 1OXXK 4X64L 4OWTB 5IYDG 2ZJRA 1ASYA 1J5EQ 3AFQA 4JI8L 2K14A 3GO5A 4GN3B 4X66Q 1WCMH 1D7QA 2NN6G 4MNOA 1P8LA 2LXJA 4XIGS 2UXCL 1VQBA 1N8RC 3IRBA 4PZ8A 1IZ6A 1VQLA 3ICEA 3TS0A 4DAYB 5C0XJ 4X64Q 4DV6L 2R92H 3S24A 4L5QA 4JI8Q 3NBHB 1XPRA 3CCEA 3ER0A 1Y1WH 1PH7A 3CF5A 3PO2G 2JA9A 4KHPL 4A3FG 4HJ8A 3GTOH 2CKZB 4LFBL 4DR5L 4ME3A 1EQQA 1PFSA 4R4IA 1NE3A 1W3SA 2LSSA 1JJCB 2HQLA 4LF5Q 1VQGA 1FL0A 4GLVB 1HNZQ 1QVCA 2XGTA 4H02A 4DV3L 3HOUG 3NELA 4R1JA 3S2HH 4GKJQ 5LMUQ 4B3MQ 2WP8J 4IPCA 2VQFQ 4GNXB 1UE7A 3HKZE 3CAMA 2VL6A 5IYBH 3PF5A 4JBMA 3HOZH 4DR5Q 3CCUA 2VNUD 2I5MX 1A62A 1X65A 3MEFA 2C35B 5K36G 4DR3Q 2PI2E 1LUZA 3M4QA 3PUZA 1Q7YC 2F4VQ 2V1CC 3HOYH 1VQOA 2WAQG 4DUZL 4O0AA 4A3JG 1P16A 1WOCA 2ALYB 2Z6KA 4PZ6A 3UDGA 1FJGQ 3J80c 5GQOA 3PUXA 4A3IH 2HT1A 4OX9L 5LMNL 3PSIA 4B3ML 1GO3E 2VQFL 2UU9L 2B63H 1E22A 4DR4L 3UDIA 5IP7H 4X66L 4DV4Q 3GTKH 2YU9H 3T1HQ 1WI5A 1L1OA 2Q2HA 4IPGA 2Q2TA 3A5ZB 1YVCA 1FGUA 4TQUS 5GROA 2FXQA 1KHIA 3KDFB 4JC0A 2JEAI 4A3BH 4A3LG 3G6EA 1BVSA 5IYCG 2JK8A 1SROA 3CC7A 4DV0Q 4GN5A 1IXRA 1HNXL 1ASZA 4UP9A 4A3EG 4B3TL 4P73A 4R4CA 4P72A 3EBEA 2YTVA 1X6OA 4C3HH 1GM5A 2R93G 3KF8B 4DV2Q 2AHOB 4A75A 3E9IA 5M5XH 3HOXG 1L2FA 2HHHL 3RLNA 1N33Q 4RG1A 4DR7Q 4JI7Q 2UXDL 4GOPB 2MO1A 1PH1A 1X55A 2H5XA 2R6GA 2KHJA 3PGZA 1T9HA 4YCVA 1XMQL 4YCUA 3STBC 1EQRA 5M3MH 1XNQQ 4JG2A 3S15H 4L5SA 1CSPA 3HOXH 4UP7A 3PUYA 1EWIA 2VQEL 1K8GA 3A0JA 2CCZA 1XPUA 1YJWA 4HIOA 4IJHA 4BXXH 1VQ9A 1UWVA 1VQPA 2YTXA 3CCLA 1I5FA 4QY7A 2HHHQ 4JYAQ 4BY1H 1SLJA 4YHHL 3OW2A 4IFDJ 1Y14B 4YCWA 2MFIA 2VW9A 2VUMH 3GTGH 4LF4L 5IT9c 3ULPA 3D0FA 2F4VL 2AWNA 3ZJYC 1SMXA 4DV6Q 1SR3A 1VQNA 1FJGL 4GS3A 4NPSA 3KDFA 3DLLA 1CKOA 4DR2Q 4DUYL 1TWFH 1NMGA 2UU9Q 1C0AA 2A19A 2YV5A 1G291 3K81C 1X3EA 4DV4L 4POGA 2E5LQ 1G51A 1PH9A 4UPAA 2A8VA 2ATWA 1MJCA 1VQ5A 4LF6Q 3G4SA 4R4TA 4A3KG 3GTMH 3HOWG 1NY4A 4DV1Q 2IX1A 1BBUA 4P74A 2R93H 4UY8C 1HR0L 1XNRL 4DV3Q 4LUZA 3CCRA 3CCSA 4DR2L 1L1OB 4QIWE 2JA6H 4DR6Q 2ZTCA 3W1GA 3ULLA 1QUQA 1Q1EA 2B3GA 4DV7Q 3U4VA 3W1BA 1B70B 2K4KA 4JBWA 5C0XG 3GD7A 4C2MH 4DV2L 1IBKL 4JI2L 1S3OA 2EXDA 1IBML 1KC8C 4YY3Q 4A76A 1VQ8A 5H1SE 3S2DH 4GN4B 4A3MG 2IY5B 3J7ZC 4IPDA 4IJLA 5M5WH 2DGYA 4DV5Q 2L15A 5IP7G 5IYBG 1MJEA 3HOZG 4DR1L 1HR0Q 5C3EH 4DR6L 4K0KQ 1IYJB 4BY1G 3CXCA 3UE1A 2E2JH 1VS0A 2EQSA 4LF8Q 4A3JH 4HJ7A 1KRSA 2N8NA 4JI2Q 1N32L 5GADC 4JOIA 3CD6A 4YY3L 4BY7G 4APVA 5FLMH 4PZ7A 5IYDH 4O2DA 2GN5A 5C4XH 4DV5L 1VQKA 3AEVA 1A8VA 3VDYA 5BR8L 3I4OA 4AYBE 4IPHA 3TQYA 1Y1VG 2JA8H 4AIMA 2UUCQ 4B3TQ 4Y52H 4K0KL 1KIXA 3KOJA 5FLMG 1UE1A 3GTJH 1EUJA 1N32Q 3ULJA 5M3MG 3F2BA 4A3KH 5IWAL 2HIVA 2IT1A 3DM3A 3M4PA 4A3CH 1VQMA 1W2BA 2E5LL 1Y1VH 2JA8G 1V1QA 3PO3H 4B3RL 1OXSC 4LF6L 3EN2A 2F52A 3FKIH 2K52A 1NBWA 1GKHA 1UE6A 3RR5A 4AH6A 3B6YA 3G71A 1XMQQ 4IOCA 2ES2A 4JBKA 1EOVA 5HY6A 3BZKA 1C9OA 1YEZA 4JI3Q 3PO2H 1SFOH 1HNWL 1SN8A 1AE3A 3FHWA 2IX0A 3HOVH 1SE8A 4BBSG 1LYLA 3ERSX 2VUMG 3KFUA 5FJ8H 4A4IA 1BBWA 4EQ5A 2A1AA 3FKIG 2N49A 2KBNA 4GKKL 1K83H 3RNUA 1J6QA 5JEAJ 1IBMQ 3F2DA 4A3GG 1EIFA 1HJPA
chains in the Genus database with same CATH superfamily
1UE5A 4LF4Q 3K7AB 5IGGA 1SJED 3K7UC 1EY7A 1CM9A 4RCOA 1OXUA 3BVMA 1TS2A 1B8AA 1UUPA 2GVAA 2EZVA 3ERQA 5C3WA 3CCJA 2LS01 1CSQA 4DR3L 2A6HC 2KHSA 4KY7A 1IBLL 2A6HD 1SYEA 3M3YH 1EEID 4C3HG 2CFMA 1BCPC 1ESRA 1WYDA 4KHZA 3SE0A 5E1FA 4PMCA 1JWMD 3H0GG 4QF4A 1S5ED 2F0HA 2NVXB 2R7ZG 2K5NA 3PCOB 1DOMA 1J9OA 1E1TA 2B2VA 1HNXQ 3DM1A 2WB1E 1B3QA 1LABA 1STGA 1Y8NB 4ID6A 4MTKA 3SK6A 4BY7H 3HG9A 2KCNA 3NP8A 3IKJA 1CFMA 2ENBA 3KF6A 1YHAA 3S1RH 2EE1A 1A2TA 1B1ZA 3AQQA 3M9BA 1XNQL 4A93G 3SVMA 3MEHA 1I4XA 4HMJA 1IKLA 4C3HB 1K0RA 1I4GA 4KTAA 4KKSA 2OT2A 3T4AC 4ZUJA 1A3TA 2B2UC 1BNZA 5AFWA 5EBDA 4G7OC 3P75A 1I4QA 2DY7A 1O7YA 3D31A 1PH6A 4DUYQ 4OWXB 2OCEA 2L1BA 4HIMA 2IJ0A 1VQFA 4FXGC 4TKOB 2XRQD 4X3TA 4JI4Q 3HOUH 1E3PA 1NSNS 3L0OA 5CV8A 2JA5H 3FRPB 2K05A 1M90C 1HZCA 4BBRB 4EQOA 5IYCH 2PQAA 1Q1BA 3HGBA 3FDTA 3I4NG 2Y0SE 1CA6A 2G5DA 3U50C 2JA7B 3H15A 3OSOA 3LWUA 2C5CA 1A15A 2YYZA 3KLRA 4P2CB 5AJ3Q 3K5MA 4OONA 4EX5A 1XJVA 4DNIA 1I3QH 3GV3A 1V1PB 4BBSH 1EIYB 2F0VA 3RZOB 3I7FA 3PO3G 1Y8PB 1OXVA 2N78A 4GOPA 1JJGA 1ESFA 4RWSC 1SMYC 3HOYG 1I6HH 2R92G 4KHPQ 1KNAA 2N3SA 3KF8A 4F8MA 2NVXH 3CMEA 1PLFA 4HN7A 1CKMA 3BU2A 4R4OA 5FJ8G 2B29A 2NB0A 1YBYA 2OTJA 3X3MA 3Q23A 2K5DA 5FO9B 4JI0Q 4CKEA 4LF7Q 4DAYA 3M7NA 5G3LD 4JI5Q 3FP9A 1VQIA 3DWPA 5I9OA 3TN2A 1LT3D 4A3FH 2L5TA 1LTTD 4RGTA 4DPGA 5EAYA 1D5MC 2O4XA 1IHZA 3UDFA 2B2TA 2PMZB 3S14B 3K5NA 2AMCB 2DJFC 4JI5L 2BA1A 5ELCA 3X3NA 4JI6L 4A3JB 1DCZA 1BO0A 3S16B 2RA4A 4BY7B 5M5WB 1CUKA 1CHPD 1PFBA 1TWCH 2EVBA 3KJPA 1EY5A 5C3EB 2MQHA 3MXNB 2RBMA 3R2TA 2HQEA 1TQOA 2L11A 3FMCA 4LFCL 2R7ZB 4DAPA 4BA2I 1PDQA 2AUKA 3CP0A 2WFWA 2VQEQ 3EIVA 4N9PA 5C44H 1N34L 2F0TA 2QF7A 4Y7NH 4LFBQ 1TIID 4YHHQ 2PQAB 1JJ2A 3E0JA 1TXYA 4JOIC 2KQ3A 4GKJL 2E2IB 4YWKA 5K36H 1XMOL 1JWUD 1L0WA 4BY1B 4JI1Q 3K8AA 1Z9FA 5KYIA 2FHTA 5JVG3 4Q5VA 2NBFA 2F0DA 4IN3A 3M4YA 5ELOA 4DUZQ 2L4NA 5J3BA 1X3PA 4ALPA 4P75A 4RKBA 3UDXA 2PI2A 5ELNA 2E75C 2KCMA 1Q8KA 1BCPD 2L0CA 2Y0SB 3URYA 1EY4A 1O7ZA 2PNHA 1KQSA 4JPBW 1BCPB 2BH8A 2F0QA 2BDNA 1WTVA 2WV6D 1VQAA 2MJ8A 3Q8DA 4C56C 2EYFA 4TVAB 4LF8L 1HRJA 1FNWA 1FVIA 4R8NA 5A2QE 3PIPA 1G6PA 1PH4A 4DR7L 2F0JA 3DXJC 3QOJA 4J6HA 1G2SA 3L2PA 4OEMB 4IQZA 3S14H 2VZAA 1PTOC 4HCSA 3CPWA 2ID0A 1SE2A 5JEAH 1L0XB 1ZYRD 5CMDA 3QJYA 4ILWA 3OWEB 1STAA 3ICEA 3NBHB 3V05A 4OGQC 1NR2A 1Y1WH 1PH7A 3LWEA 3PO2G 1S5DD 1HTPA 3W2DA 4A3FG 5D3IB 2CKZB 4Z9CB 3ONAB 1EQQA 4A3EB 3GTPB 5ELFA 1VQGA 5C44B 2QW7A 4H02A 3NELA 2QDLA 4B3MQ 2WP8J 2VQFQ 1WVLA 2F0EA 3TZDA 3MAQA 3BDOA 5IYBH 3CCUA 2VNUD 2PZTA 2I5MX 2K5QA 1X65A 1S5CD 3PUZA 2F4VQ 3HOYH 1VQOA 5IODA 3BVZA 1WOCA 1R4QB 2Z6KA 3LX0A 2RDHA 4KN4C 5GQOA 3PUXA 2QEJC 1HUNA 4OX9L 4B3ML 2VQFL 1JORA 4X66L 2D5DA 1K8MA 2YU9H 1V1OA 1A3UA 4IPGA 2Q2HA 2F4IA 3A5ZB 4TQUS 1KHIA 4JC0A 2JEAI 2O5JC 3G6EA 2XWJB 1ASZA 1I4HA 1PZJD 4FF4A 2YTVA 3MC0B 3N52A 1GM5A 3OHXC 2R93G 1EU3A 4WRDA 5CV9A 3MXUA 4C1NK 2HHHL 1K0SA 5T1GA 4JI7Q 1ZKOA 3PMFA 4HCEA 4IFDH 3STBC 1EQRA 4JG2A 1LT5D 5KEEA 1ZYRC 5E4WC 1EWHA 3TMEA 2CCZA 2CQAA 1A2UA 4BXXH 2YTXA 4X3SA 1I5FA 3TBIB 2HHHQ 3R2IA 1F2LA 3OW2A 2CW0C 3GTGH 2F0KA 1LV9A 4LJZC 1E2WA 3HOVB 2B2YA 1SMXA 4DV6Q 1VQNA 3VYSA 2VXWA 1CKOA 4IUUA 2UU9Q 4DXGA 1FNUA 1EIGA 2QKIC 1DOLA 5EQ0A 5CYUA 4Q0FA 1D1KA 3K5LA 4CGYB 4DV3Q 4LUZA 4HMIA 4ZCKA 2LKVA 2ZTCA 1C4QA 5C0XG 3GTJB 1WTXA 2P5ZX 4YY3Q 3IL8A 2PNRC 4A3MG 2Z8LA 2O5IC 3I70A 2L15A 5IP7G 1MJEA 1SYDA 4BY1G 1HXYD 2EQSA 2ZT9C 5GADC 3SEBA 4YY3L 3Q24A 4APVA 1GJXA 4PZ7A 5M5XB 3J7AV 2GN5A 5C4XH 1JWSD 3IFDA 3BDLA 1BBXC 3TQYA 5HGTA 1SMYD 4AIMA 4Y52H 1X32A 3S15B 1SEBD 2MGSA 3F2BA 3NBHA 1W2BA 3PO3H 3GTKB 4HR7B 4LF6L 2K52A 3G71A 3BG3A 2ES2A 2NVTH 3HS0C 1M4VA 4JBKA 5HY6A 2Q8RE 3V96A 1BOSA 1EZ8A 1SFOH 1SN8A 1AE3A 1V1PA 2IX0A 3HOVH 1ILPA 1LYLA 2VUMG 3I73A 5FJ8H 4A4IA 2A1AA 3SHLA 4UHVA 2Z1CA 3MFGA 4C3JG 2B2WA 1EIFA 1HJPA 1AP0A 2MNAA 1NMFA 1I94Q 4DR1Q 3I8ZA 1XXGA 2XWBB 1VQ4A 2RHSB 4OHJA 3BS1A 1FD7D 4XQNA 3O13A 1D6EC 2JA7H 3J80i 1VQ7A 1QE6A 2JE6I 2BOSA 4AYBG 4C2MB 3NK9A 2ZJPA 1VQHA 3QG1A 3KLWA 3DMUA 3S1MH 1I94L 2OF1A 2Z6KC 1SNDA 1XNRQ 4J15A 1B4OA 1SRUA 1Z6HA 3S1QH 5LMNQ 4QIWB 1I50H 2EY5A 3TSSA 5C0XI 3E9HA 3I91A 2D62A 1PRTC 1HCZA 3Q22A 4CKBA 1MKHA 4OO1I 3BYTB 1MBYA 2ICIA 4JCVE 2BDOA 3HKSA 1WCMG 2AWOA 2GVBA 2JYOA 4JI3L 4RGMA 2AKWB 5JVH3 4BXXG 4DNRB 4DK1A 3S2DB 3AFPA 4IALA 3SGIA 4HJ5A 1PXUA 4RFBA 4P71A 4J8QA 3RZDH 1YI2A 2UXDQ 2AUJD 3QB3A 3I90A 5EKLA 2EOTA 4K14A 3SK5A 5IGEA 3AYHB 3SR1A 4LWCA 2Q8IB 2UUCL 1S5BD 1G8ZD 5EKIA 3KF6B 1YITA 4RMFA 3D4WA 2I07B 1Q3LA 2OXPA 2E2JB 2F0OA 2PW5A 3VR6A 4CDEC 1HA5A 1Z47A 4K5VA 3NTHA 4CHTB 1PTOH 1EU4A 1EYGA 5L37A 1K73C 4KI0A 4N8FA 4OIKA 2A5HA 1STYA 3RMHA 4DV1L 1XTCD 3NHHA 4K6LA 3GTGB 1WTWA 3GTQH 3CRKC 3JAME 1H9JA 3AU7A 3HOWB 1TWFB 1EIHA 3DWAA 1TT2A 2KHIA 3M7GA 1JB7A 2DY8A 4NXNQ 4FDBA 4FP5D 5C4JH 2I0QA 1SNOA 1CZWA 1C48A 2EYOA 3C1EA 2JQOA 4ODGA 4LNQA 3AB9A 3RUZA 5CBAE 3HOUB 1CI3M 1CKNB 1BF4A 2NTSA 4LFAL 2EYJA 5BR8Q 4O1NA 2ZTEA 5GAGC 2OWOA 4QGUA 1CT1D 2UXBL 5IWAQ 2I5LX 3K0XA 4HEDA 4WFN3 3PUWA 3A8KE 4LW1A 2RF4A 2X69A 3L3OC 2KOLA 1TWHB 5CR3A 4H13C 4XTCS 4CJ1B 1HNWQ 1F9RA 2ASBA 2DNEA 1H9SA 2UXBQ 2B63B 3PUVA 1H9KA 5M5YB 1U4RA 3T56B 2AQ2B 1JE5A 4WJ4A 4MTNA 3JAMc 2WAQE 2NUCA 4A3EH 1QVFA 2Z6BA 4J1MA 5E3FA 3DEPA 1X54A 4HJAA 4GZYC 2BE5C 2R7ZH 1VQEA 3KYHC 2BE5D 2QEXA 2RCNA 2CQOA 2F0UA 1KAAA 4UDUC 4DR4Q 1T5XD 4KK7A 4GOPC 3P20A 2EPBA 3CU7A 5A2QL 1QUQB 1U4PA 2IHEA 1KL9A 1W6JA 4C3JH 2H4OA 2MPMA 3HP3A 4IUVA 5IY0A 4DV0L 1KRTA 2MO0A 4ZKBB 1PYWD 2KCTA 3F1ZA 3BDCA 4CBVA 1L1OC 1EFID 3NUCA 2JA7G 1PYBA 1JT8A 5E4XA 4EQPA 3H3VH 3FPUB 1SAPA 3VR4A 3K80C 1I3QB 2Z0SA 4JW0A 3RLOA 5AJ3L 4L63B 4BBRH 2KUMA 3D8GA 3HRZC 4DF7A 5KYLA 3C46A 2BCOA 3H0GH 5D3DA 1VF5C 5DLQE 5DAUA 4M1UB 1PH3A 3EA6A 5KRUA 1X3FA 4QJFA 1HHVA 2HUGA 4HJ9A 1WJJA 4QL5A 2K7VA 2UUBL 1STHA 2F0GA 3HOYB 2Q2IA 2R92B 4M8AA 2NVTB 1D1IA 2ZTDA 5FLXc 4L5RC 3DHQA 3CW2C 3UE0A 3VYUA 1K3RA 5E7NA 1FGBD 1UEAB 5J1ZA 2JA5G 4NP5A 2AQ3B 3TP7A 4K2KA 1CK1A 5I6WA 3H94A 1RD9D 3T51B 3I4MH 3S17H 1TWAB 4C3JB 1HZ9A 3I56A 5JAVA 3C2PA 4RGOS 1HNZL 1VQJA 2R3ZA 5LMUL 4OO1H 1R4PB 2B39A 3CPFA 2JA6G 2C9OA 4KD3A 3I4LA 4U673 2PPBC 2SDFA 1R9TH 2UXCQ 3I72A 1C7YA 1AE2A 1XPOA 3RZOH 2NWGA 5F2DA 5IYDG 2ZJRA 5JJZA 1ASYA 1EY6A 3GO5A 1SJHD 2KECA 1DOKA 1D7QA 4MNOA 2LXJA 3CRLC 1RDPD 3A8IE 2R93B 2UXCL 1V8QA 2A69D 4MN3A 4PZ8A 1O7LA 3TP5A 1VDZA 4ZYSA 3SK8A 3ER0A 3P7JA 1MGSA 3CF5A 3S1NB 2JA9A 4LFBL 4ME3A 1KDAA 4EQNA 1W3SA 2TSSA 5COYA 1QG7A 1BXTA 2PZUA 3HOUG 3K5OA 4GKJQ 5LHY1 1DONA 4GNXB 1GUSA 4K8JA 3HOZH 3PF5A 2AQ1B 4WORA 1A62A 3MEFA 2C35B 5K36G 4DR3Q 5CV5A 1Q7YC 2WAQG 1RF2D 3D6CA 4DUZL 2K6AA 1P16A 4PZ6A 3UDGA 5KNBA 3PSIA 5IGCA 1STBA 5IP7H 2HDMA 3R93A 4DV4Q 2Q2TA 1YVCA 2FXQA 3KDFB 4ME5A 5G3LF 1BVSA 2JK8A 5IT9L 1W6KA 3CC7A 1HNXL 3S1QB 5JOBA 2K32A 4P73A 3EBEA 3KF8B 5C5LA 1SDFA 5I9PA 3E9IA 4QB4A 1L2FA 1N33Q 4DR7Q 4GOPB 3WDNA 1X55A 1T9HA 1XMQL 4YCUA 1CQVA 4L8JA 5CGKA 5M3MH 1XNQQ 3S15H 1TR5A 4UP7A 3PUYA 1EWIA 5LL6X 3EJIA 1JB3A 3A0JA 3VA7A 1JOKA 1UWVA 3BYYB 2J7ZA 1GOZA 1Y14B 2VUMH 2A6EC 4FNFA 5IT9c 1NAPA 3D0FA 2F4VL 1SR3A 4IUNA 3M4OB 4GS3A 4NPSA 3KDFA 4DR2Q 4DUYL 4DGZA 1JE4A 4A3FB 1EWCA 1C0AA 2E5LQ 1PH9A 1VQ5A 3KBXA 1YNNC 4A3KG 3NXWA 1BBUA 3D4RA 2R93H 4UY8C 1HR0L 3CCRA 4DR2L 1L1OB 4QIWE 2WINB 2JA6H 4QMGA 1CA5A 4DR6Q 3ULLA 4DV7Q 1B70B 4JI2L 1IBKL 3GD7A 4JYAQ 2EXDA 4F87A 1KC8C 5H1SE 1VMCA 5IGFA 4HAEA 3R3OA 5IYBG 1HR0Q 5C3EH 3J81L 4DR6L 1F2YA 1GUNA 4ZK9B 5D14A 4JI2Q 4O2DA 3AEVA 1A8VA 2B2TC 1Y1VG 3EROA 2JA8H 2Q8TA 3EFXD 1KIXA 2L12A 1Q90A 5I6YA 5M3MG 3KLSX 1WTHA 3DM3A 3A56A 3M4PA 3VYTA 1VQMA 1FR3A 4XXEA 5TSSA 3K57A 3EN2A 2F52A 4AH6A 1TS4A 3HKZB 4IOCA 1JCKB 4QCLA 1YEZA 1SE8A 3KFUA 4EQ5A 4GKKL 2KBNA 1HUMA 3TDQA 3NQTA 4CDFC 5M3MB 4BY7G 1SE3A 3I3CA 3HOVG 3TREA 5BN3A 5FOBB 4E6IA 4IFDI 1SXTA 3TS2A 3ZYYX 4OL7A 2OQ0A 2A68C 3T1YQ 1Q46A 3CCQA 2QA4A 4OWWB 1Y1VB 4XT3B 2NVYB 1VF7A 1LT6D 1S5FD 2DNCA 4CDDC 2ZJQA 2K5WA 4MZ9A 1AZPA 1A0IA 1X3QA 4OIJA 1B2TA 1D5XC 1RCVD 1TWGH 1EY9A 3T1YL 1R9TB 1E7ZA 4X3UA 1A3VA 4AQYL 1A63A 3T1HL 4XYOA 1MHWC 3E6ZX 3CCMA 4IOAA 2PMZE 1VQCA 2YTYA 1QOHA 2LFNA 5EGTA 3PV0A 2EIFA 4A3GH 4FYDA 1X3GA 4UP8A 5NUCA 4NXML 2XVSA 3QR8A 1PZKD 2NVQB 3GDEA 5C4HA 3I4NH 2Y0SG 3G48A 5C44G 5EBCA 5EKKA 5HGQA 3M4OH 4K2LA 4BS9A 2N55A 3NTKA 4BA1I 3RLFA 2FMCA 2I5HA 3N6RA 3BZCA 3U4ZA 1AZQA 2XN9C 1XMOQ 1E1OA 4A3DG 3NBIA 1TWHH 5DNFA 5KNDA 4XQJA 3TRZA 1Y8OB 5C3XA 5FLXE 1ET6A 2K33A 3NENA 3CMAA 2ZM6Q 1CHQD 1VMPA 1SSOA 1B7YB 2B63G 1G6ZA 4L6TB 1PH2A 1BUVT 3EQLC 4N9TA 4K5XA 1K8AC 3HOZB 1N36L 1RTNA 1KNEA 1PYSB 4RA8A 1JR0D 1JMCA 5I2YA 5IP9G 2ZM6L 1YJNA 1TWAH 1WCMB 1IL2A 1VCIA 1H9SB 1WTRA 2A74C 3PIOA 1QZHA 3CC4A 2K50A 1IW7D 2G9HD 2EYPA 1SYGA 1GVPA 3BJUA 1GUWA 2A73B 3OIPA 3MTSA 2JN4A 3WWVA 3BVGA 1LTLA 2B8FA 3OMCA 3J81c 2A6ED 3I4NB 2NVYH 3JAMi 3CC2A 4R4QA 3J7A5 3CKIB 2F0LA 2OEOA 1PHJA 4G7ZC 3WOFA 3W5OA 3H3VI 1XTDA 2BH2A 1YHQA 2XTIA 3TEHB 3STBD 2FINB 1S72A 3L7ZC 5FLXL 4B3RQ 2JEBI 1DGSA 1MSGA 1KLGD 5C5MA 3K7AH 3U58A 1GUTA 5C4XG 1XX8A 3H91A 3K6OA 1D2BA 1WTPA 1QJOA 3HKZG 4ZAIA 1EFWA 2UUAL 1RIPA 1S40A 1DXMA 3GTQB 3IAYA 2KJXA 1STNA 3NWSA 1SFOB 1GXDC 3F2UA 1PA6A 4OX9Q 2QGQA 1KD1C 3PIP3 3F2CA 4KLKA 3QO2A 4KKTA 1IBLQ 1WFQA 1M1KC 3NWTA 5EPKA 4X65L 5IP9H 4U68A 2BA0A 1EQTA 3HOXB 3ND8A 2PCFB 4LF9Q 2RDGA 1WTQA 2F0FA 3OMGA 3DWQA 3C3LA 4A3GB 1B50A 1IYUA 2EXZA 1LTGD 1AN8A 4NXNL 1HA6A 4JI7L 4HIDA 1EYCA 4X3KA 1EEFD 3U9OA 4LUOA 1PTOF 4A3CG 4RHRA 1U4LA 2CHBD 4LF9L 2WB1G 4NKLA 1OTCA 4YIJA 2KCCA 4RH6A 4A93H 1YNND 3NSWA 1LM0A 1IYVA 3G6JB 4LFAQ 3A54A 1HR0W 5CV4A 5IE8A 5KGUA 4LF5L 1HQRD 4GLXA 4HSVA 1J5EL 1ENCA 1D8LA 2K28A 4DKAC 1BKBA 2OQKA 3K0YA 3GTOB 4AYBB 1ML0D 1NTGA 1XWEA 2Z4IA 4K8IA 4KD4A 3VA5A 1NJIC 3GTPH 1UEBA 1HZAA 1YJ9A 1I4RA 2YU9B 3TP8A 2VS1A 4NB3A 2K75A 1E24A 2B2VC 3J81E 1B3AA 2WIIB 4C1NI 3S2HB 2CWPA 5IGDA 5FK9C 4C3IG 1YNXA 4R8IA 3MHBA 5LMNW 4A3IG 1V43A 3SK4A 3J81j 4ZQ3A 4V190 4IUTA 2A68D 5D65A 1BDOA 2HD3A 2LMCB 4A3BG 3D3RA 4DNTB 2WACA 2SNSA 3JAML 3W3AA 1HH2P 1U0LA 1OXXK 2F0NA 4OWTB 1YNJD 3AFQA 4JI8L 2K14A 1WTOA 2M00A 1WCMH 3V2TA 5M3FB 1P8LA 4XIGS 1RODA 4FF3A 1VQBA 5HURA 1JOOA 3IRBA 1N8RC 1S4ZA 4C3IB 1VQLA 4DAYB 5C0XJ 5ELEA 2XRSD 3S24A 2E74C 4JI8Q 1XPRA 3CCEA 1RJTA 1DJRD 4RAUC 2ZXRA 4KHPL 1Y69U 3PO3B 1TWCB 1PFSA 4R4IA 5C4ZA 1JJCB 2GA4B 2QDBA 1I6VC 4A93B 1FL0A 4GLVB 4IUPA 1QVCA 1HNZQ 1DM0B 2FFKB 5LMUQ 5IT9E 1HFNA 1KTKA 1FYCA 1ILQA 2JA5B 2A69C 5C4XB 3CAMA 2VL6A 4JBMA 1TY0A 2PI2E 1LUZA 2V1CC 4EVOA 3GV6A 5A35A 4O0AA 1ZXTA 2ALYB 1FJGQ 2HT1A 4A3IH 5LMNL 1E22A 3UDIA 2WKDA 1DZ1A 1TKWB 3GTKH 3K58A 2CW0D 3J7AF 3CHBD 5GROA 4A3BH 5IYCG 2RKSA 1SNCA 4GN5A 4RGNA 4A3EG 4B3TL 4R4CA 4C3HH 2SEBD 1EZ6A 4DV2Q 2IL8A 2AHOB 1HQMC 2PYKA 4I7AA 4KJNA 3T16A 5M5XH 3OOCA 3HOXG 4G7HC 3RLNA 2RQXA 3GP7A 2UXDL 2MO1A 3NE5B 1PH1A 4FO2A 1SE4A 3PGZA 1KDBA 2ICEC 2TMPA 2CVRA 2VQEL 1YJWA 4KY5A 4IJHA 2NZ1D 4BBSB 1VQ9A 1VQPA 4ZKCB 3A7AB 3CCLA 3TZUA 2WB1B 4YHHL 5K5PA 4YCWA 4LF4L 1PZID 3GQBA 5ELBA 1CQFA 2IPKD 2A19A 1G291 4DV4L 4POGA 3I4MB 3S17B 1G51A 2ATWA 2SOBA 4UPAA 1E2ZA 1MJCA 3J80E 1BQQT 2F1MA 3G4SA 4QUCA 3GTMH 3HOWG 1NY4A 4DV1Q 1C8CA 1LTID 1HFGA 4B9XA 2LY7A 4JK1C 1RKNA 4WJWA 3W1GA 1TS5A 3S9WA 3W1BA 1S3OA 1IBML 1VQ8A 5IOCA 3J7ZC 2WAQB 3MFYA 4IJLA 1IL8A 4DXFA 3PIO3 3HOZG 4QUFA 4BWGB 1F2ZA 3NQIA 4LF8Q 2EYHA 1KRSA 2N8NA 1N32L 4JVZA 4B9WA 4JOIA 4F7XA 5FLMH 1VQKA 1Z7TA 2ZXPA 2XNAC 1E0BA 5BR8L 4IPHA 1MSHA 4LK1C 1QB5D 2F03A 2EY2A 4RCNA 5FLMG 1UE1A 1ZEQX 3GTJH 1N32Q 1ET9A 5IWAL 2JXMB 2HIVA 3S1RB 2K03A 2E5LL 1Y1VH 2DN8A 1V1QA 2JA8G 1OXSC 4FVMA 1PMRA 1EY8A 3FKIH 1NBWA 1GKHA 3B6YA 1XMQQ 2FJ2A 1LTBD 1LTSD 4A3MB 5LL6S 3TP6A 1C9OA 3PO2H 4A3BB 1HNWL 3FHWA 1F9SA 1ICWA 3E3XA 4ZUIA 3ERSX 1U4MA 1BBWA 2N49A 1DYQA 1TWGB 1SNPA 2G9DA 2B2UA 3WOEA 4OELB 2EDGA 2M9VA 3MWYW 2QCPX 4O42A 4MIUA 1XYIA 1ICFB 1K28A 2MP1A 4POFA 4K5WA 4S3SA 3KUPA 4IZ8A 2VUMB 5M5YH 5FKAC 2QILA 5ELDA 1YZ6A 2EJMA 4IUQA 3DEOA 2ZXOA 2RDFA 2R7DA 5JJLA 3JC66 2EYMA 5GAEC 1PVOA 1Q12A 2HCIA 2PQEA 1NCVA 4A3LH 3M85A 4JYAL 5I2XA 4JI4L 3I55A 2KEDA 5T1IA 3BZDB 3RN2A 4G57A 3CQZB 2F0MA 3E0EA 1ENFA 1O78A 5M3FH 3HEJA 3MA2B 1EY0A 4GLAC 4DK3C 1G2TA 5KIXA 5C3EG 4GKKQ 3OYYA 4IFDG 2F3WA 4UAIA 4YWLA 2D9UA 2MHVA 1Y1WB 1JICA 2Q2UA 2HIXA 2DUDA 3C1FA 4HIKA 2B2YC 1QNKA 3A7LA 4JI0L 2UUBQ 2I46A 1HZBA 4LF7L 3HOWH 4NMZA 3J7YW 1RTOA 2NN6I 3AMUA 4LUVA 1K83B 4X62Q 1KXLA 1II3A 1Y1WG 1TY2A 1B9NA 1SNQA 2NZHA 1QZGA 5CV6A 4AQYQ 1B9MA 3QIAA 3I2ZA 4X62L 3T53B 4ULLA 1YHBA 4DA2A 3MXGA 3VR3A 4GNXA 2F0IA 3I4MG 2F3IA 1YNJC 3LGJA 2D0PA 1OXTA 4A3MH 1F9QA 5ISRA 1MI2A 4FF2A 4NW2A 3KJOA 1PRTF 2RVLA 4DAMA 1Q86C 1MIUA 5BN4A 3NEMA 1PV4A 1SNMA 2L55A 4CJ2C 3NPPA 3CQZH 4OO1G 1KAWA 4JBJA 4KJOA 3S16H 4LFCQ 2NZOA 3H0GB 2FMMA 2RHQB 3OPOA 4X6AH 5EPLA 1A6XA 1PH5A 3S1MB 2IHFA 4QQBX 1N34Q 2K04A 4TSSA 2HDLA 3H09A 2KENA 4JI6Q 2E2IH 5BN5A 4I65A 2Z9HA 2NVQH 1J8IA 2E2DC 4DN4M 1GD7A 4YWMA 3KBGA 3MXNA 4WJ3M 3F8TA 5JEAG 5M3FG 1HTLD 4I7ZC 4IO9A 4NXMQ 2D0OA 1X56A 4JI1L 3A8JE 4PQXA 1F77A 4F88A 1EQVA 3K59A 1PH8A 2JA8B 4L5TA 1N36Q 4PNYA 2K5VA 1F9PA 1V9PA 5I4DA 1IW7C 2JSOA 3L9AX 4A3DB 2E2HB 1WD0A 2E76C 2VY3A 4CKCA 3J81i 3KK7A 4BBRG 4K6DA 1LACA 2WKCA 2CWAA 1AEXA 4JV5L 1UAPA 2VB2X 4XYQA 3SXHA 3G7LA 1PRTB 2LXKA 3RN5A 2XSCA 3CCVA 2KA7A 1QVGA 3PF4A 2X6GA 1MD2D 3H6MA 1FNVA 3HZXA 1TU2B 2DJGC 1X9NA 3ITPA 4JV5Q 1SBBB 4RKLA 2IX3A 4IURA 4A3IB 1ENAA 1EYAA 2E8GA 1N33L 1K9MC 1CKNA 3A5UA 4DK0A 2K5HA 4PV1C 2R7FA 3U9SA 5CC4A 2PW7A 2JJQA 3FKIB 1KDCA 3OIQA 3FPPA 4RHSA 5GAHC 3A74A 5JJIA 1STEA 1T5EA 1QILA 1U5KA 2UUAQ 4DFAA 1F2MA 2VB3X 3J80L 5C4JB 1LO5D 3HFZB 1GUOA 1PTOB 1N9WA 1U9RA 1B44D 1Q81C 3GTLB 3S1NH 3ND9A 3H3VC 2V4DA 1O7IA 1L0YB 4B3SL 1PTOD 4H0LC 1YIJA 4DK6C 4NDXA 2EJGC 1SYFA 2IW3A 1RL2A 4PMWA 3EVQA 4X65Q 3OTOL 2RSOA 2NYZD 5CORA 5FO8B 4PG3A 1O80A 3OW7A 5J22A 1I6HB 1AH9A 1TVXA 4DV7L 4G4KA 2N88A 4B3SQ 1G91A 4B08A 1IBKQ 2F0PA 5C6AA 3Q6SA 4ZRZA 4GNXC 4PMBA 1DD2A 3OTOQ 1JC7A 2SNMA 3KLSA 4KN7C 2OTLA 3GTLH 1JOQA 2K1BA 2E2HH 4A3DH 4FXDA 3E5SA 1Q82C 4C3IH 2M2LA 5JJKA 2EYLA 2Z4HA 4FXKC 1VQDA 5C0XH 4OXPA 4KY6A 3MXPA 3PQIA 1NNXA 4X64L 4H44C 4KV6A 5JPMC 2RCFA 1J5EQ 1GHKA 5M9OA 2O2LD 4GN3B 4X66Q 3QWNA 2NN6G 2L9HA 3LNNA 5FO7B 1IZ6A 4R9WA 3TS0A 4FF1A 4X64Q 1UNSA 2K01A 4KKUA 4DV6L 2R92H 2NN6H 3GTMB 1ONLA 4L5QA 4DAVA 4XDXA 5CV7A 4HJ8A 3GTOH 4DR5L 3T13A 1TS3A 5EPJA 1NE3A 1LLRD 2LSSA 1GHJA 2HQLA 4LF5Q 1QCBD 2PZWA 2XGTA 4H7BA 3VR2A 4DV3L 4R1JA 3S2HH 4IPCA 1UE7A 1BR9A 3Q0AA 4LMQD 3HKZE 4DR5Q 5DEHA 2EY6A 1RHPA 2JP1A 4HTHA 3QOLA 1E2VA 3M4QA 4V0BA 1PFMA 4A3JG 2B8GA 3D6WA 1K3BC 3J80c 2D2CC 1GO3E 5DM73 2UU9L 2B63H 4DR4L 5IGBA 3T1HQ 1WI5A 1L1OA 1LTRD 3IFTA 1FGUA 3M3YB 4A3LG 2EJFC 3NTIA 1EYDA 1SROA 4DV0Q 1IXRA 2J0TD 3MZ5A 4UP9A 2PO4A 4P72A 1LT4D 1X6OA 4A75A 4DU9A 1NUCA 5IIFA 4RG1A 4Y7NB 1CTMA 2EY1A 1CZGA 2RSNA 5J39A 1I4PA 2H5XA 2R6GA 3R8BA 2KHJA 1M8AA 4YCVA 4L5SA 1CSPA 3HOXH 3DUZA 1K8GA 1XPUA 4TRDA 4HIOA 1Q8IA 2F3VA 2KEEA 4QY7A 4BY1H 1SLJA 1PFNA 4A3KB 4IFDJ 1NR4A 5EJWA 2MFIA 2VW9A 4LAAA 3ULPA 2AWNA 3ZJYC 1IKMA 3D4DA 4KMUC 2KVMA 1FJGL 3DLLA 3PO2B 4ABNA 4HSPA 3OWFA 1TWFH 1NMGA 3FVQA 2YV5A 3K81C 1X3EA 3VR5A 2A8VA 1HPCA 4LF6Q 4R4TA 3VYRA 2CH4W 2IX1A 4P74A 1XNRL 3CCSA 2IWHA 1QUQA 1EOTA 1Q1EA 2B3GA 4DV2L 2K4KA 4JBWA 2NTTA 4C2MH 1OO9B 4EGVA 1VQ6A 4A76A 3S2DH 2IY5B 4XQQA 4GN4B 4IPDA 2R61A 3MVVA 1K8OA 5M5WH 2DGYA 4DV5Q 4DR1L 1BCPF 1QNUA 3FEWX 4K0KQ 1IYJB 3CXCA 2E2JH 3UE1A 1VS0A 5DM63 4A3JH 4HJ7A 2B2WC 1WD1A 3CD6A 2CH4A 2H1EA 2HCCA 1AFPA 1D5ZC 4MHEA 4XT1B 1QWYA 4KHVA 2MUYA 5IYDH 1B53A 3SDZA 4DV5L 1H9MA 3VDYA 3I4OA 1SYBA 4AYBE 4N8X1 2JA6B 2F0SA 2X6LA 3RD4A 2UUCQ 4B3TQ 4K0KL 3KOJA 4CJ0B 2F0WA 5KNCA 3RZDB 1AW7A 1EUJA 1GUGA 3ULJA 4A3KH 5JPNC 2IT1A 4A3CH 2XIWA 5CBEE 1KLUD 4B3RL 3P1HA 1KABA 4ZLTF 1EL0A 1H95A 1UE6A 3RR5A 4CDCC 2J4XA 1LTAD 1EOVA 4JI3Q 3BZKA 1PRTD 1H9RA 4BBSG 1JQYD 3A55A 3FKIG 1I50B 1K83H 1SYCA 1J6QA 3RNUA 5JEAJ 1IBMQ 3F2DA 4A3GG 3UI2A 3U4VA
chains in the Genus database with same CATH topology
3HOVG 1UE5A 4LF4Q 2MNAA 1NMFA 3TREA 1I94Q 4DR1Q 4IFDI 1VQ4A 2RHSB 3TS2A 4POFA 3K7UC 3T1YQ 2OQ0A 2JA7H 1Q46A 1OXUA 3J80i 3CCQA 2QA4A 5M5YH 1VQ7A 4OWWB 1B8AA 2GVAA 2JE6I 4AYBG 1YZ6A 3CCJA 2ZJPA 1CSQA 1VQHA 4DR3L 1IBLL 2ZJQA 3KLWA 3M3YH 3S1MH 1I94L 2R7DA 2Z6KC 4MZ9A 5JJLA 1A0IA 2CFMA 3JC66 1WYDA 4J15A 1SRUA 4KHZA 1XNRQ 3S1QH 5GAEC 1PVOA 5LMNQ 1Q12A 1I50H 1TWGH 3T1YL 3H0GG 1E7ZA 5C0XI 3E9HA 4A3LH 2D62A 3M85A 4JYAL 4AQYL 1A63A 4JI4L 3T1HL 2R7ZG 3I55A 1MKHA 2K5NA 3PCOB 4OO1I 3CCMA 4IOAA 2PMZE 1E1TA 1VQCA 2YTYA 4JCVE 3RN2A 3HKSA 1HNXQ 3E0EA 1WCMG 2AWOA 2GVBA 2WB1E 4JI3L 2AKWB 4BXXG 3PV0A 5M3FH 2EIFA 3AFPA 4GLAC 3SGIA 4DK3C 4HJ5A 4BY7H 4A3GH 1X3GA 5C3EG 4P71A 3RZDH 1YI2A 4UP8A 4GKKQ 3OYYA 4IFDG 4NXML 2UXDQ 4YWLA 3KF6A 1YHAA 3S1RH 3M9BA 3GDEA 3AQQA 3I4NH 2Y0SG 3G48A 3AYHB 5C44G 2Q2UA 4LWCA 1XNQL 4A93G 5HGQA 2UUCL 3M4OH 2HIXA 2DUDA 4HIKA 4BA1I 3RLFA 1K0RA 3KF6B 1YITA 4JI0L 2UUBQ 2I5HA 4RMFA 3BZCA 3U4ZA 1HZBA 4LF7L 3HOWH 1XMOQ 1E1OA 2NN6I 4LUVA 4A3DG 4X62Q 1KXLA 1TWHH 1Z47A 1Y1WG 3D31A 3TRZA 1PH6A 4DUYQ 4OWXB 2NZHA 1QZGA 2OCEA 1EYGA 3NENA 3CMAA 1K73C 4HIMA 4KI0A 4AQYQ 1VQFA 2ZM6Q 4JI4Q 3I2ZA 4X62L 1B7YB 3HOUH 2B63G 1E3PA 1YHBA 3L0OA 4DV1L 1PH2A 4GNXA 3GTQH 3I4MG 2JA5H 2F3IA 1K8AC 1M90C 1N36L 3LGJA 1HZCA 2D0PA 1OXTA 4A3MH 1PYSB 5IYCH 1JMCA 2PQAA 3KJOA 4DAMA 1Q1BA 5IP9G 2KHIA 2ZM6L 1Q86C 1JB7A 1YJNA 1MIUA 2Y0SE 1TWAH 3I4NG 1IL2A 4NXNQ 3NEMA 1VCIA 4FDBA 1PV4A 5C4JH 2I0QA 4OO1G 3CQZH 1KAWA 4JBJA 3U50C 3H15A 1QZHA 3PIOA 3S16H 4LFCQ 1VQ6A 3CC4A 2K50A 2NZOA 3BJUA 1GVPA 2JQOA 2YYZA 2RHQB 4LNQA 4X6AH 1PH5A 3WWVA 5AJ3Q 2IHFA 1LTLA 1CKNB 4OONA 4EX5A 4QQBX 1N34Q 3J81c 2NVYH 3JAMi 1XJVA 2KENA 3CC2A 4R4QA 2E2IH 4DNIA 1I3QH 4JI6Q 4LFAL 5BR8Q 3J7A5 4BBSH 2NVQH 1PHJA 2ZTEA 5GAGC 1EIYB 2OWOA 3W5OA 4QGUA 3H3VI 1XTDA 1GD7A 3I7FA 3PO3G 2BH2A 4YWMA 4GOPA 1OXVA 2N78A 1YHQA 2UXBL 2XTIA 4WJ3M 3F8TA 3TEHB 5JEAG 5IWAQ 1JJGA 5M3FG 4IO9A 3STBD 1S72A 4NXMQ 2D0OA 3L7ZC 3HOYG 2I5LX 3K0XA 4B3RQ 1X56A 1DGSA 2JEBI 2N3SA 3PUWA 2NVXH 2R92G 4KHPQ 4LW1A 3CMEA 2RF4A 4JI1L 1CKMA 3BU2A 4R4OA 5FJ8G 3K7AH 3U58A 2B29A 4XTCS 1YBYA 1HNWQ 1PH8A 2ASBA 5C4XG 4L5TA 1N36Q 2OTJA 2K5VA 1V9PA 4JI0Q 2UXBQ 3PUVA 3HKZG 4LF7Q 1EFWA 2UUAL 3M7NA 1RIPA 1S40A 4JI5Q 2VY3A 1JE5A 3FP9A 1VQIA 3J81i 4WJ4A 4MTNA 3JAMc 4BBRG 2WAQE 4A3EH 1QVFA 4A3FH 2CWAA 4JV5L 1X54A 4DPGA 5EAYA 2NVTH 4HJAA 2LXKA 3UDFA 1VQEA 3KYHC 2QEXA 1PA6A 2R7ZH 2RCNA 4OX9Q 3RN5A 2QGQA 1KD1C 2CQOA 3CCVA 3F2CA 1QVGA 4DR4Q 2AMCB 4KLKA 4JI5L 2BA1A 4GOPC 3PF4A 1IBLQ 1WFQA 1M1KC 1QUQB 2IHEA 4X65L 4JI6L 5IP9H 1KL9A 1X9NA 4JV5Q 2BA0A 1I6HH 4C3JH 5IY0A 4DV0L 1KRTA 2MO0A 4LF9Q 2KCTA 3F1ZA 1CUKA 1L1OC 1TWCH 4NXNL 3KJPA 2E8GA 2JA7G 1PYBA 2MQHA 1N33L 1JT8A 3MXNB 1K9MC 4JI7L 1CKNA 4HIDA 3H3VH 4LFCL 3A5UA 4LUOA 2K5HA 3K80C 2Z0SA 4A3CG 4LF9L 2R7FA 4BA2I 2WB1G 3CP0A 3RLOA 2WFWA 2JJQA 1OTCA 5AJ3L 1H95A 2VQEQ 3EIVA 5GAHC 3A74A 4BBRH 5JJIA 5C44H 1N34L 4A93H 1U5KA 2UUAQ 3H0GH 5DLQE 4Y7NH 1LM0A 4LFBQ 4YHHQ 4LFAQ 2PQAB 1PH3A 1HR0W 1JJ2A 1X3FA 5IE8A 3HFZB 4QJFA 4LF5L 1N9WA 1TXYA 4GLXA 4JOIC 1Q81C 4HJ9A 3S1NH 1WJJA 4QL5A 1J5EL 2UUBL 1D8LA 4GKJL 1O7IA 2Q2IA 4DKAC 4YWKA 1BKBA 2OQKA 5FLXc 2ZTDA 4B3SL 4L5RC 1XMOL 1YIJA 3CW2C 4DK6C 1NTGA 1L0WA 3UE0A 1K3RA 5E7NA 1NJIC 2JA5G 1RL2A 4JI1Q 4PMWA 3K8AA 3GTPH 1UEBA 1HZAA 1Z9FA 4X65Q 3OTOL 1YJ9A 2VS1A 4NB3A 4PG3A 5ELOA 5J3BA 4DUZQ 1AH9A 4ALPA 4P75A 2K75A 1E24A 3UDXA 2PI2A 5ELNA 4DV7L 4B3SQ 2KCMA 1Q8KA 2CWPA 1IBKQ 3I4MH 3S17H 1YNXA 5LMNW 4A3IG 4GNXC 1V43A 2PNHA 1HZ9A 3J81j 3OTOQ 3I56A 1KQSA 2OTLA 3GTLH 2BH8A 2E2HH 4A3DH 1HNZL 1VQJA 1Q82C 1VQAA 3Q8DA 4C3IH 5LMUL 4TVAB 4A3BG 4LF8L 1FVIA 3PIPA 3CPFA 2JA6G 5JJKA 1G6PA 1PH4A 1VQDA 4DR7L 4OXPA 1R9TH 3L2PA 2UXCQ 1HH2P 3S14H 1C7YA 1U0LA 2VZAA 1AE2A 3CPWA 1XPOA 2ID0A 3RZOH 1OXXK 4X64L 4OWTB 5IYDG 2ZJRA 1ASYA 1J5EQ 3AFQA 4JI8L 2K14A 3GO5A 4GN3B 4X66Q 1WCMH 1D7QA 2NN6G 4MNOA 1P8LA 2LXJA 4XIGS 2UXCL 1VQBA 1N8RC 3IRBA 4PZ8A 1IZ6A 1VQLA 3ICEA 3TS0A 4DAYB 5C0XJ 4X64Q 4DV6L 2R92H 3S24A 4L5QA 4JI8Q 3NBHB 1XPRA 3CCEA 3ER0A 1Y1WH 1PH7A 3CF5A 3PO2G 2JA9A 4KHPL 4A3FG 4HJ8A 3GTOH 2CKZB 4LFBL 4DR5L 4ME3A 1EQQA 1PFSA 4R4IA 1NE3A 1W3SA 2LSSA 1JJCB 2HQLA 4LF5Q 1VQGA 1FL0A 4GLVB 1HNZQ 1QVCA 2XGTA 4H02A 4DV3L 3HOUG 3NELA 4R1JA 3S2HH 4GKJQ 5LMUQ 4B3MQ 2WP8J 4IPCA 2VQFQ 4GNXB 1UE7A 3HKZE 3CAMA 2VL6A 5IYBH 3PF5A 4JBMA 3HOZH 4DR5Q 3CCUA 2VNUD 2I5MX 1A62A 1X65A 3MEFA 2C35B 5K36G 4DR3Q 2PI2E 1LUZA 3M4QA 3PUZA 1Q7YC 2F4VQ 2V1CC 3HOYH 1VQOA 2WAQG 4DUZL 4O0AA 4A3JG 1P16A 1WOCA 2ALYB 2Z6KA 4PZ6A 3UDGA 1FJGQ 3J80c 5GQOA 3PUXA 4A3IH 2HT1A 4OX9L 5LMNL 3PSIA 4B3ML 1GO3E 2VQFL 2UU9L 2B63H 1E22A 4DR4L 3UDIA 5IP7H 4X66L 4DV4Q 3GTKH 2YU9H 3T1HQ 1WI5A 1L1OA 2Q2HA 4IPGA 2Q2TA 3A5ZB 1YVCA 1FGUA 4TQUS 5GROA 2FXQA 1KHIA 3KDFB 4JC0A 2JEAI 4A3BH 4A3LG 3G6EA 1BVSA 5IYCG 2JK8A 1SROA 3CC7A 4DV0Q 4GN5A 1IXRA 1HNXL 1ASZA 4UP9A 4A3EG 4B3TL 4P73A 4R4CA 4P72A 3EBEA 2YTVA 1X6OA 4C3HH 1GM5A 2R93G 3KF8B 4DV2Q 2AHOB 4A75A 3E9IA 5M5XH 3HOXG 1L2FA 2HHHL 3RLNA 1N33Q 4RG1A 4DR7Q 4JI7Q 2UXDL 4GOPB 2MO1A 1PH1A 1X55A 2H5XA 2R6GA 2KHJA 3PGZA 1T9HA 4YCVA 1XMQL 4YCUA 3STBC 1EQRA 5M3MH 1XNQQ 4JG2A 3S15H 4L5SA 1CSPA 3HOXH 4UP7A 3PUYA 1EWIA 2VQEL 1K8GA 3A0JA 2CCZA 1XPUA 1YJWA 4HIOA 4IJHA 4BXXH 1VQ9A 1UWVA 1VQPA 2YTXA 3CCLA 1I5FA 4QY7A 2HHHQ 4JYAQ 4BY1H 1SLJA 4YHHL 3OW2A 4IFDJ 1Y14B 4YCWA 2MFIA 2VW9A 2VUMH 3GTGH 4LF4L 5IT9c 3ULPA 3D0FA 2F4VL 2AWNA 3ZJYC 1SMXA 4DV6Q 1SR3A 1VQNA 1FJGL 4GS3A 4NPSA 3KDFA 3DLLA 1CKOA 4DR2Q 4DUYL 1TWFH 1NMGA 2UU9Q 1C0AA 2A19A 2YV5A 1G291 3K81C 1X3EA 4DV4L 4POGA 2E5LQ 1G51A 1PH9A 4UPAA 2A8VA 2ATWA 1MJCA 1VQ5A 4LF6Q 3G4SA 4R4TA 4A3KG 3GTMH 3HOWG 1NY4A 4DV1Q 2IX1A 1BBUA 4P74A 2R93H 4UY8C 1HR0L 1XNRL 4DV3Q 4LUZA 3CCRA 3CCSA 4DR2L 1L1OB 4QIWE 2JA6H 4DR6Q 2ZTCA 3W1GA 3ULLA 1QUQA 1Q1EA 2B3GA 4DV7Q 3U4VA 3W1BA 1B70B 2K4KA 4JBWA 5C0XG 3GD7A 4C2MH 4DV2L 1IBKL 4JI2L 1S3OA 2EXDA 1IBML 1KC8C 4YY3Q 4A76A 1VQ8A 5H1SE 3S2DH 4GN4B 4A3MG 2IY5B 3J7ZC 4IPDA 4IJLA 5M5WH 2DGYA 4DV5Q 2L15A 5IP7G 5IYBG 1MJEA 3HOZG 4DR1L 1HR0Q 5C3EH 4DR6L 4K0KQ 1IYJB 4BY1G 3CXCA 3UE1A 2E2JH 1VS0A 2EQSA 4LF8Q 4A3JH 4HJ7A 1KRSA 2N8NA 4JI2Q 1N32L 5GADC 4JOIA 3CD6A 4YY3L 4BY7G 4APVA 5FLMH 4PZ7A 5IYDH 4O2DA 2GN5A 5C4XH 4DV5L 1VQKA 3AEVA 1A8VA 3VDYA 5BR8L 3I4OA 4AYBE 4IPHA 3TQYA 1Y1VG 2JA8H 4AIMA 2UUCQ 4B3TQ 4Y52H 4K0KL 1KIXA 3KOJA 5FLMG 1UE1A 3GTJH 1EUJA 1N32Q 3ULJA 5M3MG 3F2BA 4A3KH 5IWAL 2HIVA 2IT1A 3DM3A 3M4PA 4A3CH 1VQMA 1W2BA 2E5LL 1Y1VH 2JA8G 1V1QA 3PO3H 4B3RL 1OXSC 4LF6L 3EN2A 2F52A 3FKIH 2K52A 1NBWA 1GKHA 1UE6A 3RR5A 4AH6A 3B6YA 3G71A 1XMQQ 4IOCA 2ES2A 4JBKA 1EOVA 5HY6A 3BZKA 1C9OA 1YEZA 4JI3Q 3PO2H 1SFOH 1HNWL 1SN8A 1AE3A 3FHWA 2IX0A 3HOVH 1SE8A 4BBSG 1LYLA 3ERSX 2VUMG 3KFUA 5FJ8H 4A4IA 1BBWA 4EQ5A 2A1AA 3FKIG 2N49A 2KBNA 4GKKL 1K83H 3RNUA 1J6QA 5JEAJ 1IBMQ 3F2DA 4A3GG 1EIFA 1HJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV G;  1UE5 A;  4LF4 Q;  2MNA A;  1NMF A;  3TRE A;  1I94 Q;  4DR1 Q;  4IFD I;  1VQ4 A;  2RHS B;  3TS2 A;  4POF A;  3K7U C;  3T1Y Q;  2OQ0 A;  2JA7 H;  1Q46 A;  1OXU A;  3J80 i;  3CCQ A;  2QA4 A;  5M5Y H;  1VQ7 A;  4OWW B;  1B8A A;  2GVA A;  2JE6 I;  4AYB G;  1YZ6 A;  3CCJ A;  2ZJP A;  1CSQ A;  1VQH A;  4DR3 L;  1IBL L;  2ZJQ A;  3KLW A;  3M3Y H;  3S1M H;  1I94 L;  2R7D A;  2Z6K C;  4MZ9 A;  5JJL A;  1A0I A;  2CFM A;  3JC6 6;  1WYD A;  4J15 A;  1SRU A;  4KHZ A;  1XNR Q;  3S1Q H;  5GAE C;  1PVO A;  5LMN Q;  1Q12 A;  1I50 H;  1TWG H;  3T1Y L;  3H0G G;  1E7Z A;  5C0X I;  3E9H A;  4A3L H;  2D62 A;  3M85 A;  4JYA L;  4AQY L;  1A63 A;  4JI4 L;  3T1H L;  2R7Z G;  3I55 A;  1MKH A;  2K5N A;  3PCO B;  4OO1 I;  3CCM A;  4IOA A;  2PMZ E;  1E1T A;  1VQC A;  2YTY A;  4JCV E;  3RN2 A;  3HKS A;  1HNX Q;  3E0E A;  1WCM G;  2AWO A;  2GVB A;  2WB1 E;  4JI3 L;  2AKW B;  4BXX G;  3PV0 A;  5M3F H;  2EIF A;  3AFP A;  4GLA C;  3SGI A;  4DK3 C;  4HJ5 A;  4BY7 H;  4A3G H;  1X3G A;  5C3E G;  4P71 A;  3RZD H;  1YI2 A;  4UP8 A;  4GKK Q;  3OYY A;  4IFD G;  4NXM L;  2UXD Q;  4YWL A;  3KF6 A;  1YHA A;  3S1R H;  3M9B A;  3GDE A;  3AQQ A;  3I4N H;  2Y0S G;  3G48 A;  3AYH B;  5C44 G;  2Q2U A;  4LWC A;  1XNQ L;  4A93 G;  5HGQ A;  2UUC L;  3M4O H;  2HIX A;  2DUD A;  4HIK A;  4BA1 I;  3RLF A;  1K0R A;  3KF6 B;  1YIT A;  4JI0 L;  2UUB Q;  2I5H A;  4RMF A;  3BZC A;  3U4Z A;  1HZB A;  4LF7 L;  3HOW H;  1XMO Q;  1E1O A;  2NN6 I;  4LUV A;  4A3D G;  4X62 Q;  1KXL A;  1TWH H;  1Z47 A;  1Y1W G;  3D31 A;  3TRZ A;  1PH6 A;  4DUY Q;  4OWX B;  2NZH A;  1QZG A;  2OCE A;  1EYG A;  3NEN A;  3CMA A;  1K73 C;  4HIM A;  4KI0 A;  4AQY Q;  1VQF A;  2ZM6 Q;  4JI4 Q;  3I2Z A;  4X62 L;  1B7Y B;  3HOU H;  2B63 G;  1E3P A;  1YHB A;  3L0O A;  4DV1 L;  1PH2 A;  4GNX A;  3GTQ H;  3I4M G;  2JA5 H;  2F3I A;  1K8A C;  1M90 C;  1N36 L;  3LGJ A;  1HZC A;  2D0P A;  1OXT A;  4A3M H;  1PYS B;  5IYC H;  1JMC A;  2PQA A;  3KJO A;  4DAM A;  1Q1B A;  5IP9 G;  2KHI A;  2ZM6 L;  1Q86 C;  1JB7 A;  1YJN A;  1MIU A;  2Y0S E;  1TWA H;  3I4N G;  1IL2 A;  4NXN Q;  3NEM A;  1VCI A;  4FDB A;  1PV4 A;  5C4J H;  2I0Q A;  4OO1 G;  3CQZ H;  1KAW A;  4JBJ A;  3U50 C;  3H15 A;  1QZH A;  3PIO A;  3S16 H;  4LFC Q;  1VQ6 A;  3CC4 A;  2K50 A;  2NZO A;  3BJU A;  1GVP A;  2JQO A;  2YYZ A;  2RHQ B;  4LNQ A;  4X6A H;  1PH5 A;  3WWV A;  5AJ3 Q;  2IHF A;  1LTL A;  1CKN B;  4OON A;  4EX5 A;  4QQB X;  1N34 Q;  3J81 c;  2NVY H;  3JAM i;  1XJV A;  2KEN A;  3CC2 A;  4R4Q A;  2E2I H;  4DNI A;  1I3Q H;  4JI6 Q;  4LFA L;  5BR8 Q;  3J7A 5;  4BBS H;  2NVQ H;  1PHJ A;  2ZTE A;  5GAG C;  1EIY B;  2OWO A;  3W5O A;  4QGU A;  3H3V I;  1XTD A;  1GD7 A;  3I7F A;  3PO3 G;  2BH2 A;  4YWM A;  4GOP A;  1OXV A;  2N78 A;  1YHQ A;  2UXB L;  2XTI A;  4WJ3 M;  3F8T A;  3TEH B;  5JEA G;  5IWA Q;  1JJG A;  5M3F G;  4IO9 A;  3STB D;  1S72 A;  4NXM Q;  2D0O A;  3L7Z C;  3HOY G;  2I5L X;  3K0X A;  4B3R Q;  1X56 A;  1DGS A;  2JEB I;  2N3S A;  3PUW A;  2NVX H;  2R92 G;  4KHP Q;  4LW1 A;  3CME A;  2RF4 A;  4JI1 L;  1CKM A;  3BU2 A;  4R4O A;  5FJ8 G;  3K7A H;  3U58 A;  2B29 A;  4XTC S;  1YBY A;  1HNW Q;  1PH8 A;  2ASB A;  5C4X G;  4L5T A;  1N36 Q;  2OTJ A;  2K5V A;  1V9P A;  4JI0 Q;  2UXB Q;  3PUV A;  3HKZ G;  4LF7 Q;  1EFW A;  2UUA L;  3M7N A;  1RIP A;  1S40 A;  4JI5 Q;  2VY3 A;  1JE5 A;  3FP9 A;  1VQI A;  3J81 i;  4WJ4 A;  4MTN A;  3JAM c;  4BBR G;  2WAQ E;  4A3E H;  1QVF A;  4A3F H;  2CWA A;  4JV5 L;  1X54 A;  4DPG A;  5EAY A;  2NVT H;  4HJA A;  2LXK A;  3UDF A;  1VQE A;  3KYH C;  2QEX A;  1PA6 A;  2R7Z H;  2RCN A;  4OX9 Q;  3RN5 A;  2QGQ A;  1KD1 C;  2CQO A;  3CCV A;  3F2C A;  1QVG A;  4DR4 Q;  2AMC B;  4KLK A;  4JI5 L;  2BA1 A;  4GOP C;  3PF4 A;  1IBL Q;  1WFQ A;  1M1K C;  1QUQ B;  2IHE A;  4X65 L;  4JI6 L;  5IP9 H;  1KL9 A;  1X9N A;  4JV5 Q;  2BA0 A;  1I6H H;  4C3J H;  5IY0 A;  4DV0 L;  1KRT A;  2MO0 A;  4LF9 Q;  2KCT A;  3F1Z A;  1CUK A;  1L1O C;  1TWC H;  4NXN L;  3KJP A;  2E8G A;  2JA7 G;  1PYB A;  2MQH A;  1N33 L;  1JT8 A;  3MXN B;  1K9M C;  4JI7 L;  1CKN A;  4HID A;  3H3V H;  4LFC L;  3A5U A;  4LUO A;  2K5H A;  3K80 C;  2Z0S A;  4A3C G;  4LF9 L;  2R7F A;  4BA2 I;  2WB1 G;  3CP0 A;  3RLO A;  2WFW A;  2JJQ A;  1OTC A;  5AJ3 L;  1H95 A;  2VQE Q;  3EIV A;  5GAH C;  3A74 A;  4BBR H;  5JJI A;  5C44 H;  1N34 L;  4A93 H;  1U5K A;  2UUA Q;  3H0G H;  5DLQ E;  4Y7N H;  1LM0 A;  4LFB Q;  4YHH Q;  4LFA Q;  2PQA B;  1PH3 A;  1HR0 W;  1JJ2 A;  1X3F A;  5IE8 A;  3HFZ B;  4QJF A;  4LF5 L;  1N9W A;  1TXY A;  4GLX A;  4JOI C;  1Q81 C;  4HJ9 A;  3S1N H;  1WJJ A;  4QL5 A;  1J5E L;  2UUB L;  1D8L A;  4GKJ L;  1O7I A;  2Q2I A;  4DKA C;  4YWK A;  1BKB A;  2OQK A;  5FLX c;  2ZTD A;  4B3S L;  4L5R C;  1XMO L;  1YIJ A;  3CW2 C;  4DK6 C;  1NTG A;  1L0W A;  3UE0 A;  1K3R A;  5E7N A;  1NJI C;  2JA5 G;  1RL2 A;  4JI1 Q;  4PMW A;  3K8A A;  3GTP H;  1UEB A;  1HZA A;  1Z9F A;  4X65 Q;  3OTO L;  1YJ9 A;  2VS1 A;  4NB3 A;  4PG3 A;  5ELO A;  5J3B A;  4DUZ Q;  1AH9 A;  4ALP A;  4P75 A;  2K75 A;  1E24 A;  3UDX A;  2PI2 A;  5ELN A;  4DV7 L;  4B3S Q;  2KCM A;  1Q8K A;  2CWP A;  1IBK Q;  3I4M H;  3S17 H;  1YNX A;  5LMN W;  4A3I G;  4GNX C;  1V43 A;  2PNH A;  1HZ9 A;  3J81 j;  3OTO Q;  3I56 A;  1KQS A;  2OTL A;  3GTL H;  2BH8 A;  2E2H H;  4A3D H;  1HNZ L;  1VQJ A;  1Q82 C;  1VQA A;  3Q8D A;  4C3I H;  5LMU L;  4TVA B;  4A3B G;  4LF8 L;  1FVI A;  3PIP A;  3CPF A;  2JA6 G;  5JJK A;  1G6P A;  1PH4 A;  1VQD A;  4DR7 L;  4OXP A;  1R9T H;  3L2P A;  2UXC Q;  1HH2 P;  3S14 H;  1C7Y A;  1U0L A;  2VZA A;  1AE2 A;  3CPW A;  1XPO A;  2ID0 A;  3RZO H;  1OXX K;  4X64 L;  4OWT B;  5IYD G;  2ZJR A;  1ASY A;  1J5E Q;  3AFQ A;  4JI8 L;  2K14 A;  3GO5 A;  4GN3 B;  4X66 Q;  1WCM H;  1D7Q A;  2NN6 G;  4MNO A;  1P8L A;  2LXJ A;  4XIG S;  2UXC L;  1VQB A;  1N8R C;  3IRB A;  4PZ8 A;  1IZ6 A;  1VQL A;  3ICE A;  3TS0 A;  4DAY B;  5C0X J;  4X64 Q;  4DV6 L;  2R92 H;  3S24 A;  4L5Q A;  4JI8 Q;  3NBH B;  1XPR A;  3CCE A;  3ER0 A;  1Y1W H;  1PH7 A;  3CF5 A;  3PO2 G;  2JA9 A;  4KHP L;  4A3F G;  4HJ8 A;  3GTO H;  2CKZ B;  4LFB L;  4DR5 L;  4ME3 A;  1EQQ A;  1PFS A;  4R4I A;  1NE3 A;  1W3S A;  2LSS A;  1JJC B;  2HQL A;  4LF5 Q;  1VQG A;  1FL0 A;  4GLV B;  1HNZ Q;  1QVC A;  2XGT A;  4H02 A;  4DV3 L;  3HOU G;  3NEL A;  4R1J A;  3S2H H;  4GKJ Q;  5LMU Q;  4B3M Q;  2WP8 J;  4IPC A;  2VQF Q;  4GNX B;  1UE7 A;  3HKZ E;  3CAM A;  2VL6 A;  5IYB H;  3PF5 A;  4JBM A;  3HOZ H;  4DR5 Q;  3CCU A;  2VNU D;  2I5M X;  1A62 A;  1X65 A;  3MEF A;  2C35 B;  5K36 G;  4DR3 Q;  2PI2 E;  1LUZ A;  3M4Q A;  3PUZ A;  1Q7Y C;  2F4V Q;  2V1C C;  3HOY H;  1VQO A;  2WAQ G;  4DUZ L;  4O0A A;  4A3J G;  1P16 A;  1WOC A;  2ALY B;  2Z6K A;  4PZ6 A;  3UDG A;  1FJG Q;  3J80 c;  5GQO A;  3PUX A;  4A3I H;  2HT1 A;  4OX9 L;  5LMN L;  3PSI A;  4B3M L;  1GO3 E;  2VQF L;  2UU9 L;  2B63 H;  1E22 A;  4DR4 L;  3UDI A;  5IP7 H;  4X66 L;  4DV4 Q;  3GTK H;  2YU9 H;  3T1H Q;  1WI5 A;  1L1O A;  2Q2H A;  4IPG A;  2Q2T A;  3A5Z B;  1YVC A;  1FGU A;  4TQU S;  5GRO A;  2FXQ A;  1KHI A;  3KDF B;  4JC0 A;  2JEA I;  4A3B H;  4A3L G;  3G6E A;  1BVS A;  5IYC G;  2JK8 A;  1SRO A;  3CC7 A;  4DV0 Q;  4GN5 A;  1IXR A;  1HNX L;  1ASZ A;  4UP9 A;  4A3E G;  4B3T L;  4P73 A;  4R4C A;  4P72 A;  3EBE A;  2YTV A;  1X6O A;  4C3H H;  1GM5 A;  2R93 G;  3KF8 B;  4DV2 Q;  2AHO B;  4A75 A;  3E9I A;  5M5X H;  3HOX G;  1L2F A;  2HHH L;  3RLN A;  1N33 Q;  4RG1 A;  4DR7 Q;  4JI7 Q;  2UXD L;  4GOP B;  2MO1 A;  1PH1 A;  1X55 A;  2H5X A;  2R6G A;  2KHJ A;  3PGZ A;  1T9H A;  4YCV A;  1XMQ L;  4YCU A;  3STB C;  1EQR A;  5M3M H;  1XNQ Q;  4JG2 A;  3S15 H;  4L5S A;  1CSP A;  3HOX H;  4UP7 A;  3PUY A;  1EWI A;  2VQE L;  1K8G A;  3A0J A;  2CCZ A;  1XPU A;  1YJW A;  4HIO A;  4IJH A;  4BXX H;  1VQ9 A;  1UWV A;  1VQP A;  2YTX A;  3CCL A;  1I5F A;  4QY7 A;  2HHH Q;  4JYA Q;  4BY1 H;  1SLJ A;  4YHH L;  3OW2 A;  4IFD J;  1Y14 B;  4YCW A;  2MFI A;  2VW9 A;  2VUM H;  3GTG H;  4LF4 L;  5IT9 c;  3ULP A;  3D0F A;  2F4V L;  2AWN A;  3ZJY C;  1SMX A;  4DV6 Q;  1SR3 A;  1VQN A;  1FJG L;  4GS3 A;  4NPS A;  3KDF A;  3DLL A;  1CKO A;  4DR2 Q;  4DUY L;  1TWF H;  1NMG A;  2UU9 Q;  1C0A A;  2A19 A;  2YV5 A;  1G29 1;  3K81 C;  1X3E A;  4DV4 L;  4POG A;  2E5L Q;  1G51 A;  1PH9 A;  4UPA A;  2A8V A;  2ATW A;  1MJC A;  1VQ5 A;  4LF6 Q;  3G4S A;  4R4T A;  4A3K G;  3GTM H;  3HOW G;  1NY4 A;  4DV1 Q;  2IX1 A;  1BBU A;  4P74 A;  2R93 H;  4UY8 C;  1HR0 L;  1XNR L;  4DV3 Q;  4LUZ A;  3CCR A;  3CCS A;  4DR2 L;  1L1O B;  4QIW E;  2JA6 H;  4DR6 Q;  2ZTC A;  3W1G A;  3ULL A;  1QUQ A;  1Q1E A;  2B3G A;  4DV7 Q;  3U4V A;  3W1B A;  1B70 B;  2K4K A;  4JBW A;  5C0X G;  3GD7 A;  4C2M H;  4DV2 L;  1IBK L;  4JI2 L;  1S3O A;  2EXD A;  1IBM L;  1KC8 C;  4YY3 Q;  4A76 A;  1VQ8 A;  5H1S E;  3S2D H;  4GN4 B;  4A3M G;  2IY5 B;  3J7Z C;  4IPD A;  4IJL A;  5M5W H;  2DGY A;  4DV5 Q;  2L15 A;  5IP7 G;  5IYB G;  1MJE A;  3HOZ G;  4DR1 L;  1HR0 Q;  5C3E H;  4DR6 L;  4K0K Q;  1IYJ B;  4BY1 G;  3CXC A;  3UE1 A;  2E2J H;  1VS0 A;  2EQS A;  4LF8 Q;  4A3J H;  4HJ7 A;  1KRS A;  2N8N A;  4JI2 Q;  1N32 L;  5GAD C;  4JOI A;  3CD6 A;  4YY3 L;  4BY7 G;  4APV A;  5FLM H;  4PZ7 A;  5IYD H;  4O2D A;  2GN5 A;  5C4X H;  4DV5 L;  1VQK A;  3AEV A;  1A8V A;  3VDY A;  5BR8 L;  3I4O A;  4AYB E;  4IPH A;  3TQY A;  1Y1V G;  2JA8 H;  4AIM A;  2UUC Q;  4B3T Q;  4Y52 H;  4K0K L;  1KIX A;  3KOJ A;  5FLM G;  1UE1 A;  3GTJ H;  1EUJ A;  1N32 Q;  3ULJ A;  5M3M G;  3F2B A;  4A3K H;  5IWA L;  2HIV A;  2IT1 A;  3DM3 A;  3M4P A;  4A3C H;  1VQM A;  1W2B A;  2E5L L;  1Y1V H;  2JA8 G;  1V1Q A;  3PO3 H;  4B3R L;  1OXS C;  4LF6 L;  3EN2 A;  2F52 A;  3FKI H;  2K52 A;  1NBW A;  1GKH A;  1UE6 A;  3RR5 A;  4AH6 A;  3B6Y A;  3G71 A;  1XMQ Q;  4IOC A;  2ES2 A;  4JBK A;  1EOV A;  5HY6 A;  3BZK A;  1C9O A;  1YEZ A;  4JI3 Q;  3PO2 H;  1SFO H;  1HNW L;  1SN8 A;  1AE3 A;  3FHW A;  2IX0 A;  3HOV H;  1SE8 A;  4BBS G;  1LYL A;  3ERS X;  2VUM G;  3KFU A;  5FJ8 H;  4A4I A;  1BBW A;  4EQ5 A;  2A1A A;  3FKI G;  2N49 A;  2KBN A;  4GKK L;  1K83 H;  3RNU A;  1J6Q A;  5JEA J;  1IBM Q;  3F2D A;  4A3G G;  1EIF A;  1HJP A; 
#chains in the Genus database with same CATH topology
 1UE5 A;  4LF4 Q;  3K7A B;  5IGG A;  1SJE D;  3K7U C;  1EY7 A;  1CM9 A;  4RCO A;  1OXU A;  3BVM A;  1TS2 A;  1B8A A;  1UUP A;  2GVA A;  2EZV A;  3ERQ A;  5C3W A;  3CCJ A;  2LS0 1;  1CSQ A;  4DR3 L;  2A6H C;  2KHS A;  4KY7 A;  1IBL L;  2A6H D;  1SYE A;  3M3Y H;  1EEI D;  4C3H G;  2CFM A;  1BCP C;  1ESR A;  1WYD A;  4KHZ A;  3SE0 A;  5E1F A;  4PMC A;  1JWM D;  3H0G G;  4QF4 A;  1S5E D;  2F0H A;  2NVX B;  2R7Z G;  2K5N A;  3PCO B;  1DOM A;  1J9O A;  1E1T A;  2B2V A;  1HNX Q;  3DM1 A;  2WB1 E;  1B3Q A;  1LAB A;  1STG A;  1Y8N B;  4ID6 A;  4MTK A;  3SK6 A;  4BY7 H;  3HG9 A;  2KCN A;  3NP8 A;  3IKJ A;  1CFM A;  2ENB A;  3KF6 A;  1YHA A;  3S1R H;  2EE1 A;  1A2T A;  1B1Z A;  3AQQ A;  3M9B A;  1XNQ L;  4A93 G;  3SVM A;  3MEH A;  1I4X A;  4HMJ A;  1IKL A;  4C3H B;  1K0R A;  1I4G A;  4KTA A;  4KKS A;  2OT2 A;  3T4A C;  4ZUJ A;  1A3T A;  2B2U C;  1BNZ A;  5AFW A;  5EBD A;  4G7O C;  3P75 A;  1I4Q A;  2DY7 A;  1O7Y A;  3D31 A;  1PH6 A;  4DUY Q;  4OWX B;  2OCE A;  2L1B A;  4HIM A;  2IJ0 A;  1VQF A;  4FXG C;  4TKO B;  2XRQ D;  4X3T A;  4JI4 Q;  3HOU H;  1E3P A;  1NSN S;  3L0O A;  5CV8 A;  2JA5 H;  3FRP B;  2K05 A;  1M90 C;  1HZC A;  4BBR B;  4EQO A;  5IYC H;  2PQA A;  1Q1B A;  3HGB A;  3FDT A;  3I4N G;  2Y0S E;  1CA6 A;  2G5D A;  3U50 C;  2JA7 B;  3H15 A;  3OSO A;  3LWU A;  2C5C A;  1A15 A;  2YYZ A;  3KLR A;  4P2C B;  5AJ3 Q;  3K5M A;  4OON A;  4EX5 A;  1XJV A;  4DNI A;  1I3Q H;  3GV3 A;  1V1P B;  4BBS H;  1EIY B;  2F0V A;  3RZO B;  3I7F A;  3PO3 G;  1Y8P B;  1OXV A;  2N78 A;  4GOP A;  1JJG A;  1ESF A;  4RWS C;  1SMY C;  3HOY G;  1I6H H;  2R92 G;  4KHP Q;  1KNA A;  2N3S A;  3KF8 A;  4F8M A;  2NVX H;  3CME A;  1PLF A;  4HN7 A;  1CKM A;  3BU2 A;  4R4O A;  5FJ8 G;  2B29 A;  2NB0 A;  1YBY A;  2OTJ A;  3X3M A;  3Q23 A;  2K5D A;  5FO9 B;  4JI0 Q;  4CKE A;  4LF7 Q;  4DAY A;  3M7N A;  5G3L D;  4JI5 Q;  3FP9 A;  1VQI A;  3DWP A;  5I9O A;  3TN2 A;  1LT3 D;  4A3F H;  2L5T A;  1LTT D;  4RGT A;  4DPG A;  5EAY A;  1D5M C;  2O4X A;  1IHZ A;  3UDF A;  2B2T A;  2PMZ B;  3S14 B;  3K5N A;  2AMC B;  2DJF C;  4JI5 L;  2BA1 A;  5ELC A;  3X3N A;  4JI6 L;  4A3J B;  1DCZ A;  1BO0 A;  3S16 B;  2RA4 A;  4BY7 B;  5M5W B;  1CUK A;  1CHP D;  1PFB A;  1TWC H;  2EVB A;  3KJP A;  1EY5 A;  5C3E B;  2MQH A;  3MXN B;  2RBM A;  3R2T A;  2HQE A;  1TQO A;  2L11 A;  3FMC A;  4LFC L;  2R7Z B;  4DAP A;  4BA2 I;  1PDQ A;  2AUK A;  3CP0 A;  2WFW A;  2VQE Q;  3EIV A;  4N9P A;  5C44 H;  1N34 L;  2F0T A;  2QF7 A;  4Y7N H;  4LFB Q;  1TII D;  4YHH Q;  2PQA B;  1JJ2 A;  3E0J A;  1TXY A;  4JOI C;  2KQ3 A;  4GKJ L;  2E2I B;  4YWK A;  5K36 H;  1XMO L;  1JWU D;  1L0W A;  4BY1 B;  4JI1 Q;  3K8A A;  1Z9F A;  5KYI A;  2FHT A;  5JVG 3;  4Q5V A;  2NBF A;  2F0D A;  4IN3 A;  3M4Y A;  5ELO A;  4DUZ Q;  2L4N A;  5J3B A;  1X3P A;  4ALP A;  4P75 A;  4RKB A;  3UDX A;  2PI2 A;  5ELN A;  2E75 C;  2KCM A;  1Q8K A;  1BCP D;  2L0C A;  2Y0S B;  3URY A;  1EY4 A;  1O7Z A;  2PNH A;  1KQS A;  4JPB W;  1BCP B;  2BH8 A;  2F0Q A;  2BDN A;  1WTV A;  2WV6 D;  1VQA A;  2MJ8 A;  3Q8D A;  4C56 C;  2EYF A;  4TVA B;  4LF8 L;  1HRJ A;  1FNW A;  1FVI A;  4R8N A;  5A2Q E;  3PIP A;  1G6P A;  1PH4 A;  4DR7 L;  2F0J A;  3DXJ C;  3QOJ A;  4J6H A;  1G2S A;  3L2P A;  4OEM B;  4IQZ A;  3S14 H;  2VZA A;  1PTO C;  4HCS A;  3CPW A;  2ID0 A;  1SE2 A;  5JEA H;  1L0X B;  1ZYR D;  5CMD A;  3QJY A;  4ILW A;  3OWE B;  1STA A;  3ICE A;  3NBH B;  3V05 A;  4OGQ C;  1NR2 A;  1Y1W H;  1PH7 A;  3LWE A;  3PO2 G;  1S5D D;  1HTP A;  3W2D A;  4A3F G;  5D3I B;  2CKZ B;  4Z9C B;  3ONA B;  1EQQ A;  4A3E B;  3GTP B;  5ELF A;  1VQG A;  5C44 B;  2QW7 A;  4H02 A;  3NEL A;  2QDL A;  4B3M Q;  2WP8 J;  2VQF Q;  1WVL A;  2F0E A;  3TZD A;  3MAQ A;  3BDO A;  5IYB H;  3CCU A;  2VNU D;  2PZT A;  2I5M X;  2K5Q A;  1X65 A;  1S5C D;  3PUZ A;  2F4V Q;  3HOY H;  1VQO A;  5IOD A;  3BVZ A;  1WOC A;  1R4Q B;  2Z6K A;  3LX0 A;  2RDH A;  4KN4 C;  5GQO A;  3PUX A;  2QEJ C;  1HUN A;  4OX9 L;  4B3M L;  2VQF L;  1JOR A;  4X66 L;  2D5D A;  1K8M A;  2YU9 H;  1V1O A;  1A3U A;  4IPG A;  2Q2H A;  2F4I A;  3A5Z B;  4TQU S;  1KHI A;  4JC0 A;  2JEA I;  2O5J C;  3G6E A;  2XWJ B;  1ASZ A;  1I4H A;  1PZJ D;  4FF4 A;  2YTV A;  3MC0 B;  3N52 A;  1GM5 A;  3OHX C;  2R93 G;  1EU3 A;  4WRD A;  5CV9 A;  3MXU A;  4C1N K;  2HHH L;  1K0S A;  5T1G A;  4JI7 Q;  1ZKO A;  3PMF A;  4HCE A;  4IFD H;  3STB C;  1EQR A;  4JG2 A;  1LT5 D;  5KEE A;  1ZYR C;  5E4W C;  1EWH A;  3TME A;  2CCZ A;  2CQA A;  1A2U A;  4BXX H;  2YTX A;  4X3S A;  1I5F A;  3TBI B;  2HHH Q;  3R2I A;  1F2L A;  3OW2 A;  2CW0 C;  3GTG H;  2F0K A;  1LV9 A;  4LJZ C;  1E2W A;  3HOV B;  2B2Y A;  1SMX A;  4DV6 Q;  1VQN A;  3VYS A;  2VXW A;  1CKO A;  4IUU A;  2UU9 Q;  4DXG A;  1FNU A;  1EIG A;  2QKI C;  1DOL A;  5EQ0 A;  5CYU A;  4Q0F A;  1D1K A;  3K5L A;  4CGY B;  4DV3 Q;  4LUZ A;  4HMI A;  4ZCK A;  2LKV A;  2ZTC A;  1C4Q A;  5C0X G;  3GTJ B;  1WTX A;  2P5Z X;  4YY3 Q;  3IL8 A;  2PNR C;  4A3M G;  2Z8L A;  2O5I C;  3I70 A;  2L15 A;  5IP7 G;  1MJE A;  1SYD A;  4BY1 G;  1HXY D;  2EQS A;  2ZT9 C;  5GAD C;  3SEB A;  4YY3 L;  3Q24 A;  4APV A;  1GJX A;  4PZ7 A;  5M5X B;  3J7A V;  2GN5 A;  5C4X H;  1JWS D;  3IFD A;  3BDL A;  1BBX C;  3TQY A;  5HGT A;  1SMY D;  4AIM A;  4Y52 H;  1X32 A;  3S15 B;  1SEB D;  2MGS A;  3F2B A;  3NBH A;  1W2B A;  3PO3 H;  3GTK B;  4HR7 B;  4LF6 L;  2K52 A;  3G71 A;  3BG3 A;  2ES2 A;  2NVT H;  3HS0 C;  1M4V A;  4JBK A;  5HY6 A;  2Q8R E;  3V96 A;  1BOS A;  1EZ8 A;  1SFO H;  1SN8 A;  1AE3 A;  1V1P A;  2IX0 A;  3HOV H;  1ILP A;  1LYL A;  2VUM G;  3I73 A;  5FJ8 H;  4A4I A;  2A1A A;  3SHL A;  4UHV A;  2Z1C A;  3MFG A;  4C3J G;  2B2W A;  1EIF A;  1HJP A;  1AP0 A;  2MNA A;  1NMF A;  1I94 Q;  4DR1 Q;  3I8Z A;  1XXG A;  2XWB B;  1VQ4 A;  2RHS B;  4OHJ A;  3BS1 A;  1FD7 D;  4XQN A;  3O13 A;  1D6E C;  2JA7 H;  3J80 i;  1VQ7 A;  1QE6 A;  2JE6 I;  2BOS A;  4AYB G;  4C2M B;  3NK9 A;  2ZJP A;  1VQH A;  3QG1 A;  3KLW A;  3DMU A;  3S1M H;  1I94 L;  2OF1 A;  2Z6K C;  1SND A;  1XNR Q;  4J15 A;  1B4O A;  1SRU A;  1Z6H A;  3S1Q H;  5LMN Q;  4QIW B;  1I50 H;  2EY5 A;  3TSS A;  5C0X I;  3E9H A;  3I91 A;  2D62 A;  1PRT C;  1HCZ A;  3Q22 A;  4CKB A;  1MKH A;  4OO1 I;  3BYT B;  1MBY A;  2ICI A;  4JCV E;  2BDO A;  3HKS A;  1WCM G;  2AWO A;  2GVB A;  2JYO A;  4JI3 L;  4RGM A;  2AKW B;  5JVH 3;  4BXX G;  4DNR B;  4DK1 A;  3S2D B;  3AFP A;  4IAL A;  3SGI A;  4HJ5 A;  1PXU A;  4RFB A;  4P71 A;  4J8Q A;  3RZD H;  1YI2 A;  2UXD Q;  2AUJ D;  3QB3 A;  3I90 A;  5EKL A;  2EOT A;  4K14 A;  3SK5 A;  5IGE A;  3AYH B;  3SR1 A;  4LWC A;  2Q8I B;  2UUC L;  1S5B D;  1G8Z D;  5EKI A;  3KF6 B;  1YIT A;  4RMF A;  3D4W A;  2I07 B;  1Q3L A;  2OXP A;  2E2J B;  2F0O A;  2PW5 A;  3VR6 A;  4CDE C;  1HA5 A;  1Z47 A;  4K5V A;  3NTH A;  4CHT B;  1PTO H;  1EU4 A;  1EYG A;  5L37 A;  1K73 C;  4KI0 A;  4N8F A;  4OIK A;  2A5H A;  1STY A;  3RMH A;  4DV1 L;  1XTC D;  3NHH A;  4K6L A;  3GTG B;  1WTW A;  3GTQ H;  3CRK C;  3JAM E;  1H9J A;  3AU7 A;  3HOW B;  1TWF B;  1EIH A;  3DWA A;  1TT2 A;  2KHI A;  3M7G A;  1JB7 A;  2DY8 A;  4NXN Q;  4FDB A;  4FP5 D;  5C4J H;  2I0Q A;  1SNO A;  1CZW A;  1C48 A;  2EYO A;  3C1E A;  2JQO A;  4ODG A;  4LNQ A;  3AB9 A;  3RUZ A;  5CBA E;  3HOU B;  1CI3 M;  1CKN B;  1BF4 A;  2NTS A;  4LFA L;  2EYJ A;  5BR8 Q;  4O1N A;  2ZTE A;  5GAG C;  2OWO A;  4QGU A;  1CT1 D;  2UXB L;  5IWA Q;  2I5L X;  3K0X A;  4HED A;  4WFN 3;  3PUW A;  3A8K E;  4LW1 A;  2RF4 A;  2X69 A;  3L3O C;  2KOL A;  1TWH B;  5CR3 A;  4H13 C;  4XTC S;  4CJ1 B;  1HNW Q;  1F9R A;  2ASB A;  2DNE A;  1H9S A;  2UXB Q;  2B63 B;  3PUV A;  1H9K A;  5M5Y B;  1U4R A;  3T56 B;  2AQ2 B;  1JE5 A;  4WJ4 A;  4MTN A;  3JAM c;  2WAQ E;  2NUC A;  4A3E H;  1QVF A;  2Z6B A;  4J1M A;  5E3F A;  3DEP A;  1X54 A;  4HJA A;  4GZY C;  2BE5 C;  2R7Z H;  1VQE A;  3KYH C;  2BE5 D;  2QEX A;  2RCN A;  2CQO A;  2F0U A;  1KAA A;  4UDU C;  4DR4 Q;  1T5X D;  4KK7 A;  4GOP C;  3P20 A;  2EPB A;  3CU7 A;  5A2Q L;  1QUQ B;  1U4P A;  2IHE A;  1KL9 A;  1W6J A;  4C3J H;  2H4O A;  2MPM A;  3HP3 A;  4IUV A;  5IY0 A;  4DV0 L;  1KRT A;  2MO0 A;  4ZKB B;  1PYW D;  2KCT A;  3F1Z A;  3BDC A;  4CBV A;  1L1O C;  1EFI D;  3NUC A;  2JA7 G;  1PYB A;  1JT8 A;  5E4X A;  4EQP A;  3H3V H;  3FPU B;  1SAP A;  3VR4 A;  3K80 C;  1I3Q B;  2Z0S A;  4JW0 A;  3RLO A;  5AJ3 L;  4L63 B;  4BBR H;  2KUM A;  3D8G A;  3HRZ C;  4DF7 A;  5KYL A;  3C46 A;  2BCO A;  3H0G H;  5D3D A;  1VF5 C;  5DLQ E;  5DAU A;  4M1U B;  1PH3 A;  3EA6 A;  5KRU A;  1X3F A;  4QJF A;  1HHV A;  2HUG A;  4HJ9 A;  1WJJ A;  4QL5 A;  2K7V A;  2UUB L;  1STH A;  2F0G A;  3HOY B;  2Q2I A;  2R92 B;  4M8A A;  2NVT B;  1D1I A;  2ZTD A;  5FLX c;  4L5R C;  3DHQ A;  3CW2 C;  3UE0 A;  3VYU A;  1K3R A;  5E7N A;  1FGB D;  1UEA B;  5J1Z A;  2JA5 G;  4NP5 A;  2AQ3 B;  3TP7 A;  4K2K A;  1CK1 A;  5I6W A;  3H94 A;  1RD9 D;  3T51 B;  3I4M H;  3S17 H;  1TWA B;  4C3J B;  1HZ9 A;  3I56 A;  5JAV A;  3C2P A;  4RGO S;  1HNZ L;  1VQJ A;  2R3Z A;  5LMU L;  4OO1 H;  1R4P B;  2B39 A;  3CPF A;  2JA6 G;  2C9O A;  4KD3 A;  3I4L A;  4U67 3;  2PPB C;  2SDF A;  1R9T H;  2UXC Q;  3I72 A;  1C7Y A;  1AE2 A;  1XPO A;  3RZO H;  2NWG A;  5F2D A;  5IYD G;  2ZJR A;  5JJZ A;  1ASY A;  1EY6 A;  3GO5 A;  1SJH D;  2KEC A;  1DOK A;  1D7Q A;  4MNO A;  2LXJ A;  3CRL C;  1RDP D;  3A8I E;  2R93 B;  2UXC L;  1V8Q A;  2A69 D;  4MN3 A;  4PZ8 A;  1O7L A;  3TP5 A;  1VDZ A;  4ZYS A;  3SK8 A;  3ER0 A;  3P7J A;  1MGS A;  3CF5 A;  3S1N B;  2JA9 A;  4LFB L;  4ME3 A;  1KDA A;  4EQN A;  1W3S A;  2TSS A;  5COY A;  1QG7 A;  1BXT A;  2PZU A;  3HOU G;  3K5O A;  4GKJ Q;  5LHY 1;  1DON A;  4GNX B;  1GUS A;  4K8J A;  3HOZ H;  3PF5 A;  2AQ1 B;  4WOR A;  1A62 A;  3MEF A;  2C35 B;  5K36 G;  4DR3 Q;  5CV5 A;  1Q7Y C;  2WAQ G;  1RF2 D;  3D6C A;  4DUZ L;  2K6A A;  1P16 A;  4PZ6 A;  3UDG A;  5KNB A;  3PSI A;  5IGC A;  1STB A;  5IP7 H;  2HDM A;  3R93 A;  4DV4 Q;  2Q2T A;  1YVC A;  2FXQ A;  3KDF B;  4ME5 A;  5G3L F;  1BVS A;  2JK8 A;  5IT9 L;  1W6K A;  3CC7 A;  1HNX L;  3S1Q B;  5JOB A;  2K32 A;  4P73 A;  3EBE A;  3KF8 B;  5C5L A;  1SDF A;  5I9P A;  3E9I A;  4QB4 A;  1L2F A;  1N33 Q;  4DR7 Q;  4GOP B;  3WDN A;  1X55 A;  1T9H A;  1XMQ L;  4YCU A;  1CQV A;  4L8J A;  5CGK A;  5M3M H;  1XNQ Q;  3S15 H;  1TR5 A;  4UP7 A;  3PUY A;  1EWI A;  5LL6 X;  3EJI A;  1JB3 A;  3A0J A;  3VA7 A;  1JOK A;  1UWV A;  3BYY B;  2J7Z A;  1GOZ A;  1Y14 B;  2VUM H;  2A6E C;  4FNF A;  5IT9 c;  1NAP A;  3D0F A;  2F4V L;  1SR3 A;  4IUN A;  3M4O B;  4GS3 A;  4NPS A;  3KDF A;  4DR2 Q;  4DUY L;  4DGZ A;  1JE4 A;  4A3F B;  1EWC A;  1C0A A;  2E5L Q;  1PH9 A;  1VQ5 A;  3KBX A;  1YNN C;  4A3K G;  3NXW A;  1BBU A;  3D4R A;  2R93 H;  4UY8 C;  1HR0 L;  3CCR A;  4DR2 L;  1L1O B;  4QIW E;  2WIN B;  2JA6 H;  4QMG A;  1CA5 A;  4DR6 Q;  3ULL A;  4DV7 Q;  1B70 B;  4JI2 L;  1IBK L;  3GD7 A;  4JYA Q;  2EXD A;  4F87 A;  1KC8 C;  5H1S E;  1VMC A;  5IGF A;  4HAE A;  3R3O A;  5IYB G;  1HR0 Q;  5C3E H;  3J81 L;  4DR6 L;  1F2Y A;  1GUN A;  4ZK9 B;  5D14 A;  4JI2 Q;  4O2D A;  3AEV A;  1A8V A;  2B2T C;  1Y1V G;  3ERO A;  2JA8 H;  2Q8T A;  3EFX D;  1KIX A;  2L12 A;  1Q90 A;  5I6Y A;  5M3M G;  3KLS X;  1WTH A;  3DM3 A;  3A56 A;  3M4P A;  3VYT A;  1VQM A;  1FR3 A;  4XXE A;  5TSS A;  3K57 A;  3EN2 A;  2F52 A;  4AH6 A;  1TS4 A;  3HKZ B;  4IOC A;  1JCK B;  4QCL A;  1YEZ A;  1SE8 A;  3KFU A;  4EQ5 A;  4GKK L;  2KBN A;  1HUM A;  3TDQ A;  3NQT A;  4CDF C;  5M3M B;  4BY7 G;  1SE3 A;  3I3C A;  3HOV G;  3TRE A;  5BN3 A;  5FOB B;  4E6I A;  4IFD I;  1SXT A;  3TS2 A;  3ZYY X;  4OL7 A;  2OQ0 A;  2A68 C;  3T1Y Q;  1Q46 A;  3CCQ A;  2QA4 A;  4OWW B;  1Y1V B;  4XT3 B;  2NVY B;  1VF7 A;  1LT6 D;  1S5F D;  2DNC A;  4CDD C;  2ZJQ A;  2K5W A;  4MZ9 A;  1AZP A;  1A0I A;  1X3Q A;  4OIJ A;  1B2T A;  1D5X C;  1RCV D;  1TWG H;  1EY9 A;  3T1Y L;  1R9T B;  1E7Z A;  4X3U A;  1A3V A;  4AQY L;  1A63 A;  3T1H L;  4XYO A;  1MHW C;  3E6Z X;  3CCM A;  4IOA A;  2PMZ E;  1VQC A;  2YTY A;  1QOH A;  2LFN A;  5EGT A;  3PV0 A;  2EIF A;  4A3G H;  4FYD A;  1X3G A;  4UP8 A;  5NUC A;  4NXM L;  2XVS A;  3QR8 A;  1PZK D;  2NVQ B;  3GDE A;  5C4H A;  3I4N H;  2Y0S G;  3G48 A;  5C44 G;  5EBC A;  5EKK A;  5HGQ A;  3M4O H;  4K2L A;  4BS9 A;  2N55 A;  3NTK A;  4BA1 I;  3RLF A;  2FMC A;  2I5H A;  3N6R A;  3BZC A;  3U4Z A;  1AZQ A;  2XN9 C;  1XMO Q;  1E1O A;  4A3D G;  3NBI A;  1TWH H;  5DNF A;  5KND A;  4XQJ A;  3TRZ A;  1Y8O B;  5C3X A;  5FLX E;  1ET6 A;  2K33 A;  3NEN A;  3CMA A;  2ZM6 Q;  1CHQ D;  1VMP A;  1SSO A;  1B7Y B;  2B63 G;  1G6Z A;  4L6T B;  1PH2 A;  1BUV T;  3EQL C;  4N9T A;  4K5X A;  1K8A C;  3HOZ B;  1N36 L;  1RTN A;  1KNE A;  1PYS B;  4RA8 A;  1JR0 D;  1JMC A;  5I2Y A;  5IP9 G;  2ZM6 L;  1YJN A;  1TWA H;  1WCM B;  1IL2 A;  1VCI A;  1H9S B;  1WTR A;  2A74 C;  3PIO A;  1QZH A;  3CC4 A;  2K50 A;  1IW7 D;  2G9H D;  2EYP A;  1SYG A;  1GVP A;  3BJU A;  1GUW A;  2A73 B;  3OIP A;  3MTS A;  2JN4 A;  3WWV A;  3BVG A;  1LTL A;  2B8F A;  3OMC A;  3J81 c;  2A6E D;  3I4N B;  2NVY H;  3JAM i;  3CC2 A;  4R4Q A;  3J7A 5;  3CKI B;  2F0L A;  2OEO A;  1PHJ A;  4G7Z C;  3WOF A;  3W5O A;  3H3V I;  1XTD A;  2BH2 A;  1YHQ A;  2XTI A;  3TEH B;  3STB D;  2FIN B;  1S72 A;  3L7Z C;  5FLX L;  4B3R Q;  2JEB I;  1DGS A;  1MSG A;  1KLG D;  5C5M A;  3K7A H;  3U58 A;  1GUT A;  5C4X G;  1XX8 A;  3H91 A;  3K6O A;  1D2B A;  1WTP A;  1QJO A;  3HKZ G;  4ZAI A;  1EFW A;  2UUA L;  1RIP A;  1S40 A;  1DXM A;  3GTQ B;  3IAY A;  2KJX A;  1STN A;  3NWS A;  1SFO B;  1GXD C;  3F2U A;  1PA6 A;  4OX9 Q;  2QGQ A;  1KD1 C;  3PIP 3;  3F2C A;  4KLK A;  3QO2 A;  4KKT A;  1IBL Q;  1WFQ A;  1M1K C;  3NWT A;  5EPK A;  4X65 L;  5IP9 H;  4U68 A;  2BA0 A;  1EQT A;  3HOX B;  3ND8 A;  2PCF B;  4LF9 Q;  2RDG A;  1WTQ A;  2F0F A;  3OMG A;  3DWQ A;  3C3L A;  4A3G B;  1B50 A;  1IYU A;  2EXZ A;  1LTG D;  1AN8 A;  4NXN L;  1HA6 A;  4JI7 L;  4HID A;  1EYC A;  4X3K A;  1EEF D;  3U9O A;  4LUO A;  1PTO F;  4A3C G;  4RHR A;  1U4L A;  2CHB D;  4LF9 L;  2WB1 G;  4NKL A;  1OTC A;  4YIJ A;  2KCC A;  4RH6 A;  4A93 H;  1YNN D;  3NSW A;  1LM0 A;  1IYV A;  3G6J B;  4LFA Q;  3A54 A;  1HR0 W;  5CV4 A;  5IE8 A;  5KGU A;  4LF5 L;  1HQR D;  4GLX A;  4HSV A;  1J5E L;  1ENC A;  1D8L A;  2K28 A;  4DKA C;  1BKB A;  2OQK A;  3K0Y A;  3GTO B;  4AYB B;  1ML0 D;  1NTG A;  1XWE A;  2Z4I A;  4K8I A;  4KD4 A;  3VA5 A;  1NJI C;  3GTP H;  1UEB A;  1HZA A;  1YJ9 A;  1I4R A;  2YU9 B;  3TP8 A;  2VS1 A;  4NB3 A;  2K75 A;  1E24 A;  2B2V C;  3J81 E;  1B3A A;  2WII B;  4C1N I;  3S2H B;  2CWP A;  5IGD A;  5FK9 C;  4C3I G;  1YNX A;  4R8I A;  3MHB A;  5LMN W;  4A3I G;  1V43 A;  3SK4 A;  3J81 j;  4ZQ3 A;  4V19 0;  4IUT A;  2A68 D;  5D65 A;  1BDO A;  2HD3 A;  2LMC B;  4A3B G;  3D3R A;  4DNT B;  2WAC A;  2SNS A;  3JAM L;  3W3A A;  1HH2 P;  1U0L A;  1OXX K;  2F0N A;  4OWT B;  1YNJ D;  3AFQ A;  4JI8 L;  2K14 A;  1WTO A;  2M00 A;  1WCM H;  3V2T A;  5M3F B;  1P8L A;  4XIG S;  1ROD A;  4FF3 A;  1VQB A;  5HUR A;  1JOO A;  3IRB A;  1N8R C;  1S4Z A;  4C3I B;  1VQL A;  4DAY B;  5C0X J;  5ELE A;  2XRS D;  3S24 A;  2E74 C;  4JI8 Q;  1XPR A;  3CCE A;  1RJT A;  1DJR D;  4RAU C;  2ZXR A;  4KHP L;  1Y69 U;  3PO3 B;  1TWC B;  1PFS A;  4R4I A;  5C4Z A;  1JJC B;  2GA4 B;  2QDB A;  1I6V C;  4A93 B;  1FL0 A;  4GLV B;  4IUP A;  1QVC A;  1HNZ Q;  1DM0 B;  2FFK B;  5LMU Q;  5IT9 E;  1HFN A;  1KTK A;  1FYC A;  1ILQ A;  2JA5 B;  2A69 C;  5C4X B;  3CAM A;  2VL6 A;  4JBM A;  1TY0 A;  2PI2 E;  1LUZ A;  2V1C C;  4EVO A;  3GV6 A;  5A35 A;  4O0A A;  1ZXT A;  2ALY B;  1FJG Q;  2HT1 A;  4A3I H;  5LMN L;  1E22 A;  3UDI A;  2WKD A;  1DZ1 A;  1TKW B;  3GTK H;  3K58 A;  2CW0 D;  3J7A F;  3CHB D;  5GRO A;  4A3B H;  5IYC G;  2RKS A;  1SNC A;  4GN5 A;  4RGN A;  4A3E G;  4B3T L;  4R4C A;  4C3H H;  2SEB D;  1EZ6 A;  4DV2 Q;  2IL8 A;  2AHO B;  1HQM C;  2PYK A;  4I7A A;  4KJN A;  3T16 A;  5M5X H;  3OOC A;  3HOX G;  4G7H C;  3RLN A;  2RQX A;  3GP7 A;  2UXD L;  2MO1 A;  3NE5 B;  1PH1 A;  4FO2 A;  1SE4 A;  3PGZ A;  1KDB A;  2ICE C;  2TMP A;  2CVR A;  2VQE L;  1YJW A;  4KY5 A;  4IJH A;  2NZ1 D;  4BBS B;  1VQ9 A;  1VQP A;  4ZKC B;  3A7A B;  3CCL A;  3TZU A;  2WB1 B;  4YHH L;  5K5P A;  4YCW A;  4LF4 L;  1PZI D;  3GQB A;  5ELB A;  1CQF A;  2IPK D;  2A19 A;  1G29 1;  4DV4 L;  4POG A;  3I4M B;  3S17 B;  1G51 A;  2ATW A;  2SOB A;  4UPA A;  1E2Z A;  1MJC A;  3J80 E;  1BQQ T;  2F1M A;  3G4S A;  4QUC A;  3GTM H;  3HOW G;  1NY4 A;  4DV1 Q;  1C8C A;  1LTI D;  1HFG A;  4B9X A;  2LY7 A;  4JK1 C;  1RKN A;  4WJW A;  3W1G A;  1TS5 A;  3S9W A;  3W1B A;  1S3O A;  1IBM L;  1VQ8 A;  5IOC A;  3J7Z C;  2WAQ B;  3MFY A;  4IJL A;  1IL8 A;  4DXF A;  3PIO 3;  3HOZ G;  4QUF A;  4BWG B;  1F2Z A;  3NQI A;  4LF8 Q;  2EYH A;  1KRS A;  2N8N A;  1N32 L;  4JVZ A;  4B9W A;  4JOI A;  4F7X A;  5FLM H;  1VQK A;  1Z7T A;  2ZXP A;  2XNA C;  1E0B A;  5BR8 L;  4IPH A;  1MSH A;  4LK1 C;  1QB5 D;  2F03 A;  2EY2 A;  4RCN A;  5FLM G;  1UE1 A;  1ZEQ X;  3GTJ H;  1N32 Q;  1ET9 A;  5IWA L;  2JXM B;  2HIV A;  3S1R B;  2K03 A;  2E5L L;  1Y1V H;  2DN8 A;  1V1Q A;  2JA8 G;  1OXS C;  4FVM A;  1PMR A;  1EY8 A;  3FKI H;  1NBW A;  1GKH A;  3B6Y A;  1XMQ Q;  2FJ2 A;  1LTB D;  1LTS D;  4A3M B;  5LL6 S;  3TP6 A;  1C9O A;  3PO2 H;  4A3B B;  1HNW L;  3FHW A;  1F9S A;  1ICW A;  3E3X A;  4ZUI A;  3ERS X;  1U4M A;  1BBW A;  2N49 A;  1DYQ A;  1TWG B;  1SNP A;  2G9D A;  2B2U A;  3WOE A;  4OEL B;  2EDG A;  2M9V A;  3MWY W;  2QCP X;  4O42 A;  4MIU A;  1XYI A;  1ICF B;  1K28 A;  2MP1 A;  4POF A;  4K5W A;  4S3S A;  3KUP A;  4IZ8 A;  2VUM B;  5M5Y H;  5FKA C;  2QIL A;  5ELD A;  1YZ6 A;  2EJM A;  4IUQ A;  3DEO A;  2ZXO A;  2RDF A;  2R7D A;  5JJL A;  3JC6 6;  2EYM A;  5GAE C;  1PVO A;  1Q12 A;  2HCI A;  2PQE A;  1NCV A;  4A3L H;  3M85 A;  4JYA L;  5I2X A;  4JI4 L;  3I55 A;  2KED A;  5T1I A;  3BZD B;  3RN2 A;  4G57 A;  3CQZ B;  2F0M A;  3E0E A;  1ENF A;  1O78 A;  5M3F H;  3HEJ A;  3MA2 B;  1EY0 A;  4GLA C;  4DK3 C;  1G2T A;  5KIX A;  5C3E G;  4GKK Q;  3OYY A;  4IFD G;  2F3W A;  4UAI A;  4YWL A;  2D9U A;  2MHV A;  1Y1W B;  1JIC A;  2Q2U A;  2HIX A;  2DUD A;  3C1F A;  4HIK A;  2B2Y C;  1QNK A;  3A7L A;  4JI0 L;  2UUB Q;  2I46 A;  1HZB A;  4LF7 L;  3HOW H;  4NMZ A;  3J7Y W;  1RTO A;  2NN6 I;  3AMU A;  4LUV A;  1K83 B;  4X62 Q;  1KXL A;  1II3 A;  1Y1W G;  1TY2 A;  1B9N A;  1SNQ A;  2NZH A;  1QZG A;  5CV6 A;  4AQY Q;  1B9M A;  3QIA A;  3I2Z A;  4X62 L;  3T53 B;  4ULL A;  1YHB A;  4DA2 A;  3MXG A;  3VR3 A;  4GNX A;  2F0I A;  3I4M G;  2F3I A;  1YNJ C;  3LGJ A;  2D0P A;  1OXT A;  4A3M H;  1F9Q A;  5ISR A;  1MI2 A;  4FF2 A;  4NW2 A;  3KJO A;  1PRT F;  2RVL A;  4DAM A;  1Q86 C;  1MIU A;  5BN4 A;  3NEM A;  1PV4 A;  1SNM A;  2L55 A;  4CJ2 C;  3NPP A;  3CQZ H;  4OO1 G;  1KAW A;  4JBJ A;  4KJO A;  3S16 H;  4LFC Q;  2NZO A;  3H0G B;  2FMM A;  2RHQ B;  3OPO A;  4X6A H;  5EPL A;  1A6X A;  1PH5 A;  3S1M B;  2IHF A;  4QQB X;  1N34 Q;  2K04 A;  4TSS A;  2HDL A;  3H09 A;  2KEN A;  4JI6 Q;  2E2I H;  5BN5 A;  4I65 A;  2Z9H A;  2NVQ H;  1J8I A;  2E2D C;  4DN4 M;  1GD7 A;  4YWM A;  3KBG A;  3MXN A;  4WJ3 M;  3F8T A;  5JEA G;  5M3F G;  1HTL D;  4I7Z C;  4IO9 A;  4NXM Q;  2D0O A;  1X56 A;  4JI1 L;  3A8J E;  4PQX A;  1F77 A;  4F88 A;  1EQV A;  3K59 A;  1PH8 A;  2JA8 B;  4L5T A;  1N36 Q;  4PNY A;  2K5V A;  1F9P A;  1V9P A;  5I4D A;  1IW7 C;  2JSO A;  3L9A X;  4A3D B;  2E2H B;  1WD0 A;  2E76 C;  2VY3 A;  4CKC A;  3J81 i;  3KK7 A;  4BBR G;  4K6D A;  1LAC A;  2WKC A;  2CWA A;  1AEX A;  4JV5 L;  1UAP A;  2VB2 X;  4XYQ A;  3SXH A;  3G7L A;  1PRT B;  2LXK A;  3RN5 A;  2XSC A;  3CCV A;  2KA7 A;  1QVG A;  3PF4 A;  2X6G A;  1MD2 D;  3H6M A;  1FNV A;  3HZX A;  1TU2 B;  2DJG C;  1X9N A;  3ITP A;  4JV5 Q;  1SBB B;  4RKL A;  2IX3 A;  4IUR A;  4A3I B;  1ENA A;  1EYA A;  2E8G A;  1N33 L;  1K9M C;  1CKN A;  3A5U A;  4DK0 A;  2K5H A;  4PV1 C;  2R7F A;  3U9S A;  5CC4 A;  2PW7 A;  2JJQ A;  3FKI B;  1KDC A;  3OIQ A;  3FPP A;  4RHS A;  5GAH C;  3A74 A;  5JJI A;  1STE A;  1T5E A;  1QIL A;  1U5K A;  2UUA Q;  4DFA A;  1F2M A;  2VB3 X;  3J80 L;  5C4J B;  1LO5 D;  3HFZ B;  1GUO A;  1PTO B;  1N9W A;  1U9R A;  1B44 D;  1Q81 C;  3GTL B;  3S1N H;  3ND9 A;  3H3V C;  2V4D A;  1O7I A;  1L0Y B;  4B3S L;  1PTO D;  4H0L C;  1YIJ A;  4DK6 C;  4NDX A;  2EJG C;  1SYF A;  2IW3 A;  1RL2 A;  4PMW A;  3EVQ A;  4X65 Q;  3OTO L;  2RSO A;  2NYZ D;  5COR A;  5FO8 B;  4PG3 A;  1O80 A;  3OW7 A;  5J22 A;  1I6H B;  1AH9 A;  1TVX A;  4DV7 L;  4G4K A;  2N88 A;  4B3S Q;  1G91 A;  4B08 A;  1IBK Q;  2F0P A;  5C6A A;  3Q6S A;  4ZRZ A;  4GNX C;  4PMB A;  1DD2 A;  3OTO Q;  1JC7 A;  2SNM A;  3KLS A;  4KN7 C;  2OTL A;  3GTL H;  1JOQ A;  2K1B A;  2E2H H;  4A3D H;  4FXD A;  3E5S A;  1Q82 C;  4C3I H;  2M2L A;  5JJK A;  2EYL A;  2Z4H A;  4FXK C;  1VQD A;  5C0X H;  4OXP A;  4KY6 A;  3MXP A;  3PQI A;  1NNX A;  4X64 L;  4H44 C;  4KV6 A;  5JPM C;  2RCF A;  1J5E Q;  1GHK A;  5M9O A;  2O2L D;  4GN3 B;  4X66 Q;  3QWN A;  2NN6 G;  2L9H A;  3LNN A;  5FO7 B;  1IZ6 A;  4R9W A;  3TS0 A;  4FF1 A;  4X64 Q;  1UNS A;  2K01 A;  4KKU A;  4DV6 L;  2R92 H;  2NN6 H;  3GTM B;  1ONL A;  4L5Q A;  4DAV A;  4XDX A;  5CV7 A;  4HJ8 A;  3GTO H;  4DR5 L;  3T13 A;  1TS3 A;  5EPJ A;  1NE3 A;  1LLR D;  2LSS A;  1GHJ A;  2HQL A;  4LF5 Q;  1QCB D;  2PZW A;  2XGT A;  4H7B A;  3VR2 A;  4DV3 L;  4R1J A;  3S2H H;  4IPC A;  1UE7 A;  1BR9 A;  3Q0A A;  4LMQ D;  3HKZ E;  4DR5 Q;  5DEH A;  2EY6 A;  1RHP A;  2JP1 A;  4HTH A;  3QOL A;  1E2V A;  3M4Q A;  4V0B A;  1PFM A;  4A3J G;  2B8G A;  3D6W A;  1K3B C;  3J80 c;  2D2C C;  1GO3 E;  5DM7 3;  2UU9 L;  2B63 H;  4DR4 L;  5IGB A;  3T1H Q;  1WI5 A;  1L1O A;  1LTR D;  3IFT A;  1FGU A;  3M3Y B;  4A3L G;  2EJF C;  3NTI A;  1EYD A;  1SRO A;  4DV0 Q;  1IXR A;  2J0T D;  3MZ5 A;  4UP9 A;  2PO4 A;  4P72 A;  1LT4 D;  1X6O A;  4A75 A;  4DU9 A;  1NUC A;  5IIF A;  4RG1 A;  4Y7N B;  1CTM A;  2EY1 A;  1CZG A;  2RSN A;  5J39 A;  1I4P A;  2H5X A;  2R6G A;  3R8B A;  2KHJ A;  1M8A A;  4YCV A;  4L5S A;  1CSP A;  3HOX H;  3DUZ A;  1K8G A;  1XPU A;  4TRD A;  4HIO A;  1Q8I A;  2F3V A;  2KEE A;  4QY7 A;  4BY1 H;  1SLJ A;  1PFN A;  4A3K B;  4IFD J;  1NR4 A;  5EJW A;  2MFI A;  2VW9 A;  4LAA A;  3ULP A;  2AWN A;  3ZJY C;  1IKM A;  3D4D A;  4KMU C;  2KVM A;  1FJG L;  3DLL A;  3PO2 B;  4ABN A;  4HSP A;  3OWF A;  1TWF H;  1NMG A;  3FVQ A;  2YV5 A;  3K81 C;  1X3E A;  3VR5 A;  2A8V A;  1HPC A;  4LF6 Q;  4R4T A;  3VYR A;  2CH4 W;  2IX1 A;  4P74 A;  1XNR L;  3CCS A;  2IWH A;  1QUQ A;  1EOT A;  1Q1E A;  2B3G A;  4DV2 L;  2K4K A;  4JBW A;  2NTT A;  4C2M H;  1OO9 B;  4EGV A;  1VQ6 A;  4A76 A;  3S2D H;  2IY5 B;  4XQQ A;  4GN4 B;  4IPD A;  2R61 A;  3MVV A;  1K8O A;  5M5W H;  2DGY A;  4DV5 Q;  4DR1 L;  1BCP F;  1QNU A;  3FEW X;  4K0K Q;  1IYJ B;  3CXC A;  2E2J H;  3UE1 A;  1VS0 A;  5DM6 3;  4A3J H;  4HJ7 A;  2B2W C;  1WD1 A;  3CD6 A;  2CH4 A;  2H1E A;  2HCC A;  1AFP A;  1D5Z C;  4MHE A;  4XT1 B;  1QWY A;  4KHV A;  2MUY A;  5IYD H;  1B53 A;  3SDZ A;  4DV5 L;  1H9M A;  3VDY A;  3I4O A;  1SYB A;  4AYB E;  4N8X 1;  2JA6 B;  2F0S A;  2X6L A;  3RD4 A;  2UUC Q;  4B3T Q;  4K0K L;  3KOJ A;  4CJ0 B;  2F0W A;  5KNC A;  3RZD B;  1AW7 A;  1EUJ A;  1GUG A;  3ULJ A;  4A3K H;  5JPN C;  2IT1 A;  4A3C H;  2XIW A;  5CBE E;  1KLU D;  4B3R L;  3P1H A;  1KAB A;  4ZLT F;  1EL0 A;  1H95 A;  1UE6 A;  3RR5 A;  4CDC C;  2J4X A;  1LTA D;  1EOV A;  4JI3 Q;  3BZK A;  1PRT D;  1H9R A;  4BBS G;  1JQY D;  3A55 A;  3FKI G;  1I50 B;  1K83 H;  1SYC A;  1J6Q A;  3RNU A;  5JEA J;  1IBM Q;  3F2D A;  4A3G G;  3UI2 A;  3U4V A; 
#chains in the Genus database with same CATH homology
 3HOV G;  1UE5 A;  4LF4 Q;  2MNA A;  1NMF A;  3TRE A;  1I94 Q;  4DR1 Q;  4IFD I;  1VQ4 A;  2RHS B;  3TS2 A;  4POF A;  3K7U C;  3T1Y Q;  2OQ0 A;  2JA7 H;  1Q46 A;  1OXU A;  3J80 i;  3CCQ A;  2QA4 A;  5M5Y H;  1VQ7 A;  4OWW B;  1B8A A;  2GVA A;  2JE6 I;  4AYB G;  1YZ6 A;  3CCJ A;  2ZJP A;  1CSQ A;  1VQH A;  4DR3 L;  1IBL L;  2ZJQ A;  3KLW A;  3M3Y H;  3S1M H;  1I94 L;  2R7D A;  2Z6K C;  4MZ9 A;  5JJL A;  1A0I A;  2CFM A;  3JC6 6;  1WYD A;  4J15 A;  1SRU A;  4KHZ A;  1XNR Q;  3S1Q H;  5GAE C;  1PVO A;  5LMN Q;  1Q12 A;  1I50 H;  1TWG H;  3T1Y L;  3H0G G;  1E7Z A;  5C0X I;  3E9H A;  4A3L H;  2D62 A;  3M85 A;  4JYA L;  4AQY L;  1A63 A;  4JI4 L;  3T1H L;  2R7Z G;  3I55 A;  1MKH A;  2K5N A;  3PCO B;  4OO1 I;  3CCM A;  4IOA A;  2PMZ E;  1E1T A;  1VQC A;  2YTY A;  4JCV E;  3RN2 A;  3HKS A;  1HNX Q;  3E0E A;  1WCM G;  2AWO A;  2GVB A;  2WB1 E;  4JI3 L;  2AKW B;  4BXX G;  3PV0 A;  5M3F H;  2EIF A;  3AFP A;  4GLA C;  3SGI A;  4DK3 C;  4HJ5 A;  4BY7 H;  4A3G H;  1X3G A;  5C3E G;  4P71 A;  3RZD H;  1YI2 A;  4UP8 A;  4GKK Q;  3OYY A;  4IFD G;  4NXM L;  2UXD Q;  4YWL A;  3KF6 A;  1YHA A;  3S1R H;  3M9B A;  3GDE A;  3AQQ A;  3I4N H;  2Y0S G;  3G48 A;  3AYH B;  5C44 G;  2Q2U A;  4LWC A;  1XNQ L;  4A93 G;  5HGQ A;  2UUC L;  3M4O H;  2HIX A;  2DUD A;  4HIK A;  4BA1 I;  3RLF A;  1K0R A;  3KF6 B;  1YIT A;  4JI0 L;  2UUB Q;  2I5H A;  4RMF A;  3BZC A;  3U4Z A;  1HZB A;  4LF7 L;  3HOW H;  1XMO Q;  1E1O A;  2NN6 I;  4LUV A;  4A3D G;  4X62 Q;  1KXL A;  1TWH H;  1Z47 A;  1Y1W G;  3D31 A;  3TRZ A;  1PH6 A;  4DUY Q;  4OWX B;  2NZH A;  1QZG A;  2OCE A;  1EYG A;  3NEN A;  3CMA A;  1K73 C;  4HIM A;  4KI0 A;  4AQY Q;  1VQF A;  2ZM6 Q;  4JI4 Q;  3I2Z A;  4X62 L;  1B7Y B;  3HOU H;  2B63 G;  1E3P A;  1YHB A;  3L0O A;  4DV1 L;  1PH2 A;  4GNX A;  3GTQ H;  3I4M G;  2JA5 H;  2F3I A;  1K8A C;  1M90 C;  1N36 L;  3LGJ A;  1HZC A;  2D0P A;  1OXT A;  4A3M H;  1PYS B;  5IYC H;  1JMC A;  2PQA A;  3KJO A;  4DAM A;  1Q1B A;  5IP9 G;  2KHI A;  2ZM6 L;  1Q86 C;  1JB7 A;  1YJN A;  1MIU A;  2Y0S E;  1TWA H;  3I4N G;  1IL2 A;  4NXN Q;  3NEM A;  1VCI A;  4FDB A;  1PV4 A;  5C4J H;  2I0Q A;  4OO1 G;  3CQZ H;  1KAW A;  4JBJ A;  3U50 C;  3H15 A;  1QZH A;  3PIO A;  3S16 H;  4LFC Q;  1VQ6 A;  3CC4 A;  2K50 A;  2NZO A;  3BJU A;  1GVP A;  2JQO A;  2YYZ A;  2RHQ B;  4LNQ A;  4X6A H;  1PH5 A;  3WWV A;  5AJ3 Q;  2IHF A;  1LTL A;  1CKN B;  4OON A;  4EX5 A;  4QQB X;  1N34 Q;  3J81 c;  2NVY H;  3JAM i;  1XJV A;  2KEN A;  3CC2 A;  4R4Q A;  2E2I H;  4DNI A;  1I3Q H;  4JI6 Q;  4LFA L;  5BR8 Q;  3J7A 5;  4BBS H;  2NVQ H;  1PHJ A;  2ZTE A;  5GAG C;  1EIY B;  2OWO A;  3W5O A;  4QGU A;  3H3V I;  1XTD A;  1GD7 A;  3I7F A;  3PO3 G;  2BH2 A;  4YWM A;  4GOP A;  1OXV A;  2N78 A;  1YHQ A;  2UXB L;  2XTI A;  4WJ3 M;  3F8T A;  3TEH B;  5JEA G;  5IWA Q;  1JJG A;  5M3F G;  4IO9 A;  3STB D;  1S72 A;  4NXM Q;  2D0O A;  3L7Z C;  3HOY G;  2I5L X;  3K0X A;  4B3R Q;  1X56 A;  1DGS A;  2JEB I;  2N3S A;  3PUW A;  2NVX H;  2R92 G;  4KHP Q;  4LW1 A;  3CME A;  2RF4 A;  4JI1 L;  1CKM A;  3BU2 A;  4R4O A;  5FJ8 G;  3K7A H;  3U58 A;  2B29 A;  4XTC S;  1YBY A;  1HNW Q;  1PH8 A;  2ASB A;  5C4X G;  4L5T A;  1N36 Q;  2OTJ A;  2K5V A;  1V9P A;  4JI0 Q;  2UXB Q;  3PUV A;  3HKZ G;  4LF7 Q;  1EFW A;  2UUA L;  3M7N A;  1RIP A;  1S40 A;  4JI5 Q;  2VY3 A;  1JE5 A;  3FP9 A;  1VQI A;  3J81 i;  4WJ4 A;  4MTN A;  3JAM c;  4BBR G;  2WAQ E;  4A3E H;  1QVF A;  4A3F H;  2CWA A;  4JV5 L;  1X54 A;  4DPG A;  5EAY A;  2NVT H;  4HJA A;  2LXK A;  3UDF A;  1VQE A;  3KYH C;  2QEX A;  1PA6 A;  2R7Z H;  2RCN A;  4OX9 Q;  3RN5 A;  2QGQ A;  1KD1 C;  2CQO A;  3CCV A;  3F2C A;  1QVG A;  4DR4 Q;  2AMC B;  4KLK A;  4JI5 L;  2BA1 A;  4GOP C;  3PF4 A;  1IBL Q;  1WFQ A;  1M1K C;  1QUQ B;  2IHE A;  4X65 L;  4JI6 L;  5IP9 H;  1KL9 A;  1X9N A;  4JV5 Q;  2BA0 A;  1I6H H;  4C3J H;  5IY0 A;  4DV0 L;  1KRT A;  2MO0 A;  4LF9 Q;  2KCT A;  3F1Z A;  1CUK A;  1L1O C;  1TWC H;  4NXN L;  3KJP A;  2E8G A;  2JA7 G;  1PYB A;  2MQH A;  1N33 L;  1JT8 A;  3MXN B;  1K9M C;  4JI7 L;  1CKN A;  4HID A;  3H3V H;  4LFC L;  3A5U A;  4LUO A;  2K5H A;  3K80 C;  2Z0S A;  4A3C G;  4LF9 L;  2R7F A;  4BA2 I;  2WB1 G;  3CP0 A;  3RLO A;  2WFW A;  2JJQ A;  1OTC A;  5AJ3 L;  1H95 A;  2VQE Q;  3EIV A;  5GAH C;  3A74 A;  4BBR H;  5JJI A;  5C44 H;  1N34 L;  4A93 H;  1U5K A;  2UUA Q;  3H0G H;  5DLQ E;  4Y7N H;  1LM0 A;  4LFB Q;  4YHH Q;  4LFA Q;  2PQA B;  1PH3 A;  1HR0 W;  1JJ2 A;  1X3F A;  5IE8 A;  3HFZ B;  4QJF A;  4LF5 L;  1N9W A;  1TXY A;  4GLX A;  4JOI C;  1Q81 C;  4HJ9 A;  3S1N H;  1WJJ A;  4QL5 A;  1J5E L;  2UUB L;  1D8L A;  4GKJ L;  1O7I A;  2Q2I A;  4DKA C;  4YWK A;  1BKB A;  2OQK A;  5FLX c;  2ZTD A;  4B3S L;  4L5R C;  1XMO L;  1YIJ A;  3CW2 C;  4DK6 C;  1NTG A;  1L0W A;  3UE0 A;  1K3R A;  5E7N A;  1NJI C;  2JA5 G;  1RL2 A;  4JI1 Q;  4PMW A;  3K8A A;  3GTP H;  1UEB A;  1HZA A;  1Z9F A;  4X65 Q;  3OTO L;  1YJ9 A;  2VS1 A;  4NB3 A;  4PG3 A;  5ELO A;  5J3B A;  4DUZ Q;  1AH9 A;  4ALP A;  4P75 A;  2K75 A;  1E24 A;  3UDX A;  2PI2 A;  5ELN A;  4DV7 L;  4B3S Q;  2KCM A;  1Q8K A;  2CWP A;  1IBK Q;  3I4M H;  3S17 H;  1YNX A;  5LMN W;  4A3I G;  4GNX C;  1V43 A;  2PNH A;  1HZ9 A;  3J81 j;  3OTO Q;  3I56 A;  1KQS A;  2OTL A;  3GTL H;  2BH8 A;  2E2H H;  4A3D H;  1HNZ L;  1VQJ A;  1Q82 C;  1VQA A;  3Q8D A;  4C3I H;  5LMU L;  4TVA B;  4A3B G;  4LF8 L;  1FVI A;  3PIP A;  3CPF A;  2JA6 G;  5JJK A;  1G6P A;  1PH4 A;  1VQD A;  4DR7 L;  4OXP A;  1R9T H;  3L2P A;  2UXC Q;  1HH2 P;  3S14 H;  1C7Y A;  1U0L A;  2VZA A;  1AE2 A;  3CPW A;  1XPO A;  2ID0 A;  3RZO H;  1OXX K;  4X64 L;  4OWT B;  5IYD G;  2ZJR A;  1ASY A;  1J5E Q;  3AFQ A;  4JI8 L;  2K14 A;  3GO5 A;  4GN3 B;  4X66 Q;  1WCM H;  1D7Q A;  2NN6 G;  4MNO A;  1P8L A;  2LXJ A;  4XIG S;  2UXC L;  1VQB A;  1N8R C;  3IRB A;  4PZ8 A;  1IZ6 A;  1VQL A;  3ICE A;  3TS0 A;  4DAY B;  5C0X J;  4X64 Q;  4DV6 L;  2R92 H;  3S24 A;  4L5Q A;  4JI8 Q;  3NBH B;  1XPR A;  3CCE A;  3ER0 A;  1Y1W H;  1PH7 A;  3CF5 A;  3PO2 G;  2JA9 A;  4KHP L;  4A3F G;  4HJ8 A;  3GTO H;  2CKZ B;  4LFB L;  4DR5 L;  4ME3 A;  1EQQ A;  1PFS A;  4R4I A;  1NE3 A;  1W3S A;  2LSS A;  1JJC B;  2HQL A;  4LF5 Q;  1VQG A;  1FL0 A;  4GLV B;  1HNZ Q;  1QVC A;  2XGT A;  4H02 A;  4DV3 L;  3HOU G;  3NEL A;  4R1J A;  3S2H H;  4GKJ Q;  5LMU Q;  4B3M Q;  2WP8 J;  4IPC A;  2VQF Q;  4GNX B;  1UE7 A;  3HKZ E;  3CAM A;  2VL6 A;  5IYB H;  3PF5 A;  4JBM A;  3HOZ H;  4DR5 Q;  3CCU A;  2VNU D;  2I5M X;  1A62 A;  1X65 A;  3MEF A;  2C35 B;  5K36 G;  4DR3 Q;  2PI2 E;  1LUZ A;  3M4Q A;  3PUZ A;  1Q7Y C;  2F4V Q;  2V1C C;  3HOY H;  1VQO A;  2WAQ G;  4DUZ L;  4O0A A;  4A3J G;  1P16 A;  1WOC A;  2ALY B;  2Z6K A;  4PZ6 A;  3UDG A;  1FJG Q;  3J80 c;  5GQO A;  3PUX A;  4A3I H;  2HT1 A;  4OX9 L;  5LMN L;  3PSI A;  4B3M L;  1GO3 E;  2VQF L;  2UU9 L;  2B63 H;  1E22 A;  4DR4 L;  3UDI A;  5IP7 H;  4X66 L;  4DV4 Q;  3GTK H;  2YU9 H;  3T1H Q;  1WI5 A;  1L1O A;  2Q2H A;  4IPG A;  2Q2T A;  3A5Z B;  1YVC A;  1FGU A;  4TQU S;  5GRO A;  2FXQ A;  1KHI A;  3KDF B;  4JC0 A;  2JEA I;  4A3B H;  4A3L G;  3G6E A;  1BVS A;  5IYC G;  2JK8 A;  1SRO A;  3CC7 A;  4DV0 Q;  4GN5 A;  1IXR A;  1HNX L;  1ASZ A;  4UP9 A;  4A3E G;  4B3T L;  4P73 A;  4R4C A;  4P72 A;  3EBE A;  2YTV A;  1X6O A;  4C3H H;  1GM5 A;  2R93 G;  3KF8 B;  4DV2 Q;  2AHO B;  4A75 A;  3E9I A;  5M5X H;  3HOX G;  1L2F A;  2HHH L;  3RLN A;  1N33 Q;  4RG1 A;  4DR7 Q;  4JI7 Q;  2UXD L;  4GOP B;  2MO1 A;  1PH1 A;  1X55 A;  2H5X A;  2R6G A;  2KHJ A;  3PGZ A;  1T9H A;  4YCV A;  1XMQ L;  4YCU A;  3STB C;  1EQR A;  5M3M H;  1XNQ Q;  4JG2 A;  3S15 H;  4L5S A;  1CSP A;  3HOX H;  4UP7 A;  3PUY A;  1EWI A;  2VQE L;  1K8G A;  3A0J A;  2CCZ A;  1XPU A;  1YJW A;  4HIO A;  4IJH A;  4BXX H;  1VQ9 A;  1UWV A;  1VQP A;  2YTX A;  3CCL A;  1I5F A;  4QY7 A;  2HHH Q;  4JYA Q;  4BY1 H;  1SLJ A;  4YHH L;  3OW2 A;  4IFD J;  1Y14 B;  4YCW A;  2MFI A;  2VW9 A;  2VUM H;  3GTG H;  4LF4 L;  5IT9 c;  3ULP A;  3D0F A;  2F4V L;  2AWN A;  3ZJY C;  1SMX A;  4DV6 Q;  1SR3 A;  1VQN A;  1FJG L;  4GS3 A;  4NPS A;  3KDF A;  3DLL A;  1CKO A;  4DR2 Q;  4DUY L;  1TWF H;  1NMG A;  2UU9 Q;  1C0A A;  2A19 A;  2YV5 A;  1G29 1;  3K81 C;  1X3E A;  4DV4 L;  4POG A;  2E5L Q;  1G51 A;  1PH9 A;  4UPA A;  2A8V A;  2ATW A;  1MJC A;  1VQ5 A;  4LF6 Q;  3G4S A;  4R4T A;  4A3K G;  3GTM H;  3HOW G;  1NY4 A;  4DV1 Q;  2IX1 A;  1BBU A;  4P74 A;  2R93 H;  4UY8 C;  1HR0 L;  1XNR L;  4DV3 Q;  4LUZ A;  3CCR A;  3CCS A;  4DR2 L;  1L1O B;  4QIW E;  2JA6 H;  4DR6 Q;  2ZTC A;  3W1G A;  3ULL A;  1QUQ A;  1Q1E A;  2B3G A;  4DV7 Q;  3U4V A;  3W1B A;  1B70 B;  2K4K A;  4JBW A;  5C0X G;  3GD7 A;  4C2M H;  4DV2 L;  1IBK L;  4JI2 L;  1S3O A;  2EXD A;  1IBM L;  1KC8 C;  4YY3 Q;  4A76 A;  1VQ8 A;  5H1S E;  3S2D H;  4GN4 B;  4A3M G;  2IY5 B;  3J7Z C;  4IPD A;  4IJL A;  5M5W H;  2DGY A;  4DV5 Q;  2L15 A;  5IP7 G;  5IYB G;  1MJE A;  3HOZ G;  4DR1 L;  1HR0 Q;  5C3E H;  4DR6 L;  4K0K Q;  1IYJ B;  4BY1 G;  3CXC A;  3UE1 A;  2E2J H;  1VS0 A;  2EQS A;  4LF8 Q;  4A3J H;  4HJ7 A;  1KRS A;  2N8N A;  4JI2 Q;  1N32 L;  5GAD C;  4JOI A;  3CD6 A;  4YY3 L;  4BY7 G;  4APV A;  5FLM H;  4PZ7 A;  5IYD H;  4O2D A;  2GN5 A;  5C4X H;  4DV5 L;  1VQK A;  3AEV A;  1A8V A;  3VDY A;  5BR8 L;  3I4O A;  4AYB E;  4IPH A;  3TQY A;  1Y1V G;  2JA8 H;  4AIM A;  2UUC Q;  4B3T Q;  4Y52 H;  4K0K L;  1KIX A;  3KOJ A;  5FLM G;  1UE1 A;  3GTJ H;  1EUJ A;  1N32 Q;  3ULJ A;  5M3M G;  3F2B A;  4A3K H;  5IWA L;  2HIV A;  2IT1 A;  3DM3 A;  3M4P A;  4A3C H;  1VQM A;  1W2B A;  2E5L L;  1Y1V H;  2JA8 G;  1V1Q A;  3PO3 H;  4B3R L;  1OXS C;  4LF6 L;  3EN2 A;  2F52 A;  3FKI H;  2K52 A;  1NBW A;  1GKH A;  1UE6 A;  3RR5 A;  4AH6 A;  3B6Y A;  3G71 A;  1XMQ Q;  4IOC A;  2ES2 A;  4JBK A;  1EOV A;  5HY6 A;  3BZK A;  1C9O A;  1YEZ A;  4JI3 Q;  3PO2 H;  1SFO H;  1HNW L;  1SN8 A;  1AE3 A;  3FHW A;  2IX0 A;  3HOV H;  1SE8 A;  4BBS G;  1LYL A;  3ERS X;  2VUM G;  3KFU A;  5FJ8 H;  4A4I A;  1BBW A;  4EQ5 A;  2A1A A;  3FKI G;  2N49 A;  2KBN A;  4GKK L;  1K83 H;  3RNU A;  1J6Q A;  5JEA J;  1IBM Q;  3F2D A;  4A3G G;  1EIF A;  1HJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...