1XMQQ

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmqQ00
5C44G 2ZM6L 4DV1Q 1SFOH 1QUQB 3L0OA 4JI5L 2OTJA 3S17H 1I5FA 3U58A 4OWXB 4HJAA 1SE8A 1UE6A 1X65A 4PZ7A 3EN2A 5FLXc 3CCLA 4GN5A 3GTPH 1JT8A 1SRUA 4WJ4A 3K80C 4JBWA 4KI0A 2QEXA 1E1TA 3PO3G 4JV5L 3E9IA 1TWHH 5C4JH 3MXNB 3H3VI 3BZKA 3HOXG 3HOZG 2OCEA 4LFBL 2GN5A 3AEVA 4HJ5A 4YWMA 4AIMA 5JJKA 3M85A 4NXNQ 2Q2TA 1EIFA 3HOVG 1Q8KA 1PYSB 2YV5A 3NEMA 4RG1A 2RHQB 5EAYA 2WAQG 2RHSB 1I50H 1B70B 2N78A 4BA2I 1OXUA 3L2PA 4GNXA 3T1YL 2I0QA 1I3QH 2NN6G 5IWAQ 4LF6Q 2Q2UA 3S16H 1EIYB 4LFAQ 1VQCA 1FJGL 1YNXA 2DUDA 4EQ5A 2VUMG 3PF4A 4LF5L 2ALYB 1VQ7A 2A8VA 2NVXH 4POGA 3AYHB 1Q86C 1V9PA 2IHFA 1IBLQ 4GLVB 5GQOA 4BY7H 1P16A 5AJ3Q 1HNWL 1I94L 1E7ZA 2UUCQ 4JI7L 4MNOA 2R7ZG 4QJFA 4X65L 5IP9H 3T1HL 3CCQA 1SN8A 4UP8A 3CCUA 1I6HH 4EX5A 4X66Q 5DLQE 3PUWA 2JA7H 4OX9L 1YBYA 3PGZA 1GO3E 2BH8A 5E7NA 2E2JH 3D0FA 3HFZB 4DR4Q 2JA8G 5LMNL 2AKWB 1YEZA 4NPSA 1XNQQ 3PO3H 1AE2A 4BBRG 2Z6KA 3G6EA 1XTDA 4BBSG 4JI4L 5C4XG 2AMCB 1KRSA 2HIVA 3AFQA 4AYBE 4A3MH 4DK3C 4B3SL 4PZ8A 1Q46A 1VQIA 3A0JA 4BY1G 4TQUS 3WWVA 1PH7A 4R4QA 3JC66 1VS0A 1E22A 3SGIA 1WFQA 4A3LH 1PH3A 1GM5A 4NXML 1VQ4A 2CCZA 3RNUA 4JI8L 4GLAC 4NB3A 4LF7Q 1ASZA 2UU9L 4GKJL 1VQBA 4B3RL 3KF6B 2WP8J 4LWCA 2YTXA 4LNQA 4R4CA 1SR3A 2F4VL 2NVQH 5C0XG 3CC4A 5C0XI 2NZHA 4R4TA 4B3TL 5FJ8H 4DV7Q 3VDYA 2VUMH 3GTLH 3CCEA 3U4ZA 4QIWE 1YHQA 1OTCA 5JEAG 5IP7H 4JI0Q 2JA6H 2K14A 4QL5A 4YHHQ 4DR2L 1G291 4A3EH 1XNRL 1XMOQ 1IL2A 4IPCA 1CSPA 2NVYH 1KL9A 2CFMA 2GVAA 2JQOA 3K7UC 5C3EH 1EQRA 1SLJA 2Y0SE 1UEBA 3J7ZC 4A3CG 3S24A 3GTKH 1NMFA 2HT1A 4DR5L 4DAYB 1HNXQ 4HIOA 3G71A 1S3OA 2JA9A 4R4IA 1J5EQ 4DV5L 1N9WA 3I4NH 1FGUA 4L5TA 4BBSH 3STBD 2YTVA 4DUYQ 4DV6L 1VQMA 2QGQA 4DNIA 3J80i 3GTJH 1OXXK 3AFPA 1IYJB 3CMAA 4X64Q 1CUKA 2V1CC 3CCSA 4GNXB 3F8TA 1N33L 1S40A 2MQHA 1L1OB 3B6YA 1JE5A 4DV6Q 1E1OA 3CPFA 1L0WA 3UDXA 1HR0W 3PV0A 2HQLA 5C0XJ 3F2BA 2VQFQ 3KFUA 2KCTA 4J15A 1JJ2A 1Q1EA 1YVCA 1A63A 2NZOA 2PNHA 4BA1I 1LTLA 3Q8DA 5HGQA 1HNZQ 5JEAJ 4LUOA 5IT9c 1G6PA 4LUVA 5GADC 3HKSA 2OWOA 4O2DA 5JJLA 4O0AA 1PVOA 1Q7YC 4YY3L 3PUVA 1KD1C 1TWFH 4DAMA 1E24A 2KBNA 3K0XA 1YHAA 3K81C 3CCRA 4B3ML 2K4KA 4BY7G 2IY5B 1PH8A 3KLWA 1VQDA 1KHIA 2EXDA 4DUZQ 4JI1Q 3BU2A 2VZAA 2Z6KC 3KDFB 1N36Q 5IP9G 1Z47A 3NBHB 4KHZA 4LFCL 1BKBA 4C3HH 1C7YA 2JA7G 2I5LX 1YJNA 4JI6L 3I56A 2K5VA 2JJQA 4XTCS 4JCVE 1TXYA 4AQYQ 4R1JA 4WJ3M 1VQFA 1IBML 1EWIA 2ZM6Q 1KQSA 3CXCA 4JI5Q 4HIKA 4QGUA 3F1ZA 1LUZA 2A19A 4XIGS 3PO2G 4OO1G 3M9BA 1PFSA 2XGTA 3RN5A 4A3MG 4A3JH 4JV5Q 4IJLA 3RZDH 1R9TH 3S2DH 4UP9A 5HY6A 1PYBA 4P71A 1UE5A 4BXXH 4LFBQ 3EIVA 1GVPA 1IBKL 4A3LG 3FKIG 2JEAI 1RL2A 5GAHC 1T9HA 4PG3A 2NN6I 3JAMi 4DV0L 3L7ZC 1VQJA 4LF4L 2IX0A 4A3GH 5IE8A 3IRBA 3T1YQ 3ER0A 3PIPA 3KF8B 2EIFA 4JBJA 2ZTEA 2R92H 4GKKL 3CW2C 5FJ8G 3I55A 5IYCH 1M90C 1NY4A 1HZAA 3TQYA 2CQOA 1VQNA 1AE3A 3PF5A 1KXLA 4PZ6A 1FJGQ 3PUYA 1CKNA 5IP7G 2UXBL 2JA6G 3EBEA 2BH2A 4LF5Q 4DV3L 2Q2HA 5IYDH 1Y14B 1KRTA 1HR0L 4A3EG 3TS2A 2ID0A 4JI3L 4A3FH 3CD6A 1XMQL 3M4QA 4DR7L 2ZJQA 4GOPA 5C3EG 4JI2L 1IXRA 2UUAL 3I4OA 1A0IA 1J6QA 2CWAA 2ES2A 2YU9H 3D31A 1HNWQ 1X3EA 1I94Q 4A3BH 4JI7Q 3S15H 2HHHL 4X65Q 1BVSA 3T1HQ 1SMXA 3BJUA 3M4OH 3A5ZB 1YZ6A 2XTIA 4OX9Q 1D8LA 1WJJA 1BBUA 5LMUL 4DKAC 1YJWA 1WI5A 1KC8C 4DV2L 2E8GA 2L15A 5M3MH 4HJ7A 3I4NG 3PO2H 4GS3A 5LMNQ 3CAMA 4JOIA 3HOWH 4A3KG 3HOUH 1WYDA 4IOCA 1QZHA 4OWTB 1MJEA 4GN3B 1N34L 1V43A 4JI4Q 4DR1L 2PQAA 4C2MH 1XPOA 1PH1A 4ALPA 1SROA 2K50A 3FKIH 2VNUD 4B3SQ 2UXCL 3GDEA 2K75A 4LF9L 3ULJA 3PUXA 1PHJA 2R93H 2WB1E 4P75A 3BZCA 4NXMQ 2H5XA 3J80c 2VW9A 1G51A 4UP7A 4JI8Q 2IT1A 4LF8L 2KCMA 1PA6A 4Y52H 5K36G 2UU9Q 4GKJQ 4B3RQ 1QUQA 3H3VH 5JJIA 3RLFA 3HOYH 2F4VQ 4B3TQ 1X3GA 1K8GA 4LW1A 4P74A 1Q82C 5GAGC 3CMEA 2I5MX 2N49A 1PH9A 1X3FA 3G4SA 2B63G 3M3YH 1ASYA 1GD7A 1N32L 4DR2Q 1BBWA 4DR6L 1XNRQ 1DGSA 4JC0A 1MIUA 1V1QA 4HIDA 4PMWA 4FDBA 4HIMA 3CPWA 1K8AC 4KLKA 3UDGA 2CKZB 1XPRA 4DR5Q 3OTOL 4AYBG 1YJ9A 2KENA 3I2ZA 1LYLA 2K5HA 3TEHB 3GTGH 4DV5Q 2UUBL 2A1AA 4UPAA 5IYBG 1N8RC 1PH6A 4L5SA 2K5NA 1U0LA 3ZJYC 4A3JG 4IFDJ 1VQ9A 1YI2A 3GTOH 2ZTDA 1RIPA 3KJOA 4BXXG 1K3RA 5J3BA 1N33Q 2E5LL 2AHOB 3J81i 4IPHA 4APVA 1TWGH 1K83H 2MFIA 3W5OA 3S14H 4A3GG 2UXDL 3U50C 2KHIA 3S1QH 5BR8L 4GOPC 4OXPA 1EYGA 1Y1VG 1NBWA 2R92G 3S1NH 1AH9A 3M7NA 2OTLA 1XPUA 5IYCG 4JYAL 3S2HH 3H15A 4X62L 2BA0A 2Z0SA 3TREA 1CKMA 1YIJA 3RLNA 1Y1WH 5IYDG 3JAMc 2VQEQ 4YY3Q 4DV4L 1VQ5A 2R6GA 2Y0SG 1CSQA 2B63H 1X56A 4A3FG 4B3MQ 2LXKA 4QY7A 4IJHA 2I5HA 3UDIA 5FLMH 2ZJPA 4JOIC 4DR3L 1Q1BA 3HKZE 4A3BG 2AWNA 4KHPL 4K0KL 4MTNA 2IX1A 5IY0A 4LFCQ 3UE1A 1H95A 4JI6Q 3H0GH 4K0KQ 3RN2A 1UWVA 3GO5A 2PQAB 4HJ8A 4RMFA 1PH4A 2PI2E 5M3MG 4OO1I 3RZOH 1YITA 1IBMQ 5IYBH 3HOWG 3PIOA 3HOUG 4DV1L 4A93H 1VQ8A 4L5RC 3DLLA 2MO0A 3RR5A 1VQ6A 2NVTH 2N3SA 2LXJA 1EQQA 2R93G 3F2DA 1VCIA 1C9OA 1TWCH 1JMCA 3K8AA 2QA4A 1K9MC 1IBKQ 2GVBA 3GTMH 4A3IH 4YWKA 1TWAH 1Y1VH 4ME3A 4A3CH 4DV0Q 4A3DG 1JB7A 4LF4Q 3UDFA 3ICEA 5M5XH 3TRZA 4LUZA 4NXNL 3DM3A 3HOYG 2MO1A 2F3IA 2FXQA 3I7FA 1XJVA 3I4MG 2F52A 4DPGA 4YCVA 4GKKQ 1HJPA 2EQSA 2N8NA 4X6AH 2ATWA 2HIXA 2R7DA 4C3JH 1PH5A 3RLOA 5IWAL 4LF6L 1GKHA 2UXBQ 4C3IH 2VS1A 3HKZG 4DV3Q 4LFAL 1EOVA 1QVFA 1HR0Q 1NJIC 4OWWB 1D7QA 3TS0A 3OYYA 1OXSC 2E2IH 4MZ9A 4JI3Q 4YWLA 1HZCA 1XMQQ 3J7A5 4DR7Q 2Q2IA 2B29A 4JI2Q 1VQLA 1L1OA 3E0EA 2UUAQ 1U5KA 3A74A 3OW2A 1L2FA 3ERSX 1IBLL 2JA5H 2HHHQ 4A4IA 1X9NA 5AJ3L 1JJGA 3CCVA 1M1KC 2UUCL 1OXVA 2OQKA 2D0OA 3AQQA 1JJCB 4L5QA 1A8VA 4X66L 5LMUQ 4LF9Q 3NENA 4DV2Q 5GAEC 3W1BA 5M3FH 1HZBA 4DR4L 4IFDG 4IFDI 3CF5A 5C44H 5H1SE 1N34Q 3PSIA 4DR1Q 5ELNA 3S1RH 1LM0A 1XNQL 3KDFA 3STBC 1NTGA 2JEBI 2D0PA 2AWOA 3CCMA 2UXCQ 3KJPA 3J81j 2RCNA 1IZ6A 2YTYA 2K52A 2ASBA 4A3DH 4JG2A 4JBKA 4OONA 1K0RA 3HOXH 3HOZH 4LF8Q 4YCWA 4POFA 3I4MH 4GN4B 4IPDA 1OXTA 3GTQH 5GROA 3J81c 1CKOA 2IHEA 1Y1WG 1O7IA 2D62A 4UY8C 3LGJA 2PMZE 4LF7L 3HOVH 2BA1A 4P73A 4A3KH 4TVAB 1NE3A 2KHJA 2PI2A 1QZGA 1EUJA 1VQAA 1WOCA 3UE0A 5FLMG 4DV7L 3NELA 2VL6A 2RF4A 1NMGA 2WFWA 4Y7NH 2OQ0A 1N32Q 1VQPA 4DR6Q 4IO9A 1W3SA 4JI0L 4YHHL 1W2BA 1XMOL 1VQHA 3PCOB 3H0GG 4AH6A 3CCJA 3FP9A 4DK6C 2B3GA 1C0AA 2C35B 1PH2A 5M5YH 3OTOQ 2R7ZH 1WCMG 1X54A 4A93G 5ELOA 1HNXL 2WB1G 1EFWA 2UUBQ 3A5UA 1UE1A 1VQGA 1B8AA 3E9HA 1QVCA 3M4PA 1KIXA 4IPGA 1J5EL 2ZJRA 2MNAA 1FL0A 4R4OA 1VQKA 1MJCA 3W1GA 1CKNB 3CQZH 4DUYL 2E5LQ 2JA8H 1A62A 2R7FA 2YYZA 4A3IG 2VQEL 4BBRH 5M5WH 4X64L 4GNXC 2E2HH 1X6OA 3CC2A 2UXDQ 5C4XH 4H02A 4GOPB 5BR8Q 4HJ9A 1FVIA 3CC7A 1PV4A 1L1OC 2DGYA 4QQBX 4JYAQ 4P72A 2VQFL 4BY1H 4GLXA 3KYHC 4IOAA 2CWPA 4X62Q 1QVGA 1YHBA 2ZTCA 1X55A 1UE7A 3CP0A 1Q81C 1HNZL 1KAWA 4DV4Q 4YCUA 2VY3A 3F2CA 1Q12A 3ULPA 3G48A 2WAQE 1HZ9A 3PUZA 1MKHA 1B7YB 4A76A 3ULLA 4DR3Q 4JBMA 1P8LA 2JA5G 4KHPQ 2JE6I 3KF6A 1S72A 1K73C 3KOJA 1VQEA 4DUZL 4JI1L 1N36L 5LMNW 1E3PA 2LSSA 3FHWA 3K7AH 1HH2P 3GD7A 1WCMH 1Z9FA 3MEFA 1VQOA 5M3FG 3U4VA 4A75A 4AQYL 3S1MH 2JK8A
chains in the Genus database with same CATH superfamily
2JP1A 2ZM6L 1EYDA 1LABA 2VXWA 5IT9L 4HMIA 1B53A 1GHKA 4HJAA 1SXTA 2XRSD 5FLXc 3EN2A 5D3DA 4GN5A 2F0KA 4WJ4A 3PIO3 2EYMA 5HGTA 4FP5D 1GUWA 5JJKA 1TY0A 2YV5A 4RG1A 3D6CA 5IT9E 2WAQG 5T1IA 4BA2I 4GNXA 1LACA 3T1YL 1I3QH 2F0PA 5IWAQ 4LF6Q 3GTOB 1JICA 1FJGL 4EQ5A 2NVXH 3AYHB 5E4WC 1Q86C 3S1QB 1V9PA 1P16A 2EYFA 5AJ3Q 1I94L 1E7ZA 4MNOA 2F0LA 2R7ZG 5IP9H 3CCQA 1SN8A 4FXKC 4UP8A 3CCUA 3E6ZX 1H9SB 4EX5A 3PUWA 3KBGA 3IFTA 3PGZA 3HFZB 5DEHA 1HXYD 2B2VA 1LTSD 5I2XA 1F2ZA 2AKWB 4KJNA 4NPSA 1XNQQ 2CQAA 4BBRG 1SYBA 1SEBD 1XTDA 4BBSG 4QUCA 4FNFA 5KNCA 1CQFA 4A3MH 1PH7A 1B3QA 4ZKBB 1E22A 5C5MA 4NB3A 5HURA 4A93B 2NVQH 1GJXA 3C1FA 4HCEA 2NZ1D 1YHQA 1OTCA 1F2LA 4IUNA 2JA6H 2X6GA 4QL5A 4RGOS 4YHHQ 4G7ZC 1G291 3HG9A 4NMZA 4H0LC 1XMOQ 1CSPA 4H7BA 2OXPA 2CFMA 4WRDA 3MXUA 2F0HA 2G5DA 4KMUC 3DEOA 4A3CG 3X3NA 3J80L 3I8ZA 4HAEA 4FO2A 1I6VC 2ZT9C 2E2IB 1STNA 3BDLA 3I4NH 1FGUA 4BBSH 2YTVA 2RVLA 3EROA 4DNIA 3QG1A 3J80i 3AFPA 3CMAA 4GNXB 4A3KH 2JA5B 4UDUC 1D2BA 3HS0C 2F3WA 3QIAA 2NWGA 1FD7D 3B6YA 3CPFA 5E3FA 3UDXA 2J4XA 4EGVA 3KFUA 4J15A 4KTAA 1Q1EA 1YVCA 2F0NA 5KGUA 1K8OA 5K36H 5HGQA 4LUOA 1FNUA 4EVOA 5JJLA 4L6TB 4O2DA 2IW3A 3VYSA 1TWFH 1E24A 4B3ML 4HN7A 4KK7A 1SE2A 2IY5B 3IFDA 1D5ZC 1EEID 1WTWA 2Z6KC 3LWEA 3GTQB 3ONAB 4KHZA 3EA6A 1C7YA 2JA7G 1YJNA 4JI6L 4R1JA 1I4HA 1EWIA 3TN2A 2BE5D 4R9WA 2A19A 1PFSA 1NR4A 2LKVA 4A3JH 1R9TH 4KD4A 4UP9A 4BXXH 4LFBQ 3NTHA 5CBEE 5M5YB 2JEAI 4PG3A 2NN6I 4MTKA 2R7ZB 4I7AA 1DD2A 4LF4L 2IX0A 4A3GH 3IRBA 1Q3LA 3PIPA 1TR5A 2EIFA 1STEA 3I55A 1VDZA 1M90C 1CM9A 3D8GA 1HZAA 1Z6HA 3PF5A 3CQZB 3PUYA 2BH2A 4K5WA 5IYDH 4BBRB 2ID0A 4JI3L 4H13C 1NSNS 1TIID 2EOTA 2WKDA 5IGCA 2UUAL 1A0IA 4OIKA 2YU9H 4O1NA 3D31A 1X3EA 4JI7Q 5CR3A 3T13A 3W2DA 1Z7TA 2NTTA 3A5ZB 5J1ZA 1EU4A 2F0QA 5BN3A 3MXPA 1KC8C 4LF9L 3OIQA 3QOLA 1WI5A 4DV2L 2E8GA 4HJ7A 4GS3A 5LMNQ 1VMCA 4ABNA 1MJEA 4JI4Q 5L37A 2PQAA 3RZOB 1PH1A 2VNUD 1DOKA 4B3SQ 2UXCL 5EKLA 3K7AB 1PHJA 2IL8A 4ZLTF 2H5XA 2EJGC 4JI8Q 2IT1A 4Y52H 2KCMA 1PA6A 2UU9Q 4GKJQ 4KV6A 4ZK9B 4CJ0B 4B3RQ 1QUQA 5AFWA 5JJIA 2F4VQ 2A74C 1K8GA 1A2UA 1FYCA 4R8IA 1PTOB 1X3FA 5C4JB 2B63G 2PMZB 3M3YH 3CRKC 4ZKCB 1CHQD 1V1PA 4C3HG 4HIDA 4PMBA 4G7HC 4FDBA 3CPWA 4KLKA 1IW7D 3FEWX 4DR5Q 3SK8A 3V96A 2Z9HA 3OTOL 1QJOA 4AYBG 3P20A 4ZRZA 2E2DC 3GTGH 2A1AA 4K2LA 1EYCA 1N8RC 1PH6A 4L5SA 2K5NA 3ZJYC 1EIHA 3EFXD 1RIPA 1N33Q 3QJYA 1PXUA 1TWGH 1K83H 4OGQC 2JA7B 4OXPA 1EYGA 1Y1VG 2EY6A 3M7NA 1IKMA 2HDLA 3H15A 2E2JB 1PZJD 2BA0A 4X62L 3PO3B 4DV4L 1VQ5A 2Y0SG 2B63H 1TQOA 4C3IG 2OT2A 5FLMH 3UDIA 4DR3L 1Q1BA 3HKZE 4KHPL 3A7AB 2BDOA 4MTNA 2IX1A 5IY0A 4LFCQ 1CA6A 2F4IA 5EBDA 3BYTB 3H0GH 4K0KQ 1UWVA 4HJ8A 2PQAB 2XWJB 1PH4A 2VUMB 2MGSA 1KABA 1YITA 3PIOA 3HOUG 4IUPA 4L5RC 5C3WA 4HMJA 1EQQA 1WTXA 1C9OA 4RFBA 4CHTB 1Y1VH 2PPBC 3GTKB 4LMQD 3UDFA 3ICEA 5M5XH 4DAYA 2EYPA 3L9AX 4ZAIA 4X6AH 2ATWA 2HIXA 4Q0FA 1V1PB 1WTVA 5IWAL 4LF6L 3ERQA 4C3IH 4DV3Q 1QVFA 1EOVA 5D3IB 3DM1A 1HR0Q 4ZCKA 4OWWB 2CH4A 1OXSC 2NBFA 2MUYA 5FLXL 1L1OA 1EQVA 1JORA 4V190 5CYUA 2QDLA 5AJ3L 2D0OA 3AQQA 3FDTA 2ICIA 1JOOA 2ZXOA 5M3FH 2KVMA 1HZBA 4LAAA 3RMHA 4IFDI 1N34Q 4DR1Q 5ELNA 3S1RH 1XNQL 1VF7A 3KDFA 3STBC 3P7JA 1NTGA 3CCMA 1SYCA 2PW5A 2RSOA 4JW0A 3J81j 3KJPA 1IZ6A 4C3HB 2LMCB 5ELEA 4OONA 4HSVA 3HOXH 2O4XA 2K5QA 4PV1C 1I4XA 3J81c 4AYBB 2D62A 2KECA 3HOVH 1SNMA 4P73A 1SSOA 4TVAB 2WINB 1NE3A 2KHJA 3UE0A 1FNVA 2RF4A 3S2DB 1GHJA 1N32Q 4IUUA 1VQPA 3EJIA 3RUZA 3SXHA 4YHHL 1PRTD 2SNMA 1XMOL 3MWYW 3PCOB 1D1IA 4DK6C 2B2UA 2B3GA 5KNDA 1WTRA 5DNFA 2L5TA 2K28A 1UE1A 3E9HA 1KIXA 2Y0SB 3R8BA 1ZXTA 1ET6A 3U9SA 1PMRA 2H1EA 4NP5A 1A62A 4CKEA 5M5WH 2A6HD 4GNXC 3S15B 1X6OA 2G9HD 3J7AF 2DJGC 3M4OB 1CHPD 5C4XH 4GOPB 4BY1H 4H44C 1EWCA 3Q0AA 4RCOA 4JVZA 3H91A 4K6DA 3HOUB 1DJRD 4B9WA 4C2MB 2LS01 2F0OA 1S5FD 1HZ9A 4YIJA 5C0XH 3PUZA 1P8LA 5JOBA 4RGMA 2JE6I 5JEAH 3KOJA 1VQEA 1HQRD 5T1GA 4E6IA 5LMNW 3FHWA 1H9JA 1F9PA 4XYOA 4A75A 3GTPH 5C44G 3VYRA 2BDNA 1SFOH 3SK5A 1RD9D 3S17H 3W3AA 3U58A 1SE8A 3DEPA 1JT8A 3TP7A 3K5NA 3K80C 3EVQA 2J0TD 4JBWA 2QEXA 4ULLA 4GZYC 3H3VI 3BZKA 3HOZG 1GXDC 2OCEA 4LFBL 5IOCA 1BXTA 4YWMA 4N8X1 1PFNA 3M85A 2Q2TA 1Q8KA 1SYGA 2RHSB 5IGFA 4V0BA 2RSNA 2I0QA 4LFAQ 1VQCA 3VA5A 5A2QE 1SAPA 3NUCA 4CDDC 2ALYB 1LT4D 2L11A 2A8VA 4O42A 2IHFA 1IBLQ 3AMUA 4BY7H 5JVG3 3I91A 3S2HB 4JI7L 4FF2A 1IYVA 2AUKA 1I6HH 5DLQE 5JPNC 4CKCA 3K5MA 3NXWA 5E7NA 1PZKD 3D0FA 3UI2A 2FJ2A 4DR4Q 2JA8G 5LMNL 3I72A 1YEZA 5EPJA 4DK0A 5FOBB 1AE2A 2DNCA 5COYA 3K0YA 4JI4L 4F87A 2AMCB 2HIVA 4B08A 1LLRD 4B3SL 1Q46A 1VQIA 2R61A 5IGBA 4TQUS 3SGIA 1WFQA 3CHBD 1GM5A 2LY7A 1VQ4A 2CCZA 4JI8L 4LF7Q 2UU9L 4GKJL 2FMCA 4B3RL 2WP8J 2YTXA 4R4CA 2F4VL 3BYYB 3GTLH 3VYUA 1BQQT 4QIWE 1TWCB 1HFNA 1PTOC 3GTMB 1KDCA 2NVYH 2GVAA 2ICEC 3K7UC 2AUJD 3MHBA 3J7ZC 1HHVA 2A68D 2B8FA 4DR5L 1S3OA 2B2YA 2JA9A 2Q8TA 2M00A 3HEJA 5CC4A 4WORA 4KKTA 5CV6A 4CJ1B 4G57A 1A15A 4ZYSA 1F9QA 1ILQA 1VQMA 2QGQA 3GTJH 2VQEQ 4DV6L 1IYJB 5E4XA 1N33L 1CUKA 3I3CA 1O7LA 1JE5A 4RHRA 1L0WA 1Y8PB 5LL6S 2VQFQ 2HQLA 1HR0W 2KCTA 1A6XA 4BA1I 3D3RA 5ELFA 1HNZQ 2B2TC 5C44B 4LUVA 4U68A 3HKSA 5I4DA 5GADC 3G6JB 3V2TA 1HPCA 4BS9A 4RGNA 4DAMA 4FXDA 5LL6X 1O7YA 3E3XA 4XQQA 2E74C 1BDOA 4K5VA 4DUZQ 3HOZB 1N36Q 2VZAA 4I65A 3I4MB 5IP9G 2L12A 4LFCL 1BKBA 2I5LX 5C4HA 3A56A 2K5VA 2JJQA 4JCVE 2B39A 3ITPA 2IPKD 4WJ3M 1EU3A 1VQFA 1KQSA 4JI5Q 4Y7NB 1BO0A 1LUZA 2F0JA 4XIGS 3PO2G 1AP0A 1NAPA 4A3MG 1I4QA 3RZDH 5HY6A 4P71A 3EIVA 1RL2A 1T9HA 1Q8IA 1VQJA 1JCKB 4FF4A 3KLSX 1I4RA 4JBJA 2ZTEA 3CW2C 1M8AA 1NY4A 1VQNA 3G7LA 1NR2A 4G7OC 1KXLA 1CKNA 2JA8B 2JA6G 3EBEA 5CORA 3FVQA 4LF5Q 4DV3L 1WD1A 1HR0L 4LJZC 2X6LA 3TS2A 2E2HB 4EQNA 4A3FH 5I6WA 2ZXPA 2ES2A 4L63B 1HNWQ 4X65Q 2L9HA 3A7LA 1YZ6A 2XTIA 2MJ8A 1Q90A 3SDZA 1D5XC 2B2WA 3I4NG 2L15A 3PO2H 5CV5A 4JOIA 3HOWH 1H9MA 4A3KG 1GUGA 1WYDA 4FF1A 4OWTB 1N34L 4DR1L 2R3ZA 1MHWC 3OSOA 1EY4A 1B3AA 2F0GA 3ULJA 2R93H 4ID6A 1MSGA 4P75A 1YNND 1G51A 1SJHD 2JN4A 5K36G 3H3VH 3HOYH 3MZ5A 4LW1A 4P74A 4FVMA 3WOEA 4FXGC 1WVLA 2PZTA 5GAGC 3CMEA 4XQNA 2ENBA 3MFGA 3MXNA 1ASYA 1GD7A 2N88A 5EJWA 1N32L 3OWFA 4C1NK 4JC0A 1V1QA 4OL7A 4PMWA 3TP8A 1JWMD 3DMUA 5KRUA 2CKZB 1I3QB 1W6KA 1XPRA 2K1BA 4RGTA 2F1MA 2K5HA 3J81L 2LFNA 4DV5Q 2L4NA 5IYBG 3T53B 1U0LA 4A3JG 3H6MA 2NVXB 1VQ9A 2XNAC 2ZTDA 3J80E 4BXXG 1K3RA 4IURA 1DXMA 2O5JC 1EWHA 3J81i 3SHLA 2MFIA 3W5OA 3S14H 4A3GG 2KHIA 2HQEA 4GOPC 1QOHA 4IALA 1NBWA 3S1NH 2Z0SA 5IGDA 1YIJA 1Y1WH 4BWGB 5IYDG 4KY5A 4YY3Q 2FHTA 2HCCA 1BCPB 1X56A 1LTTD 4IJHA 4A3MB 2I5HA 2ZJPA 5I2YA 2WAQB 1MD2D 1H95A 2Z8LA 4J1MA 1ET9A 1U9RA 3RN2A 5IGEA 4RMFA 2PI2E 4OO1I 2NVQB 3RZOH 2EY5A 1QNKA 1IBMQ 5IYBH 1LO5D 2JA6B 5ELBA 1F9RA 2MO0A 2K04A 3RR5A 3BZDB 2NVTH 1VQ6A 4DNRB 4G4KA 5C4ZA 1GUTA 4NDXA 2QA4A 1K9MC 4X3UA 1IBKQ 5ISRA 3NPPA 4A3IH 4YWKA 1TWAH 4DV0Q 4A3DG 2PO4A 3K57A 1IYUA 3VR5A 2RQXA 1KNAA 2F3IA 2FXQA 2MO1A 2QCPX 4GKKQ 2F52A 4DPGA 2TMPA 3I4NB 4BBSB 4C3JH 1KLGD 1GKHA 2UXBQ 2VS1A 3HKZG 4A3KB 4LFAL 1NJIC 1G2TA 3OYYA 4YWLA 4DR7Q 5C3XA 1SNPA 1PRTB 4CDEC 3X3MA 1IBLL 1X3PA 2HHHQ 2EXZA 4A4IA 2EVBA 1JJGA 1HFGA 3CCVA 4XT1B 4RHSA 1JOQA 1JJCB 4ZQ3A 4L5QA 3OIPA 1KNEA 2EE1A 3P75A 3W1BA 1TWFB 1PDQA 5FO8B 4DR4L 4DXFA 5H1SE 1WD0A 3TP5A 5CV4A 3GP7A 3SEBA 1B9NA 2JEBI 2AWOA 3NBHA 2YTYA 4A3DH 1QILA 2K05A 3C46A 4DGZA 1B2TA 1SYDA 2VB3X 4LF8Q 1ENCA 4YCWA 4GN4B 4IPDA 1CKOA 1JC7A 1PFMA 4LF7L 2PMZE 2CW0C 4DF7A 3FRPB 1QZGA 3PMFA 5FLMG 4A3JB 3NELA 1R9TB 1NMGA 2OQ0A 3VR6A 2A6EC 3LNNA 1I50B 1W3SA 1ZEQX 1W2BA 2XIWA 1VQHA 3H0GG 3LWUA 3TSSA 4A3GB 2P5ZX 3GV3A 3R93A 1PH2A 1HUMA 4OIJA 1K3BC 1KTKA 1WCMG 2Z6BA 5ELOA 2WB1G 1F77A 1B8AA 3J7AV 4IPGA 1G8ZD 2ZJRA 1CK1A 2JXMB 2MNAA 2G9DA 2BE5C 3D4DA 3OWEB 4R4OA 3W1GA 2E5LQ 3IL8A 4U673 2YU9B 2VQEL 4HR7B 1PLFA 3I70A 4KKUA 4ME5A 1BF4A 5BR8Q 4HJ9A 2EYLA 1PV4A 4JYAQ 1U4MA 1II3A 2VQFL 4GLXA 3KYHC 2CWPA 1XXGA 2SEBD 4KY7A 3C1EA 1QVGA 1YHBA 1FGBD 3I73A 1HNZL 5I9OA 1Q12A 3A8KE 1D6EC 2PW7A 1MKHA 2KCCA 4A76A 1KDBA 4JBMA 5EQ0A 1HA5A 4DUZL 2BOSA 1L0XB 1N36L 2LSSA 3O13A 5J39A 3GD7A 1WCMH 1VQOA 2Z4HA 5M3FG 2AQ3B 3S1MH 4DV1Q 1HCZA 1QUQB 1JWSD 4JI5L 2KA7A 3M3YB 3TBIB 1X65A 1UE6A 1AZPA 4KD3A 1SRUA 4KI0A 2A73B 1U4RA 1KDAA 2F0SA 1TWHH 3E9IA 3HOXG 2GN5A 3AEVA 1AEXA 4HJ5A 4CDFC 4AIMA 4NXNQ 3HOVG 1PYSB 3NEMA 5EAYA 2RHQB 3GTGB 1B70B 1OXUA 3L2PA 4N9TA 5A35A 2NN6G 3VA7A 2XRQD 3S16H 1EIYB 1YNXA 2DUDA 3URYA 3PF4A 4LF5L 1DCZA 1VQ7A 5ELCA 4POGA 1TWGB 1K83B 1G91A 4CJ2C 4XT3B 2L55A 4NKLA 2A69D 4K14A 4IUTA 3VR4A 1HNWL 2UUCQ 4QJFA 4X65L 1DOMA 5FLXE 2NYZD 5CV8A 5BN5A 2B63B 1YBYA 2BH8A 4KY6A 2EY1A 3A55A 2KHSA 4TRDA 5FKAC 1DYQA 1HUNA 5TSSA 2Z6KA 3IKJA 3NHHA 5C4XG 3AFQA 4AYBE 4DK3C 5I9PA 1RDPD 4PZ8A 3H0GB 3A0JA 4BY1G 1SDFA 4Z9CB 4A3LH 3T51B 1PH3A 1SE3A 1J9OA 3RNUA 2NN6H 4GLAC 2RDHA 1BCPF 4LWCA 2WB1B 2A5HA 1SR3A 5C0XG 2NZHA 5FJ8H 3VDYA 3CCEA 4HSPA 2DNEA 1B4OA 1MI2A 5JEAG 5IP7H 1STGA 2XSCA 4J8QA 1Y1VB 3KF8A 4A3EH 2SOBA 5M5XB 1EY7A 4MHEA 2JQOA 5C3EH 1EQRA 1SLJA 2Y0SE 1UEBA 4KJOA 3S24A 1NMFA 4MN3A 4DAYB 3T16A 4C3IB 4HIOA 1HNXQ 3G71A 4PMCA 1J5EQ 4DV5L 3BDCA 4L5TA 4DUYQ 4PNYA 2QF7A 1A63A 1OXXK 1STAA 3CCSA 3F8TA 1S40A 3I90A 1L1OB 1L0YB 1E1OA 1DZ1A 4L8JA 2M9VA 5ELDA 3PV0A 1S5BD 3MFYA 1B9MA 2E76C 5M3FB 2NZOA 3SR1A 2PNHA 3Q8DA 1G6PA 1OO9B 1E2ZA 2F03A 3S1RB 4O0AA 1PVOA 4YY3L 1KLUD 2RKSA 1BCPC 3AB9A 3CCRA 3K81C 3K0XA 2K4KA 4BY7G 2B2VC 3NWTA 1PYWD 1PH8A 1VQDA 2EXDA 4JI1Q 3KDFB 3P1HA 3ND9A 1EQTA 3D4RA 5EPKA 1ENFA 3HOVB 1QNUA 1A2TA 1ZYRD 4XDXA 3OPOA 4XTCS 4AQYQ 1LTAD 1IBML 4OHJA 3CXCA 4M8AA 1STYA 4HIKA 3F1ZA 2MPMA 3M9BA 1EZ6A 3KBXA 2F3VA 3CKIB 1MSHA 4JV5Q 4IJLA 4RWSC 5NUCA 3LX0A 1UE5A 2PZUA 3FPUB 1GVPA 1IBKL 3FKIG 4Q5VA 5GAHC 4DV0L 1EIGA 1QB5D 1LT5D 1PTOF 1X3QA 3ER0A 2Q8RE 3OMCA 3KF8B 2R92H 4GKKL 5IYCH 2CQOA 2AQ2B 3SK4A 2UXBL 4RCNA 5FK9C 1I4PA 2Q2HA 1Y14B 1SMYD 3CD6A 3H94A 3M4QA 4DR7L 5C4XB 2ZJQA 1TS4A 5EBCA 3MXGA 4PQXA 1J6QA 2CWAA 1NUCA 1PRTC 1U4PA 4A3BH 1RJTA 2RA4A 2HHHL 1O7ZA 3T1HQ 4WJWA 1E2WA 1SMXA 3BJUA 3NE5B 1SNCA 5FO7B 4OX9Q 1LTID 1WJJA 1ASZA 1YJWA 1HTPA 3U9OA 5M3MH 1Y69U 3CAMA 1TS5A 1ONLA 1V43A 3NTIA 4DN4M 1XPOA 2K50A 3FKIH 3GDEA 3PUXA 1HRJA 4KKSA 4NXMQ 3A54A 4LF8L 3GTPB 3KLRA 1SFOB 1CT1D 3S17B 5G3LF 4J6HA 3RLFA 4B3TQ 1X3GA 4RA8A 5M9OA 1Q82C 1E0BA 3G4SA 4DR2Q 3EQLC 3C3LA 1BBWA 1XNRQ 1MIUA 1VMPA 3HP3A 4HIMA 1K8AC 3UDGA 4DK1A 1SE4A 2KENA 3I2ZA 1LYLA 3TEHB 1JR0D 3KK7A 4XYQA 4UPAA 1CFMA 5K5PA 1YI2A 1CZGA 3GTOH 3KJOA 2KQ3A 4IUVA 5J3BA 4IFDH 4BY7B 2E5LL 1LT6D 4DU9A 3C2PA 4IPHA 4APVA 2K6AA 3DXJC 3V05A 3R3OA 3U50C 3S1QH 5BR8L 1I6HB 1H9SA 5BN4A 3HGBA 1ESRA 4RH6A 1EY0A 4JYAL 3J7YW 2KUMA 1WTOA 1CKMA 4CBVA 3RLNA 3JAMc 1AW7A 2R6GA 1H9RA 1CSQA 1STBA 2F0WA 4A3FG 2LXKA 1LTGD 4HTHA 5J22A 2AWNA 4K0KL 2EYJA 2EYOA 3UE1A 2XN9C 2JYOA 1XWEA 2DY7A 4EQOA 3Q6SA 3WDNA 4C1NI 1JWUD 1K28A 3HOWG 1TT2A 3GTLB 1NCVA 1Y8OB 2FFKB 4DV1L 4A93H 1VQ8A 1S5DD 1JOKA 2EYHA 2N3SA 2LXJA 2NVYB 2R93G 3BDOA 1JMCA 3K8AA 2WIIB 2KEEA 2GVBA 1UNSA 5F2DA 3TRZA 4DAVA 1STHA 5EKIA 4LUZA 4NXNL 3DM3A 4KN4C 2F0IA 3TDQA 3HOYG 5JPMC 4YCVA 4QMGA 3QR8A 2R7DA 3HRZC 4R8NA 3RLOA 3GTJB 2SNSA 2GA4B 2E2IH 2D9UA 4MZ9A 1XMQQ 1HZCA 2Q2IA 2B29A 4JI2Q 2RBMA 4P2CB 1U5KA 2F0VA 4B9XA 3OW2A 1EOTA 1L2FA 3ERSX 1H9KA 2JA5H 1CTMA 5DAUA 4HCSA 1EFID 4JK1C 1M1KC 2UUCL 1OXVA 1S5CD 2OQKA 2QW7A 3R2TA 3MAQA 5LMUQ 2A68C 4QF4A 5GAEC 1TS3A 2EJFC 2EZVA 1EEFD 3DWPA 4X3KA 3CF5A 1E2VA 3VR3A 1VF5C 2D0PA 5CV7A 1JE4A 1ICFB 1G2SA 4JG2A 1K0RA 5D14A 1OXTA 3GTQH 5GROA 1YNJC 2IHEA 4DFAA 1Y1WG 2K5DA 3LGJA 1WTHA 2EY2A 1QE6A 3GQBA 2PI2A 1VQAA 4N9PA 1RCVD 2HDMA 3RZDB 4DR6Q 3Q23A 4IO9A 1A3UA 3E5SA 3MVVA 3CCJA 1RHPA 3FP9A 4RKLA 1JQYD 1JB3A 5EGTA 2C35B 1GOZA 5M5YH 1LV9A 5IODA 2R7ZH 1AZQA 4K8IA 1F2YA 1HNXL 2UUBQ 3A5UA 3BVMA 3M4PA 1QVCA 2SDFA 3SVMA 1J5EL 3NQTA 1FL0A 4K5XA 1F9SA 4A3FB 1GUOA 1VQKA 1MJCA 1CKNB 3CQZH 3J81E 2NB0A 4DUYL 4A3IG 1RTOA 4BBRH 2CHBD 3K59A 2K33A 2F0EA 3NBIA 3OHXC 1UEAB 3CU7A 2EJMA 2UXDQ 3NTKA 1HTLD 4H02A 3DWAA 1FVIA 1L1OC 2DGYA 1TS2A 4QQBX 5JVH3 4P72A 1C8CA 3NK9A 3TZDA 4IOAA 4C3JG 3PO2B 2JSOA 2ZTCA 1X55A 1UE7A 1EL0A 1Q81C 3HOWB 3QOJA 3F2CA 3ULPA 3G48A 2WAQE 4XQJA 2AQ1B 2CW0D 1KAAA 3ULLA 5KYLA 2R93B 1ML0D 3N52A 3KF6A 1K73C 2A6ED 5FO9B 2QDBA 4JI1L 1E3PA 4QB4A 3DUZA 3K7AH 1HH2P 1B1ZA 3HOYB 2F0MA 1EY9A 3ND8A 3U4VA 5CBAE 3D6WA 4AQYL 4A3CH 1R4PB 2JK8A 3L0OA 2J7ZA 3KUPA 2OTJA 3AU7A 1Y8NB 1I5FA 4OWXB 2NUCA 4PZ7A 3CCLA 2H4OA 4TSSA 2PNRC 1W6JA 3CRLC 1E1TA 3PO3G 4JV5L 1DM0B 1PTOH 3MXNB 5C4JH 1SBBB 5LHY1 1MBYA 3OMGA 1WTPA 2XVSA 3BG3A 1EIFA 1XYIA 1SYFA 1YNNC 1GUNA 1I50H 2N78A 1K8MA 3L3OC 2B2UC 1PFBA 4LK1C 2RDGA 1QG7A 1EZ8A 2Q2UA 5DM73 4C56C 2DN8A 2VUMG 1MGSA 5CGKA 3TMEA 3S14B 1FR3A 4ZUIA 4GLVB 5GQOA 3S1NB 2EDGA 4FF3A 2FINB 1V1OA 2B2TA 3T1HL 1Y1WB 1EY5A 4X66Q 2JA7H 2NTSA 1TU2B 4OX9L 3IAYA 1GO3E 1TY2A 2E2JH 2RDFA 3PQIA 5KIXA 3PO3H 3G6EA 3M4YA 2K01A 1KRSA 1TVXA 1SJED 3WWVA 1HA6A 4R4QA 3JC66 1VS0A 3R2IA 4NXML 2IJ0A 1A3VA 1T5XD 3N6RA 1VQBA 3KF6B 4LNQA 3SE0A 2NVTB 3CC4A 4B3TL 5C0XI 2VUMH 4R4TA 4DV7Q 5JAVA 3U4ZA 1U4LA 4JI0Q 2K14A 4A3IB 1TWAB 4DR2L 1F2MA 4MIUA 5JJZA 1XNRL 1IL2A 4IPCA 2O2LD 4DA2A 1DOLA 1KL9A 4OEMB 2DJFC 3GTKH 5C5LA 4C3JB 2M2LA 2HT1A 2IWHA 1CA5A 1RTNA 2XWBB 4R4IA 2C9OA 2BCOA 1N9WA 3STBD 1SNDA 4X64Q 2V1CC 3RD4A 2MQHA 4NW2A 1LT3D 1M4VA 1XX8A 4DV6Q 3FPPA 2Z1CA 3F2BA 5C0XJ 4KN7C 2CVRA 1JJ2A 2F0TA 1LTLA 3H09A 5JEAJ 5IT9c 2OWOA 3BS1A 4QCLA 3MTSA 4DXGA 1Q7YC 3PUVA 3M7GA 1KD1C 2KBNA 1YHAA 4A3DB 2L1BA 3KLWA 1KHIA 5KYIA 3BU2A 1Z47A 3NBHB 5CMDA 4C3HH 3I56A 1UUPA 3HKZB 1TKWB 1TXYA 2K32A 4RKBA 1BBXC 2ZM6Q 4QGUA 4OO1G 3JAML 2XGTA 3RN5A 3T4AC 2I46A 4IN3A 3GV6A 3S2DH 4F7XA 3QB3A 1PYBA 1ILPA 4A3LG 1EYAA 5DM63 3MA2B 3JAMi 3L7ZC 5D65A 2CH4W 5IE8A 4I7ZC 3T1YQ 4X3SA 3JAME 1GUSA 5EPLA 5FJ8G 3TQYA 1LTBD 1AE3A 4PZ6A 1FJGQ 5IP7G 1KRTA 2B2YC 4N8FA 4UHVA 4A3EG 2O5IC 1S5ED 4X3TA 1XMQL 1BCPD 2MP1A 4ODGA 4CDCC 5C3EG 4GOPA 4JI2L 2V4DA 3NP8A 1IXRA 1BOSA 3I4OA 1IW7C 4S3SA 1I94Q 3S15H 1BVSA 1EY8A 3A8JE 1WTQA 3VR2A 4IZ8A 3M4OH 5E1FA 3DHQA 1D8LA 3I4LA 1BBUA 5LMUL 4DKAC 4OO1H 3BVZA 3S9WA 1HQMC 3HOUH 1QZHA 4IOCA 4GN3B 4C2MH 3ZYYX 4ALPA 1SROA 2K75A 2DY8A 1WCMB 2WB1E 5IIFA 1R4QB 3BZCA 2PYKA 3J80c 2VW9A 4UP7A 4CGYB 3K5LA 2OF1A 3S1MB 2QKIC 4K8JA 2KOLA 1EY6A 1BNZA 3K5OA 2I5MX 2N49A 1TWHB 1PH9A 1J8IA 1CZWA 4DR6L 4IQZA 1DGSA 3T56B 2E75C 4CKBA 5KNBA 2VB2X 2HD3A 2HUGA 3SK6A 1B50A 1YJ9A 3S16B 2K03A 2UUBL 2Z4IA 4WFN3 2TSSA 4IFDJ 1LTRD 1DONA 2N55A 2RCFA 2C5CA 2EPBA 2AHOB 2Q8IB 1PZID 4ILWA 1NNXA 1A3TA 3D4WA 3KLSA 2UXDL 2PQEA 3HZXA 4JPBW 2R92G 1AH9A 2OTLA 1XPUA 5IYCG 3S2HH 5CV9A 3TREA 1CI3M 1PRTF 2HCIA 2WV6D 4M1UB 3HOXB 3QWNA 4QY7A 4B3MQ 1PTOD 2B2WC 1ZKOA 4TKOB 2KCNA 4JOIC 4A3BG 2A69C 4JI6Q 3GO5A 5C6AA 3H3VC 2WKCA 2OEOA 5M3MG 2D2CC 4F8MA 3WOFA 2K5WA 3DLLA 4A3EB 3TP6A 5I6YA 1D5MC 3E0JA 3Q24A 3F2DA 1VCIA 5C3EB 1TWCH 3GTMH 4XXEA 4ME3A 3Q22A 1SYEA 1JB7A 4LF4Q 2ZXRA 2KEDA 5A2QL 2WACA 1XJVA 3I4MG 3I7FA 2F0FA 1HJPA 2EQSA 2N8NA 5M5WB 2PCFB 1PH5A 3NSWA 2D5DA 1CQVA 1D7QA 3TS0A 4BY1B 4JI3Q 3J7A5 3PIP3 5G3LD 1VQLA 3E0EA 2UUAQ 3A74A 3F2UA 1V8QA 4DNTB 1O80A 1X9NA 1SNQA 1C48A 3NWSA 1QCBD 1ENAA 1A8VA 4X66L 4LF9Q 3NENA 4DV2Q 4FYDA 1S4ZA 4IFDG 5C44H 1XTCD 2A6HC 2PZWA 3PSIA 2QEJC 1LM0A 3VYTA 1O78A 3TZUA 2UXCQ 1UAPA 1QWYA 2RCNA 2ASBA 2B8GA 2K52A 2L0CA 2QILA 4K2KA 4JBKA 4DAPA 3HOZH 4POFA 4KHVA 3I4MH 1IHZA 1O7IA 4UY8C 4OELB 4EQPA 1SNOA 1IKLA 2BA1A 3BVGA 1EUJA 1WOCA 4DV7L 2VL6A 2WFWA 1BR9A 4Y7NH 2IX3A 4IUQA 5IGGA 1IL8A 4JI0L 3NQIA 3K6OA 4HEDA 4AH6A 1ICWA 4QIWB 2KJXA 1C0AA 4ZUJA 3MC0B 2R92B 3OTOQ 4QUFA 3MEHA 1X54A 5EKKA 1ZYRC 4A93G 2X69A 1EFWA 1VQGA 1G6ZA 3A8IE 1AFPA 1B44D 2JA8H 2R7FA 2YYZA 4A3BB 4X64L 2E2HH 1AN8A 1RF2D 3CC2A 1C4QA 3CC7A 1ESFA 1RKNA 4RAUC 1K0SA 4X62Q 5M3MB 1X32A 2MHVA 3CP0A 3QO2A 2FMMA 1KAWA 1YNJD 4F88A 4YCUA 2VY3A 4DV4Q 3K58A 1FNWA 3OW7A 3FKIB 2F0UA 1B7YB 2K7VA 4DR3Q 1BUVT 2JA5G 1SMYC 4KHPQ 1S72A 1T5EA 5KEEA 4K6LA 2F0DA 3DWQA 3OOCA 1D1KA 1Z9FA 3MEFA 1RODA 2I07B 1I4GA 3FMCA 4UAIA
chains in the Genus database with same CATH topology
5C44G 2ZM6L 4DV1Q 1SFOH 1QUQB 3L0OA 4JI5L 2OTJA 3S17H 1I5FA 3U58A 4OWXB 4HJAA 1SE8A 1UE6A 1X65A 4PZ7A 3EN2A 5FLXc 3CCLA 4GN5A 3GTPH 1JT8A 1SRUA 4WJ4A 3K80C 4JBWA 4KI0A 2QEXA 1E1TA 3PO3G 4JV5L 3E9IA 1TWHH 5C4JH 3MXNB 3H3VI 3BZKA 3HOXG 3HOZG 2OCEA 4LFBL 2GN5A 3AEVA 4HJ5A 4YWMA 4AIMA 5JJKA 3M85A 4NXNQ 2Q2TA 1EIFA 3HOVG 1Q8KA 1PYSB 2YV5A 3NEMA 4RG1A 2RHQB 5EAYA 2WAQG 2RHSB 1I50H 1B70B 2N78A 4BA2I 1OXUA 3L2PA 4GNXA 3T1YL 2I0QA 1I3QH 2NN6G 5IWAQ 4LF6Q 2Q2UA 3S16H 1EIYB 4LFAQ 1VQCA 1FJGL 1YNXA 2DUDA 4EQ5A 2VUMG 3PF4A 4LF5L 2ALYB 1VQ7A 2A8VA 2NVXH 4POGA 3AYHB 1Q86C 1V9PA 2IHFA 1IBLQ 4GLVB 5GQOA 4BY7H 1P16A 5AJ3Q 1HNWL 1I94L 1E7ZA 2UUCQ 4JI7L 4MNOA 2R7ZG 4QJFA 4X65L 5IP9H 3T1HL 3CCQA 1SN8A 4UP8A 3CCUA 1I6HH 4EX5A 4X66Q 5DLQE 3PUWA 2JA7H 4OX9L 1YBYA 3PGZA 1GO3E 2BH8A 5E7NA 2E2JH 3D0FA 3HFZB 4DR4Q 2JA8G 5LMNL 2AKWB 1YEZA 4NPSA 1XNQQ 3PO3H 1AE2A 4BBRG 2Z6KA 3G6EA 1XTDA 4BBSG 4JI4L 5C4XG 2AMCB 1KRSA 2HIVA 3AFQA 4AYBE 4A3MH 4DK3C 4B3SL 4PZ8A 1Q46A 1VQIA 3A0JA 4BY1G 4TQUS 3WWVA 1PH7A 4R4QA 3JC66 1VS0A 1E22A 3SGIA 1WFQA 4A3LH 1PH3A 1GM5A 4NXML 1VQ4A 2CCZA 3RNUA 4JI8L 4GLAC 4NB3A 4LF7Q 1ASZA 2UU9L 4GKJL 1VQBA 4B3RL 3KF6B 2WP8J 4LWCA 2YTXA 4LNQA 4R4CA 1SR3A 2F4VL 2NVQH 5C0XG 3CC4A 5C0XI 2NZHA 4R4TA 4B3TL 5FJ8H 4DV7Q 3VDYA 2VUMH 3GTLH 3CCEA 3U4ZA 4QIWE 1YHQA 1OTCA 5JEAG 5IP7H 4JI0Q 2JA6H 2K14A 4QL5A 4YHHQ 4DR2L 1G291 4A3EH 1XNRL 1XMOQ 1IL2A 4IPCA 1CSPA 2NVYH 1KL9A 2CFMA 2GVAA 2JQOA 3K7UC 5C3EH 1EQRA 1SLJA 2Y0SE 1UEBA 3J7ZC 4A3CG 3S24A 3GTKH 1NMFA 2HT1A 4DR5L 4DAYB 1HNXQ 4HIOA 3G71A 1S3OA 2JA9A 4R4IA 1J5EQ 4DV5L 1N9WA 3I4NH 1FGUA 4L5TA 4BBSH 3STBD 2YTVA 4DUYQ 4DV6L 1VQMA 2QGQA 4DNIA 3J80i 3GTJH 1OXXK 3AFPA 1IYJB 3CMAA 4X64Q 1CUKA 2V1CC 3CCSA 4GNXB 3F8TA 1N33L 1S40A 2MQHA 1L1OB 3B6YA 1JE5A 4DV6Q 1E1OA 3CPFA 1L0WA 3UDXA 1HR0W 3PV0A 2HQLA 5C0XJ 3F2BA 2VQFQ 3KFUA 2KCTA 4J15A 1JJ2A 1Q1EA 1YVCA 1A63A 2NZOA 2PNHA 4BA1I 1LTLA 3Q8DA 5HGQA 1HNZQ 5JEAJ 4LUOA 5IT9c 1G6PA 4LUVA 5GADC 3HKSA 2OWOA 4O2DA 5JJLA 4O0AA 1PVOA 1Q7YC 4YY3L 3PUVA 1KD1C 1TWFH 4DAMA 1E24A 2KBNA 3K0XA 1YHAA 3K81C 3CCRA 4B3ML 2K4KA 4BY7G 2IY5B 1PH8A 3KLWA 1VQDA 1KHIA 2EXDA 4DUZQ 4JI1Q 3BU2A 2VZAA 2Z6KC 3KDFB 1N36Q 5IP9G 1Z47A 3NBHB 4KHZA 4LFCL 1BKBA 4C3HH 1C7YA 2JA7G 2I5LX 1YJNA 4JI6L 3I56A 2K5VA 2JJQA 4XTCS 4JCVE 1TXYA 4AQYQ 4R1JA 4WJ3M 1VQFA 1IBML 1EWIA 2ZM6Q 1KQSA 3CXCA 4JI5Q 4HIKA 4QGUA 3F1ZA 1LUZA 2A19A 4XIGS 3PO2G 4OO1G 3M9BA 1PFSA 2XGTA 3RN5A 4A3MG 4A3JH 4JV5Q 4IJLA 3RZDH 1R9TH 3S2DH 4UP9A 5HY6A 1PYBA 4P71A 1UE5A 4BXXH 4LFBQ 3EIVA 1GVPA 1IBKL 4A3LG 3FKIG 2JEAI 1RL2A 5GAHC 1T9HA 4PG3A 2NN6I 3JAMi 4DV0L 3L7ZC 1VQJA 4LF4L 2IX0A 4A3GH 5IE8A 3IRBA 3T1YQ 3ER0A 3PIPA 3KF8B 2EIFA 4JBJA 2ZTEA 2R92H 4GKKL 3CW2C 5FJ8G 3I55A 5IYCH 1M90C 1NY4A 1HZAA 3TQYA 2CQOA 1VQNA 1AE3A 3PF5A 1KXLA 4PZ6A 1FJGQ 3PUYA 1CKNA 5IP7G 2UXBL 2JA6G 3EBEA 2BH2A 4LF5Q 4DV3L 2Q2HA 5IYDH 1Y14B 1KRTA 1HR0L 4A3EG 3TS2A 2ID0A 4JI3L 4A3FH 3CD6A 1XMQL 3M4QA 4DR7L 2ZJQA 4GOPA 5C3EG 4JI2L 1IXRA 2UUAL 3I4OA 1A0IA 1J6QA 2CWAA 2ES2A 2YU9H 3D31A 1HNWQ 1X3EA 1I94Q 4A3BH 4JI7Q 3S15H 2HHHL 4X65Q 1BVSA 3T1HQ 1SMXA 3BJUA 3M4OH 3A5ZB 1YZ6A 2XTIA 4OX9Q 1D8LA 1WJJA 1BBUA 5LMUL 4DKAC 1YJWA 1WI5A 1KC8C 4DV2L 2E8GA 2L15A 5M3MH 4HJ7A 3I4NG 3PO2H 4GS3A 5LMNQ 3CAMA 4JOIA 3HOWH 4A3KG 3HOUH 1WYDA 4IOCA 1QZHA 4OWTB 1MJEA 4GN3B 1N34L 1V43A 4JI4Q 4DR1L 2PQAA 4C2MH 1XPOA 1PH1A 4ALPA 1SROA 2K50A 3FKIH 2VNUD 4B3SQ 2UXCL 3GDEA 2K75A 4LF9L 3ULJA 3PUXA 1PHJA 2R93H 2WB1E 4P75A 3BZCA 4NXMQ 2H5XA 3J80c 2VW9A 1G51A 4UP7A 4JI8Q 2IT1A 4LF8L 2KCMA 1PA6A 4Y52H 5K36G 2UU9Q 4GKJQ 4B3RQ 1QUQA 3H3VH 5JJIA 3RLFA 3HOYH 2F4VQ 4B3TQ 1X3GA 1K8GA 4LW1A 4P74A 1Q82C 5GAGC 3CMEA 2I5MX 2N49A 1PH9A 1X3FA 3G4SA 2B63G 3M3YH 1ASYA 1GD7A 1N32L 4DR2Q 1BBWA 4DR6L 1XNRQ 1DGSA 4JC0A 1MIUA 1V1QA 4HIDA 4PMWA 4FDBA 4HIMA 3CPWA 1K8AC 4KLKA 3UDGA 2CKZB 1XPRA 4DR5Q 3OTOL 4AYBG 1YJ9A 2KENA 3I2ZA 1LYLA 2K5HA 3TEHB 3GTGH 4DV5Q 2UUBL 2A1AA 4UPAA 5IYBG 1N8RC 1PH6A 4L5SA 2K5NA 1U0LA 3ZJYC 4A3JG 4IFDJ 1VQ9A 1YI2A 3GTOH 2ZTDA 1RIPA 3KJOA 4BXXG 1K3RA 5J3BA 1N33Q 2E5LL 2AHOB 3J81i 4IPHA 4APVA 1TWGH 1K83H 2MFIA 3W5OA 3S14H 4A3GG 2UXDL 3U50C 2KHIA 3S1QH 5BR8L 4GOPC 4OXPA 1EYGA 1Y1VG 1NBWA 2R92G 3S1NH 1AH9A 3M7NA 2OTLA 1XPUA 5IYCG 4JYAL 3S2HH 3H15A 4X62L 2BA0A 2Z0SA 3TREA 1CKMA 1YIJA 3RLNA 1Y1WH 5IYDG 3JAMc 2VQEQ 4YY3Q 4DV4L 1VQ5A 2R6GA 2Y0SG 1CSQA 2B63H 1X56A 4A3FG 4B3MQ 2LXKA 4QY7A 4IJHA 2I5HA 3UDIA 5FLMH 2ZJPA 4JOIC 4DR3L 1Q1BA 3HKZE 4A3BG 2AWNA 4KHPL 4K0KL 4MTNA 2IX1A 5IY0A 4LFCQ 3UE1A 1H95A 4JI6Q 3H0GH 4K0KQ 3RN2A 1UWVA 3GO5A 2PQAB 4HJ8A 4RMFA 1PH4A 2PI2E 5M3MG 4OO1I 3RZOH 1YITA 1IBMQ 5IYBH 3HOWG 3PIOA 3HOUG 4DV1L 4A93H 1VQ8A 4L5RC 3DLLA 2MO0A 3RR5A 1VQ6A 2NVTH 2N3SA 2LXJA 1EQQA 2R93G 3F2DA 1VCIA 1C9OA 1TWCH 1JMCA 3K8AA 2QA4A 1K9MC 1IBKQ 2GVBA 3GTMH 4A3IH 4YWKA 1TWAH 1Y1VH 4ME3A 4A3CH 4DV0Q 4A3DG 1JB7A 4LF4Q 3UDFA 3ICEA 5M5XH 3TRZA 4LUZA 4NXNL 3DM3A 3HOYG 2MO1A 2F3IA 2FXQA 3I7FA 1XJVA 3I4MG 2F52A 4DPGA 4YCVA 4GKKQ 1HJPA 2EQSA 2N8NA 4X6AH 2ATWA 2HIXA 2R7DA 4C3JH 1PH5A 3RLOA 5IWAL 4LF6L 1GKHA 2UXBQ 4C3IH 2VS1A 3HKZG 4DV3Q 4LFAL 1EOVA 1QVFA 1HR0Q 1NJIC 4OWWB 1D7QA 3TS0A 3OYYA 1OXSC 2E2IH 4MZ9A 4JI3Q 4YWLA 1HZCA 1XMQQ 3J7A5 4DR7Q 2Q2IA 2B29A 4JI2Q 1VQLA 1L1OA 3E0EA 2UUAQ 1U5KA 3A74A 3OW2A 1L2FA 3ERSX 1IBLL 2JA5H 2HHHQ 4A4IA 1X9NA 5AJ3L 1JJGA 3CCVA 1M1KC 2UUCL 1OXVA 2OQKA 2D0OA 3AQQA 1JJCB 4L5QA 1A8VA 4X66L 5LMUQ 4LF9Q 3NENA 4DV2Q 5GAEC 3W1BA 5M3FH 1HZBA 4DR4L 4IFDG 4IFDI 3CF5A 5C44H 5H1SE 1N34Q 3PSIA 4DR1Q 5ELNA 3S1RH 1LM0A 1XNQL 3KDFA 3STBC 1NTGA 2JEBI 2D0PA 2AWOA 3CCMA 2UXCQ 3KJPA 3J81j 2RCNA 1IZ6A 2YTYA 2K52A 2ASBA 4A3DH 4JG2A 4JBKA 4OONA 1K0RA 3HOXH 3HOZH 4LF8Q 4YCWA 4POFA 3I4MH 4GN4B 4IPDA 1OXTA 3GTQH 5GROA 3J81c 1CKOA 2IHEA 1Y1WG 1O7IA 2D62A 4UY8C 3LGJA 2PMZE 4LF7L 3HOVH 2BA1A 4P73A 4A3KH 4TVAB 1NE3A 2KHJA 2PI2A 1QZGA 1EUJA 1VQAA 1WOCA 3UE0A 5FLMG 4DV7L 3NELA 2VL6A 2RF4A 1NMGA 2WFWA 4Y7NH 2OQ0A 1N32Q 1VQPA 4DR6Q 4IO9A 1W3SA 4JI0L 4YHHL 1W2BA 1XMOL 1VQHA 3PCOB 3H0GG 4AH6A 3CCJA 3FP9A 4DK6C 2B3GA 1C0AA 2C35B 1PH2A 5M5YH 3OTOQ 2R7ZH 1WCMG 1X54A 4A93G 5ELOA 1HNXL 2WB1G 1EFWA 2UUBQ 3A5UA 1UE1A 1VQGA 1B8AA 3E9HA 1QVCA 3M4PA 1KIXA 4IPGA 1J5EL 2ZJRA 2MNAA 1FL0A 4R4OA 1VQKA 1MJCA 3W1GA 1CKNB 3CQZH 4DUYL 2E5LQ 2JA8H 1A62A 2R7FA 2YYZA 4A3IG 2VQEL 4BBRH 5M5WH 4X64L 4GNXC 2E2HH 1X6OA 3CC2A 2UXDQ 5C4XH 4H02A 4GOPB 5BR8Q 4HJ9A 1FVIA 3CC7A 1PV4A 1L1OC 2DGYA 4QQBX 4JYAQ 4P72A 2VQFL 4BY1H 4GLXA 3KYHC 4IOAA 2CWPA 4X62Q 1QVGA 1YHBA 2ZTCA 1X55A 1UE7A 3CP0A 1Q81C 1HNZL 1KAWA 4DV4Q 4YCUA 2VY3A 3F2CA 1Q12A 3ULPA 3G48A 2WAQE 1HZ9A 3PUZA 1MKHA 1B7YB 4A76A 3ULLA 4DR3Q 4JBMA 1P8LA 2JA5G 4KHPQ 2JE6I 3KF6A 1S72A 1K73C 3KOJA 1VQEA 4DUZL 4JI1L 1N36L 5LMNW 1E3PA 2LSSA 3FHWA 3K7AH 1HH2P 3GD7A 1WCMH 1Z9FA 3MEFA 1VQOA 5M3FG 3U4VA 4A75A 4AQYL 3S1MH 2JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 G;  2ZM6 L;  4DV1 Q;  1SFO H;  1QUQ B;  3L0O A;  4JI5 L;  2OTJ A;  3S17 H;  1I5F A;  3U58 A;  4OWX B;  4HJA A;  1SE8 A;  1UE6 A;  1X65 A;  4PZ7 A;  3EN2 A;  5FLX c;  3CCL A;  4GN5 A;  3GTP H;  1JT8 A;  1SRU A;  4WJ4 A;  3K80 C;  4JBW A;  4KI0 A;  2QEX A;  1E1T A;  3PO3 G;  4JV5 L;  3E9I A;  1TWH H;  5C4J H;  3MXN B;  3H3V I;  3BZK A;  3HOX G;  3HOZ G;  2OCE A;  4LFB L;  2GN5 A;  3AEV A;  4HJ5 A;  4YWM A;  4AIM A;  5JJK A;  3M85 A;  4NXN Q;  2Q2T A;  1EIF A;  3HOV G;  1Q8K A;  1PYS B;  2YV5 A;  3NEM A;  4RG1 A;  2RHQ B;  5EAY A;  2WAQ G;  2RHS B;  1I50 H;  1B70 B;  2N78 A;  4BA2 I;  1OXU A;  3L2P A;  4GNX A;  3T1Y L;  2I0Q A;  1I3Q H;  2NN6 G;  5IWA Q;  4LF6 Q;  2Q2U A;  3S16 H;  1EIY B;  4LFA Q;  1VQC A;  1FJG L;  1YNX A;  2DUD A;  4EQ5 A;  2VUM G;  3PF4 A;  4LF5 L;  2ALY B;  1VQ7 A;  2A8V A;  2NVX H;  4POG A;  3AYH B;  1Q86 C;  1V9P A;  2IHF A;  1IBL Q;  4GLV B;  5GQO A;  4BY7 H;  1P16 A;  5AJ3 Q;  1HNW L;  1I94 L;  1E7Z A;  2UUC Q;  4JI7 L;  4MNO A;  2R7Z G;  4QJF A;  4X65 L;  5IP9 H;  3T1H L;  3CCQ A;  1SN8 A;  4UP8 A;  3CCU A;  1I6H H;  4EX5 A;  4X66 Q;  5DLQ E;  3PUW A;  2JA7 H;  4OX9 L;  1YBY A;  3PGZ A;  1GO3 E;  2BH8 A;  5E7N A;  2E2J H;  3D0F A;  3HFZ B;  4DR4 Q;  2JA8 G;  5LMN L;  2AKW B;  1YEZ A;  4NPS A;  1XNQ Q;  3PO3 H;  1AE2 A;  4BBR G;  2Z6K A;  3G6E A;  1XTD A;  4BBS G;  4JI4 L;  5C4X G;  2AMC B;  1KRS A;  2HIV A;  3AFQ A;  4AYB E;  4A3M H;  4DK3 C;  4B3S L;  4PZ8 A;  1Q46 A;  1VQI A;  3A0J A;  4BY1 G;  4TQU S;  3WWV A;  1PH7 A;  4R4Q A;  3JC6 6;  1VS0 A;  1E22 A;  3SGI A;  1WFQ A;  4A3L H;  1PH3 A;  1GM5 A;  4NXM L;  1VQ4 A;  2CCZ A;  3RNU A;  4JI8 L;  4GLA C;  4NB3 A;  4LF7 Q;  1ASZ A;  2UU9 L;  4GKJ L;  1VQB A;  4B3R L;  3KF6 B;  2WP8 J;  4LWC A;  2YTX A;  4LNQ A;  4R4C A;  1SR3 A;  2F4V L;  2NVQ H;  5C0X G;  3CC4 A;  5C0X I;  2NZH A;  4R4T A;  4B3T L;  5FJ8 H;  4DV7 Q;  3VDY A;  2VUM H;  3GTL H;  3CCE A;  3U4Z A;  4QIW E;  1YHQ A;  1OTC A;  5JEA G;  5IP7 H;  4JI0 Q;  2JA6 H;  2K14 A;  4QL5 A;  4YHH Q;  4DR2 L;  1G29 1;  4A3E H;  1XNR L;  1XMO Q;  1IL2 A;  4IPC A;  1CSP A;  2NVY H;  1KL9 A;  2CFM A;  2GVA A;  2JQO A;  3K7U C;  5C3E H;  1EQR A;  1SLJ A;  2Y0S E;  1UEB A;  3J7Z C;  4A3C G;  3S24 A;  3GTK H;  1NMF A;  2HT1 A;  4DR5 L;  4DAY B;  1HNX Q;  4HIO A;  3G71 A;  1S3O A;  2JA9 A;  4R4I A;  1J5E Q;  4DV5 L;  1N9W A;  3I4N H;  1FGU A;  4L5T A;  4BBS H;  3STB D;  2YTV A;  4DUY Q;  4DV6 L;  1VQM A;  2QGQ A;  4DNI A;  3J80 i;  3GTJ H;  1OXX K;  3AFP A;  1IYJ B;  3CMA A;  4X64 Q;  1CUK A;  2V1C C;  3CCS A;  4GNX B;  3F8T A;  1N33 L;  1S40 A;  2MQH A;  1L1O B;  3B6Y A;  1JE5 A;  4DV6 Q;  1E1O A;  3CPF A;  1L0W A;  3UDX A;  1HR0 W;  3PV0 A;  2HQL A;  5C0X J;  3F2B A;  2VQF Q;  3KFU A;  2KCT A;  4J15 A;  1JJ2 A;  1Q1E A;  1YVC A;  1A63 A;  2NZO A;  2PNH A;  4BA1 I;  1LTL A;  3Q8D A;  5HGQ A;  1HNZ Q;  5JEA J;  4LUO A;  5IT9 c;  1G6P A;  4LUV A;  5GAD C;  3HKS A;  2OWO A;  4O2D A;  5JJL A;  4O0A A;  1PVO A;  1Q7Y C;  4YY3 L;  3PUV A;  1KD1 C;  1TWF H;  4DAM A;  1E24 A;  2KBN A;  3K0X A;  1YHA A;  3K81 C;  3CCR A;  4B3M L;  2K4K A;  4BY7 G;  2IY5 B;  1PH8 A;  3KLW A;  1VQD A;  1KHI A;  2EXD A;  4DUZ Q;  4JI1 Q;  3BU2 A;  2VZA A;  2Z6K C;  3KDF B;  1N36 Q;  5IP9 G;  1Z47 A;  3NBH B;  4KHZ A;  4LFC L;  1BKB A;  4C3H H;  1C7Y A;  2JA7 G;  2I5L X;  1YJN A;  4JI6 L;  3I56 A;  2K5V A;  2JJQ A;  4XTC S;  4JCV E;  1TXY A;  4AQY Q;  4R1J A;  4WJ3 M;  1VQF A;  1IBM L;  1EWI A;  2ZM6 Q;  1KQS A;  3CXC A;  4JI5 Q;  4HIK A;  4QGU A;  3F1Z A;  1LUZ A;  2A19 A;  4XIG S;  3PO2 G;  4OO1 G;  3M9B A;  1PFS A;  2XGT A;  3RN5 A;  4A3M G;  4A3J H;  4JV5 Q;  4IJL A;  3RZD H;  1R9T H;  3S2D H;  4UP9 A;  5HY6 A;  1PYB A;  4P71 A;  1UE5 A;  4BXX H;  4LFB Q;  3EIV A;  1GVP A;  1IBK L;  4A3L G;  3FKI G;  2JEA I;  1RL2 A;  5GAH C;  1T9H A;  4PG3 A;  2NN6 I;  3JAM i;  4DV0 L;  3L7Z C;  1VQJ A;  4LF4 L;  2IX0 A;  4A3G H;  5IE8 A;  3IRB A;  3T1Y Q;  3ER0 A;  3PIP A;  3KF8 B;  2EIF A;  4JBJ A;  2ZTE A;  2R92 H;  4GKK L;  3CW2 C;  5FJ8 G;  3I55 A;  5IYC H;  1M90 C;  1NY4 A;  1HZA A;  3TQY A;  2CQO A;  1VQN A;  1AE3 A;  3PF5 A;  1KXL A;  4PZ6 A;  1FJG Q;  3PUY A;  1CKN A;  5IP7 G;  2UXB L;  2JA6 G;  3EBE A;  2BH2 A;  4LF5 Q;  4DV3 L;  2Q2H A;  5IYD H;  1Y14 B;  1KRT A;  1HR0 L;  4A3E G;  3TS2 A;  2ID0 A;  4JI3 L;  4A3F H;  3CD6 A;  1XMQ L;  3M4Q A;  4DR7 L;  2ZJQ A;  4GOP A;  5C3E G;  4JI2 L;  1IXR A;  2UUA L;  3I4O A;  1A0I A;  1J6Q A;  2CWA A;  2ES2 A;  2YU9 H;  3D31 A;  1HNW Q;  1X3E A;  1I94 Q;  4A3B H;  4JI7 Q;  3S15 H;  2HHH L;  4X65 Q;  1BVS A;  3T1H Q;  1SMX A;  3BJU A;  3M4O H;  3A5Z B;  1YZ6 A;  2XTI A;  4OX9 Q;  1D8L A;  1WJJ A;  1BBU A;  5LMU L;  4DKA C;  1YJW A;  1WI5 A;  1KC8 C;  4DV2 L;  2E8G A;  2L15 A;  5M3M H;  4HJ7 A;  3I4N G;  3PO2 H;  4GS3 A;  5LMN Q;  3CAM A;  4JOI A;  3HOW H;  4A3K G;  3HOU H;  1WYD A;  4IOC A;  1QZH A;  4OWT B;  1MJE A;  4GN3 B;  1N34 L;  1V43 A;  4JI4 Q;  4DR1 L;  2PQA A;  4C2M H;  1XPO A;  1PH1 A;  4ALP A;  1SRO A;  2K50 A;  3FKI H;  2VNU D;  4B3S Q;  2UXC L;  3GDE A;  2K75 A;  4LF9 L;  3ULJ A;  3PUX A;  1PHJ A;  2R93 H;  2WB1 E;  4P75 A;  3BZC A;  4NXM Q;  2H5X A;  3J80 c;  2VW9 A;  1G51 A;  4UP7 A;  4JI8 Q;  2IT1 A;  4LF8 L;  2KCM A;  1PA6 A;  4Y52 H;  5K36 G;  2UU9 Q;  4GKJ Q;  4B3R Q;  1QUQ A;  3H3V H;  5JJI A;  3RLF A;  3HOY H;  2F4V Q;  4B3T Q;  1X3G A;  1K8G A;  4LW1 A;  4P74 A;  1Q82 C;  5GAG C;  3CME A;  2I5M X;  2N49 A;  1PH9 A;  1X3F A;  3G4S A;  2B63 G;  3M3Y H;  1ASY A;  1GD7 A;  1N32 L;  4DR2 Q;  1BBW A;  4DR6 L;  1XNR Q;  1DGS A;  4JC0 A;  1MIU A;  1V1Q A;  4HID A;  4PMW A;  4FDB A;  4HIM A;  3CPW A;  1K8A C;  4KLK A;  3UDG A;  2CKZ B;  1XPR A;  4DR5 Q;  3OTO L;  4AYB G;  1YJ9 A;  2KEN A;  3I2Z A;  1LYL A;  2K5H A;  3TEH B;  3GTG H;  4DV5 Q;  2UUB L;  2A1A A;  4UPA A;  5IYB G;  1N8R C;  1PH6 A;  4L5S A;  2K5N A;  1U0L A;  3ZJY C;  4A3J G;  4IFD J;  1VQ9 A;  1YI2 A;  3GTO H;  2ZTD A;  1RIP A;  3KJO A;  4BXX G;  1K3R A;  5J3B A;  1N33 Q;  2E5L L;  2AHO B;  3J81 i;  4IPH A;  4APV A;  1TWG H;  1K83 H;  2MFI A;  3W5O A;  3S14 H;  4A3G G;  2UXD L;  3U50 C;  2KHI A;  3S1Q H;  5BR8 L;  4GOP C;  4OXP A;  1EYG A;  1Y1V G;  1NBW A;  2R92 G;  3S1N H;  1AH9 A;  3M7N A;  2OTL A;  1XPU A;  5IYC G;  4JYA L;  3S2H H;  3H15 A;  4X62 L;  2BA0 A;  2Z0S A;  3TRE A;  1CKM A;  1YIJ A;  3RLN A;  1Y1W H;  5IYD G;  3JAM c;  2VQE Q;  4YY3 Q;  4DV4 L;  1VQ5 A;  2R6G A;  2Y0S G;  1CSQ A;  2B63 H;  1X56 A;  4A3F G;  4B3M Q;  2LXK A;  4QY7 A;  4IJH A;  2I5H A;  3UDI A;  5FLM H;  2ZJP A;  4JOI C;  4DR3 L;  1Q1B A;  3HKZ E;  4A3B G;  2AWN A;  4KHP L;  4K0K L;  4MTN A;  2IX1 A;  5IY0 A;  4LFC Q;  3UE1 A;  1H95 A;  4JI6 Q;  3H0G H;  4K0K Q;  3RN2 A;  1UWV A;  3GO5 A;  2PQA B;  4HJ8 A;  4RMF A;  1PH4 A;  2PI2 E;  5M3M G;  4OO1 I;  3RZO H;  1YIT A;  1IBM Q;  5IYB H;  3HOW G;  3PIO A;  3HOU G;  4DV1 L;  4A93 H;  1VQ8 A;  4L5R C;  3DLL A;  2MO0 A;  3RR5 A;  1VQ6 A;  2NVT H;  2N3S A;  2LXJ A;  1EQQ A;  2R93 G;  3F2D A;  1VCI A;  1C9O A;  1TWC H;  1JMC A;  3K8A A;  2QA4 A;  1K9M C;  1IBK Q;  2GVB A;  3GTM H;  4A3I H;  4YWK A;  1TWA H;  1Y1V H;  4ME3 A;  4A3C H;  4DV0 Q;  4A3D G;  1JB7 A;  4LF4 Q;  3UDF A;  3ICE A;  5M5X H;  3TRZ A;  4LUZ A;  4NXN L;  3DM3 A;  3HOY G;  2MO1 A;  2F3I A;  2FXQ A;  3I7F A;  1XJV A;  3I4M G;  2F52 A;  4DPG A;  4YCV A;  4GKK Q;  1HJP A;  2EQS A;  2N8N A;  4X6A H;  2ATW A;  2HIX A;  2R7D A;  4C3J H;  1PH5 A;  3RLO A;  5IWA L;  4LF6 L;  1GKH A;  2UXB Q;  4C3I H;  2VS1 A;  3HKZ G;  4DV3 Q;  4LFA L;  1EOV A;  1QVF A;  1HR0 Q;  1NJI C;  4OWW B;  1D7Q A;  3TS0 A;  3OYY A;  1OXS C;  2E2I H;  4MZ9 A;  4JI3 Q;  4YWL A;  1HZC A;  1XMQ Q;  3J7A 5;  4DR7 Q;  2Q2I A;  2B29 A;  4JI2 Q;  1VQL A;  1L1O A;  3E0E A;  2UUA Q;  1U5K A;  3A74 A;  3OW2 A;  1L2F A;  3ERS X;  1IBL L;  2JA5 H;  2HHH Q;  4A4I A;  1X9N A;  5AJ3 L;  1JJG A;  3CCV A;  1M1K C;  2UUC L;  1OXV A;  2OQK A;  2D0O A;  3AQQ A;  1JJC B;  4L5Q A;  1A8V A;  4X66 L;  5LMU Q;  4LF9 Q;  3NEN A;  4DV2 Q;  5GAE C;  3W1B A;  5M3F H;  1HZB A;  4DR4 L;  4IFD G;  4IFD I;  3CF5 A;  5C44 H;  5H1S E;  1N34 Q;  3PSI A;  4DR1 Q;  5ELN A;  3S1R H;  1LM0 A;  1XNQ L;  3KDF A;  3STB C;  1NTG A;  2JEB I;  2D0P A;  2AWO A;  3CCM A;  2UXC Q;  3KJP A;  3J81 j;  2RCN A;  1IZ6 A;  2YTY A;  2K52 A;  2ASB A;  4A3D H;  4JG2 A;  4JBK A;  4OON A;  1K0R A;  3HOX H;  3HOZ H;  4LF8 Q;  4YCW A;  4POF A;  3I4M H;  4GN4 B;  4IPD A;  1OXT A;  3GTQ H;  5GRO A;  3J81 c;  1CKO A;  2IHE A;  1Y1W G;  1O7I A;  2D62 A;  4UY8 C;  3LGJ A;  2PMZ E;  4LF7 L;  3HOV H;  2BA1 A;  4P73 A;  4A3K H;  4TVA B;  1NE3 A;  2KHJ A;  2PI2 A;  1QZG A;  1EUJ A;  1VQA A;  1WOC A;  3UE0 A;  5FLM G;  4DV7 L;  3NEL A;  2VL6 A;  2RF4 A;  1NMG A;  2WFW A;  4Y7N H;  2OQ0 A;  1N32 Q;  1VQP A;  4DR6 Q;  4IO9 A;  1W3S A;  4JI0 L;  4YHH L;  1W2B A;  1XMO L;  1VQH A;  3PCO B;  3H0G G;  4AH6 A;  3CCJ A;  3FP9 A;  4DK6 C;  2B3G A;  1C0A A;  2C35 B;  1PH2 A;  5M5Y H;  3OTO Q;  2R7Z H;  1WCM G;  1X54 A;  4A93 G;  5ELO A;  1HNX L;  2WB1 G;  1EFW A;  2UUB Q;  3A5U A;  1UE1 A;  1VQG A;  1B8A A;  3E9H A;  1QVC A;  3M4P A;  1KIX A;  4IPG A;  1J5E L;  2ZJR A;  2MNA A;  1FL0 A;  4R4O A;  1VQK A;  1MJC A;  3W1G A;  1CKN B;  3CQZ H;  4DUY L;  2E5L Q;  2JA8 H;  1A62 A;  2R7F A;  2YYZ A;  4A3I G;  2VQE L;  4BBR H;  5M5W H;  4X64 L;  4GNX C;  2E2H H;  1X6O A;  3CC2 A;  2UXD Q;  5C4X H;  4H02 A;  4GOP B;  5BR8 Q;  4HJ9 A;  1FVI A;  3CC7 A;  1PV4 A;  1L1O C;  2DGY A;  4QQB X;  4JYA Q;  4P72 A;  2VQF L;  4BY1 H;  4GLX A;  3KYH C;  4IOA A;  2CWP A;  4X62 Q;  1QVG A;  1YHB A;  2ZTC A;  1X55 A;  1UE7 A;  3CP0 A;  1Q81 C;  1HNZ L;  1KAW A;  4DV4 Q;  4YCU A;  2VY3 A;  3F2C A;  1Q12 A;  3ULP A;  3G48 A;  2WAQ E;  1HZ9 A;  3PUZ A;  1MKH A;  1B7Y B;  4A76 A;  3ULL A;  4DR3 Q;  4JBM A;  1P8L A;  2JA5 G;  4KHP Q;  2JE6 I;  3KF6 A;  1S72 A;  1K73 C;  3KOJ A;  1VQE A;  4DUZ L;  4JI1 L;  1N36 L;  5LMN W;  1E3P A;  2LSS A;  3FHW A;  3K7A H;  1HH2 P;  3GD7 A;  1WCM H;  1Z9F A;  3MEF A;  1VQO A;  5M3F G;  3U4V A;  4A75 A;  4AQY L;  3S1M H;  2JK8 A; 
#chains in the Genus database with same CATH topology
 2JP1 A;  2ZM6 L;  1EYD A;  1LAB A;  2VXW A;  5IT9 L;  4HMI A;  1B53 A;  1GHK A;  4HJA A;  1SXT A;  2XRS D;  5FLX c;  3EN2 A;  5D3D A;  4GN5 A;  2F0K A;  4WJ4 A;  3PIO 3;  2EYM A;  5HGT A;  4FP5 D;  1GUW A;  5JJK A;  1TY0 A;  2YV5 A;  4RG1 A;  3D6C A;  5IT9 E;  2WAQ G;  5T1I A;  4BA2 I;  4GNX A;  1LAC A;  3T1Y L;  1I3Q H;  2F0P A;  5IWA Q;  4LF6 Q;  3GTO B;  1JIC A;  1FJG L;  4EQ5 A;  2NVX H;  3AYH B;  5E4W C;  1Q86 C;  3S1Q B;  1V9P A;  1P16 A;  2EYF A;  5AJ3 Q;  1I94 L;  1E7Z A;  4MNO A;  2F0L A;  2R7Z G;  5IP9 H;  3CCQ A;  1SN8 A;  4FXK C;  4UP8 A;  3CCU A;  3E6Z X;  1H9S B;  4EX5 A;  3PUW A;  3KBG A;  3IFT A;  3PGZ A;  3HFZ B;  5DEH A;  1HXY D;  2B2V A;  1LTS D;  5I2X A;  1F2Z A;  2AKW B;  4KJN A;  4NPS A;  1XNQ Q;  2CQA A;  4BBR G;  1SYB A;  1SEB D;  1XTD A;  4BBS G;  4QUC A;  4FNF A;  5KNC A;  1CQF A;  4A3M H;  1PH7 A;  1B3Q A;  4ZKB B;  1E22 A;  5C5M A;  4NB3 A;  5HUR A;  4A93 B;  2NVQ H;  1GJX A;  3C1F A;  4HCE A;  2NZ1 D;  1YHQ A;  1OTC A;  1F2L A;  4IUN A;  2JA6 H;  2X6G A;  4QL5 A;  4RGO S;  4YHH Q;  4G7Z C;  1G29 1;  3HG9 A;  4NMZ A;  4H0L C;  1XMO Q;  1CSP A;  4H7B A;  2OXP A;  2CFM A;  4WRD A;  3MXU A;  2F0H A;  2G5D A;  4KMU C;  3DEO A;  4A3C G;  3X3N A;  3J80 L;  3I8Z A;  4HAE A;  4FO2 A;  1I6V C;  2ZT9 C;  2E2I B;  1STN A;  3BDL A;  3I4N H;  1FGU A;  4BBS H;  2YTV A;  2RVL A;  3ERO A;  4DNI A;  3QG1 A;  3J80 i;  3AFP A;  3CMA A;  4GNX B;  4A3K H;  2JA5 B;  4UDU C;  1D2B A;  3HS0 C;  2F3W A;  3QIA A;  2NWG A;  1FD7 D;  3B6Y A;  3CPF A;  5E3F A;  3UDX A;  2J4X A;  4EGV A;  3KFU A;  4J15 A;  4KTA A;  1Q1E A;  1YVC A;  2F0N A;  5KGU A;  1K8O A;  5K36 H;  5HGQ A;  4LUO A;  1FNU A;  4EVO A;  5JJL A;  4L6T B;  4O2D A;  2IW3 A;  3VYS A;  1TWF H;  1E24 A;  4B3M L;  4HN7 A;  4KK7 A;  1SE2 A;  2IY5 B;  3IFD A;  1D5Z C;  1EEI D;  1WTW A;  2Z6K C;  3LWE A;  3GTQ B;  3ONA B;  4KHZ A;  3EA6 A;  1C7Y A;  2JA7 G;  1YJN A;  4JI6 L;  4R1J A;  1I4H A;  1EWI A;  3TN2 A;  2BE5 D;  4R9W A;  2A19 A;  1PFS A;  1NR4 A;  2LKV A;  4A3J H;  1R9T H;  4KD4 A;  4UP9 A;  4BXX H;  4LFB Q;  3NTH A;  5CBE E;  5M5Y B;  2JEA I;  4PG3 A;  2NN6 I;  4MTK A;  2R7Z B;  4I7A A;  1DD2 A;  4LF4 L;  2IX0 A;  4A3G H;  3IRB A;  1Q3L A;  3PIP A;  1TR5 A;  2EIF A;  1STE A;  3I55 A;  1VDZ A;  1M90 C;  1CM9 A;  3D8G A;  1HZA A;  1Z6H A;  3PF5 A;  3CQZ B;  3PUY A;  2BH2 A;  4K5W A;  5IYD H;  4BBR B;  2ID0 A;  4JI3 L;  4H13 C;  1NSN S;  1TII D;  2EOT A;  2WKD A;  5IGC A;  2UUA L;  1A0I A;  4OIK A;  2YU9 H;  4O1N A;  3D31 A;  1X3E A;  4JI7 Q;  5CR3 A;  3T13 A;  3W2D A;  1Z7T A;  2NTT A;  3A5Z B;  5J1Z A;  1EU4 A;  2F0Q A;  5BN3 A;  3MXP A;  1KC8 C;  4LF9 L;  3OIQ A;  3QOL A;  1WI5 A;  4DV2 L;  2E8G A;  4HJ7 A;  4GS3 A;  5LMN Q;  1VMC A;  4ABN A;  1MJE A;  4JI4 Q;  5L37 A;  2PQA A;  3RZO B;  1PH1 A;  2VNU D;  1DOK A;  4B3S Q;  2UXC L;  5EKL A;  3K7A B;  1PHJ A;  2IL8 A;  4ZLT F;  2H5X A;  2EJG C;  4JI8 Q;  2IT1 A;  4Y52 H;  2KCM A;  1PA6 A;  2UU9 Q;  4GKJ Q;  4KV6 A;  4ZK9 B;  4CJ0 B;  4B3R Q;  1QUQ A;  5AFW A;  5JJI A;  2F4V Q;  2A74 C;  1K8G A;  1A2U A;  1FYC A;  4R8I A;  1PTO B;  1X3F A;  5C4J B;  2B63 G;  2PMZ B;  3M3Y H;  3CRK C;  4ZKC B;  1CHQ D;  1V1P A;  4C3H G;  4HID A;  4PMB A;  4G7H C;  4FDB A;  3CPW A;  4KLK A;  1IW7 D;  3FEW X;  4DR5 Q;  3SK8 A;  3V96 A;  2Z9H A;  3OTO L;  1QJO A;  4AYB G;  3P20 A;  4ZRZ A;  2E2D C;  3GTG H;  2A1A A;  4K2L A;  1EYC A;  1N8R C;  1PH6 A;  4L5S A;  2K5N A;  3ZJY C;  1EIH A;  3EFX D;  1RIP A;  1N33 Q;  3QJY A;  1PXU A;  1TWG H;  1K83 H;  4OGQ C;  2JA7 B;  4OXP A;  1EYG A;  1Y1V G;  2EY6 A;  3M7N A;  1IKM A;  2HDL A;  3H15 A;  2E2J B;  1PZJ D;  2BA0 A;  4X62 L;  3PO3 B;  4DV4 L;  1VQ5 A;  2Y0S G;  2B63 H;  1TQO A;  4C3I G;  2OT2 A;  5FLM H;  3UDI A;  4DR3 L;  1Q1B A;  3HKZ E;  4KHP L;  3A7A B;  2BDO A;  4MTN A;  2IX1 A;  5IY0 A;  4LFC Q;  1CA6 A;  2F4I A;  5EBD A;  3BYT B;  3H0G H;  4K0K Q;  1UWV A;  4HJ8 A;  2PQA B;  2XWJ B;  1PH4 A;  2VUM B;  2MGS A;  1KAB A;  1YIT A;  3PIO A;  3HOU G;  4IUP A;  4L5R C;  5C3W A;  4HMJ A;  1EQQ A;  1WTX A;  1C9O A;  4RFB A;  4CHT B;  1Y1V H;  2PPB C;  3GTK B;  4LMQ D;  3UDF A;  3ICE A;  5M5X H;  4DAY A;  2EYP A;  3L9A X;  4ZAI A;  4X6A H;  2ATW A;  2HIX A;  4Q0F A;  1V1P B;  1WTV A;  5IWA L;  4LF6 L;  3ERQ A;  4C3I H;  4DV3 Q;  1QVF A;  1EOV A;  5D3I B;  3DM1 A;  1HR0 Q;  4ZCK A;  4OWW B;  2CH4 A;  1OXS C;  2NBF A;  2MUY A;  5FLX L;  1L1O A;  1EQV A;  1JOR A;  4V19 0;  5CYU A;  2QDL A;  5AJ3 L;  2D0O A;  3AQQ A;  3FDT A;  2ICI A;  1JOO A;  2ZXO A;  5M3F H;  2KVM A;  1HZB A;  4LAA A;  3RMH A;  4IFD I;  1N34 Q;  4DR1 Q;  5ELN A;  3S1R H;  1XNQ L;  1VF7 A;  3KDF A;  3STB C;  3P7J A;  1NTG A;  3CCM A;  1SYC A;  2PW5 A;  2RSO A;  4JW0 A;  3J81 j;  3KJP A;  1IZ6 A;  4C3H B;  2LMC B;  5ELE A;  4OON A;  4HSV A;  3HOX H;  2O4X A;  2K5Q A;  4PV1 C;  1I4X A;  3J81 c;  4AYB B;  2D62 A;  2KEC A;  3HOV H;  1SNM A;  4P73 A;  1SSO A;  4TVA B;  2WIN B;  1NE3 A;  2KHJ A;  3UE0 A;  1FNV A;  2RF4 A;  3S2D B;  1GHJ A;  1N32 Q;  4IUU A;  1VQP A;  3EJI A;  3RUZ A;  3SXH A;  4YHH L;  1PRT D;  2SNM A;  1XMO L;  3MWY W;  3PCO B;  1D1I A;  4DK6 C;  2B2U A;  2B3G A;  5KND A;  1WTR A;  5DNF A;  2L5T A;  2K28 A;  1UE1 A;  3E9H A;  1KIX A;  2Y0S B;  3R8B A;  1ZXT A;  1ET6 A;  3U9S A;  1PMR A;  2H1E A;  4NP5 A;  1A62 A;  4CKE A;  5M5W H;  2A6H D;  4GNX C;  3S15 B;  1X6O A;  2G9H D;  3J7A F;  2DJG C;  3M4O B;  1CHP D;  5C4X H;  4GOP B;  4BY1 H;  4H44 C;  1EWC A;  3Q0A A;  4RCO A;  4JVZ A;  3H91 A;  4K6D A;  3HOU B;  1DJR D;  4B9W A;  4C2M B;  2LS0 1;  2F0O A;  1S5F D;  1HZ9 A;  4YIJ A;  5C0X H;  3PUZ A;  1P8L A;  5JOB A;  4RGM A;  2JE6 I;  5JEA H;  3KOJ A;  1VQE A;  1HQR D;  5T1G A;  4E6I A;  5LMN W;  3FHW A;  1H9J A;  1F9P A;  4XYO A;  4A75 A;  3GTP H;  5C44 G;  3VYR A;  2BDN A;  1SFO H;  3SK5 A;  1RD9 D;  3S17 H;  3W3A A;  3U58 A;  1SE8 A;  3DEP A;  1JT8 A;  3TP7 A;  3K5N A;  3K80 C;  3EVQ A;  2J0T D;  4JBW A;  2QEX A;  4ULL A;  4GZY C;  3H3V I;  3BZK A;  3HOZ G;  1GXD C;  2OCE A;  4LFB L;  5IOC A;  1BXT A;  4YWM A;  4N8X 1;  1PFN A;  3M85 A;  2Q2T A;  1Q8K A;  1SYG A;  2RHS B;  5IGF A;  4V0B A;  2RSN A;  2I0Q A;  4LFA Q;  1VQC A;  3VA5 A;  5A2Q E;  1SAP A;  3NUC A;  4CDD C;  2ALY B;  1LT4 D;  2L11 A;  2A8V A;  4O42 A;  2IHF A;  1IBL Q;  3AMU A;  4BY7 H;  5JVG 3;  3I91 A;  3S2H B;  4JI7 L;  4FF2 A;  1IYV A;  2AUK A;  1I6H H;  5DLQ E;  5JPN C;  4CKC A;  3K5M A;  3NXW A;  5E7N A;  1PZK D;  3D0F A;  3UI2 A;  2FJ2 A;  4DR4 Q;  2JA8 G;  5LMN L;  3I72 A;  1YEZ A;  5EPJ A;  4DK0 A;  5FOB B;  1AE2 A;  2DNC A;  5COY A;  3K0Y A;  4JI4 L;  4F87 A;  2AMC B;  2HIV A;  4B08 A;  1LLR D;  4B3S L;  1Q46 A;  1VQI A;  2R61 A;  5IGB A;  4TQU S;  3SGI A;  1WFQ A;  3CHB D;  1GM5 A;  2LY7 A;  1VQ4 A;  2CCZ A;  4JI8 L;  4LF7 Q;  2UU9 L;  4GKJ L;  2FMC A;  4B3R L;  2WP8 J;  2YTX A;  4R4C A;  2F4V L;  3BYY B;  3GTL H;  3VYU A;  1BQQ T;  4QIW E;  1TWC B;  1HFN A;  1PTO C;  3GTM B;  1KDC A;  2NVY H;  2GVA A;  2ICE C;  3K7U C;  2AUJ D;  3MHB A;  3J7Z C;  1HHV A;  2A68 D;  2B8F A;  4DR5 L;  1S3O A;  2B2Y A;  2JA9 A;  2Q8T A;  2M00 A;  3HEJ A;  5CC4 A;  4WOR A;  4KKT A;  5CV6 A;  4CJ1 B;  4G57 A;  1A15 A;  4ZYS A;  1F9Q A;  1ILQ A;  1VQM A;  2QGQ A;  3GTJ H;  2VQE Q;  4DV6 L;  1IYJ B;  5E4X A;  1N33 L;  1CUK A;  3I3C A;  1O7L A;  1JE5 A;  4RHR A;  1L0W A;  1Y8P B;  5LL6 S;  2VQF Q;  2HQL A;  1HR0 W;  2KCT A;  1A6X A;  4BA1 I;  3D3R A;  5ELF A;  1HNZ Q;  2B2T C;  5C44 B;  4LUV A;  4U68 A;  3HKS A;  5I4D A;  5GAD C;  3G6J B;  3V2T A;  1HPC A;  4BS9 A;  4RGN A;  4DAM A;  4FXD A;  5LL6 X;  1O7Y A;  3E3X A;  4XQQ A;  2E74 C;  1BDO A;  4K5V A;  4DUZ Q;  3HOZ B;  1N36 Q;  2VZA A;  4I65 A;  3I4M B;  5IP9 G;  2L12 A;  4LFC L;  1BKB A;  2I5L X;  5C4H A;  3A56 A;  2K5V A;  2JJQ A;  4JCV E;  2B39 A;  3ITP A;  2IPK D;  4WJ3 M;  1EU3 A;  1VQF A;  1KQS A;  4JI5 Q;  4Y7N B;  1BO0 A;  1LUZ A;  2F0J A;  4XIG S;  3PO2 G;  1AP0 A;  1NAP A;  4A3M G;  1I4Q A;  3RZD H;  5HY6 A;  4P71 A;  3EIV A;  1RL2 A;  1T9H A;  1Q8I A;  1VQJ A;  1JCK B;  4FF4 A;  3KLS X;  1I4R A;  4JBJ A;  2ZTE A;  3CW2 C;  1M8A A;  1NY4 A;  1VQN A;  3G7L A;  1NR2 A;  4G7O C;  1KXL A;  1CKN A;  2JA8 B;  2JA6 G;  3EBE A;  5COR A;  3FVQ A;  4LF5 Q;  4DV3 L;  1WD1 A;  1HR0 L;  4LJZ C;  2X6L A;  3TS2 A;  2E2H B;  4EQN A;  4A3F H;  5I6W A;  2ZXP A;  2ES2 A;  4L63 B;  1HNW Q;  4X65 Q;  2L9H A;  3A7L A;  1YZ6 A;  2XTI A;  2MJ8 A;  1Q90 A;  3SDZ A;  1D5X C;  2B2W A;  3I4N G;  2L15 A;  3PO2 H;  5CV5 A;  4JOI A;  3HOW H;  1H9M A;  4A3K G;  1GUG A;  1WYD A;  4FF1 A;  4OWT B;  1N34 L;  4DR1 L;  2R3Z A;  1MHW C;  3OSO A;  1EY4 A;  1B3A A;  2F0G A;  3ULJ A;  2R93 H;  4ID6 A;  1MSG A;  4P75 A;  1YNN D;  1G51 A;  1SJH D;  2JN4 A;  5K36 G;  3H3V H;  3HOY H;  3MZ5 A;  4LW1 A;  4P74 A;  4FVM A;  3WOE A;  4FXG C;  1WVL A;  2PZT A;  5GAG C;  3CME A;  4XQN A;  2ENB A;  3MFG A;  3MXN A;  1ASY A;  1GD7 A;  2N88 A;  5EJW A;  1N32 L;  3OWF A;  4C1N K;  4JC0 A;  1V1Q A;  4OL7 A;  4PMW A;  3TP8 A;  1JWM D;  3DMU A;  5KRU A;  2CKZ B;  1I3Q B;  1W6K A;  1XPR A;  2K1B A;  4RGT A;  2F1M A;  2K5H A;  3J81 L;  2LFN A;  4DV5 Q;  2L4N A;  5IYB G;  3T53 B;  1U0L A;  4A3J G;  3H6M A;  2NVX B;  1VQ9 A;  2XNA C;  2ZTD A;  3J80 E;  4BXX G;  1K3R A;  4IUR A;  1DXM A;  2O5J C;  1EWH A;  3J81 i;  3SHL A;  2MFI A;  3W5O A;  3S14 H;  4A3G G;  2KHI A;  2HQE A;  4GOP C;  1QOH A;  4IAL A;  1NBW A;  3S1N H;  2Z0S A;  5IGD A;  1YIJ A;  1Y1W H;  4BWG B;  5IYD G;  4KY5 A;  4YY3 Q;  2FHT A;  2HCC A;  1BCP B;  1X56 A;  1LTT D;  4IJH A;  4A3M B;  2I5H A;  2ZJP A;  5I2Y A;  2WAQ B;  1MD2 D;  1H95 A;  2Z8L A;  4J1M A;  1ET9 A;  1U9R A;  3RN2 A;  5IGE A;  4RMF A;  2PI2 E;  4OO1 I;  2NVQ B;  3RZO H;  2EY5 A;  1QNK A;  1IBM Q;  5IYB H;  1LO5 D;  2JA6 B;  5ELB A;  1F9R A;  2MO0 A;  2K04 A;  3RR5 A;  3BZD B;  2NVT H;  1VQ6 A;  4DNR B;  4G4K A;  5C4Z A;  1GUT A;  4NDX A;  2QA4 A;  1K9M C;  4X3U A;  1IBK Q;  5ISR A;  3NPP A;  4A3I H;  4YWK A;  1TWA H;  4DV0 Q;  4A3D G;  2PO4 A;  3K57 A;  1IYU A;  3VR5 A;  2RQX A;  1KNA A;  2F3I A;  2FXQ A;  2MO1 A;  2QCP X;  4GKK Q;  2F52 A;  4DPG A;  2TMP A;  3I4N B;  4BBS B;  4C3J H;  1KLG D;  1GKH A;  2UXB Q;  2VS1 A;  3HKZ G;  4A3K B;  4LFA L;  1NJI C;  1G2T A;  3OYY A;  4YWL A;  4DR7 Q;  5C3X A;  1SNP A;  1PRT B;  4CDE C;  3X3M A;  1IBL L;  1X3P A;  2HHH Q;  2EXZ A;  4A4I A;  2EVB A;  1JJG A;  1HFG A;  3CCV A;  4XT1 B;  4RHS A;  1JOQ A;  1JJC B;  4ZQ3 A;  4L5Q A;  3OIP A;  1KNE A;  2EE1 A;  3P75 A;  3W1B A;  1TWF B;  1PDQ A;  5FO8 B;  4DR4 L;  4DXF A;  5H1S E;  1WD0 A;  3TP5 A;  5CV4 A;  3GP7 A;  3SEB A;  1B9N A;  2JEB I;  2AWO A;  3NBH A;  2YTY A;  4A3D H;  1QIL A;  2K05 A;  3C46 A;  4DGZ A;  1B2T A;  1SYD A;  2VB3 X;  4LF8 Q;  1ENC A;  4YCW A;  4GN4 B;  4IPD A;  1CKO A;  1JC7 A;  1PFM A;  4LF7 L;  2PMZ E;  2CW0 C;  4DF7 A;  3FRP B;  1QZG A;  3PMF A;  5FLM G;  4A3J B;  3NEL A;  1R9T B;  1NMG A;  2OQ0 A;  3VR6 A;  2A6E C;  3LNN A;  1I50 B;  1W3S A;  1ZEQ X;  1W2B A;  2XIW A;  1VQH A;  3H0G G;  3LWU A;  3TSS A;  4A3G B;  2P5Z X;  3GV3 A;  3R93 A;  1PH2 A;  1HUM A;  4OIJ A;  1K3B C;  1KTK A;  1WCM G;  2Z6B A;  5ELO A;  2WB1 G;  1F77 A;  1B8A A;  3J7A V;  4IPG A;  1G8Z D;  2ZJR A;  1CK1 A;  2JXM B;  2MNA A;  2G9D A;  2BE5 C;  3D4D A;  3OWE B;  4R4O A;  3W1G A;  2E5L Q;  3IL8 A;  4U67 3;  2YU9 B;  2VQE L;  4HR7 B;  1PLF A;  3I70 A;  4KKU A;  4ME5 A;  1BF4 A;  5BR8 Q;  4HJ9 A;  2EYL A;  1PV4 A;  4JYA Q;  1U4M A;  1II3 A;  2VQF L;  4GLX A;  3KYH C;  2CWP A;  1XXG A;  2SEB D;  4KY7 A;  3C1E A;  1QVG A;  1YHB A;  1FGB D;  3I73 A;  1HNZ L;  5I9O A;  1Q12 A;  3A8K E;  1D6E C;  2PW7 A;  1MKH A;  2KCC A;  4A76 A;  1KDB A;  4JBM A;  5EQ0 A;  1HA5 A;  4DUZ L;  2BOS A;  1L0X B;  1N36 L;  2LSS A;  3O13 A;  5J39 A;  3GD7 A;  1WCM H;  1VQO A;  2Z4H A;  5M3F G;  2AQ3 B;  3S1M H;  4DV1 Q;  1HCZ A;  1QUQ B;  1JWS D;  4JI5 L;  2KA7 A;  3M3Y B;  3TBI B;  1X65 A;  1UE6 A;  1AZP A;  4KD3 A;  1SRU A;  4KI0 A;  2A73 B;  1U4R A;  1KDA A;  2F0S A;  1TWH H;  3E9I A;  3HOX G;  2GN5 A;  3AEV A;  1AEX A;  4HJ5 A;  4CDF C;  4AIM A;  4NXN Q;  3HOV G;  1PYS B;  3NEM A;  5EAY A;  2RHQ B;  3GTG B;  1B70 B;  1OXU A;  3L2P A;  4N9T A;  5A35 A;  2NN6 G;  3VA7 A;  2XRQ D;  3S16 H;  1EIY B;  1YNX A;  2DUD A;  3URY A;  3PF4 A;  4LF5 L;  1DCZ A;  1VQ7 A;  5ELC A;  4POG A;  1TWG B;  1K83 B;  1G91 A;  4CJ2 C;  4XT3 B;  2L55 A;  4NKL A;  2A69 D;  4K14 A;  4IUT A;  3VR4 A;  1HNW L;  2UUC Q;  4QJF A;  4X65 L;  1DOM A;  5FLX E;  2NYZ D;  5CV8 A;  5BN5 A;  2B63 B;  1YBY A;  2BH8 A;  4KY6 A;  2EY1 A;  3A55 A;  2KHS A;  4TRD A;  5FKA C;  1DYQ A;  1HUN A;  5TSS A;  2Z6K A;  3IKJ A;  3NHH A;  5C4X G;  3AFQ A;  4AYB E;  4DK3 C;  5I9P A;  1RDP D;  4PZ8 A;  3H0G B;  3A0J A;  4BY1 G;  1SDF A;  4Z9C B;  4A3L H;  3T51 B;  1PH3 A;  1SE3 A;  1J9O A;  3RNU A;  2NN6 H;  4GLA C;  2RDH A;  1BCP F;  4LWC A;  2WB1 B;  2A5H A;  1SR3 A;  5C0X G;  2NZH A;  5FJ8 H;  3VDY A;  3CCE A;  4HSP A;  2DNE A;  1B4O A;  1MI2 A;  5JEA G;  5IP7 H;  1STG A;  2XSC A;  4J8Q A;  1Y1V B;  3KF8 A;  4A3E H;  2SOB A;  5M5X B;  1EY7 A;  4MHE A;  2JQO A;  5C3E H;  1EQR A;  1SLJ A;  2Y0S E;  1UEB A;  4KJO A;  3S24 A;  1NMF A;  4MN3 A;  4DAY B;  3T16 A;  4C3I B;  4HIO A;  1HNX Q;  3G71 A;  4PMC A;  1J5E Q;  4DV5 L;  3BDC A;  4L5T A;  4DUY Q;  4PNY A;  2QF7 A;  1A63 A;  1OXX K;  1STA A;  3CCS A;  3F8T A;  1S40 A;  3I90 A;  1L1O B;  1L0Y B;  1E1O A;  1DZ1 A;  4L8J A;  2M9V A;  5ELD A;  3PV0 A;  1S5B D;  3MFY A;  1B9M A;  2E76 C;  5M3F B;  2NZO A;  3SR1 A;  2PNH A;  3Q8D A;  1G6P A;  1OO9 B;  1E2Z A;  2F03 A;  3S1R B;  4O0A A;  1PVO A;  4YY3 L;  1KLU D;  2RKS A;  1BCP C;  3AB9 A;  3CCR A;  3K81 C;  3K0X A;  2K4K A;  4BY7 G;  2B2V C;  3NWT A;  1PYW D;  1PH8 A;  1VQD A;  2EXD A;  4JI1 Q;  3KDF B;  3P1H A;  3ND9 A;  1EQT A;  3D4R A;  5EPK A;  1ENF A;  3HOV B;  1QNU A;  1A2T A;  1ZYR D;  4XDX A;  3OPO A;  4XTC S;  4AQY Q;  1LTA D;  1IBM L;  4OHJ A;  3CXC A;  4M8A A;  1STY A;  4HIK A;  3F1Z A;  2MPM A;  3M9B A;  1EZ6 A;  3KBX A;  2F3V A;  3CKI B;  1MSH A;  4JV5 Q;  4IJL A;  4RWS C;  5NUC A;  3LX0 A;  1UE5 A;  2PZU A;  3FPU B;  1GVP A;  1IBK L;  3FKI G;  4Q5V A;  5GAH C;  4DV0 L;  1EIG A;  1QB5 D;  1LT5 D;  1PTO F;  1X3Q A;  3ER0 A;  2Q8R E;  3OMC A;  3KF8 B;  2R92 H;  4GKK L;  5IYC H;  2CQO A;  2AQ2 B;  3SK4 A;  2UXB L;  4RCN A;  5FK9 C;  1I4P A;  2Q2H A;  1Y14 B;  1SMY D;  3CD6 A;  3H94 A;  3M4Q A;  4DR7 L;  5C4X B;  2ZJQ A;  1TS4 A;  5EBC A;  3MXG A;  4PQX A;  1J6Q A;  2CWA A;  1NUC A;  1PRT C;  1U4P A;  4A3B H;  1RJT A;  2RA4 A;  2HHH L;  1O7Z A;  3T1H Q;  4WJW A;  1E2W A;  1SMX A;  3BJU A;  3NE5 B;  1SNC A;  5FO7 B;  4OX9 Q;  1LTI D;  1WJJ A;  1ASZ A;  1YJW A;  1HTP A;  3U9O A;  5M3M H;  1Y69 U;  3CAM A;  1TS5 A;  1ONL A;  1V43 A;  3NTI A;  4DN4 M;  1XPO A;  2K50 A;  3FKI H;  3GDE A;  3PUX A;  1HRJ A;  4KKS A;  4NXM Q;  3A54 A;  4LF8 L;  3GTP B;  3KLR A;  1SFO B;  1CT1 D;  3S17 B;  5G3L F;  4J6H A;  3RLF A;  4B3T Q;  1X3G A;  4RA8 A;  5M9O A;  1Q82 C;  1E0B A;  3G4S A;  4DR2 Q;  3EQL C;  3C3L A;  1BBW A;  1XNR Q;  1MIU A;  1VMP A;  3HP3 A;  4HIM A;  1K8A C;  3UDG A;  4DK1 A;  1SE4 A;  2KEN A;  3I2Z A;  1LYL A;  3TEH B;  1JR0 D;  3KK7 A;  4XYQ A;  4UPA A;  1CFM A;  5K5P A;  1YI2 A;  1CZG A;  3GTO H;  3KJO A;  2KQ3 A;  4IUV A;  5J3B A;  4IFD H;  4BY7 B;  2E5L L;  1LT6 D;  4DU9 A;  3C2P A;  4IPH A;  4APV A;  2K6A A;  3DXJ C;  3V05 A;  3R3O A;  3U50 C;  3S1Q H;  5BR8 L;  1I6H B;  1H9S A;  5BN4 A;  3HGB A;  1ESR A;  4RH6 A;  1EY0 A;  4JYA L;  3J7Y W;  2KUM A;  1WTO A;  1CKM A;  4CBV A;  3RLN A;  3JAM c;  1AW7 A;  2R6G A;  1H9R A;  1CSQ A;  1STB A;  2F0W A;  4A3F G;  2LXK A;  1LTG D;  4HTH A;  5J22 A;  2AWN A;  4K0K L;  2EYJ A;  2EYO A;  3UE1 A;  2XN9 C;  2JYO A;  1XWE A;  2DY7 A;  4EQO A;  3Q6S A;  3WDN A;  4C1N I;  1JWU D;  1K28 A;  3HOW G;  1TT2 A;  3GTL B;  1NCV A;  1Y8O B;  2FFK B;  4DV1 L;  4A93 H;  1VQ8 A;  1S5D D;  1JOK A;  2EYH A;  2N3S A;  2LXJ A;  2NVY B;  2R93 G;  3BDO A;  1JMC A;  3K8A A;  2WII B;  2KEE A;  2GVB A;  1UNS A;  5F2D A;  3TRZ A;  4DAV A;  1STH A;  5EKI A;  4LUZ A;  4NXN L;  3DM3 A;  4KN4 C;  2F0I A;  3TDQ A;  3HOY G;  5JPM C;  4YCV A;  4QMG A;  3QR8 A;  2R7D A;  3HRZ C;  4R8N A;  3RLO A;  3GTJ B;  2SNS A;  2GA4 B;  2E2I H;  2D9U A;  4MZ9 A;  1XMQ Q;  1HZC A;  2Q2I A;  2B29 A;  4JI2 Q;  2RBM A;  4P2C B;  1U5K A;  2F0V A;  4B9X A;  3OW2 A;  1EOT A;  1L2F A;  3ERS X;  1H9K A;  2JA5 H;  1CTM A;  5DAU A;  4HCS A;  1EFI D;  4JK1 C;  1M1K C;  2UUC L;  1OXV A;  1S5C D;  2OQK A;  2QW7 A;  3R2T A;  3MAQ A;  5LMU Q;  2A68 C;  4QF4 A;  5GAE C;  1TS3 A;  2EJF C;  2EZV A;  1EEF D;  3DWP A;  4X3K A;  3CF5 A;  1E2V A;  3VR3 A;  1VF5 C;  2D0P A;  5CV7 A;  1JE4 A;  1ICF B;  1G2S A;  4JG2 A;  1K0R A;  5D14 A;  1OXT A;  3GTQ H;  5GRO A;  1YNJ C;  2IHE A;  4DFA A;  1Y1W G;  2K5D A;  3LGJ A;  1WTH A;  2EY2 A;  1QE6 A;  3GQB A;  2PI2 A;  1VQA A;  4N9P A;  1RCV D;  2HDM A;  3RZD B;  4DR6 Q;  3Q23 A;  4IO9 A;  1A3U A;  3E5S A;  3MVV A;  3CCJ A;  1RHP A;  3FP9 A;  4RKL A;  1JQY D;  1JB3 A;  5EGT A;  2C35 B;  1GOZ A;  5M5Y H;  1LV9 A;  5IOD A;  2R7Z H;  1AZQ A;  4K8I A;  1F2Y A;  1HNX L;  2UUB Q;  3A5U A;  3BVM A;  3M4P A;  1QVC A;  2SDF A;  3SVM A;  1J5E L;  3NQT A;  1FL0 A;  4K5X A;  1F9S A;  4A3F B;  1GUO A;  1VQK A;  1MJC A;  1CKN B;  3CQZ H;  3J81 E;  2NB0 A;  4DUY L;  4A3I G;  1RTO A;  4BBR H;  2CHB D;  3K59 A;  2K33 A;  2F0E A;  3NBI A;  3OHX C;  1UEA B;  3CU7 A;  2EJM A;  2UXD Q;  3NTK A;  1HTL D;  4H02 A;  3DWA A;  1FVI A;  1L1O C;  2DGY A;  1TS2 A;  4QQB X;  5JVH 3;  4P72 A;  1C8C A;  3NK9 A;  3TZD A;  4IOA A;  4C3J G;  3PO2 B;  2JSO A;  2ZTC A;  1X55 A;  1UE7 A;  1EL0 A;  1Q81 C;  3HOW B;  3QOJ A;  3F2C A;  3ULP A;  3G48 A;  2WAQ E;  4XQJ A;  2AQ1 B;  2CW0 D;  1KAA A;  3ULL A;  5KYL A;  2R93 B;  1ML0 D;  3N52 A;  3KF6 A;  1K73 C;  2A6E D;  5FO9 B;  2QDB A;  4JI1 L;  1E3P A;  4QB4 A;  3DUZ A;  3K7A H;  1HH2 P;  1B1Z A;  3HOY B;  2F0M A;  1EY9 A;  3ND8 A;  3U4V A;  5CBA E;  3D6W A;  4AQY L;  4A3C H;  1R4P B;  2JK8 A;  3L0O A;  2J7Z A;  3KUP A;  2OTJ A;  3AU7 A;  1Y8N B;  1I5F A;  4OWX B;  2NUC A;  4PZ7 A;  3CCL A;  2H4O A;  4TSS A;  2PNR C;  1W6J A;  3CRL C;  1E1T A;  3PO3 G;  4JV5 L;  1DM0 B;  1PTO H;  3MXN B;  5C4J H;  1SBB B;  5LHY 1;  1MBY A;  3OMG A;  1WTP A;  2XVS A;  3BG3 A;  1EIF A;  1XYI A;  1SYF A;  1YNN C;  1GUN A;  1I50 H;  2N78 A;  1K8M A;  3L3O C;  2B2U C;  1PFB A;  4LK1 C;  2RDG A;  1QG7 A;  1EZ8 A;  2Q2U A;  5DM7 3;  4C56 C;  2DN8 A;  2VUM G;  1MGS A;  5CGK A;  3TME A;  3S14 B;  1FR3 A;  4ZUI A;  4GLV B;  5GQO A;  3S1N B;  2EDG A;  4FF3 A;  2FIN B;  1V1O A;  2B2T A;  3T1H L;  1Y1W B;  1EY5 A;  4X66 Q;  2JA7 H;  2NTS A;  1TU2 B;  4OX9 L;  3IAY A;  1GO3 E;  1TY2 A;  2E2J H;  2RDF A;  3PQI A;  5KIX A;  3PO3 H;  3G6E A;  3M4Y A;  2K01 A;  1KRS A;  1TVX A;  1SJE D;  3WWV A;  1HA6 A;  4R4Q A;  3JC6 6;  1VS0 A;  3R2I A;  4NXM L;  2IJ0 A;  1A3V A;  1T5X D;  3N6R A;  1VQB A;  3KF6 B;  4LNQ A;  3SE0 A;  2NVT B;  3CC4 A;  4B3T L;  5C0X I;  2VUM H;  4R4T A;  4DV7 Q;  5JAV A;  3U4Z A;  1U4L A;  4JI0 Q;  2K14 A;  4A3I B;  1TWA B;  4DR2 L;  1F2M A;  4MIU A;  5JJZ A;  1XNR L;  1IL2 A;  4IPC A;  2O2L D;  4DA2 A;  1DOL A;  1KL9 A;  4OEM B;  2DJF C;  3GTK H;  5C5L A;  4C3J B;  2M2L A;  2HT1 A;  2IWH A;  1CA5 A;  1RTN A;  2XWB B;  4R4I A;  2C9O A;  2BCO A;  1N9W A;  3STB D;  1SND A;  4X64 Q;  2V1C C;  3RD4 A;  2MQH A;  4NW2 A;  1LT3 D;  1M4V A;  1XX8 A;  4DV6 Q;  3FPP A;  2Z1C A;  3F2B A;  5C0X J;  4KN7 C;  2CVR A;  1JJ2 A;  2F0T A;  1LTL A;  3H09 A;  5JEA J;  5IT9 c;  2OWO A;  3BS1 A;  4QCL A;  3MTS A;  4DXG A;  1Q7Y C;  3PUV A;  3M7G A;  1KD1 C;  2KBN A;  1YHA A;  4A3D B;  2L1B A;  3KLW A;  1KHI A;  5KYI A;  3BU2 A;  1Z47 A;  3NBH B;  5CMD A;  4C3H H;  3I56 A;  1UUP A;  3HKZ B;  1TKW B;  1TXY A;  2K32 A;  4RKB A;  1BBX C;  2ZM6 Q;  4QGU A;  4OO1 G;  3JAM L;  2XGT A;  3RN5 A;  3T4A C;  2I46 A;  4IN3 A;  3GV6 A;  3S2D H;  4F7X A;  3QB3 A;  1PYB A;  1ILP A;  4A3L G;  1EYA A;  5DM6 3;  3MA2 B;  3JAM i;  3L7Z C;  5D65 A;  2CH4 W;  5IE8 A;  4I7Z C;  3T1Y Q;  4X3S A;  3JAM E;  1GUS A;  5EPL A;  5FJ8 G;  3TQY A;  1LTB D;  1AE3 A;  4PZ6 A;  1FJG Q;  5IP7 G;  1KRT A;  2B2Y C;  4N8F A;  4UHV A;  4A3E G;  2O5I C;  1S5E D;  4X3T A;  1XMQ L;  1BCP D;  2MP1 A;  4ODG A;  4CDC C;  5C3E G;  4GOP A;  4JI2 L;  2V4D A;  3NP8 A;  1IXR A;  1BOS A;  3I4O A;  1IW7 C;  4S3S A;  1I94 Q;  3S15 H;  1BVS A;  1EY8 A;  3A8J E;  1WTQ A;  3VR2 A;  4IZ8 A;  3M4O H;  5E1F A;  3DHQ A;  1D8L A;  3I4L A;  1BBU A;  5LMU L;  4DKA C;  4OO1 H;  3BVZ A;  3S9W A;  1HQM C;  3HOU H;  1QZH A;  4IOC A;  4GN3 B;  4C2M H;  3ZYY X;  4ALP A;  1SRO A;  2K75 A;  2DY8 A;  1WCM B;  2WB1 E;  5IIF A;  1R4Q B;  3BZC A;  2PYK A;  3J80 c;  2VW9 A;  4UP7 A;  4CGY B;  3K5L A;  2OF1 A;  3S1M B;  2QKI C;  4K8J A;  2KOL A;  1EY6 A;  1BNZ A;  3K5O A;  2I5M X;  2N49 A;  1TWH B;  1PH9 A;  1J8I A;  1CZW A;  4DR6 L;  4IQZ A;  1DGS A;  3T56 B;  2E75 C;  4CKB A;  5KNB A;  2VB2 X;  2HD3 A;  2HUG A;  3SK6 A;  1B50 A;  1YJ9 A;  3S16 B;  2K03 A;  2UUB L;  2Z4I A;  4WFN 3;  2TSS A;  4IFD J;  1LTR D;  1DON A;  2N55 A;  2RCF A;  2C5C A;  2EPB A;  2AHO B;  2Q8I B;  1PZI D;  4ILW A;  1NNX A;  1A3T A;  3D4W A;  3KLS A;  2UXD L;  2PQE A;  3HZX A;  4JPB W;  2R92 G;  1AH9 A;  2OTL A;  1XPU A;  5IYC G;  3S2H H;  5CV9 A;  3TRE A;  1CI3 M;  1PRT F;  2HCI A;  2WV6 D;  4M1U B;  3HOX B;  3QWN A;  4QY7 A;  4B3M Q;  1PTO D;  2B2W C;  1ZKO A;  4TKO B;  2KCN A;  4JOI C;  4A3B G;  2A69 C;  4JI6 Q;  3GO5 A;  5C6A A;  3H3V C;  2WKC A;  2OEO A;  5M3M G;  2D2C C;  4F8M A;  3WOF A;  2K5W A;  3DLL A;  4A3E B;  3TP6 A;  5I6Y A;  1D5M C;  3E0J A;  3Q24 A;  3F2D A;  1VCI A;  5C3E B;  1TWC H;  3GTM H;  4XXE A;  4ME3 A;  3Q22 A;  1SYE A;  1JB7 A;  4LF4 Q;  2ZXR A;  2KED A;  5A2Q L;  2WAC A;  1XJV A;  3I4M G;  3I7F A;  2F0F A;  1HJP A;  2EQS A;  2N8N A;  5M5W B;  2PCF B;  1PH5 A;  3NSW A;  2D5D A;  1CQV A;  1D7Q A;  3TS0 A;  4BY1 B;  4JI3 Q;  3J7A 5;  3PIP 3;  5G3L D;  1VQL A;  3E0E A;  2UUA Q;  3A74 A;  3F2U A;  1V8Q A;  4DNT B;  1O80 A;  1X9N A;  1SNQ A;  1C48 A;  3NWS A;  1QCB D;  1ENA A;  1A8V A;  4X66 L;  4LF9 Q;  3NEN A;  4DV2 Q;  4FYD A;  1S4Z A;  4IFD G;  5C44 H;  1XTC D;  2A6H C;  2PZW A;  3PSI A;  2QEJ C;  1LM0 A;  3VYT A;  1O78 A;  3TZU A;  2UXC Q;  1UAP A;  1QWY A;  2RCN A;  2ASB A;  2B8G A;  2K52 A;  2L0C A;  2QIL A;  4K2K A;  4JBK A;  4DAP A;  3HOZ H;  4POF A;  4KHV A;  3I4M H;  1IHZ A;  1O7I A;  4UY8 C;  4OEL B;  4EQP A;  1SNO A;  1IKL A;  2BA1 A;  3BVG A;  1EUJ A;  1WOC A;  4DV7 L;  2VL6 A;  2WFW A;  1BR9 A;  4Y7N H;  2IX3 A;  4IUQ A;  5IGG A;  1IL8 A;  4JI0 L;  3NQI A;  3K6O A;  4HED A;  4AH6 A;  1ICW A;  4QIW B;  2KJX A;  1C0A A;  4ZUJ A;  3MC0 B;  2R92 B;  3OTO Q;  4QUF A;  3MEH A;  1X54 A;  5EKK A;  1ZYR C;  4A93 G;  2X69 A;  1EFW A;  1VQG A;  1G6Z A;  3A8I E;  1AFP A;  1B44 D;  2JA8 H;  2R7F A;  2YYZ A;  4A3B B;  4X64 L;  2E2H H;  1AN8 A;  1RF2 D;  3CC2 A;  1C4Q A;  3CC7 A;  1ESF A;  1RKN A;  4RAU C;  1K0S A;  4X62 Q;  5M3M B;  1X32 A;  2MHV A;  3CP0 A;  3QO2 A;  2FMM A;  1KAW A;  1YNJ D;  4F88 A;  4YCU A;  2VY3 A;  4DV4 Q;  3K58 A;  1FNW A;  3OW7 A;  3FKI B;  2F0U A;  1B7Y B;  2K7V A;  4DR3 Q;  1BUV T;  2JA5 G;  1SMY C;  4KHP Q;  1S72 A;  1T5E A;  5KEE A;  4K6L A;  2F0D A;  3DWQ A;  3OOC A;  1D1K A;  1Z9F A;  3MEF A;  1ROD A;  2I07 B;  1I4G A;  3FMC A;  4UAI A; 
#chains in the Genus database with same CATH homology
 5C44 G;  2ZM6 L;  4DV1 Q;  1SFO H;  1QUQ B;  3L0O A;  4JI5 L;  2OTJ A;  3S17 H;  1I5F A;  3U58 A;  4OWX B;  4HJA A;  1SE8 A;  1UE6 A;  1X65 A;  4PZ7 A;  3EN2 A;  5FLX c;  3CCL A;  4GN5 A;  3GTP H;  1JT8 A;  1SRU A;  4WJ4 A;  3K80 C;  4JBW A;  4KI0 A;  2QEX A;  1E1T A;  3PO3 G;  4JV5 L;  3E9I A;  1TWH H;  5C4J H;  3MXN B;  3H3V I;  3BZK A;  3HOX G;  3HOZ G;  2OCE A;  4LFB L;  2GN5 A;  3AEV A;  4HJ5 A;  4YWM A;  4AIM A;  5JJK A;  3M85 A;  4NXN Q;  2Q2T A;  1EIF A;  3HOV G;  1Q8K A;  1PYS B;  2YV5 A;  3NEM A;  4RG1 A;  2RHQ B;  5EAY A;  2WAQ G;  2RHS B;  1I50 H;  1B70 B;  2N78 A;  4BA2 I;  1OXU A;  3L2P A;  4GNX A;  3T1Y L;  2I0Q A;  1I3Q H;  2NN6 G;  5IWA Q;  4LF6 Q;  2Q2U A;  3S16 H;  1EIY B;  4LFA Q;  1VQC A;  1FJG L;  1YNX A;  2DUD A;  4EQ5 A;  2VUM G;  3PF4 A;  4LF5 L;  2ALY B;  1VQ7 A;  2A8V A;  2NVX H;  4POG A;  3AYH B;  1Q86 C;  1V9P A;  2IHF A;  1IBL Q;  4GLV B;  5GQO A;  4BY7 H;  1P16 A;  5AJ3 Q;  1HNW L;  1I94 L;  1E7Z A;  2UUC Q;  4JI7 L;  4MNO A;  2R7Z G;  4QJF A;  4X65 L;  5IP9 H;  3T1H L;  3CCQ A;  1SN8 A;  4UP8 A;  3CCU A;  1I6H H;  4EX5 A;  4X66 Q;  5DLQ E;  3PUW A;  2JA7 H;  4OX9 L;  1YBY A;  3PGZ A;  1GO3 E;  2BH8 A;  5E7N A;  2E2J H;  3D0F A;  3HFZ B;  4DR4 Q;  2JA8 G;  5LMN L;  2AKW B;  1YEZ A;  4NPS A;  1XNQ Q;  3PO3 H;  1AE2 A;  4BBR G;  2Z6K A;  3G6E A;  1XTD A;  4BBS G;  4JI4 L;  5C4X G;  2AMC B;  1KRS A;  2HIV A;  3AFQ A;  4AYB E;  4A3M H;  4DK3 C;  4B3S L;  4PZ8 A;  1Q46 A;  1VQI A;  3A0J A;  4BY1 G;  4TQU S;  3WWV A;  1PH7 A;  4R4Q A;  3JC6 6;  1VS0 A;  1E22 A;  3SGI A;  1WFQ A;  4A3L H;  1PH3 A;  1GM5 A;  4NXM L;  1VQ4 A;  2CCZ A;  3RNU A;  4JI8 L;  4GLA C;  4NB3 A;  4LF7 Q;  1ASZ A;  2UU9 L;  4GKJ L;  1VQB A;  4B3R L;  3KF6 B;  2WP8 J;  4LWC A;  2YTX A;  4LNQ A;  4R4C A;  1SR3 A;  2F4V L;  2NVQ H;  5C0X G;  3CC4 A;  5C0X I;  2NZH A;  4R4T A;  4B3T L;  5FJ8 H;  4DV7 Q;  3VDY A;  2VUM H;  3GTL H;  3CCE A;  3U4Z A;  4QIW E;  1YHQ A;  1OTC A;  5JEA G;  5IP7 H;  4JI0 Q;  2JA6 H;  2K14 A;  4QL5 A;  4YHH Q;  4DR2 L;  1G29 1;  4A3E H;  1XNR L;  1XMO Q;  1IL2 A;  4IPC A;  1CSP A;  2NVY H;  1KL9 A;  2CFM A;  2GVA A;  2JQO A;  3K7U C;  5C3E H;  1EQR A;  1SLJ A;  2Y0S E;  1UEB A;  3J7Z C;  4A3C G;  3S24 A;  3GTK H;  1NMF A;  2HT1 A;  4DR5 L;  4DAY B;  1HNX Q;  4HIO A;  3G71 A;  1S3O A;  2JA9 A;  4R4I A;  1J5E Q;  4DV5 L;  1N9W A;  3I4N H;  1FGU A;  4L5T A;  4BBS H;  3STB D;  2YTV A;  4DUY Q;  4DV6 L;  1VQM A;  2QGQ A;  4DNI A;  3J80 i;  3GTJ H;  1OXX K;  3AFP A;  1IYJ B;  3CMA A;  4X64 Q;  1CUK A;  2V1C C;  3CCS A;  4GNX B;  3F8T A;  1N33 L;  1S40 A;  2MQH A;  1L1O B;  3B6Y A;  1JE5 A;  4DV6 Q;  1E1O A;  3CPF A;  1L0W A;  3UDX A;  1HR0 W;  3PV0 A;  2HQL A;  5C0X J;  3F2B A;  2VQF Q;  3KFU A;  2KCT A;  4J15 A;  1JJ2 A;  1Q1E A;  1YVC A;  1A63 A;  2NZO A;  2PNH A;  4BA1 I;  1LTL A;  3Q8D A;  5HGQ A;  1HNZ Q;  5JEA J;  4LUO A;  5IT9 c;  1G6P A;  4LUV A;  5GAD C;  3HKS A;  2OWO A;  4O2D A;  5JJL A;  4O0A A;  1PVO A;  1Q7Y C;  4YY3 L;  3PUV A;  1KD1 C;  1TWF H;  4DAM A;  1E24 A;  2KBN A;  3K0X A;  1YHA A;  3K81 C;  3CCR A;  4B3M L;  2K4K A;  4BY7 G;  2IY5 B;  1PH8 A;  3KLW A;  1VQD A;  1KHI A;  2EXD A;  4DUZ Q;  4JI1 Q;  3BU2 A;  2VZA A;  2Z6K C;  3KDF B;  1N36 Q;  5IP9 G;  1Z47 A;  3NBH B;  4KHZ A;  4LFC L;  1BKB A;  4C3H H;  1C7Y A;  2JA7 G;  2I5L X;  1YJN A;  4JI6 L;  3I56 A;  2K5V A;  2JJQ A;  4XTC S;  4JCV E;  1TXY A;  4AQY Q;  4R1J A;  4WJ3 M;  1VQF A;  1IBM L;  1EWI A;  2ZM6 Q;  1KQS A;  3CXC A;  4JI5 Q;  4HIK A;  4QGU A;  3F1Z A;  1LUZ A;  2A19 A;  4XIG S;  3PO2 G;  4OO1 G;  3M9B A;  1PFS A;  2XGT A;  3RN5 A;  4A3M G;  4A3J H;  4JV5 Q;  4IJL A;  3RZD H;  1R9T H;  3S2D H;  4UP9 A;  5HY6 A;  1PYB A;  4P71 A;  1UE5 A;  4BXX H;  4LFB Q;  3EIV A;  1GVP A;  1IBK L;  4A3L G;  3FKI G;  2JEA I;  1RL2 A;  5GAH C;  1T9H A;  4PG3 A;  2NN6 I;  3JAM i;  4DV0 L;  3L7Z C;  1VQJ A;  4LF4 L;  2IX0 A;  4A3G H;  5IE8 A;  3IRB A;  3T1Y Q;  3ER0 A;  3PIP A;  3KF8 B;  2EIF A;  4JBJ A;  2ZTE A;  2R92 H;  4GKK L;  3CW2 C;  5FJ8 G;  3I55 A;  5IYC H;  1M90 C;  1NY4 A;  1HZA A;  3TQY A;  2CQO A;  1VQN A;  1AE3 A;  3PF5 A;  1KXL A;  4PZ6 A;  1FJG Q;  3PUY A;  1CKN A;  5IP7 G;  2UXB L;  2JA6 G;  3EBE A;  2BH2 A;  4LF5 Q;  4DV3 L;  2Q2H A;  5IYD H;  1Y14 B;  1KRT A;  1HR0 L;  4A3E G;  3TS2 A;  2ID0 A;  4JI3 L;  4A3F H;  3CD6 A;  1XMQ L;  3M4Q A;  4DR7 L;  2ZJQ A;  4GOP A;  5C3E G;  4JI2 L;  1IXR A;  2UUA L;  3I4O A;  1A0I A;  1J6Q A;  2CWA A;  2ES2 A;  2YU9 H;  3D31 A;  1HNW Q;  1X3E A;  1I94 Q;  4A3B H;  4JI7 Q;  3S15 H;  2HHH L;  4X65 Q;  1BVS A;  3T1H Q;  1SMX A;  3BJU A;  3M4O H;  3A5Z B;  1YZ6 A;  2XTI A;  4OX9 Q;  1D8L A;  1WJJ A;  1BBU A;  5LMU L;  4DKA C;  1YJW A;  1WI5 A;  1KC8 C;  4DV2 L;  2E8G A;  2L15 A;  5M3M H;  4HJ7 A;  3I4N G;  3PO2 H;  4GS3 A;  5LMN Q;  3CAM A;  4JOI A;  3HOW H;  4A3K G;  3HOU H;  1WYD A;  4IOC A;  1QZH A;  4OWT B;  1MJE A;  4GN3 B;  1N34 L;  1V43 A;  4JI4 Q;  4DR1 L;  2PQA A;  4C2M H;  1XPO A;  1PH1 A;  4ALP A;  1SRO A;  2K50 A;  3FKI H;  2VNU D;  4B3S Q;  2UXC L;  3GDE A;  2K75 A;  4LF9 L;  3ULJ A;  3PUX A;  1PHJ A;  2R93 H;  2WB1 E;  4P75 A;  3BZC A;  4NXM Q;  2H5X A;  3J80 c;  2VW9 A;  1G51 A;  4UP7 A;  4JI8 Q;  2IT1 A;  4LF8 L;  2KCM A;  1PA6 A;  4Y52 H;  5K36 G;  2UU9 Q;  4GKJ Q;  4B3R Q;  1QUQ A;  3H3V H;  5JJI A;  3RLF A;  3HOY H;  2F4V Q;  4B3T Q;  1X3G A;  1K8G A;  4LW1 A;  4P74 A;  1Q82 C;  5GAG C;  3CME A;  2I5M X;  2N49 A;  1PH9 A;  1X3F A;  3G4S A;  2B63 G;  3M3Y H;  1ASY A;  1GD7 A;  1N32 L;  4DR2 Q;  1BBW A;  4DR6 L;  1XNR Q;  1DGS A;  4JC0 A;  1MIU A;  1V1Q A;  4HID A;  4PMW A;  4FDB A;  4HIM A;  3CPW A;  1K8A C;  4KLK A;  3UDG A;  2CKZ B;  1XPR A;  4DR5 Q;  3OTO L;  4AYB G;  1YJ9 A;  2KEN A;  3I2Z A;  1LYL A;  2K5H A;  3TEH B;  3GTG H;  4DV5 Q;  2UUB L;  2A1A A;  4UPA A;  5IYB G;  1N8R C;  1PH6 A;  4L5S A;  2K5N A;  1U0L A;  3ZJY C;  4A3J G;  4IFD J;  1VQ9 A;  1YI2 A;  3GTO H;  2ZTD A;  1RIP A;  3KJO A;  4BXX G;  1K3R A;  5J3B A;  1N33 Q;  2E5L L;  2AHO B;  3J81 i;  4IPH A;  4APV A;  1TWG H;  1K83 H;  2MFI A;  3W5O A;  3S14 H;  4A3G G;  2UXD L;  3U50 C;  2KHI A;  3S1Q H;  5BR8 L;  4GOP C;  4OXP A;  1EYG A;  1Y1V G;  1NBW A;  2R92 G;  3S1N H;  1AH9 A;  3M7N A;  2OTL A;  1XPU A;  5IYC G;  4JYA L;  3S2H H;  3H15 A;  4X62 L;  2BA0 A;  2Z0S A;  3TRE A;  1CKM A;  1YIJ A;  3RLN A;  1Y1W H;  5IYD G;  3JAM c;  2VQE Q;  4YY3 Q;  4DV4 L;  1VQ5 A;  2R6G A;  2Y0S G;  1CSQ A;  2B63 H;  1X56 A;  4A3F G;  4B3M Q;  2LXK A;  4QY7 A;  4IJH A;  2I5H A;  3UDI A;  5FLM H;  2ZJP A;  4JOI C;  4DR3 L;  1Q1B A;  3HKZ E;  4A3B G;  2AWN A;  4KHP L;  4K0K L;  4MTN A;  2IX1 A;  5IY0 A;  4LFC Q;  3UE1 A;  1H95 A;  4JI6 Q;  3H0G H;  4K0K Q;  3RN2 A;  1UWV A;  3GO5 A;  2PQA B;  4HJ8 A;  4RMF A;  1PH4 A;  2PI2 E;  5M3M G;  4OO1 I;  3RZO H;  1YIT A;  1IBM Q;  5IYB H;  3HOW G;  3PIO A;  3HOU G;  4DV1 L;  4A93 H;  1VQ8 A;  4L5R C;  3DLL A;  2MO0 A;  3RR5 A;  1VQ6 A;  2NVT H;  2N3S A;  2LXJ A;  1EQQ A;  2R93 G;  3F2D A;  1VCI A;  1C9O A;  1TWC H;  1JMC A;  3K8A A;  2QA4 A;  1K9M C;  1IBK Q;  2GVB A;  3GTM H;  4A3I H;  4YWK A;  1TWA H;  1Y1V H;  4ME3 A;  4A3C H;  4DV0 Q;  4A3D G;  1JB7 A;  4LF4 Q;  3UDF A;  3ICE A;  5M5X H;  3TRZ A;  4LUZ A;  4NXN L;  3DM3 A;  3HOY G;  2MO1 A;  2F3I A;  2FXQ A;  3I7F A;  1XJV A;  3I4M G;  2F52 A;  4DPG A;  4YCV A;  4GKK Q;  1HJP A;  2EQS A;  2N8N A;  4X6A H;  2ATW A;  2HIX A;  2R7D A;  4C3J H;  1PH5 A;  3RLO A;  5IWA L;  4LF6 L;  1GKH A;  2UXB Q;  4C3I H;  2VS1 A;  3HKZ G;  4DV3 Q;  4LFA L;  1EOV A;  1QVF A;  1HR0 Q;  1NJI C;  4OWW B;  1D7Q A;  3TS0 A;  3OYY A;  1OXS C;  2E2I H;  4MZ9 A;  4JI3 Q;  4YWL A;  1HZC A;  1XMQ Q;  3J7A 5;  4DR7 Q;  2Q2I A;  2B29 A;  4JI2 Q;  1VQL A;  1L1O A;  3E0E A;  2UUA Q;  1U5K A;  3A74 A;  3OW2 A;  1L2F A;  3ERS X;  1IBL L;  2JA5 H;  2HHH Q;  4A4I A;  1X9N A;  5AJ3 L;  1JJG A;  3CCV A;  1M1K C;  2UUC L;  1OXV A;  2OQK A;  2D0O A;  3AQQ A;  1JJC B;  4L5Q A;  1A8V A;  4X66 L;  5LMU Q;  4LF9 Q;  3NEN A;  4DV2 Q;  5GAE C;  3W1B A;  5M3F H;  1HZB A;  4DR4 L;  4IFD G;  4IFD I;  3CF5 A;  5C44 H;  5H1S E;  1N34 Q;  3PSI A;  4DR1 Q;  5ELN A;  3S1R H;  1LM0 A;  1XNQ L;  3KDF A;  3STB C;  1NTG A;  2JEB I;  2D0P A;  2AWO A;  3CCM A;  2UXC Q;  3KJP A;  3J81 j;  2RCN A;  1IZ6 A;  2YTY A;  2K52 A;  2ASB A;  4A3D H;  4JG2 A;  4JBK A;  4OON A;  1K0R A;  3HOX H;  3HOZ H;  4LF8 Q;  4YCW A;  4POF A;  3I4M H;  4GN4 B;  4IPD A;  1OXT A;  3GTQ H;  5GRO A;  3J81 c;  1CKO A;  2IHE A;  1Y1W G;  1O7I A;  2D62 A;  4UY8 C;  3LGJ A;  2PMZ E;  4LF7 L;  3HOV H;  2BA1 A;  4P73 A;  4A3K H;  4TVA B;  1NE3 A;  2KHJ A;  2PI2 A;  1QZG A;  1EUJ A;  1VQA A;  1WOC A;  3UE0 A;  5FLM G;  4DV7 L;  3NEL A;  2VL6 A;  2RF4 A;  1NMG A;  2WFW A;  4Y7N H;  2OQ0 A;  1N32 Q;  1VQP A;  4DR6 Q;  4IO9 A;  1W3S A;  4JI0 L;  4YHH L;  1W2B A;  1XMO L;  1VQH A;  3PCO B;  3H0G G;  4AH6 A;  3CCJ A;  3FP9 A;  4DK6 C;  2B3G A;  1C0A A;  2C35 B;  1PH2 A;  5M5Y H;  3OTO Q;  2R7Z H;  1WCM G;  1X54 A;  4A93 G;  5ELO A;  1HNX L;  2WB1 G;  1EFW A;  2UUB Q;  3A5U A;  1UE1 A;  1VQG A;  1B8A A;  3E9H A;  1QVC A;  3M4P A;  1KIX A;  4IPG A;  1J5E L;  2ZJR A;  2MNA A;  1FL0 A;  4R4O A;  1VQK A;  1MJC A;  3W1G A;  1CKN B;  3CQZ H;  4DUY L;  2E5L Q;  2JA8 H;  1A62 A;  2R7F A;  2YYZ A;  4A3I G;  2VQE L;  4BBR H;  5M5W H;  4X64 L;  4GNX C;  2E2H H;  1X6O A;  3CC2 A;  2UXD Q;  5C4X H;  4H02 A;  4GOP B;  5BR8 Q;  4HJ9 A;  1FVI A;  3CC7 A;  1PV4 A;  1L1O C;  2DGY A;  4QQB X;  4JYA Q;  4P72 A;  2VQF L;  4BY1 H;  4GLX A;  3KYH C;  4IOA A;  2CWP A;  4X62 Q;  1QVG A;  1YHB A;  2ZTC A;  1X55 A;  1UE7 A;  3CP0 A;  1Q81 C;  1HNZ L;  1KAW A;  4DV4 Q;  4YCU A;  2VY3 A;  3F2C A;  1Q12 A;  3ULP A;  3G48 A;  2WAQ E;  1HZ9 A;  3PUZ A;  1MKH A;  1B7Y B;  4A76 A;  3ULL A;  4DR3 Q;  4JBM A;  1P8L A;  2JA5 G;  4KHP Q;  2JE6 I;  3KF6 A;  1S72 A;  1K73 C;  3KOJ A;  1VQE A;  4DUZ L;  4JI1 L;  1N36 L;  5LMN W;  1E3P A;  2LSS A;  3FHW A;  3K7A H;  1HH2 P;  3GD7 A;  1WCM H;  1Z9F A;  3MEF A;  1VQO A;  5M3F G;  3U4V A;  4A75 A;  4AQY L;  3S1M H;  2JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...