1XMQT

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xmqT00
1IBKT 1HNWT 4DV2T 1IBLT 2VQET 4B3ST 1FJGT 5LMNT 4GKJT 4JI0T 4DV3T 5IWAT 4AQYT 2UXBT 2E5LT 4LFBT 4DUYT 4LF6T 2F4VT 4LFCT 1XMOT 4LF7T 4DR3T 2UU9T 1N36T 4X64T 1HNXT 4X65T 1N34T 2UXDT 4LF4T 5BR8T 4B3TT 2UUAT 2UUBT 4DR4T 4DV5T 4LF9T 4DV1T 2UXCT 1XNRT 2HHHT 4DR1T 1HR0T 4JI1T 1J5ET 4DR6T 4X62T 4B3RT 4B3MT 4JI4T 1N32T 4DUZT 1HNZT 4X66T 4NXMT 4LF5T 1I94T 1XMQT 3T1HT 4YY3T 4LFAT 4DV0T 4DV6T 4GKKT 4LF8T 4DV7T 4JI6T 2VQFT 4DR2T 4DR7T 4JI3T 1IBMT 4JI2T 3T1YT 4JI8T 1XNQT 4JYAT 4JI7T 2UUCT 3OTOT 4YHHT 4K0KT 5LMUT 4OX9T 4JV5T 1N33T 2ZM6T 4DV4T 4DR5T 4JI5T 4NXNT 4KHPT
chains in the Genus database with same CATH superfamily
3M3ZB 4AXPA 3N2KE 2C0SA 2B1EA 2BS3A 3CPZA 4KBMB 2VVSA 4HFIA 2IHR1 4NUUA 2ZM0A 4YSZA 1W0AA 4IHJE 1IBLT 2ODUA 4YHJA 3RYCE 4OYKA 3JCFA 2P9BA 3HKEE 4QX7B 1W9RA 2DL1A 2W63A 5LMNT 4I55E 3AA6B 4O8SA 4U31A 2ES0A 4JI0T 3CX8B 3EI0A 2CCQA 4WBNE 1WCRA 1MNDA 3AA7B 2V5CA 2YDRA 2PJQA 2UXXB 3VRAA 2UXBT 3L09A 2UXNB 3P4RA 2CLYB 4K0UA 4HGAA 1L0VA 4LF6T 2MBGA 2JQKA 2F4VT 2IUBA 2XJ7A 4A5XA 5FY7A 2XAQB 2E9XD 2XPKA 5LOVE 2Y48B 2UU9T 2NTYA 2NR4A 3AE1A 1VOMA 2H7OA 4TV8E 1YD8G 3B13A 5JQGE 2QA7A 5JVDE 2K9AA 3EDVA 2YDSA 1HX1B 2WZIA 3PUXF 4QXBB 4IDOA 1W09A 5AQLB 3RHWA 2D2SA 3RC8A 3PJAJ 1ZHCA 2BG9B 2Q9QC 5EZYE 2BS2A 5JDLA 1D1BA 2UXDT 5FXZA 1T72A 2LT3A 3AVSA 3ZT6A 2VURA 3CWZB 5C3JA 3WAKA 3ZC1A 3RQUA 3ZPOA 3K1SA 1WFDA 1HTJF 5L3FB 5AQUB 4U72A 5J2UE 4JEUB 1QLBA 5ETWA 2CRBA 5LB7B 3VKGA 4TNVA 1G73A 4A97A 4EGWA 4E7ZA 2UXCT 3HI2A 4GK0E 1X79A 4IE6A 4LMLA 3TLSA 3K3NA 2JJ9A 2XTLA 5H6RB 4IE4A 4UELA 4U3CA 2X9WA 4TX5A 1JNRA 4HFEA 3RF1A 2C5JA 5DQWA 1D1CA 2LSKA 3IBPA 2CE7A 4TWHA 3O1JA 1KF6A 1IZNB 2AXDS 3SFDA 1MMGA 4AKHA 5HEOA 4B3RT 5JRCA 4CN4A 3RRCA 4J2CA 4IDPA 4ILBA 4JI4T 4NXMT 3DJBA 5JDFA 3WI3A 4AKLA 4BA9A 5HWXA 3CX6B 2YINA 3P4WA 1GQEA 3ZN0B 4HKAA 4O4IE 3FXDB 4TWFA 1XMQT 1OEDC 2CHOA 2ZM8A 3NVOA 3IF8B 5L3CB 3T1HT 2ZLYA 3H3MA 4BJNA 2VKJA 4DV6T 3AAEB 1KNZA 1JNZA 2XQ8A 3ZSTA 2V6XA 3VR8A 4H63H 4CI2B 1ZP0A 1SE7A 2C5KT 3MKDA 3ZN1B 5CB4E 3O4XE 2KWHA 4YSYA 5L3BB 4JI3T 3C64A 4Q25A 2KLQA 5IYZE 4N78D 1BR2A 2QYWA 4JI8T 2XQ7A 1E7PA 2X66A 4YT0A 5LHIB 3ONXA 4O2AE 5AQIB 4UF0B 2V7KA 2JQHA 5LBMA 3DTOA 3RIAA 5LNKA 4DMVA 5JR9A 3OTOT 3FBLA 5LMUT 2KT9A 1HG5A 3FHNA 2RP4A 2SPCA 3AXJA 1UURA 4JV5T 4MBQA 4GIWA 1XWMA 5LGNB 3UU5A 4ZI3D 3R6NA 4HFBA 4PJMA 2WCAA 4GYSA 1MIWA 3GMIA 2CBIA 2YKSA 3FZKB 3F2EA 3RKGA 5C8YE 2JQ9A 2CEAA 3P4PA 2YU2A 3AEDA 3N9NA 3PUQA 1YKHB 2BG9A 4JEHB 4JBWF 2JPFA 4PJLA 3E22E 4JI5T 3V5SA 4BJMA 1WYBA 2OLTA 2H89A 4FI5A 4YJ3E 3GWHA 3RKOA 4EZ4A 3QC9A 1Z8UA 3RRWA 3NWIA 1BR4A 1NAFA 1XZYA 2CA5A 5FXXA 1YXRA 2VVNA 3ZLIA 3ZSSA 4AQGA 5AQFB 4CI3B 3UU6A 4LMJA 1MNEA 1H7CA 4QH5A 2WWVA 1SHZC 2VQET 4L0RA 2V6YA 4QKNA 3NZPA 5AQGB 2J1DG 4PFOA 4HWFA 3TLWA 4B3ST 3RQWA 3H37A 5ABFA 5LYJE 2GK9A 4UIGA 3UQ7A 4GOUA 2BKOA 3GN5B 2LRKA 1XDPA 2BG9C 2Q9QB 4AISA 4EB6E 2ODVA 4EIWA 1UGOA 2OA5A 5IWAT 1BR0A 2BBHA 3KBUA 3PUVF 4EZHA 2VKOA 1Y01A 1J5WA 3VR9A 3ZJ2A 2J62A 3P50A 4P0AA 2PFVA 3ONLC 4LFCT 5L4EA 4UVAB 5HXRA 4COFA 1VRBA 3VRBA 2XHEB 3UFEA 4ANJA 4ERRA 3CKDA 2NTXA 4X20E 1QSDA 3EHZA 3AEBA 4EYUA 4DR3T 4HE8A 3ZYMA 2WDRA 3PURA 3Q5XA 3C4WA 4JUYA 3AVRA 3PUWF 3RIFA 5JREA 2LKHA 4MFRA 4X64T 2K24A 2WY2A 2E8IA 3AECA 4X1YE 5AQVB 2X67A 3RYIE 4X1KE 5LG4A 4X65T 1N34T 2MAWA 2CWYA 2FJBA 3K3OA 4IE0A 3QB5K 2V26A 1UCUA 2L8KA 3SOLA 5ABEA 2KWIB 4KUMB 4B3TT 2H7VC 1HFAA 4ZI3C 5FL0A 5AQHB 3PU8A 4YTPA 3L39A 5CFBA 3F57A 2WZHA 5FL1A 5FKYA 3J9X1 4EAHA 4XBFB 3PUGA 3F31A 3AA0B 2H88A 2IDOB 2XUEA 3U3IA 4DV1T 4TN7B 5LBQB 2HN1A 1KNRA 4UF0A 1XNRT 3KV4A 2QRXA 4OX9T 4PJJA 3TLTA 4UXNB 5HXEA 2HHHT 3C98B 4DR1T 4PJNA 3V5UA 3AA1B 4O4LE 2X0YA 2CHNA 3KVBA 2I6HA 2MPKA 4HN9A 1BR1A 4DR6T 2DLRA 2JIWA 4NPPA 2XQYA 4UVBB 3BQKA 2XQ5A 4X1IE 5FY1A 2BDEA 4JLEA 3ZJ1A 4ZEYA 3Q5DA 4AKIA 4DUZT 1KK7A 3C51A 4PAGA 2DNXA 4CN1A 4F8HA 2G0UA 5CJ5A 3MJXA 2K48A 4DO0A 4ZI2D 3IA3A 3NZQA 4HWIB 4P0BA 4PW8A 2Y8DA 5IHYA 4IGUA 1OEDE 3ETVA 3EDUA 4IDQA 2NP9A 2XAJB 5DABA 3ZYLA 4EEBA 3AEAA 4BAYB 5AQSB 3UUBA 1HX8A 1LVKA 2J4GA 5FNVE 1T98A 2DWKA 3MA9A 4KP3C 5E0OA 3SRZA 3ZMTB 2BZBA 2L9QA 3RYHE 4XAXB 2BKPA 3AE5A 3VHLA 5AFUL 4JI6T 4HEAA 2CBJA 2J47A 5AQNB 5ABFB 5HXSA 3UU4A 4DBQA 3I9YA 1HS7A 4U33A 4ZS2A 1J1JA 4H63V 2AE9A 2CLYC 1IBMT 2A3DA 3C4XA 3RH3A 2W66A 1EZ3A 2M67A 2VWAA 1O3XA 3AEEA 3CX7B 3K8PC 3Q5EA 5IUXA 1XNQT 1HCIA 4GYRA 4HFCA 1HG2A 4JI7T 2VK9A 2CXDA 2X9YA 3EAMA 3LFMA 3KFWX 4NUVA 5F5WA 4QXCB 5F8PA 1UX5A 3LK2B 5H6QB 4DNDA 2XQAA 2H3RA 3PUAA 4Z8XA 4ZS3A 5GONE 4AQFC 1NWMX 5DQVA 2FJAA 3RC3A 1OWAA 5FXWA 3UU3A 4OHFA 4F6RC 1OXZA 2CWOA 2E9XC 3CQGB 4G63A 1LRZA 4ILAA 1ZV4X 2FUPA 1YQ3A 4PK4A 5AQJB 3KDSE 5FVLA 1LKXA 3L3PA 4ZZBA 3MACA 5KMGP 2R6GF 1I94T 3E0ZA 3UQ4A 2V8SV 5FVKA 1KNPA 4O4HE 1WLXA 2WDQA 1UK5A 3HKCE 1MMAA 3Q9DA 4YSXA 5ADXL 4DV2T 1OEDB 4WYVA 2EHOD 5HYAA 2LKGA 2LHNA 3ABVA 4PK5A 4IIJE 1SA0E 3JAFA 2WWUA 4C91A 1FEWA 5LCYA 4CI1B 3A5XA 3B57A 2NOXA 4X5TA 4AKRB 3CK6A 4P1NA 3ZCJA 2V7JA 1QUUA 2V7IA 1S35A 4HFDA 4AQYT 5JDNA 2JMKA 2E5LT 4LFBT 2KINB 1VCTA 2W4XA 4ZXLA 3OYXA 3SS1A 4CZZB 5C2TA 2DI4A 4DUYT 2ACZA 2KNDA 5EK3A 4UR9A 2M6IA 4LF7T 2FBWA 5AQRB 4DR4T 1MIYA 4IE7A 5LHHB 3QB5A 3U78A 2LSIA 1U5PA 3I1AA 2XQ6A 2D0UA 3D0TA 5LGTB 1N32T 1I6ZA 3I9WA 3KV9A 5FMNA 5HEUA 4U2ZA 5EK2A 3LJCA 4DBRA 3QUJA 1N36T 4YLHA 2YOEA 3ESLA 4TNWA 2VL8A 5FXVA 3TLVA 1WR6A 2WM9A 3O1HA 2LHRA 3AE4A 2EHOA 3Q2MA 2XSBA 2LSJA 1FMVA 5AQKB 4LF4T 1CHUA 3R84B 3C50A 2UUAT 5HEJA 2WBLA 3X1DA 4CXYA 4ASKA 1T7SA 2LE8A 2WAUA 1MMDA 2XZEA 3FXEB 3FZHB 3ZCIA 3ZT7A 5JTGA 1V9DA 3T8OA 3LBXB 4Z91A 1W0BA 4I4TE 5LHGB 3N5LA 5J1GA 3O9XA 5JRCB 2BBJA 3P8CD 5BMVE 4PFPA 2A72A 2XASB 3OJAA 2BKNA 3MXZA 2HPLA 2X68A 5JR9C 1D1AA 2XAGB 4I43B 3KV5A 4QH1A 3RLFF 4U74A 3CVRA 2W0GA 2XAFB 4LMKA 3ZMUB 4U7YA 4DMWA 1YKEB 5CA1E 1T8BA 4XZCA 2EHOC 2XAHB 3RGLA 2KXPB 3OPCA 4ISTA 5HXCA 3ZEFB 4P09A 3NKZA 1HR0T 4CXXA 1J5ET 2XQ4A 3GA8A 4M1PA 4ADZA 3BK9A 2JQQA 2PBIA 3AB3B 5ABHA 1LVFA 2BS4A 4YTMA 4HFHA 3EUHA 2DCFA 5HWYA 4H9QC 3FZMB 2D0TA 4PK6A 5LP6E 1FJGT 3ANWB 1IJ6A 2Q9QD 2NW8A 4YJ2E 4HWHA 3PU3A 2V5DA 3QNUA 4B6XA 3B5MA 3JADA 3KVAA 2N1GA 3ZYKA 2QVAA 3AE6A 3QK6A 2W61A 3SFEA 5AQMB 2Y6XA 2V7MA 3A7MA 3FZFB 4QHOA 4PNIA 1IAPA 2IMLA 2V1DB 1OEDA 3EVYA 4HTEA 1M62A 1D0ZA 4EYYR 4DV0T 1S94A 4A98A 1Y64B 3ZT5A 1DU2A 4DV7T 2VQFT 2N2NA 3I0QA 5HCJA 3VU7H 3FBZA 3AXJB 3WAJA 4DR2T 4CXWA 2NWBA 3EABA 4AI6A 4YXDA 2C5IT 2LRLA 3OVUA 3T1YT 5HCMA 4H9SE 2YEVC 2Z6EA 2PG8A 4KI0F 5HEGA 4OK0A 4EOZB 2NW7A 2W00A 4H9PC 4O2BE 3RYFE 2K3WA 3AEFA 2LLYA 3N2OA 2LM9A 3JAEA 2K5BB 3KBTA 3H3AA 3PJAA 3AAIA 4QX8B 3ONJA 2LEHA 2LSYA 4WW0A 5L3DB 1D0XA 3K3QC 3OBVE 4UV9B 5FYMA 4HWDA 2WB5A 3UT5E 2X9HA 3AE7A 5L2LA 4YHHT 2FJDA 3QOFA 5HXHA 3CIRA 4H9NC 5JDQA 2I0MA 2ZM6T 2IC6A 3BQLA 1B7TA 2EHOB 2W62A 3UTKA 4AQFA 3FB2A 1ZKEA 4IDZA 4KMCA 4ZI2C 4DR5T 3PE0A 4ILCA 2CM0A 4NXNT 3MZKB 1KEYA 4QXHB 4KHPT 2XQ3A 5AQQB 5JR9B 3O1IA 4MLKA 4IL9A 1IBKT 4UEMA 3HA4A 2DHRA 4YY3T 1HNWT 5JDGA 4WZXA 2WDVA 3RX6A 2DWGA 3CQXC 3NRXA 3P7IA 4FJOA 3L8RA 3LBXA 1MIVA 3MK7C 2IW5B 4OFZA 2YK0A 3N9MA 4NIQA 2IAKA 2X0HA 3JC6D 1E1HB 3BQIA 3PUYF 4H9RC 4MALA 4V1Av 4WNKA 4GKJT 3CQCB 1HF8A 2XQ9A 3HR0A 4U7IA 5KX5E 3UUNA 4DV3T 4C90A 3CMLA 4KHZF 1CUNA 2MTQA 2OV9A 1NENA 2VL0A 4TZ4C 5L3EB 3S4UA 4K0KT 3HL6A 2KZ7B 2BG9E 1X9BA 1E2AA 5L3GB 2M6BA 3HKDE 1XMOT 2WU5A 2V6YB 3AE3A 5KXJA 4KX6A 4AIUA 2W2UA 4UV8B 2E9XB 2A2FX 3UUXB 4E7SA 3ANWA 2IC9A 1IJ5A 3GN5A 3KINB 4YFSA 2Q9QA 4I50E 2XM2A 3RI5A 4GK5E 2VASA 2ZMAA 3N2GE 5TAOA 1HNXT 3P4SA 5JDMA 2I59A 4MHCA 3NRYA 5JH7E 4HFVA 3AAAB 4QH4A 4I0UA 3AE8A 4ZOLE 5BR8T 5M4YA 3ZMSB 5ABGA 5KDMC 5LJNA 3TKLB 5LJMA 2CPTA 4ZI7E 3N9PA 2UUBT 2YN6A 3AEGA 3E08A 1Z0PA 3OKQA 5A1LA 2LSGA 2MYSA 4DV5T 5AQPB 4LF9T 2HN2A 2JRKA 1YW0A 3N9LA 4QWNB 3UUMA 4TUYE 4U2YA 4AKGA 5LA6E 5LGUB 4TWDA 4A56A 5LXTE 3NBXX 2XSAA 2BVLA 2CMRA 3PV0F 2WU2A 5LG3A 4WBOA 2CXLA 2HH7A 3PDYA 2WQYA 3P4QA 2YU1A 3PTRB 4EEDA 4ZHQE 5FY0A 5L4HA 2N9DA 3AE2A 2WP9A 5J2TE 4ISSA 2KMFA 2LM2A 2X0LB 2YDQA 2VB6A 4JI1T 4H9OC 2QGSA 1R8IA 3JC6C 3UFGA 2WSSV 5FP3A 4X62T 1WRDA 5HAXA 2VKDA 3SWHA 4B3MT 1SUMB 5AQTB 4CQIA 4YTNA 3IEEA 1HNZT 1UX4A 3RPUA 3ZMVB 1WYCA 4IE5A 1G8XA 4X66T 2VKHA 2D5UA 2V7LA 2RA1A 2IIUA 1UUSA 3HKBE 3PUSA 4IREA 2MOZA 4HWCA 4LF5T 1ZEEA 2B76A 3ZMZB 5AQOB 2CXFA 3LK3B 4IDNA 4ILUA 4LFAT 2BVMA 2XM1A 1MMNA 4O4JE 3Q5WA 4GKKT 2E5VA 4LF8T 3ETUA 2XY8B 3W15B 2X9XA 2FJEA 1FMWA 3FZLB 4OYJA 2HPJA 4DR7T 1XDOA 2JMHA 3LSVA 4JI2T 1VCSA 5EK4A 3A8YC 4DIDB 5F3JA 1WR0A 1KFYA 1ZOYA 2L3LA 1FIOA 4IL4A 3UULA 2LOSA 4JYAT 2RPAA 3KV6A 1NEKA 2E2AA 3J7Yq 1AJ3A 2UUCT 2WMOA 2KSRA 3RIUC 5CA0E 2E9XA 2ACXA 3DP7A 4G2AA 4L9IA 1YQ4A 2W67A 3LK42 4IT4A 2NW9A 4CN6A 4TV9E 1M7KA 1D0YA 2D9DA 4EXTA 4Z90A 3OYZA 1N33T 2A9UA 2ZM2A 3UU8A 3LG7A 2WS3A 3IHRA 1US7B 5HEHA 3ZC0A 2LJLA 3LDQB 3N9OA 3RIUA 5JDHA 3AE9A 3TLUA 4UVCB 2X51A 5J0ZA 5L47A 4DVDA 4ZZCA 2PTFA 5DJQC 3G06A 1U4QA 3C4ZA 3PUZF 3ZKRA 5CGMA 3I0OA 4DV4T 3N9QA 2LOPA 2WMNA 3M65A 4L5GA 3VKHA 4EV6A
chains in the Genus database with same CATH topology
1IBKT 1HNWT 4DV2T 1IBLT 2VQET 4B3ST 1FJGT 5LMNT 4GKJT 4JI0T 4DV3T 5IWAT 4AQYT 2UXBT 2E5LT 4LFBT 4DUYT 4LF6T 2F4VT 4LFCT 1XMOT 4LF7T 4DR3T 2UU9T 1N36T 4X64T 1HNXT 4X65T 1N34T 2UXDT 4LF4T 5BR8T 4B3TT 2UUAT 2UUBT 4DR4T 4DV5T 4LF9T 4DV1T 2UXCT 1XNRT 2HHHT 4DR1T 1HR0T 4JI1T 1J5ET 4DR6T 4X62T 4B3RT 4B3MT 4JI4T 1N32T 4DUZT 1HNZT 4X66T 4NXMT 4LF5T 1I94T 1XMQT 3T1HT 4YY3T 4LFAT 4DV0T 4DV6T 4GKKT 4LF8T 4DV7T 4JI6T 2VQFT 4DR2T 4DR7T 4JI3T 1IBMT 4JI2T 3T1YT 4JI8T 1XNQT 4JYAT 4JI7T 2UUCT 3OTOT 4YHHT 4K0KT 5LMUT 4OX9T 4JV5T 1N33T 2ZM6T 4DV4T 4DR5T 4JI5T 4NXNT 4KHPT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK T;  1HNW T;  4DV2 T;  1IBL T;  2VQE T;  4B3S T;  1FJG T;  5LMN T;  4GKJ T;  4JI0 T;  4DV3 T;  5IWA T;  4AQY T;  2UXB T;  2E5L T;  4LFB T;  4DUY T;  4LF6 T;  2F4V T;  4LFC T;  1XMO T;  4LF7 T;  4DR3 T;  2UU9 T;  1N36 T;  4X64 T;  1HNX T;  4X65 T;  1N34 T;  2UXD T;  4LF4 T;  5BR8 T;  4B3T T;  2UUA T;  2UUB T;  4DR4 T;  4DV5 T;  4LF9 T;  4DV1 T;  2UXC T;  1XNR T;  2HHH T;  4DR1 T;  1HR0 T;  4JI1 T;  1J5E T;  4DR6 T;  4X62 T;  4B3R T;  4B3M T;  4JI4 T;  1N32 T;  4DUZ T;  1HNZ T;  4X66 T;  4NXM T;  4LF5 T;  1I94 T;  1XMQ T;  3T1H T;  4YY3 T;  4LFA T;  4DV0 T;  4DV6 T;  4GKK T;  4LF8 T;  4DV7 T;  4JI6 T;  2VQF T;  4DR2 T;  4DR7 T;  4JI3 T;  1IBM T;  4JI2 T;  3T1Y T;  4JI8 T;  1XNQ T;  4JYA T;  4JI7 T;  2UUC T;  3OTO T;  4YHH T;  4K0K T;  5LMU T;  4OX9 T;  4JV5 T;  1N33 T;  2ZM6 T;  4DV4 T;  4DR5 T;  4JI5 T;  4NXN T;  4KHP T; 
#chains in the Genus database with same CATH topology
 3M3Z B;  4AXP A;  3N2K E;  2C0S A;  2B1E A;  2BS3 A;  3CPZ A;  4KBM B;  2VVS A;  4HFI A;  2IHR 1;  4NUU A;  2ZM0 A;  4YSZ A;  1W0A A;  4IHJ E;  1IBL T;  2ODU A;  4YHJ A;  3RYC E;  4OYK A;  3JCF A;  2P9B A;  3HKE E;  4QX7 B;  1W9R A;  2DL1 A;  2W63 A;  5LMN T;  4I55 E;  3AA6 B;  4O8S A;  4U31 A;  2ES0 A;  4JI0 T;  3CX8 B;  3EI0 A;  2CCQ A;  4WBN E;  1WCR A;  1MND A;  3AA7 B;  2V5C A;  2YDR A;  2PJQ A;  2UXX B;  3VRA A;  2UXB T;  3L09 A;  2UXN B;  3P4R A;  2CLY B;  4K0U A;  4HGA A;  1L0V A;  4LF6 T;  2MBG A;  2JQK A;  2F4V T;  2IUB A;  2XJ7 A;  4A5X A;  5FY7 A;  2XAQ B;  2E9X D;  2XPK A;  5LOV E;  2Y48 B;  2UU9 T;  2NTY A;  2NR4 A;  3AE1 A;  1VOM A;  2H7O A;  4TV8 E;  1YD8 G;  3B13 A;  5JQG E;  2QA7 A;  5JVD E;  2K9A A;  3EDV A;  2YDS A;  1HX1 B;  2WZI A;  3PUX F;  4QXB B;  4IDO A;  1W09 A;  5AQL B;  3RHW A;  2D2S A;  3RC8 A;  3PJA J;  1ZHC A;  2BG9 B;  2Q9Q C;  5EZY E;  2BS2 A;  5JDL A;  1D1B A;  2UXD T;  5FXZ A;  1T72 A;  2LT3 A;  3AVS A;  3ZT6 A;  2VUR A;  3CWZ B;  5C3J A;  3WAK A;  3ZC1 A;  3RQU A;  3ZPO A;  3K1S A;  1WFD A;  1HTJ F;  5L3F B;  5AQU B;  4U72 A;  5J2U E;  4JEU B;  1QLB A;  5ETW A;  2CRB A;  5LB7 B;  3VKG A;  4TNV A;  1G73 A;  4A97 A;  4EGW A;  4E7Z A;  2UXC T;  3HI2 A;  4GK0 E;  1X79 A;  4IE6 A;  4LML A;  3TLS A;  3K3N A;  2JJ9 A;  2XTL A;  5H6R B;  4IE4 A;  4UEL A;  4U3C A;  2X9W A;  4TX5 A;  1JNR A;  4HFE A;  3RF1 A;  2C5J A;  5DQW A;  1D1C A;  2LSK A;  3IBP A;  2CE7 A;  4TWH A;  3O1J A;  1KF6 A;  1IZN B;  2AXD S;  3SFD A;  1MMG A;  4AKH A;  5HEO A;  4B3R T;  5JRC A;  4CN4 A;  3RRC A;  4J2C A;  4IDP A;  4ILB A;  4JI4 T;  4NXM T;  3DJB A;  5JDF A;  3WI3 A;  4AKL A;  4BA9 A;  5HWX A;  3CX6 B;  2YIN A;  3P4W A;  1GQE A;  3ZN0 B;  4HKA A;  4O4I E;  3FXD B;  4TWF A;  1XMQ T;  1OED C;  2CHO A;  2ZM8 A;  3NVO A;  3IF8 B;  5L3C B;  3T1H T;  2ZLY A;  3H3M A;  4BJN A;  2VKJ A;  4DV6 T;  3AAE B;  1KNZ A;  1JNZ A;  2XQ8 A;  3ZST A;  2V6X A;  3VR8 A;  4H63 H;  4CI2 B;  1ZP0 A;  1SE7 A;  2C5K T;  3MKD A;  3ZN1 B;  5CB4 E;  3O4X E;  2KWH A;  4YSY A;  5L3B B;  4JI3 T;  3C64 A;  4Q25 A;  2KLQ A;  5IYZ E;  4N78 D;  1BR2 A;  2QYW A;  4JI8 T;  2XQ7 A;  1E7P A;  2X66 A;  4YT0 A;  5LHI B;  3ONX A;  4O2A E;  5AQI B;  4UF0 B;  2V7K A;  2JQH A;  5LBM A;  3DTO A;  3RIA A;  5LNK A;  4DMV A;  5JR9 A;  3OTO T;  3FBL A;  5LMU T;  2KT9 A;  1HG5 A;  3FHN A;  2RP4 A;  2SPC A;  3AXJ A;  1UUR A;  4JV5 T;  4MBQ A;  4GIW A;  1XWM A;  5LGN B;  3UU5 A;  4ZI3 D;  3R6N A;  4HFB A;  4PJM A;  2WCA A;  4GYS A;  1MIW A;  3GMI A;  2CBI A;  2YKS A;  3FZK B;  3F2E A;  3RKG A;  5C8Y E;  2JQ9 A;  2CEA A;  3P4P A;  2YU2 A;  3AED A;  3N9N A;  3PUQ A;  1YKH B;  2BG9 A;  4JEH B;  4JBW F;  2JPF A;  4PJL A;  3E22 E;  4JI5 T;  3V5S A;  4BJM A;  1WYB A;  2OLT A;  2H89 A;  4FI5 A;  4YJ3 E;  3GWH A;  3RKO A;  4EZ4 A;  3QC9 A;  1Z8U A;  3RRW A;  3NWI A;  1BR4 A;  1NAF A;  1XZY A;  2CA5 A;  5FXX A;  1YXR A;  2VVN A;  3ZLI A;  3ZSS A;  4AQG A;  5AQF B;  4CI3 B;  3UU6 A;  4LMJ A;  1MNE A;  1H7C A;  4QH5 A;  2WWV A;  1SHZ C;  2VQE T;  4L0R A;  2V6Y A;  4QKN A;  3NZP A;  5AQG B;  2J1D G;  4PFO A;  4HWF A;  3TLW A;  4B3S T;  3RQW A;  3H37 A;  5ABF A;  5LYJ E;  2GK9 A;  4UIG A;  3UQ7 A;  4GOU A;  2BKO A;  3GN5 B;  2LRK A;  1XDP A;  2BG9 C;  2Q9Q B;  4AIS A;  4EB6 E;  2ODV A;  4EIW A;  1UGO A;  2OA5 A;  5IWA T;  1BR0 A;  2BBH A;  3KBU A;  3PUV F;  4EZH A;  2VKO A;  1Y01 A;  1J5W A;  3VR9 A;  3ZJ2 A;  2J62 A;  3P50 A;  4P0A A;  2PFV A;  3ONL C;  4LFC T;  5L4E A;  4UVA B;  5HXR A;  4COF A;  1VRB A;  3VRB A;  2XHE B;  3UFE A;  4ANJ A;  4ERR A;  3CKD A;  2NTX A;  4X20 E;  1QSD A;  3EHZ A;  3AEB A;  4EYU A;  4DR3 T;  4HE8 A;  3ZYM A;  2WDR A;  3PUR A;  3Q5X A;  3C4W A;  4JUY A;  3AVR A;  3PUW F;  3RIF A;  5JRE A;  2LKH A;  4MFR A;  4X64 T;  2K24 A;  2WY2 A;  2E8I A;  3AEC A;  4X1Y E;  5AQV B;  2X67 A;  3RYI E;  4X1K E;  5LG4 A;  4X65 T;  1N34 T;  2MAW A;  2CWY A;  2FJB A;  3K3O A;  4IE0 A;  3QB5 K;  2V26 A;  1UCU A;  2L8K A;  3SOL A;  5ABE A;  2KWI B;  4KUM B;  4B3T T;  2H7V C;  1HFA A;  4ZI3 C;  5FL0 A;  5AQH B;  3PU8 A;  4YTP A;  3L39 A;  5CFB A;  3F57 A;  2WZH A;  5FL1 A;  5FKY A;  3J9X 1;  4EAH A;  4XBF B;  3PUG A;  3F31 A;  3AA0 B;  2H88 A;  2IDO B;  2XUE A;  3U3I A;  4DV1 T;  4TN7 B;  5LBQ B;  2HN1 A;  1KNR A;  4UF0 A;  1XNR T;  3KV4 A;  2QRX A;  4OX9 T;  4PJJ A;  3TLT A;  4UXN B;  5HXE A;  2HHH T;  3C98 B;  4DR1 T;  4PJN A;  3V5U A;  3AA1 B;  4O4L E;  2X0Y A;  2CHN A;  3KVB A;  2I6H A;  2MPK A;  4HN9 A;  1BR1 A;  4DR6 T;  2DLR A;  2JIW A;  4NPP A;  2XQY A;  4UVB B;  3BQK A;  2XQ5 A;  4X1I E;  5FY1 A;  2BDE A;  4JLE A;  3ZJ1 A;  4ZEY A;  3Q5D A;  4AKI A;  4DUZ T;  1KK7 A;  3C51 A;  4PAG A;  2DNX A;  4CN1 A;  4F8H A;  2G0U A;  5CJ5 A;  3MJX A;  2K48 A;  4DO0 A;  4ZI2 D;  3IA3 A;  3NZQ A;  4HWI B;  4P0B A;  4PW8 A;  2Y8D A;  5IHY A;  4IGU A;  1OED E;  3ETV A;  3EDU A;  4IDQ A;  2NP9 A;  2XAJ B;  5DAB A;  3ZYL A;  4EEB A;  3AEA A;  4BAY B;  5AQS B;  3UUB A;  1HX8 A;  1LVK A;  2J4G A;  5FNV E;  1T98 A;  2DWK A;  3MA9 A;  4KP3 C;  5E0O A;  3SRZ A;  3ZMT B;  2BZB A;  2L9Q A;  3RYH E;  4XAX B;  2BKP A;  3AE5 A;  3VHL A;  5AFU L;  4JI6 T;  4HEA A;  2CBJ A;  2J47 A;  5AQN B;  5ABF B;  5HXS A;  3UU4 A;  4DBQ A;  3I9Y A;  1HS7 A;  4U33 A;  4ZS2 A;  1J1J A;  4H63 V;  2AE9 A;  2CLY C;  1IBM T;  2A3D A;  3C4X A;  3RH3 A;  2W66 A;  1EZ3 A;  2M67 A;  2VWA A;  1O3X A;  3AEE A;  3CX7 B;  3K8P C;  3Q5E A;  5IUX A;  1XNQ T;  1HCI A;  4GYR A;  4HFC A;  1HG2 A;  4JI7 T;  2VK9 A;  2CXD A;  2X9Y A;  3EAM A;  3LFM A;  3KFW X;  4NUV A;  5F5W A;  4QXC B;  5F8P A;  1UX5 A;  3LK2 B;  5H6Q B;  4DND A;  2XQA A;  2H3R A;  3PUA A;  4Z8X A;  4ZS3 A;  5GON E;  4AQF C;  1NWM X;  5DQV A;  2FJA A;  3RC3 A;  1OWA A;  5FXW A;  3UU3 A;  4OHF A;  4F6R C;  1OXZ A;  2CWO A;  2E9X C;  3CQG B;  4G63 A;  1LRZ A;  4ILA A;  1ZV4 X;  2FUP A;  1YQ3 A;  4PK4 A;  5AQJ B;  3KDS E;  5FVL A;  1LKX A;  3L3P A;  4ZZB A;  3MAC A;  5KMG P;  2R6G F;  1I94 T;  3E0Z A;  3UQ4 A;  2V8S V;  5FVK A;  1KNP A;  4O4H E;  1WLX A;  2WDQ A;  1UK5 A;  3HKC E;  1MMA A;  3Q9D A;  4YSX A;  5ADX L;  4DV2 T;  1OED B;  4WYV A;  2EHO D;  5HYA A;  2LKG A;  2LHN A;  3ABV A;  4PK5 A;  4IIJ E;  1SA0 E;  3JAF A;  2WWU A;  4C91 A;  1FEW A;  5LCY A;  4CI1 B;  3A5X A;  3B57 A;  2NOX A;  4X5T A;  4AKR B;  3CK6 A;  4P1N A;  3ZCJ A;  2V7J A;  1QUU A;  2V7I A;  1S35 A;  4HFD A;  4AQY T;  5JDN A;  2JMK A;  2E5L T;  4LFB T;  2KIN B;  1VCT A;  2W4X A;  4ZXL A;  3OYX A;  3SS1 A;  4CZZ B;  5C2T A;  2DI4 A;  4DUY T;  2ACZ A;  2KND A;  5EK3 A;  4UR9 A;  2M6I A;  4LF7 T;  2FBW A;  5AQR B;  4DR4 T;  1MIY A;  4IE7 A;  5LHH B;  3QB5 A;  3U78 A;  2LSI A;  1U5P A;  3I1A A;  2XQ6 A;  2D0U A;  3D0T A;  5LGT B;  1N32 T;  1I6Z A;  3I9W A;  3KV9 A;  5FMN A;  5HEU A;  4U2Z A;  5EK2 A;  3LJC A;  4DBR A;  3QUJ A;  1N36 T;  4YLH A;  2YOE A;  3ESL A;  4TNW A;  2VL8 A;  5FXV A;  3TLV A;  1WR6 A;  2WM9 A;  3O1H A;  2LHR A;  3AE4 A;  2EHO A;  3Q2M A;  2XSB A;  2LSJ A;  1FMV A;  5AQK B;  4LF4 T;  1CHU A;  3R84 B;  3C50 A;  2UUA T;  5HEJ A;  2WBL A;  3X1D A;  4CXY A;  4ASK A;  1T7S A;  2LE8 A;  2WAU A;  1MMD A;  2XZE A;  3FXE B;  3FZH B;  3ZCI A;  3ZT7 A;  5JTG A;  1V9D A;  3T8O A;  3LBX B;  4Z91 A;  1W0B A;  4I4T E;  5LHG B;  3N5L A;  5J1G A;  3O9X A;  5JRC B;  2BBJ A;  3P8C D;  5BMV E;  4PFP A;  2A72 A;  2XAS B;  3OJA A;  2BKN A;  3MXZ A;  2HPL A;  2X68 A;  5JR9 C;  1D1A A;  2XAG B;  4I43 B;  3KV5 A;  4QH1 A;  3RLF F;  4U74 A;  3CVR A;  2W0G A;  2XAF B;  4LMK A;  3ZMU B;  4U7Y A;  4DMW A;  1YKE B;  5CA1 E;  1T8B A;  4XZC A;  2EHO C;  2XAH B;  3RGL A;  2KXP B;  3OPC A;  4IST A;  5HXC A;  3ZEF B;  4P09 A;  3NKZ A;  1HR0 T;  4CXX A;  1J5E T;  2XQ4 A;  3GA8 A;  4M1P A;  4ADZ A;  3BK9 A;  2JQQ A;  2PBI A;  3AB3 B;  5ABH A;  1LVF A;  2BS4 A;  4YTM A;  4HFH A;  3EUH A;  2DCF A;  5HWY A;  4H9Q C;  3FZM B;  2D0T A;  4PK6 A;  5LP6 E;  1FJG T;  3ANW B;  1IJ6 A;  2Q9Q D;  2NW8 A;  4YJ2 E;  4HWH A;  3PU3 A;  2V5D A;  3QNU A;  4B6X A;  3B5M A;  3JAD A;  3KVA A;  2N1G A;  3ZYK A;  2QVA A;  3AE6 A;  3QK6 A;  2W61 A;  3SFE A;  5AQM B;  2Y6X A;  2V7M A;  3A7M A;  3FZF B;  4QHO A;  4PNI A;  1IAP A;  2IML A;  2V1D B;  1OED A;  3EVY A;  4HTE A;  1M62 A;  1D0Z A;  4EYY R;  4DV0 T;  1S94 A;  4A98 A;  1Y64 B;  3ZT5 A;  1DU2 A;  4DV7 T;  2VQF T;  2N2N A;  3I0Q A;  5HCJ A;  3VU7 H;  3FBZ A;  3AXJ B;  3WAJ A;  4DR2 T;  4CXW A;  2NWB A;  3EAB A;  4AI6 A;  4YXD A;  2C5I T;  2LRL A;  3OVU A;  3T1Y T;  5HCM A;  4H9S E;  2YEV C;  2Z6E A;  2PG8 A;  4KI0 F;  5HEG A;  4OK0 A;  4EOZ B;  2NW7 A;  2W00 A;  4H9P C;  4O2B E;  3RYF E;  2K3W A;  3AEF A;  2LLY A;  3N2O A;  2LM9 A;  3JAE A;  2K5B B;  3KBT A;  3H3A A;  3PJA A;  3AAI A;  4QX8 B;  3ONJ A;  2LEH A;  2LSY A;  4WW0 A;  5L3D B;  1D0X A;  3K3Q C;  3OBV E;  4UV9 B;  5FYM A;  4HWD A;  2WB5 A;  3UT5 E;  2X9H A;  3AE7 A;  5L2L A;  4YHH T;  2FJD A;  3QOF A;  5HXH A;  3CIR A;  4H9N C;  5JDQ A;  2I0M A;  2ZM6 T;  2IC6 A;  3BQL A;  1B7T A;  2EHO B;  2W62 A;  3UTK A;  4AQF A;  3FB2 A;  1ZKE A;  4IDZ A;  4KMC A;  4ZI2 C;  4DR5 T;  3PE0 A;  4ILC A;  2CM0 A;  4NXN T;  3MZK B;  1KEY A;  4QXH B;  4KHP T;  2XQ3 A;  5AQQ B;  5JR9 B;  3O1I A;  4MLK A;  4IL9 A;  1IBK T;  4UEM A;  3HA4 A;  2DHR A;  4YY3 T;  1HNW T;  5JDG A;  4WZX A;  2WDV A;  3RX6 A;  2DWG A;  3CQX C;  3NRX A;  3P7I A;  4FJO A;  3L8R A;  3LBX A;  1MIV A;  3MK7 C;  2IW5 B;  4OFZ A;  2YK0 A;  3N9M A;  4NIQ A;  2IAK A;  2X0H A;  3JC6 D;  1E1H B;  3BQI A;  3PUY F;  4H9R C;  4MAL A;  4V1A v;  4WNK A;  4GKJ T;  3CQC B;  1HF8 A;  2XQ9 A;  3HR0 A;  4U7I A;  5KX5 E;  3UUN A;  4DV3 T;  4C90 A;  3CML A;  4KHZ F;  1CUN A;  2MTQ A;  2OV9 A;  1NEN A;  2VL0 A;  4TZ4 C;  5L3E B;  3S4U A;  4K0K T;  3HL6 A;  2KZ7 B;  2BG9 E;  1X9B A;  1E2A A;  5L3G B;  2M6B A;  3HKD E;  1XMO T;  2WU5 A;  2V6Y B;  3AE3 A;  5KXJ A;  4KX6 A;  4AIU A;  2W2U A;  4UV8 B;  2E9X B;  2A2F X;  3UUX B;  4E7S A;  3ANW A;  2IC9 A;  1IJ5 A;  3GN5 A;  3KIN B;  4YFS A;  2Q9Q A;  4I50 E;  2XM2 A;  3RI5 A;  4GK5 E;  2VAS A;  2ZMA A;  3N2G E;  5TAO A;  1HNX T;  3P4S A;  5JDM A;  2I59 A;  4MHC A;  3NRY A;  5JH7 E;  4HFV A;  3AAA B;  4QH4 A;  4I0U A;  3AE8 A;  4ZOL E;  5BR8 T;  5M4Y A;  3ZMS B;  5ABG A;  5KDM C;  5LJN A;  3TKL B;  5LJM A;  2CPT A;  4ZI7 E;  3N9P A;  2UUB T;  2YN6 A;  3AEG A;  3E08 A;  1Z0P A;  3OKQ A;  5A1L A;  2LSG A;  2MYS A;  4DV5 T;  5AQP B;  4LF9 T;  2HN2 A;  2JRK A;  1YW0 A;  3N9L A;  4QWN B;  3UUM A;  4TUY E;  4U2Y A;  4AKG A;  5LA6 E;  5LGU B;  4TWD A;  4A56 A;  5LXT E;  3NBX X;  2XSA A;  2BVL A;  2CMR A;  3PV0 F;  2WU2 A;  5LG3 A;  4WBO A;  2CXL A;  2HH7 A;  3PDY A;  2WQY A;  3P4Q A;  2YU1 A;  3PTR B;  4EED A;  4ZHQ E;  5FY0 A;  5L4H A;  2N9D A;  3AE2 A;  2WP9 A;  5J2T E;  4ISS A;  2KMF A;  2LM2 A;  2X0L B;  2YDQ A;  2VB6 A;  4JI1 T;  4H9O C;  2QGS A;  1R8I A;  3JC6 C;  3UFG A;  2WSS V;  5FP3 A;  4X62 T;  1WRD A;  5HAX A;  2VKD A;  3SWH A;  4B3M T;  1SUM B;  5AQT B;  4CQI A;  4YTN A;  3IEE A;  1HNZ T;  1UX4 A;  3RPU A;  3ZMV B;  1WYC A;  4IE5 A;  1G8X A;  4X66 T;  2VKH A;  2D5U A;  2V7L A;  2RA1 A;  2IIU A;  1UUS A;  3HKB E;  3PUS A;  4IRE A;  2MOZ A;  4HWC A;  4LF5 T;  1ZEE A;  2B76 A;  3ZMZ B;  5AQO B;  2CXF A;  3LK3 B;  4IDN A;  4ILU A;  4LFA T;  2BVM A;  2XM1 A;  1MMN A;  4O4J E;  3Q5W A;  4GKK T;  2E5V A;  4LF8 T;  3ETU A;  2XY8 B;  3W15 B;  2X9X A;  2FJE A;  1FMW A;  3FZL B;  4OYJ A;  2HPJ A;  4DR7 T;  1XDO A;  2JMH A;  3LSV A;  4JI2 T;  1VCS A;  5EK4 A;  3A8Y C;  4DID B;  5F3J A;  1WR0 A;  1KFY A;  1ZOY A;  2L3L A;  1FIO A;  4IL4 A;  3UUL A;  2LOS A;  4JYA T;  2RPA A;  3KV6 A;  1NEK A;  2E2A A;  3J7Y q;  1AJ3 A;  2UUC T;  2WMO A;  2KSR A;  3RIU C;  5CA0 E;  2E9X A;  2ACX A;  3DP7 A;  4G2A A;  4L9I A;  1YQ4 A;  2W67 A;  3LK4 2;  4IT4 A;  2NW9 A;  4CN6 A;  4TV9 E;  1M7K A;  1D0Y A;  2D9D A;  4EXT A;  4Z90 A;  3OYZ A;  1N33 T;  2A9U A;  2ZM2 A;  3UU8 A;  3LG7 A;  2WS3 A;  3IHR A;  1US7 B;  5HEH A;  3ZC0 A;  2LJL A;  3LDQ B;  3N9O A;  3RIU A;  5JDH A;  3AE9 A;  3TLU A;  4UVC B;  2X51 A;  5J0Z A;  5L47 A;  4DVD A;  4ZZC A;  2PTF A;  5DJQ C;  3G06 A;  1U4Q A;  3C4Z A;  3PUZ F;  3ZKR A;  5CGM A;  3I0O A;  4DV4 T;  3N9Q A;  2LOP A;  2WMN A;  3M65 A;  4L5G A;  3VKH A;  4EV6 A; 
#chains in the Genus database with same CATH homology
 1IBK T;  1HNW T;  4DV2 T;  1IBL T;  2VQE T;  4B3S T;  1FJG T;  5LMN T;  4GKJ T;  4JI0 T;  4DV3 T;  5IWA T;  4AQY T;  2UXB T;  2E5L T;  4LFB T;  4DUY T;  4LF6 T;  2F4V T;  4LFC T;  1XMO T;  4LF7 T;  4DR3 T;  2UU9 T;  1N36 T;  4X64 T;  1HNX T;  4X65 T;  1N34 T;  2UXD T;  4LF4 T;  5BR8 T;  4B3T T;  2UUA T;  2UUB T;  4DR4 T;  4DV5 T;  4LF9 T;  4DV1 T;  2UXC T;  1XNR T;  2HHH T;  4DR1 T;  1HR0 T;  4JI1 T;  1J5E T;  4DR6 T;  4X62 T;  4B3R T;  4B3M T;  4JI4 T;  1N32 T;  4DUZ T;  1HNZ T;  4X66 T;  4NXM T;  4LF5 T;  1I94 T;  1XMQ T;  3T1H T;  4YY3 T;  4LFA T;  4DV0 T;  4DV6 T;  4GKK T;  4LF8 T;  4DV7 T;  4JI6 T;  2VQF T;  4DR2 T;  4DR7 T;  4JI3 T;  1IBM T;  4JI2 T;  3T1Y T;  4JI8 T;  1XNQ T;  4JYA T;  4JI7 T;  2UUC T;  3OTO T;  4YHH T;  4K0K T;  5LMU T;  4OX9 T;  4JV5 T;  1N33 T;  2ZM6 T;  4DV4 T;  4DR5 T;  4JI5 T;  4NXN T;  4KHP T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...