1XMQT

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xmqT00
4DR5T 4JI2T 4LF5T 1XNQT 2VQFT 1I94T 1HR0T 1XNRT 4JI1T 2UXCT 4DR1T 4KHPT 4YHHT 1IBMT 4DR4T 2E5LT 4JI5T 4LF4T 4K0KT 4OX9T 1J5ET 5BR8T 4DR3T 4NXNT 4JI7T 4DV1T 4AQYT 4LFAT 4X62T 4JI8T 4NXMT 4LF8T 1XMQT 4JI3T 4DV0T 4DV3T 4LF7T 4GKKT 2UXBT 2UUCT 4JI6T 4X66T 2UU9T 4X64T 2F4VT 1HNXT 4DUZT 4B3TT 2VQET 3T1YT 4DV2T 1N33T 2UXDT 5LMUT 4DV5T 1IBKT 4B3ST 4DR2T 4YY3T 3T1HT 2UUAT 1FJGT 4B3MT 2ZM6T 5IWAT 1IBLT 2UUBT 4DR6T 2HHHT 4GKJT 4JYAT 4DV7T 3OTOT 4JI4T 4DV4T 1N34T 5LMNT 4DUYT 1HNZT 4JV5T 1N32T 4LFBT 4X65T 1HNWT 1XMOT 4B3RT 4LFCT 1N36T 4DR7T 4LF9T 4LF6T 4DV6T 4JI0T
chains in the Genus database with same CATH superfamily
3O9XA 4MFRA 2LOPA 2PBIA 1I94T 4HKAA 5JDLA 2M6IA 1HX8A 4DR1T 2D0TA 4O4JE 3VRAA 3PTRB 3CWZB 1VCTA 3AEDA 3U3IA 2J1DG 5J1GA 3TLWA 3GMIA 2K5BB 3QC9A 2XAQB 5LGTB 1MIWA 3FZMB 4TWHA 3DJBA 1HFAA 2XQ8A 3UU5A 1E2AA 2WM9A 2XQ9A 4CI1B 3JAFA 4IL9A 4PJNA 1YW0A 2YINA 3LK42 1ZEEA 2MAWA 2ZLYA 4G2AA 3RRCA 5LG4A 1W9RA 4X20E 4YJ2E 3RGLA 2WSSV 3UUBA 3CPZA 2CCQA 2ZMAA 3AVSA 4ILBA 2K48A 2BG9B 2XQ5A 1HNWT 3IA3A 2LM2A 2CXDA 5LYJE 1ZHCA 1NENA 2BKOA 4GK5E 1ZOYA 4C91A 3ONLC 3QB5A 4EYYR 3M65A 3C50A 4LMLA 3SS1A 2WMOA 2XM2A 4YHHT 4YJ3E 5J2TE 4EYUA 1WFDA 4HWDA 3IF8B 1Y01A 1D0YA 4X62T 3O1HA 4L0RA 2NWBA 2K24A 3V5SA 2YDQA 4HFBA 3NZPA 3ZT5A 4U2YA 2WDVA 1FMVA 3AE4A 2VVNA 4IE4A 2MOZA 3EDUA 2V7IA 2W66A 5JDHA 3LFMA 4B3ST 5BMVE 3ESLA 5L4EA 5IWAT 1Y64B 3WAKA 4CI3B 3ANWB 2NW8A 1T98A 1MMNA 2LKGA 4UXNB 2JJ9A 4KMCA 4WBNE 1YD8G 4LMJA 3KFWX 3OKQA 4I55E 4J2CA 2X9XA 4U74A 2PG8A 2V7KA 5DQVA 2K3WA 1QUUA 2L8KA 2UXCT 2BDEA 5M4YA 5C3JA 2CM0A 5LGUB 2VASA 5LJNA 3N9PA 5L47A 3Q5WA 4MBQA 5CB4E 2V5DA 2CXLA 3MK7C 4ZI3D 1KFYA 3EI0A 2J62A 4P09A 4DV0T 2C5IT 4YSXA 1WR6A 4K0UA 4Z91A 3AE7A 3ETUA 5FL1A 2MYSA 4TNVA 1HNXT 2OV9A 3K3NA 2V1DB 2UXDT 2CBJA 5LB7B 3N9QA 5FVLA 2Q9QB 2LSKA 4B3MT 3QK6A 5H6QB 4AKRB 3O1JA 4PFOA 4PK6A 4TUYE 5FXXA 2WWUA 3J9X1 3HI2A 3ZN0B 2XY8B 2BBHA 3AEEA 3LK2B 2NW7A 4E7ZA 5KX5E 3UT5E 1HNZT 3ZJ1A 2NR4A 2VL8A 3LBXB 5HCJA 4EV6A 4M1PA 3MZKB 1KEYA 4Q25A 2WWVA 3ONXA 3ZLIA 4DV6T 3AAIA 2CPTA 2YDRA 2WDRA 5TAOA 5C8YE 4QH5A 4X1KE 4CZZB 4BAYB 3Q5DA 5AQKB 3ZMZB 4BA9A 3B5MA 5CA1E 5HEHA 3AEAA 4IHJE 1OEDC 3ZMUB 1HG5A 4KBMB 4ZHQE 2V5CA 1KF6A 4WBOA 3F31A 3KV5A 1QLBA 2NW9A 4DMWA 2UU9T 1WYBA 3HKDE 2M6BA 2AXDS 2VQET 4XBFB 1QSDA 4QXBB 3OPCA 5LMUT 4QH4A 4UV9B 5FP3A 4DV5T 5AQJB 2A2FX 2IDOB 2R6GF 1XZYA 5ETWA 3C51A 2UUAT 2FJDA 2BG9C 1D0ZA 4IDZA 4CN4A 1FIOA 1OEDA 5HEGA 3TKLB 3QUJA 3N9NA 2ZM2A 2XQ4A 3LJCA 3CKDA 3CQGB 2XAHB 1E1HB 5LBQB 1D1BA 3IEEA 3D0TA 4LFBT 3ZYLA 4OFZA 4DBRA 3AXJB 1XMOT 5JR9B 3N9MA 4IT4A 4LF6T 5LBMA 1BR0A 1G8XA 4EIWA 4IE0A 4OK0A 3X1DA 2VQFT 1HR0T 2H3RA 3H37A 4NPPA 3ZYKA 3RI5A 2FJAA 3N9OA 5J2UE 2CRBA 3Q5XA 4JI7T 3EHZA 5JDFA 3BQIA 4PFPA 4DNDA 3VHLA 1NWMX 4TX5A 5JRCB 1YQ4A 2V7LA 4F8HA 1LVFA 2WMNA 2M67A 3FHNA 4LF7T 4P0BA 4CXXA 2QYWA 2FJEA 3B57A 3PUAA 2VB6A 3N9LA 3NZQA 2MBGA 3ZPOA 3OYXA 2KINB 3ETVA 3G06A 2DWKA 4DR2T 2AE9A 3U78A 4ZS3A 3AE3A 4MALA 3T1HT 4O4HE 3RRWA 2XTLA 2I6HA 4GOUA 3AB3B 1HF8A 2JIWA 4IE6A 3WI3A 3FXDB 5L4HA 1V9DA 5AQPB 3BK9A 2ACXA 4ANJA 3AEFA 5HEJA 2OLTA 4AKIA 2EHOB 4EAHA 3PU8A 2BBJA 3AA0B 5AQVB 2D9DA 3OVUA 4GK0E 3L8RA 2YK0A 3RQUA 1XNRT 1UURA 4U72A 3AE5A 2KMFA 3N5LA 5AFUL 5FY1A 2LRKA 3RC3A 4DV1T 3MXZA 4TNWA 5A1LA 2CWYA 3P4SA 1BR2A 4QXHB 2A3DA 1U4QA 5LNKA 2XSBA 2LM9A 2VKJA 2JMHA 1MIYA 1UX4A 2DL1A 1WLXA 1W0BA 2Y6XA 1L0VA 4A98A 4P0AA 2WB5A 1XDPA 2Q9QC 3CX7B 2WY2A 3LDQB 4DV2T 3AE8A 5JQGE 4HEAA 1D1AA 1CHUA 3AA7B 3T8OA 4COFA 4DIDB 2FUPA 2KZ7B 3RKGA 3L3PA 2WZIA 4WNKA 4YFSA 2ODVA 3CX8B 4IDNA 1S94A 3FZHB 5AQIB 1KNPA 3W15B 3R6NA 2BKNA 2E9XD 4JV5T 4ADZA 5IYZE 2IC6A 2YU2A 5HWXA 3HKEE 5AQQB 2KT9A 1WR0A 3ZCIA 4CXWA 3Q9DA 4L9IA 5H6RB 3KINB 4I0UA 3AE2A 3CQCB 1GQEA 2NOXA 3PUXF 4BJMA 3C4WA 3CX6B 5BR8T 5E0OA 3UUXB 5FKYA 4TV9E 4NXNT 4UVCB 3VR9A 3P4WA 4EB6E 3RYHE 5GONE 3I9WA 4AISA 3N2GE 5HYAA 2UXXB 5F3JA 2DNXA 4X66T 2X67A 2CHOA 5ABFB 2Z6EA 2F4VT 3AE9A 4H9OC 2V6YB 4DBQA 3CVRA 5EK4A 4HFEA 5FXVA 5JDNA 3HKBE 3ZN1B 4TWFA 4IREA 4IGUA 4CXYA 4TV8E 3AEGA 2LE8A 3AAEB 2WQYA 2ACZA 4I50E 2CMRA 5IHYA 3RIUC 2YOEA 1N36T 3H3AA 3EAMA 2QGSA 4HFHA 2X68A 3A5XA 2W4XA 4UV8B 3O1IA 1KNRA 3RHWA 5L3BB 5JDGA 2CWOA 2CBIA 3FBZA 5FY0A 4H9RC 3P8CD 3NRXA 4OX9T 1NAFA 4DR3T 3RQWA 2VKOA 2MTQA 4JUYA 3CIRA 4TZ4C 2VL0A 3DTOA 4XZCA 1KK7A 3PE0A 3JC6D 3EVYA 5L3EB 3MACA 1O3XA 3UQ4A 5LG3A 4UF0B 2WU2A 5FXZA 3PJAJ 3CMLA 3GN5B 2K9AA 1N33T 1NEKA 2RP4A 1IBKT 2IUBA 4PAGA 5JVDE 3SOLA 1FJGT 4GYSA 4A56A 3OYZA 3SWHA 3UUMA 2HN1A 2KWIB 4DR6T 2H7OA 4DMVA 1HS7A 1VRBA 5ABGA 3VKHA 5L3GB 1ZP0A 3UTKA 4DUYT 4AXPA 3UU8A 2E9XC 4X65T 3SRZA 3KV9A 2NTXA 2J4GA 4F6RC 3ABVA 3ZMTB 4X5TA 4FI5A 2ODUA 2XAJB 2W63A 4U33A 3RKOA 3LG7A 4JLEA 3ZYMA 3C4XA 2XSAA 4Z8XA 4EGWA 4KHPT 4U2ZA 1S35A 3ZSTA 2E8IA 4CI2B 1UCUA 4YXDA 4AQYT 4AQFC 2LJLA 1MNEA 3LK3B 3PUZF 4LF8T 3ZEFB 1XMQT 2E9XA 3L39A 5AQMB 3J7Yq 4E7SA 1CUNA 1OEDE 1UGOA 4I4TE 5AQSB 5L3CB 4ISSA 4H9QC 2W0GA 2Y8DA 3RF1A 3OBVE 5AQNB 2Q9QD 2XQAA 1IBLT 2HPJA 4AQFA 3KVBA 5LA6E 3FXEB 4ZI2C 2KSRA 4QKNA 5FXWA 2W62A 2BG9E 3FZLB 4X1YE 2VVSA 1LKXA 1N34T 4WZXA 3UQ7A 5JDQA 4IIJE 1N32T 3NBXX 4PW8A 4CN6A 3MA9A 4IL4A 3MJXA 4LF9T 5EK3A 3C4ZA 1B7TA 1JNRA 2E2AA 2YKSA 2LKHA 5L3FB 3JCFA 3QOFA 4ILAA 2VK9A 3NWIA 1SUMB 3AEBA 1FEWA 2B1EA 2RPAA 3AAAB 1G73A 1D1CA 2H7VC 2ZM8A 2NTYA 2CXFA 2XQ3A 4O8SA 3FB2A 3TLUA 3I9YA 3MKDA 3UFGA 3JC6C 3R84B 4GIWA 4C90A 2BG9A 5FVKA 4DV3T 2UXBT 2UUCT 5KXJA 3PDYA 4ZZCA 5ABHA 1D0XA 3RIAA 4B3TT 3DP7A 2VKHA 5J0ZA 3RYFE 3KV6A 2BVLA 2XZEA 1SA0E 4O2AE 3EABA 4AKGA 5FL0A 4N78D 5FY7A 4AI6A 1YKHB 5AQOB 2FJBA 3AA1B 3EDVA 2HHHT 3I0QA 3ZT6A 1IJ6A 2ZM0A 1LRZA 4L5GA 3HA4A 1HG2A 4PJLA 4IDOA 2L9QA 2BZBA 4ILCA 1X9BA 2JRKA 1YQ3A 3UULA 5F5WA 3Q5EA 3N2KE 4UELA 4GYRA 3KDSE 4JI0T 2N9DA 3UU3A 2XPKA 4U7YA 3AE1A 5HAXA 3EUHA 5LCYA 4I43B 3ZJ2A 4QX7B 2MPKA 4AKHA 2YN6A 2V7JA 2FBWA 1MMAA 1W0AA 3P4QA 4JI5T 4H63V 4QX8B 1R8IA 1YXRA 3ANWA 2LT3A 4NXMT 2C5KT 3RC8A 1BR4A 4KHZF 1BR1A 3CQXC 3ZC1A 4GKKT 2LHNA 4H63H 3PUVF 2H89A 4X64T 4HWIB 5LJMA 4YTNA 2UXNB 3M3ZB 4NIQA 5EZYE 1FMWA 4PJMA 4ZOLE 1UX5A 4IE5A 5DJQC 2X0LB 5DABA 3IBPA 2UUBT 5EK2A 4B6XA 3PURA 4Z90A 4LMKA 4EEDA 3OTOT 4NUVA 2A9UA 2KXPB 3ZMSB 1SHZC 2VWAA 2PJQA 3UFEA 2ES0A 4HWCA 2BKPA 5AQLB 1ZV4X 4ZEYA 4P1NA 4ZI7E 2X0YA 2QRXA 4YTMA 2C5JA 2XM1A 2WZHA 2EHOD 1XNQT 1MNDA 5CA0E 3E0ZA 3WAJA 2DWGA 1IBMT 1J5ET 1OEDB 1ZKEA 1T72A 2Q9QA 3HR0A 4EEBA 4MLKA 3UU6A 3RPUA 2GK9A 3L09A 2N2NA 5CGMA 2X9YA 5HXEA 3A7MA 1M7KA 4U7IA 4PJJA 3JAEA 2JQHA 3PUGA 2WCAA 1MMDA 3LSVA 3RYCE 3UUNA 5JH7E 2XASB 5HXRA 2NP9A 4YSYA 1UUSA 3LBXA 3OJAA 3VU7H 3T1YT 3AA6B 3KV4A 4ZXLA 5FYMA 2YDSA 3B13A 2BS2A 2W2UA 4HFIA 1YKEB 4JEHB 5LHHB 1VCSA 5HXCA 1US7B 5AQUB 1DU2A 1U5PA 4ISTA 2YU1A 3TLTA 4UR9A 2XQ6A 2X51A 4OYJA 2QA7A 4BJNA 2IHR1 3C98B 3ZT7A 2WDQA 4ZI2D 5JR9C 2HH7A 3AECA 1E7PA 4MHCA 2PFVA 1X79A 1XDOA 3FBLA 2CLYB 2E5LT 1MMGA 2G0UA 2XUEA 2HN2A 4LF4T 3S4UA 4H9NC 2KWHA 3ZSSA 3H3MA 1T8BA 4UVAB 3A8YC 3RH3A 3TLSA 2CA5A 4CQIA 4HGAA 4TWDA 5LHGB 3CK6A 3SFDA 4HTEA 1HX1B 2D0UA 3ZC0A 3AXJA 3N2OA 1KNZA 5JR9A 4OYKA 4G63A 4DVDA 1W09A 3RX6A 3RIUA 2LSYA 2WP9A 2CE7A 3PJAA 5LHIB 1HTJF 4YHJA 1SE7A 4QXCB 5KMGP 2D2SA 4ILUA 3QNUA 2JPFA 4EZ4A 1HCIA 3KBUA 5LMNT 5JRCA 3ZMVB 3ZCJA 3RIFA 4FJOA 2CHNA 4PNIA 3VR8A 1UK5A 2LLYA 4O4LE 2LRLA 4JI2T 1IZNB 2XJ7A 2VURA 4O2BE 2EHOC 3K3QC 4TN7B 5IUXA 3PUQA 3I1AA 2V26A 4YSZA 2XAFB 3TLVA 2JQKA 5LGNB 2XQ7A 5FMNA 4JI8T 4UEMA 4CN1A 4A97A 3K8PC 5L3DB 5LP6E 2L3LA 2KLQA 5DQWA 3P50A 1I6ZA 1WYCA 2B76A 2WU5A 2EHOA 2HPLA 2WS3A 3NKZA 4PK4A 1M62A 2IAKA 1XWMA 2V6XA 3AE6A 4HWFA 2LSGA 3ZKRA 1WCRA 4KX6A 1MIVA 2IIUA 3O4XE 2QVAA 2A72A 2W67A 4JYAT 2V8SV 5HXHA 4DV7T 1H7CA 2IW5B 1J1JA 4HN9A 3QB5K 4AIUA 2X66A 2CEAA 3JADA 5LOVE 4X1IE 2LSIA 2X0HA 3P4PA 2DI4A 5KDMC 4LF5T 4AQGA 4JI1T 2JQQA 2JMKA 2XQYA 4DR4T 2IMLA 3VRBA 2I59A 5L2LA 4PK5A 3GA8A 1Z8UA 1T7SA 4NUUA 4XAXB 2BS4A 4IE7A 4JI3T 4ZS2A 3VKGA 4EZHA 5AQGB 2X9HA 2DLRA 4YLHA 4JEUB 1AJ3A 4U3CA 5CFBA 4IDPA 3SFEA 3PU3A 4KUMB 4EOZB 2XAGB 3KBTA 2SPCA 5ABEA 5C2TA 2YEVC 3IHRA 5AQTB 1J5WA 1EZ3A 2BVMA 4YY3T 3PUWF 3C64A 3PUSA 3KVAA 2OA5A 5HEOA 4OHFA 4U31A 4QWNB 4HE8A 4WYVA 5CJ5A 3K3OA 3FZFB 3NRYA 4JI4T 5JDMA 4DV4T 1IJ5A 4O4IE 3V5UA 4AKLA 2H88A 4UVBB 4YTPA 2WBLA 4QHOA 2JQ9A 3GWHA 3Q2MA 1OXZA 4V1Av 4B3RT 4LFCT 2CLYC 3AVRA 5AQHB 4ZZBA 2KNDA 5F8PA 3P7IA 5ABFA 2X9WA 3UU4A 4DR5T 4ASKA 2D5UA 2IC9A 5AQRB 4ZI3C 3ONJA 3I0OA 5HCMA 2V6YA 2Y48B 3BQLA 2WAUA 4K0KT 3K1SA 2PTFA 3P4RA 4H9SE 4KP3C 3RYIE 4LFAT 4WW0A 5JREA 1IAPA 3F2EA 2LSJA 1Z0PA 2C0SA 2P9BA 5HWYA 4YT0A 2N1GA 2LHRA 1LVKA 3HL6A 4HFVA 2W00A 3E08A 5LXTE 4JI6T 2DHRA 5ADXL 2DCFA 4UIGA 2I0MA 5JTGA 3E22E 4DO0A 4HFCA 4DUZT 2XHEB 4KI0F 4QH1A 2E5VA 1VOMA 3PUYF 3F57A 4HFDA 3HKCE 4IDQA 5AQFB 2ZM6T 5HEUA 5FNVE 2BS3A 2LEHA 4GKJT 2J47A 2LOSA 3NVOA 2E9XB 2V7MA 3FZKB 4EXTA 3BQKA 4HWHA 4JBWF 2RA1A 1JNZA 3PV0F 2VKDA 5HXSA 1WRDA 4ERRA 4UF0A 4H9PC 4DR7T 3RLFF 4A5XA 1OWAA 2W61A 3GN5A
chains in the Genus database with same CATH topology
4DR5T 4JI2T 4LF5T 1XNQT 2VQFT 1I94T 1HR0T 1XNRT 4JI1T 2UXCT 4DR1T 4KHPT 4YHHT 1IBMT 4DR4T 2E5LT 4JI5T 4LF4T 4K0KT 4OX9T 1J5ET 5BR8T 4DR3T 4NXNT 4JI7T 4DV1T 4AQYT 4LFAT 4X62T 4JI8T 4NXMT 4LF8T 1XMQT 4JI3T 4DV0T 4DV3T 4LF7T 4GKKT 2UXBT 2UUCT 4JI6T 4X66T 2UU9T 4X64T 2F4VT 1HNXT 4DUZT 4B3TT 2VQET 3T1YT 4DV2T 1N33T 2UXDT 5LMUT 4DV5T 1IBKT 4B3ST 4DR2T 4YY3T 3T1HT 2UUAT 1FJGT 4B3MT 2ZM6T 5IWAT 1IBLT 2UUBT 4DR6T 2HHHT 4GKJT 4JYAT 4DV7T 3OTOT 4JI4T 4DV4T 1N34T 5LMNT 4DUYT 1HNZT 4JV5T 1N32T 4LFBT 4X65T 1HNWT 1XMOT 4B3RT 4LFCT 1N36T 4DR7T 4LF9T 4LF6T 4DV6T 4JI0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 T;  4JI2 T;  4LF5 T;  1XNQ T;  2VQF T;  1I94 T;  1HR0 T;  1XNR T;  4JI1 T;  2UXC T;  4DR1 T;  4KHP T;  4YHH T;  1IBM T;  4DR4 T;  2E5L T;  4JI5 T;  4LF4 T;  4K0K T;  4OX9 T;  1J5E T;  5BR8 T;  4DR3 T;  4NXN T;  4JI7 T;  4DV1 T;  4AQY T;  4LFA T;  4X62 T;  4JI8 T;  4NXM T;  4LF8 T;  1XMQ T;  4JI3 T;  4DV0 T;  4DV3 T;  4LF7 T;  4GKK T;  2UXB T;  2UUC T;  4JI6 T;  4X66 T;  2UU9 T;  4X64 T;  2F4V T;  1HNX T;  4DUZ T;  4B3T T;  2VQE T;  3T1Y T;  4DV2 T;  1N33 T;  2UXD T;  5LMU T;  4DV5 T;  1IBK T;  4B3S T;  4DR2 T;  4YY3 T;  3T1H T;  2UUA T;  1FJG T;  4B3M T;  2ZM6 T;  5IWA T;  1IBL T;  2UUB T;  4DR6 T;  2HHH T;  4GKJ T;  4JYA T;  4DV7 T;  3OTO T;  4JI4 T;  4DV4 T;  1N34 T;  5LMN T;  4DUY T;  1HNZ T;  4JV5 T;  1N32 T;  4LFB T;  4X65 T;  1HNW T;  1XMO T;  4B3R T;  4LFC T;  1N36 T;  4DR7 T;  4LF9 T;  4LF6 T;  4DV6 T;  4JI0 T; 
#chains in the Genus database with same CATH topology
 3O9X A;  4MFR A;  2LOP A;  2PBI A;  1I94 T;  4HKA A;  5JDL A;  2M6I A;  1HX8 A;  4DR1 T;  2D0T A;  4O4J E;  3VRA A;  3PTR B;  3CWZ B;  1VCT A;  3AED A;  3U3I A;  2J1D G;  5J1G A;  3TLW A;  3GMI A;  2K5B B;  3QC9 A;  2XAQ B;  5LGT B;  1MIW A;  3FZM B;  4TWH A;  3DJB A;  1HFA A;  2XQ8 A;  3UU5 A;  1E2A A;  2WM9 A;  2XQ9 A;  4CI1 B;  3JAF A;  4IL9 A;  4PJN A;  1YW0 A;  2YIN A;  3LK4 2;  1ZEE A;  2MAW A;  2ZLY A;  4G2A A;  3RRC A;  5LG4 A;  1W9R A;  4X20 E;  4YJ2 E;  3RGL A;  2WSS V;  3UUB A;  3CPZ A;  2CCQ A;  2ZMA A;  3AVS A;  4ILB A;  2K48 A;  2BG9 B;  2XQ5 A;  1HNW T;  3IA3 A;  2LM2 A;  2CXD A;  5LYJ E;  1ZHC A;  1NEN A;  2BKO A;  4GK5 E;  1ZOY A;  4C91 A;  3ONL C;  3QB5 A;  4EYY R;  3M65 A;  3C50 A;  4LML A;  3SS1 A;  2WMO A;  2XM2 A;  4YHH T;  4YJ3 E;  5J2T E;  4EYU A;  1WFD A;  4HWD A;  3IF8 B;  1Y01 A;  1D0Y A;  4X62 T;  3O1H A;  4L0R A;  2NWB A;  2K24 A;  3V5S A;  2YDQ A;  4HFB A;  3NZP A;  3ZT5 A;  4U2Y A;  2WDV A;  1FMV A;  3AE4 A;  2VVN A;  4IE4 A;  2MOZ A;  3EDU A;  2V7I A;  2W66 A;  5JDH A;  3LFM A;  4B3S T;  5BMV E;  3ESL A;  5L4E A;  5IWA T;  1Y64 B;  3WAK A;  4CI3 B;  3ANW B;  2NW8 A;  1T98 A;  1MMN A;  2LKG A;  4UXN B;  2JJ9 A;  4KMC A;  4WBN E;  1YD8 G;  4LMJ A;  3KFW X;  3OKQ A;  4I55 E;  4J2C A;  2X9X A;  4U74 A;  2PG8 A;  2V7K A;  5DQV A;  2K3W A;  1QUU A;  2L8K A;  2UXC T;  2BDE A;  5M4Y A;  5C3J A;  2CM0 A;  5LGU B;  2VAS A;  5LJN A;  3N9P A;  5L47 A;  3Q5W A;  4MBQ A;  5CB4 E;  2V5D A;  2CXL A;  3MK7 C;  4ZI3 D;  1KFY A;  3EI0 A;  2J62 A;  4P09 A;  4DV0 T;  2C5I T;  4YSX A;  1WR6 A;  4K0U A;  4Z91 A;  3AE7 A;  3ETU A;  5FL1 A;  2MYS A;  4TNV A;  1HNX T;  2OV9 A;  3K3N A;  2V1D B;  2UXD T;  2CBJ A;  5LB7 B;  3N9Q A;  5FVL A;  2Q9Q B;  2LSK A;  4B3M T;  3QK6 A;  5H6Q B;  4AKR B;  3O1J A;  4PFO A;  4PK6 A;  4TUY E;  5FXX A;  2WWU A;  3J9X 1;  3HI2 A;  3ZN0 B;  2XY8 B;  2BBH A;  3AEE A;  3LK2 B;  2NW7 A;  4E7Z A;  5KX5 E;  3UT5 E;  1HNZ T;  3ZJ1 A;  2NR4 A;  2VL8 A;  3LBX B;  5HCJ A;  4EV6 A;  4M1P A;  3MZK B;  1KEY A;  4Q25 A;  2WWV A;  3ONX A;  3ZLI A;  4DV6 T;  3AAI A;  2CPT A;  2YDR A;  2WDR A;  5TAO A;  5C8Y E;  4QH5 A;  4X1K E;  4CZZ B;  4BAY B;  3Q5D A;  5AQK B;  3ZMZ B;  4BA9 A;  3B5M A;  5CA1 E;  5HEH A;  3AEA A;  4IHJ E;  1OED C;  3ZMU B;  1HG5 A;  4KBM B;  4ZHQ E;  2V5C A;  1KF6 A;  4WBO A;  3F31 A;  3KV5 A;  1QLB A;  2NW9 A;  4DMW A;  2UU9 T;  1WYB A;  3HKD E;  2M6B A;  2AXD S;  2VQE T;  4XBF B;  1QSD A;  4QXB B;  3OPC A;  5LMU T;  4QH4 A;  4UV9 B;  5FP3 A;  4DV5 T;  5AQJ B;  2A2F X;  2IDO B;  2R6G F;  1XZY A;  5ETW A;  3C51 A;  2UUA T;  2FJD A;  2BG9 C;  1D0Z A;  4IDZ A;  4CN4 A;  1FIO A;  1OED A;  5HEG A;  3TKL B;  3QUJ A;  3N9N A;  2ZM2 A;  2XQ4 A;  3LJC A;  3CKD A;  3CQG B;  2XAH B;  1E1H B;  5LBQ B;  1D1B A;  3IEE A;  3D0T A;  4LFB T;  3ZYL A;  4OFZ A;  4DBR A;  3AXJ B;  1XMO T;  5JR9 B;  3N9M A;  4IT4 A;  4LF6 T;  5LBM A;  1BR0 A;  1G8X A;  4EIW A;  4IE0 A;  4OK0 A;  3X1D A;  2VQF T;  1HR0 T;  2H3R A;  3H37 A;  4NPP A;  3ZYK A;  3RI5 A;  2FJA A;  3N9O A;  5J2U E;  2CRB A;  3Q5X A;  4JI7 T;  3EHZ A;  5JDF A;  3BQI A;  4PFP A;  4DND A;  3VHL A;  1NWM X;  4TX5 A;  5JRC B;  1YQ4 A;  2V7L A;  4F8H A;  1LVF A;  2WMN A;  2M67 A;  3FHN A;  4LF7 T;  4P0B A;  4CXX A;  2QYW A;  2FJE A;  3B57 A;  3PUA A;  2VB6 A;  3N9L A;  3NZQ A;  2MBG A;  3ZPO A;  3OYX A;  2KIN B;  3ETV A;  3G06 A;  2DWK A;  4DR2 T;  2AE9 A;  3U78 A;  4ZS3 A;  3AE3 A;  4MAL A;  3T1H T;  4O4H E;  3RRW A;  2XTL A;  2I6H A;  4GOU A;  3AB3 B;  1HF8 A;  2JIW A;  4IE6 A;  3WI3 A;  3FXD B;  5L4H A;  1V9D A;  5AQP B;  3BK9 A;  2ACX A;  4ANJ A;  3AEF A;  5HEJ A;  2OLT A;  4AKI A;  2EHO B;  4EAH A;  3PU8 A;  2BBJ A;  3AA0 B;  5AQV B;  2D9D A;  3OVU A;  4GK0 E;  3L8R A;  2YK0 A;  3RQU A;  1XNR T;  1UUR A;  4U72 A;  3AE5 A;  2KMF A;  3N5L A;  5AFU L;  5FY1 A;  2LRK A;  3RC3 A;  4DV1 T;  3MXZ A;  4TNW A;  5A1L A;  2CWY A;  3P4S A;  1BR2 A;  4QXH B;  2A3D A;  1U4Q A;  5LNK A;  2XSB A;  2LM9 A;  2VKJ A;  2JMH A;  1MIY A;  1UX4 A;  2DL1 A;  1WLX A;  1W0B A;  2Y6X A;  1L0V A;  4A98 A;  4P0A A;  2WB5 A;  1XDP A;  2Q9Q C;  3CX7 B;  2WY2 A;  3LDQ B;  4DV2 T;  3AE8 A;  5JQG E;  4HEA A;  1D1A A;  1CHU A;  3AA7 B;  3T8O A;  4COF A;  4DID B;  2FUP A;  2KZ7 B;  3RKG A;  3L3P A;  2WZI A;  4WNK A;  4YFS A;  2ODV A;  3CX8 B;  4IDN A;  1S94 A;  3FZH B;  5AQI B;  1KNP A;  3W15 B;  3R6N A;  2BKN A;  2E9X D;  4JV5 T;  4ADZ A;  5IYZ E;  2IC6 A;  2YU2 A;  5HWX A;  3HKE E;  5AQQ B;  2KT9 A;  1WR0 A;  3ZCI A;  4CXW A;  3Q9D A;  4L9I A;  5H6R B;  3KIN B;  4I0U A;  3AE2 A;  3CQC B;  1GQE A;  2NOX A;  3PUX F;  4BJM A;  3C4W A;  3CX6 B;  5BR8 T;  5E0O A;  3UUX B;  5FKY A;  4TV9 E;  4NXN T;  4UVC B;  3VR9 A;  3P4W A;  4EB6 E;  3RYH E;  5GON E;  3I9W A;  4AIS A;  3N2G E;  5HYA A;  2UXX B;  5F3J A;  2DNX A;  4X66 T;  2X67 A;  2CHO A;  5ABF B;  2Z6E A;  2F4V T;  3AE9 A;  4H9O C;  2V6Y B;  4DBQ A;  3CVR A;  5EK4 A;  4HFE A;  5FXV A;  5JDN A;  3HKB E;  3ZN1 B;  4TWF A;  4IRE A;  4IGU A;  4CXY A;  4TV8 E;  3AEG A;  2LE8 A;  3AAE B;  2WQY A;  2ACZ A;  4I50 E;  2CMR A;  5IHY A;  3RIU C;  2YOE A;  1N36 T;  3H3A A;  3EAM A;  2QGS A;  4HFH A;  2X68 A;  3A5X A;  2W4X A;  4UV8 B;  3O1I A;  1KNR A;  3RHW A;  5L3B B;  5JDG A;  2CWO A;  2CBI A;  3FBZ A;  5FY0 A;  4H9R C;  3P8C D;  3NRX A;  4OX9 T;  1NAF A;  4DR3 T;  3RQW A;  2VKO A;  2MTQ A;  4JUY A;  3CIR A;  4TZ4 C;  2VL0 A;  3DTO A;  4XZC A;  1KK7 A;  3PE0 A;  3JC6 D;  3EVY A;  5L3E B;  3MAC A;  1O3X A;  3UQ4 A;  5LG3 A;  4UF0 B;  2WU2 A;  5FXZ A;  3PJA J;  3CML A;  3GN5 B;  2K9A A;  1N33 T;  1NEK A;  2RP4 A;  1IBK T;  2IUB A;  4PAG A;  5JVD E;  3SOL A;  1FJG T;  4GYS A;  4A56 A;  3OYZ A;  3SWH A;  3UUM A;  2HN1 A;  2KWI B;  4DR6 T;  2H7O A;  4DMV A;  1HS7 A;  1VRB A;  5ABG A;  3VKH A;  5L3G B;  1ZP0 A;  3UTK A;  4DUY T;  4AXP A;  3UU8 A;  2E9X C;  4X65 T;  3SRZ A;  3KV9 A;  2NTX A;  2J4G A;  4F6R C;  3ABV A;  3ZMT B;  4X5T A;  4FI5 A;  2ODU A;  2XAJ B;  2W63 A;  4U33 A;  3RKO A;  3LG7 A;  4JLE A;  3ZYM A;  3C4X A;  2XSA A;  4Z8X A;  4EGW A;  4KHP T;  4U2Z A;  1S35 A;  3ZST A;  2E8I A;  4CI2 B;  1UCU A;  4YXD A;  4AQY T;  4AQF C;  2LJL A;  1MNE A;  3LK3 B;  3PUZ F;  4LF8 T;  3ZEF B;  1XMQ T;  2E9X A;  3L39 A;  5AQM B;  3J7Y q;  4E7S A;  1CUN A;  1OED E;  1UGO A;  4I4T E;  5AQS B;  5L3C B;  4ISS A;  4H9Q C;  2W0G A;  2Y8D A;  3RF1 A;  3OBV E;  5AQN B;  2Q9Q D;  2XQA A;  1IBL T;  2HPJ A;  4AQF A;  3KVB A;  5LA6 E;  3FXE B;  4ZI2 C;  2KSR A;  4QKN A;  5FXW A;  2W62 A;  2BG9 E;  3FZL B;  4X1Y E;  2VVS A;  1LKX A;  1N34 T;  4WZX A;  3UQ7 A;  5JDQ A;  4IIJ E;  1N32 T;  3NBX X;  4PW8 A;  4CN6 A;  3MA9 A;  4IL4 A;  3MJX A;  4LF9 T;  5EK3 A;  3C4Z A;  1B7T A;  1JNR A;  2E2A A;  2YKS A;  2LKH A;  5L3F B;  3JCF A;  3QOF A;  4ILA A;  2VK9 A;  3NWI A;  1SUM B;  3AEB A;  1FEW A;  2B1E A;  2RPA A;  3AAA B;  1G73 A;  1D1C A;  2H7V C;  2ZM8 A;  2NTY A;  2CXF A;  2XQ3 A;  4O8S A;  3FB2 A;  3TLU A;  3I9Y A;  3MKD A;  3UFG A;  3JC6 C;  3R84 B;  4GIW A;  4C90 A;  2BG9 A;  5FVK A;  4DV3 T;  2UXB T;  2UUC T;  5KXJ A;  3PDY A;  4ZZC A;  5ABH A;  1D0X A;  3RIA A;  4B3T T;  3DP7 A;  2VKH A;  5J0Z A;  3RYF E;  3KV6 A;  2BVL A;  2XZE A;  1SA0 E;  4O2A E;  3EAB A;  4AKG A;  5FL0 A;  4N78 D;  5FY7 A;  4AI6 A;  1YKH B;  5AQO B;  2FJB A;  3AA1 B;  3EDV A;  2HHH T;  3I0Q A;  3ZT6 A;  1IJ6 A;  2ZM0 A;  1LRZ A;  4L5G A;  3HA4 A;  1HG2 A;  4PJL A;  4IDO A;  2L9Q A;  2BZB A;  4ILC A;  1X9B A;  2JRK A;  1YQ3 A;  3UUL A;  5F5W A;  3Q5E A;  3N2K E;  4UEL A;  4GYR A;  3KDS E;  4JI0 T;  2N9D A;  3UU3 A;  2XPK A;  4U7Y A;  3AE1 A;  5HAX A;  3EUH A;  5LCY A;  4I43 B;  3ZJ2 A;  4QX7 B;  2MPK A;  4AKH A;  2YN6 A;  2V7J A;  2FBW A;  1MMA A;  1W0A A;  3P4Q A;  4JI5 T;  4H63 V;  4QX8 B;  1R8I A;  1YXR A;  3ANW A;  2LT3 A;  4NXM T;  2C5K T;  3RC8 A;  1BR4 A;  4KHZ F;  1BR1 A;  3CQX C;  3ZC1 A;  4GKK T;  2LHN A;  4H63 H;  3PUV F;  2H89 A;  4X64 T;  4HWI B;  5LJM A;  4YTN A;  2UXN B;  3M3Z B;  4NIQ A;  5EZY E;  1FMW A;  4PJM A;  4ZOL E;  1UX5 A;  4IE5 A;  5DJQ C;  2X0L B;  5DAB A;  3IBP A;  2UUB T;  5EK2 A;  4B6X A;  3PUR A;  4Z90 A;  4LMK A;  4EED A;  3OTO T;  4NUV A;  2A9U A;  2KXP B;  3ZMS B;  1SHZ C;  2VWA A;  2PJQ A;  3UFE A;  2ES0 A;  4HWC A;  2BKP A;  5AQL B;  1ZV4 X;  4ZEY A;  4P1N A;  4ZI7 E;  2X0Y A;  2QRX A;  4YTM A;  2C5J A;  2XM1 A;  2WZH A;  2EHO D;  1XNQ T;  1MND A;  5CA0 E;  3E0Z A;  3WAJ A;  2DWG A;  1IBM T;  1J5E T;  1OED B;  1ZKE A;  1T72 A;  2Q9Q A;  3HR0 A;  4EEB A;  4MLK A;  3UU6 A;  3RPU A;  2GK9 A;  3L09 A;  2N2N A;  5CGM A;  2X9Y A;  5HXE A;  3A7M A;  1M7K A;  4U7I A;  4PJJ A;  3JAE A;  2JQH A;  3PUG A;  2WCA A;  1MMD A;  3LSV A;  3RYC E;  3UUN A;  5JH7 E;  2XAS B;  5HXR A;  2NP9 A;  4YSY A;  1UUS A;  3LBX A;  3OJA A;  3VU7 H;  3T1Y T;  3AA6 B;  3KV4 A;  4ZXL A;  5FYM A;  2YDS A;  3B13 A;  2BS2 A;  2W2U A;  4HFI A;  1YKE B;  4JEH B;  5LHH B;  1VCS A;  5HXC A;  1US7 B;  5AQU B;  1DU2 A;  1U5P A;  4IST A;  2YU1 A;  3TLT A;  4UR9 A;  2XQ6 A;  2X51 A;  4OYJ A;  2QA7 A;  4BJN A;  2IHR 1;  3C98 B;  3ZT7 A;  2WDQ A;  4ZI2 D;  5JR9 C;  2HH7 A;  3AEC A;  1E7P A;  4MHC A;  2PFV A;  1X79 A;  1XDO A;  3FBL A;  2CLY B;  2E5L T;  1MMG A;  2G0U A;  2XUE A;  2HN2 A;  4LF4 T;  3S4U A;  4H9N C;  2KWH A;  3ZSS A;  3H3M A;  1T8B A;  4UVA B;  3A8Y C;  3RH3 A;  3TLS A;  2CA5 A;  4CQI A;  4HGA A;  4TWD A;  5LHG B;  3CK6 A;  3SFD A;  4HTE A;  1HX1 B;  2D0U A;  3ZC0 A;  3AXJ A;  3N2O A;  1KNZ A;  5JR9 A;  4OYK A;  4G63 A;  4DVD A;  1W09 A;  3RX6 A;  3RIU A;  2LSY A;  2WP9 A;  2CE7 A;  3PJA A;  5LHI B;  1HTJ F;  4YHJ A;  1SE7 A;  4QXC B;  5KMG P;  2D2S A;  4ILU A;  3QNU A;  2JPF A;  4EZ4 A;  1HCI A;  3KBU A;  5LMN T;  5JRC A;  3ZMV B;  3ZCJ A;  3RIF A;  4FJO A;  2CHN A;  4PNI A;  3VR8 A;  1UK5 A;  2LLY A;  4O4L E;  2LRL A;  4JI2 T;  1IZN B;  2XJ7 A;  2VUR A;  4O2B E;  2EHO C;  3K3Q C;  4TN7 B;  5IUX A;  3PUQ A;  3I1A A;  2V26 A;  4YSZ A;  2XAF B;  3TLV A;  2JQK A;  5LGN B;  2XQ7 A;  5FMN A;  4JI8 T;  4UEM A;  4CN1 A;  4A97 A;  3K8P C;  5L3D B;  5LP6 E;  2L3L A;  2KLQ A;  5DQW A;  3P50 A;  1I6Z A;  1WYC A;  2B76 A;  2WU5 A;  2EHO A;  2HPL A;  2WS3 A;  3NKZ A;  4PK4 A;  1M62 A;  2IAK A;  1XWM A;  2V6X A;  3AE6 A;  4HWF A;  2LSG A;  3ZKR A;  1WCR A;  4KX6 A;  1MIV A;  2IIU A;  3O4X E;  2QVA A;  2A72 A;  2W67 A;  4JYA T;  2V8S V;  5HXH A;  4DV7 T;  1H7C A;  2IW5 B;  1J1J A;  4HN9 A;  3QB5 K;  4AIU A;  2X66 A;  2CEA A;  3JAD A;  5LOV E;  4X1I E;  2LSI A;  2X0H A;  3P4P A;  2DI4 A;  5KDM C;  4LF5 T;  4AQG A;  4JI1 T;  2JQQ A;  2JMK A;  2XQY A;  4DR4 T;  2IML A;  3VRB A;  2I59 A;  5L2L A;  4PK5 A;  3GA8 A;  1Z8U A;  1T7S A;  4NUU A;  4XAX B;  2BS4 A;  4IE7 A;  4JI3 T;  4ZS2 A;  3VKG A;  4EZH A;  5AQG B;  2X9H A;  2DLR A;  4YLH A;  4JEU B;  1AJ3 A;  4U3C A;  5CFB A;  4IDP A;  3SFE A;  3PU3 A;  4KUM B;  4EOZ B;  2XAG B;  3KBT A;  2SPC A;  5ABE A;  5C2T A;  2YEV C;  3IHR A;  5AQT B;  1J5W A;  1EZ3 A;  2BVM A;  4YY3 T;  3PUW F;  3C64 A;  3PUS A;  3KVA A;  2OA5 A;  5HEO A;  4OHF A;  4U31 A;  4QWN B;  4HE8 A;  4WYV A;  5CJ5 A;  3K3O A;  3FZF B;  3NRY A;  4JI4 T;  5JDM A;  4DV4 T;  1IJ5 A;  4O4I E;  3V5U A;  4AKL A;  2H88 A;  4UVB B;  4YTP A;  2WBL A;  4QHO A;  2JQ9 A;  3GWH A;  3Q2M A;  1OXZ A;  4V1A v;  4B3R T;  4LFC T;  2CLY C;  3AVR A;  5AQH B;  4ZZB A;  2KND A;  5F8P A;  3P7I A;  5ABF A;  2X9W A;  3UU4 A;  4DR5 T;  4ASK A;  2D5U A;  2IC9 A;  5AQR B;  4ZI3 C;  3ONJ A;  3I0O A;  5HCM A;  2V6Y A;  2Y48 B;  3BQL A;  2WAU A;  4K0K T;  3K1S A;  2PTF A;  3P4R A;  4H9S E;  4KP3 C;  3RYI E;  4LFA T;  4WW0 A;  5JRE A;  1IAP A;  3F2E A;  2LSJ A;  1Z0P A;  2C0S A;  2P9B A;  5HWY A;  4YT0 A;  2N1G A;  2LHR A;  1LVK A;  3HL6 A;  4HFV A;  2W00 A;  3E08 A;  5LXT E;  4JI6 T;  2DHR A;  5ADX L;  2DCF A;  4UIG A;  2I0M A;  5JTG A;  3E22 E;  4DO0 A;  4HFC A;  4DUZ T;  2XHE B;  4KI0 F;  4QH1 A;  2E5V A;  1VOM A;  3PUY F;  3F57 A;  4HFD A;  3HKC E;  4IDQ A;  5AQF B;  2ZM6 T;  5HEU A;  5FNV E;  2BS3 A;  2LEH A;  4GKJ T;  2J47 A;  2LOS A;  3NVO A;  2E9X B;  2V7M A;  3FZK B;  4EXT A;  3BQK A;  4HWH A;  4JBW F;  2RA1 A;  1JNZ A;  3PV0 F;  2VKD A;  5HXS A;  1WRD A;  4ERR A;  4UF0 A;  4H9P C;  4DR7 T;  3RLF F;  4A5X A;  1OWA A;  2W61 A;  3GN5 A; 
#chains in the Genus database with same CATH homology
 4DR5 T;  4JI2 T;  4LF5 T;  1XNQ T;  2VQF T;  1I94 T;  1HR0 T;  1XNR T;  4JI1 T;  2UXC T;  4DR1 T;  4KHP T;  4YHH T;  1IBM T;  4DR4 T;  2E5L T;  4JI5 T;  4LF4 T;  4K0K T;  4OX9 T;  1J5E T;  5BR8 T;  4DR3 T;  4NXN T;  4JI7 T;  4DV1 T;  4AQY T;  4LFA T;  4X62 T;  4JI8 T;  4NXM T;  4LF8 T;  1XMQ T;  4JI3 T;  4DV0 T;  4DV3 T;  4LF7 T;  4GKK T;  2UXB T;  2UUC T;  4JI6 T;  4X66 T;  2UU9 T;  4X64 T;  2F4V T;  1HNX T;  4DUZ T;  4B3T T;  2VQE T;  3T1Y T;  4DV2 T;  1N33 T;  2UXD T;  5LMU T;  4DV5 T;  1IBK T;  4B3S T;  4DR2 T;  4YY3 T;  3T1H T;  2UUA T;  1FJG T;  4B3M T;  2ZM6 T;  5IWA T;  1IBL T;  2UUB T;  4DR6 T;  2HHH T;  4GKJ T;  4JYA T;  4DV7 T;  3OTO T;  4JI4 T;  4DV4 T;  1N34 T;  5LMN T;  4DUY T;  1HNZ T;  4JV5 T;  1N32 T;  4LFB T;  4X65 T;  1HNW T;  1XMO T;  4B3R T;  4LFC T;  1N36 T;  4DR7 T;  4LF9 T;  4LF6 T;  4DV6 T;  4JI0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...