1XMQT

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xmqT00
4JI2T 4JI3T 4NXNT 4LF7T 4JI5T 1XNQT 4LFAT 4DV2T 4GKKT 3OTOT 1I94T 2VQET 4X62T 4LFCT 4LF5T 2UU9T 4DR5T 2UXCT 4DV0T 1J5ET 2HHHT 4JI8T 4JI4T 4B3MT 4JI7T 1N34T 4DV1T 1HR0T 2F4VT 4DUYT 4DV6T 4OX9T 4LF6T 1FJGT 5LMUT 4B3RT 1HNZT 1HNXT 1IBKT 2UUBT 4DV3T 4DV4T 4JYAT 4JI1T 4DR4T 1N32T 4X65T 3T1HT 2UXDT 4JI6T 4JV5T 4LF8T 4DR1T 4GKJT 4YY3T 4X66T 5BR8T 2E5LT 2UUAT 4B3ST 4LF9T 5IWAT 4JI0T 1HNWT 1N33T 4X64T 4B3TT 4DR2T 1XMOT 1XNRT 4LFBT 2UXBT 4LF4T 2UUCT 4DR6T 3T1YT 4AQYT 1IBLT 1N36T 4DR7T 4DUZT 4NXMT 4DV7T 4K0KT 4KHPT 5LMNT 4YHHT 4DR3T 1XMQT 1IBMT 2ZM6T 2VQFT 4DV5T
chains in the Genus database with same CATH superfamily
3Q2MA 1MNEA 5AQOB 5LA6E 2CA5A 2E9XB 4NXNT 2XAQB 4MHCA 3TLUA 3PUWF 2Q9QD 5L47A 4AKGA 3UU3A 4PK5A 4NUUA 2B76A 2NTYA 3O1JA 3QC9A 3ABVA 4U2YA 5L3EB 2W61A 3FZKB 3MA9A 5CA1E 2HHHT 5LP6E 2WMOA 3RH3A 1MIVA 3K1SA 4H9NC 3N9MA 4J2CA 5LBQB 5E0OA 2X51A 2VKOA 4DV4T 1E7PA 2LLYA 4I43B 1MIYA 2PG8A 5DABA 3ZN1B 3AEDA 4UEMA 2V5DA 4Z8XA 2HPJA 3N9OA 5FXWA 5ABGA 3WI3A 1D0YA 1YQ4A 3QUJA 3QB5K 3MXZA 2FUPA 3QB5A 5LGTB 3N9LA 2WCAA 3ONXA 3T1YT 3UQ7A 4GK0E 2XAJB 2V7LA 1IJ5A 3CIRA 3P4PA 1D0XA 3K3NA 2YKSA 1E1HB 2EHOA 4TWDA 2XSAA 2CXLA 3B13A 3Q5DA 3O9XA 4U7IA 2YN6A 4LF7T 2I59A 5LJMA 4GKKT 5LYJE 1YW0A 2BBJA 2EHOB 5LGNB 3PUYF 5ABEA 1D0ZA 1CHUA 5AQVB 2CLYC 3NVOA 2LRKA 1OEDB 4JI7T 3UU4A 1UGOA 1QLBA 3SFEA 4QH1A 5FYMA 3ZYMA 3FBZA 2JRKA 2UUBT 4IE4A 2JQ9A 2KMFA 3AEFA 4JI6T 4YY3T 2ZM0A 2CWYA 4MALA 2E9XC 4WBNE 3BK9A 2X68A 4YXDA 3UU8A 2LKGA 1FIOA 1I6ZA 3N2GE 4TX5A 2BG9B 4U2ZA 2V26A 2X9HA 4KBMB 2CBIA 3AXJB 5DJQC 3HKCE 4ZI3D 4PNIA 5CA0E 4O2BE 1WRDA 2ACXA 3ZSTA 4ZI3C 5CJ5A 3H37A 4N78D 1XWMA 2CWOA 5LMNT 1HFAA 2P9BA 5IYZE 3FZLB 1XMQT 1IAPA 3K3OA 4QHOA 1SE7A 2JQQA 3IHRA 3ZN0B 2IC6A 4ERRA 3UUMA 4AQGA 1WCRA 3PDYA 3PURA 2XY8B 4IE6A 5LCYA 1T7SA 3U3IA 2CCQA 4HTEA 2SPCA 2FJDA 5JRCB 2JIWA 1J5ET 3BQIA 4LMJA 5FMNA 2LSGA 4ZS3A 3NRXA 3KV5A 4YT0A 1US7B 4WYVA 3UU5A 4Z91A 2LSJA 4NUVA 1HTJF 4JYAT 4IREA 4DR4T 1SUMB 3M3ZB 1WFDA 2MBGA 2YK0A 2QYWA 3IEEA 4OHFA 5LJNA 2VK9A 3PUGA 5FY0A 3C50A 2EHOC 4YSXA 3CX7B 5AQGB 4X64T 2YEVC 4DR2T 5ABHA 3RYFE 1OEDC 5LG4A 4X20E 4JUYA 4P0BA 3OKQA 3P4QA 4X1KE 5C3JA 4AKLA 2I6HA 4FI5A 1NEKA 2WS3A 5F5WA 3AA6B 3EHZA 3OYXA 3LFMA 4E7ZA 1IBMT 2ZM6T 1KNZA 2ODUA 5JDFA 2BG9C 5FNVE 4G2AA 3FHNA 3OJAA 1I94T 4P1NA 1VRBA 3AB3B 4U72A 2KWIB 4JI8T 4HWFA 3FB2A 2BKOA 3P4RA 4WZXA 4AQFA 3AVRA 3N5LA 3CX8B 2WDVA 3HKDE 4GK5E 4DUYT 4DV6T 1UURA 3A5XA 2XQ4A 1HG5A 4X65T 2CHNA 4ZZCA 4TWHA 5J1GA 4HFVA 2C5JA 5HXRA 5L3BB 1WR0A 5AQHB 3LK42 3AEEA 3AAAB 4JI0T 3MKDA 2D9DA 4B6XA 5FXXA 1L0VA 3PU3A 5JTGA 4UIGA 3PV0F 2IAKA 4GOUA 2WWVA 5HEUA 3RKOA 2NW7A 4U74A 3A7MA 2PJQA 2WY2A 3TLSA 2C5KT 3RRWA 2WZIA 4O4LE 2A9UA 1CUNA 2WU5A 5LBMA 1NWMX 2BKPA 4TN7B 3VRAA 5HCJA 4I55E 2Q9QA 4QX7B 2XSBA 3GMIA 4H63V 5AQLB 2CXDA 5M4YA 4ILBA 5F3JA 4CXYA 3B57A 3OTOT 2LE8A 5HXEA 4K0UA 4GYSA 2IIUA 3RC8A 2A2FX 1UX4A 3KDSE 4IT4A 5HWYA 4EGWA 2HH7A 3T8OA 2BBHA 3PJAA 4U3CA 1OXZA 1ZOYA 3AE5A 3NRYA 4YSZA 2QRXA 1HX8A 3ZEFB 3N9PA 1N32T 5LXTE 3T1HT 1UCUA 4YTPA 4GKJT 3ZC0A 2W66A 4X66T 1KF6A 4PJMA 1KNRA 5HXSA 1VCSA 4AI6A 2MOZA 3ANWA 2BS3A 2HN1A 5AQFB 1HG2A 2CRBA 2RP4A 2KSRA 2E5VA 2X0LB 1S35A 5KMGP 4B3TT 3RLFF 2AE9A 1S94A 4LFBT 1J5WA 3VR9A 4PFOA 3ANWB 2E8IA 1MIWA 3N2KE 5CB4E 1AJ3A 3PUZF 2NP9A 2XM2A 1Y01A 4NXMT 4IDNA 4DV7T 2X67A 4ZI2C 2W00A 4YJ3E 4ZEYA 5AQUB 5ETWA 5KXJA 2D0UA 2HPLA 3VKGA 3AE2A 2J1DG 3AAEB 2VKJA 3ETUA 3KBTA 3Q5XA 3UUXB 1V9DA 3VKHA 3N9QA 3ZT5A 1WR6A 2UU9T 5AQRB 4HFIA 4COFA 5HEJA 2X66A 4GIWA 5HXHA 3Q5WA 1QSDA 2ZLYA 4H9QC 3RIUA 3P4WA 2XASB 1W9RA 2L9QA 1HNZT 4JEUB 2J4GA 4YTNA 2FJAA 2WZHA 3VHLA 4UV9B 4DO0A 4ISTA 2BKNA 2W63A 4H9RC 3LK2B 2DI4A 3FXDB 4P09A 3PUVF 2IC9A 3UU6A 3G06A 4AXPA 3HKEE 2LHRA 4QWNB 4A97A 4EZHA 4ILUA 1UK5A 2XTLA 5TAOA 3P8CD 2K3WA 3MZKB 2NOXA 1M62A 3JC6C 4HFHA 2L3LA 3L39A 5H6QB 4I0UA 2Y48B 2IDOB 4DV5T 3AEGA 2IMLA 3RIFA 4ZI7E 3Q5EA 4BAYB 2WMNA 5A1LA 4YFSA 4YHJA 4X62T 1ZHCA 4LF5T 3ZPOA 3N2OA 2YDSA 4EEDA 2UXCT 1KEYA 2LEHA 5JREA 3ZYLA 4UV8B 1VOMA 1HR0T 3AE7A 3C4ZA 2Y8DA 4ZOLE 1HNXT 1IBKT 4X5TA 3ONLC 2MYSA 5LB7B 5FVKA 5DQWA 2H89A 5FL0A 4ZZBA 2XQ8A 4WW0A 2B1EA 1E2AA 4LF9T 1O3XA 2V7MA 2M67A 1XMOT 2CPTA 4YLHA 2E9XD 4HFBA 2V5CA 5LHHB 2V7JA 5EK4A 2XAGB 1GQEA 3RYIE 3GN5A 1T72A 2QA7A 2CBJA 3AVSA 4U33A 4PJLA 4NIQA 4XAXB 2XQYA 2V6XA 3EUHA 5AQKB 5DQVA 2UXNB 3GN5B 4DMVA 4UVAB 3UUNA 3ZT7A 3L8RA 3RIUC 2DLRA 5JDLA 3S4UA 2J47A 2N2NA 4IGUA 4WNKA 1XDOA 2NR4A 1WYBA 3SWHA 5L3CB 3P7IA 4TUYE 1NENA 2KT9A 3CMLA 4YJ2E 4O2AE 3RGLA 4L0RA 2LSIA 1LRZA 3NZQA 2JMKA 5L3GB 4KMCA 3N9NA 4EEBA 2LHNA 3RI5A 1FMWA 4KHZF 3AE9A 4M1PA 2DHRA 5JR9A 5JQGE 3BQKA 3CK6A 2BS4A 2G0UA 4CXXA 1B7TA 3C64A 1HCIA 5FXVA 4DMWA 5JR9B 5J2TE 4GYRA 4V1Av 4AKIA 4IE5A 4QH5A 3AA0B 2XPKA 4XZCA 4QXBB 2X9XA 2EHOD 3FZFB 5FY7A 3GA8A 3NWIA 3DTOA 4LMLA 3RQUA 4I50E 2DCFA 2V7KA 2XZEA 4A98A 3LBXA 2V8SV 4PK6A 2YU2A 1W0BA 4TV8E 4PAGA 5HYAA 4OYJA 5HWXA 3RYCE 1Z0PA 2VL0A 1MMDA 4MBQA 5L3DB 4X1IE 2BVMA 2YDRA 3LK3B 2H3RA 4E7SA 1YKEB 2KLQA 4QXHB 2XHEB 3OVUA 5FXZA 3W15B 4CZZB 1YQ3A 3RKGA 1IZNB 5LMUT 3JADA 2WBLA 2N9DA 3AA7B 4LF8T 3J9X1 4DR1T 4F8HA 2JQKA 4UXNB 4MFRA 4KI0F 5FL1A 2W67A 2CXFA 5JDQA 2WU2A 3L09A 1HNWT 4CXWA 2CMRA 4DNDA 2H7VC 3FBLA 2DWKA 3B5MA 4YSYA 3TLVA 4IDQA 4DIDB 5EZYE 4AQYT 1MMGA 2WM9A 5AFUL 3R6NA 1HF8A 4IDOA 2CM0A 4DUZT 3AA1B 1WLXA 3EDVA 3RHWA 4QXCB 3PUAA 4H9PC 5EK2A 3ZMSB 1KK7A 1MMNA 5AQTB 4DVDA 2WB5A 2DL1A 2L8KA 5LOVE 3ZKRA 3AE4A 2XQ6A 2DNXA 2XAFB 5KDMC 1LKXA 5HEGA 5JR9C 1LVKA 2XUEA 2XQ9A 4OK0A 1HX1B 4JBWF 3GWHA 1ZP0A 4PJNA 3UFGA 4HFDA 4HWCA 3WAJA 4OX9T 4H9OC 2CHOA 2YINA 3CQGB 4DV3T 2Q9QB 1D1CA 3ZT6A 3AAIA 3PJAJ 4TV9E 3UTKA 5BR8T 2W0GA 4C91A 2GK9A 5IWAT 3OPCA 1BR4A 3DJBA 5HCMA 2BZBA 3V5SA 3Q9DA 2V6YA 4OFZA 2YU1A 4HE8A 4OYKA 2JMHA 2LM9A 3F2EA 1IBLT 1D1AA 2K48A 4I4TE 5HEOA 1Y64B 3ZSSA 1UX5A 2MAWA 4EYUA 4C90A 1BR0A 2IHR1 4YHHT 5L4EA 4EV6A 4AKRB 1X9BA 4KX6A 4ILAA 2MTQA 4AKHA 1IJ6A 3H3AA 3KFWX 4O4JE 4ADZA 4ZI2D 3R84B 4KUMB 3MJXA 2IW5B 3VRBA 2VVSA 3AEBA 1HS7A 2ODVA 4U7YA 4AQFC 2M6IA 4CN6A 4DV0T 4L9IA 5GONE 3FZHB 1G8XA 5JH7E 4CI3B 3V5UA 2JJ9A 2F4VT 4UELA 1W09A 3D0TA 3K3QC 4O4HE 2H88A 1XZYA 3CWZB 3RRCA 2BVLA 1ZEEA 2C0SA 3EVYA 3ZMUB 5L2LA 4TWFA 2KWHA 2WDQA 3PUXF 2LJLA 3ZJ2A 3UULA 1U4QA 5CFBA 3SRZA 2XJ7A 3MACA 5HAXA 2WAUA 2D5UA 2CEAA 1XNRT 1WYCA 2WDRA 4ZS2A 1LVFA 3HI2A 2N1GA 3NBXX 2J62A 2LRLA 3CQXC 4EZ4A 5KX5E 3UFEA 3JAFA 2W62A 1D1BA 3PTRB 4IDZA 4TNWA 2Q9QC 2MPKA 2VL8A 4HWIB 3J7Yq 5J0ZA 5LHGB 4DR3T 3EI0A 3CKDA 2OV9A 4UR9A 3HL6A 4JI2T 2PTFA 2V7IA 5LGUB 2VQET 3JC6D 4G63A 3AE1A 4AISA 2C5IT 1FEWA 2ZM2A 2VKDA 3HKBE 3E22E 4HFCA 3TLTA 3QNUA 2I0MA 2ES0A 2VURA 4EOZB 1N34T 1EZ3A 4UVBB 2FJEA 5EK3A 3ZCJA 2LKHA 2WSSV 5ABFA 3RQWA 2Z6EA 3C4XA 1G73A 3ZJ1A 2OLTA 2R6GF 5LNKA 1YKHB 4HWDA 3PUSA 5ABFB 1UUSA 4ZXLA 4X1YE 4EYYR 2JQHA 2WP9A 1BR2A 2X9YA 4U31A 4HFEA 1N36T 1OEDA 2PFVA 4CI2B 5CGMA 4K0KT 4QX8B 4QKNA 1YXRA 3KBUA 3KV6A 4JLEA 4Z90A 3RIAA 4CQIA 5JDNA 2RPAA 3A8YC 3HA4A 3ZMVB 3AEAA 4H9SE 4DV2T 4QH4A 4MLKA 2KINB 2WQYA 2DWGA 2BG9A 5JDMA 3I0QA 3ZMZB 3AXJA 4BJMA 2PBIA 2NW9A 3IBPA 4CN1A 4B3MT 3FZMB 5AQPB 2XM1A 4PJJA 4B3RT 4IHJE 3EAMA 3SS1A 4UF0A 4L5GA 2IUBA 2KZ7B 1JNZA 4IE7A 3F31A 3PE0A 4YTMA 2VASA 5AQJB 1MNDA 2W4XA 3EDUA 3EABA 5IUXA 4UF0B 1ZKEA 5BMVE 2HN2A 1N33T 4BA9A 2D2SA 5JVDE 1W0AA 5L3FB 1ZV4X 2ZM8A 3H3MA 4UVCB 1KFYA 4CN4A 5JRCA 4HKAA 4HN9A 2XQ7A 4F6RC 3AE3A 3IA3A 3SFDA 2YDQA 1OWAA 5HEHA 1BR1A 2VVNA 5HXCA 5AQQB 4P0AA 1H7CA 4H63H 2W2UA 5FKYA 3C51A 4PW8A 2BDEA 4IL9A 1XNQT 4LFAT 3QK6A 4EB6E 4XBFB 4AIUA 2QGSA 1NAFA 3SOLA 2XQ5A 3I0OA 2VWAA 5F8PA 3PUQA 2NTXA 4HGAA 2VB6A 5AQNB 2JPFA 3C4WA 3M65A 4LF6T 3AECA 3LBXB 1FJGT 2UXXB 1Z8UA 4HWHA 4ASKA 2QVAA 3DP7A 5C8YE 2WWUA 4JV5T 1QUUA 5JDGA 3RX6A 2ZMAA 5H6RB 3JAEA 3VU7H 1J1JA 3C98B 3RPUA 3KV4A 2LSKA 1T98A 4JEHB 4WBOA 4O4IE 3ZMTB 2XQ3A 4IL4A 2LSYA 2CE7A 3ESLA 4KP3C 2XAHB 2NW8A 2UXBT 3I9YA 3P50A 3K8PC 1SA0E 4TNVA 3FXEB 4DBQA 4IIJE 3O1IA 3LDQB 2ACZA 5C2TA 3KINB 5LG3A 1DU2A 4BJNA 3RF1A 1YD8G 4IE0A 4ILCA 4ANJA 3LSVA 3CQCB 3NKZA 4JI5T 3I9WA 3VR8A 1JNRA 5L4HA 3O4XE 5ADXL 4LFCT 2K24A 2FBWA 1R8IA 5LHIB 1X79A 2RA1A 3MK7C 2NWBA 5FP3A 3IF8B 4JI4T 2M6BA 3ZLIA 3OYZA 4DV1T 3F57A 3UT5E 4HEAA 2KNDA 2K5BB 3CVRA 4EIWA 3CPZA 2LT3A 4JI1T 2Y6XA 3E08A 2E5LT 3U78A 2UUAT 3QOFA 3OBVE 3AE8A 3O1HA 3ZCIA 5FVLA 3ONJA 2V1DB 4LF4T 3I1AA 2A72A 3P4SA 3KV9A 1SHZC 1T8BA 3E0ZA 4A56A 4DR7T 2E2AA 4DBRA 4KHPT 5FY1A 3BQLA 2FJBA 3TKLB 3TLWA 4LMKA 2VQFT 3LJCA 3ZYKA 5AQIB 2X9WA 2A3DA 4JI3T 3X1DA 2V6YB 2X0YA 4PK4A 4Q25A 2XQAA 5IHYA 1FMVA 5AQMB 4NPPA 3WAKA 1KNPA 4DR5T 4EAHA 3RC3A 3ETVA 4PFPA 4CI1B 5J2UE 1OEDE 3AE6A 1VCTA 3UUBA 3HR0A 4A5XA 3JCFA 4IDPA 2BS2A 2H7OA 2UXDT 2KXPB 3ZC1A 1M7KA 3LG7A 5AQSB 2LOSA 4EXTA 2OA5A 2D0TA 3CX6B 4B3ST 1XDPA 3L3PA 3PU8A 2BG9E 4FJOA 3KVBA 4O8SA 2LOPA 4ZHQE 2UUCT 4DR6T 4ISSA 2CLYB 2X0HA 4TZ4C 2YOEA 2VKHA 3RYHE 1MMAA 2AXDS 2E9XA 3KVAA 2LM2A 1U5PA 5JDHA 3NZPA 3UQ4A 2K9AA
chains in the Genus database with same CATH topology
4JI2T 4JI3T 4NXNT 4LF7T 4JI5T 1XNQT 4LFAT 4DV2T 4GKKT 3OTOT 1I94T 2VQET 4X62T 4LFCT 4LF5T 2UU9T 4DR5T 2UXCT 4DV0T 1J5ET 2HHHT 4JI8T 4JI4T 4B3MT 4JI7T 1N34T 4DV1T 1HR0T 2F4VT 4DUYT 4DV6T 4OX9T 4LF6T 1FJGT 5LMUT 4B3RT 1HNZT 1HNXT 1IBKT 2UUBT 4DV3T 4DV4T 4JYAT 4JI1T 4DR4T 1N32T 4X65T 3T1HT 2UXDT 4JI6T 4JV5T 4LF8T 4DR1T 4GKJT 4YY3T 4X66T 5BR8T 2E5LT 2UUAT 4B3ST 4LF9T 5IWAT 4JI0T 1HNWT 1N33T 4X64T 4B3TT 4DR2T 1XMOT 1XNRT 4LFBT 2UXBT 4LF4T 2UUCT 4DR6T 3T1YT 4AQYT 1IBLT 1N36T 4DR7T 4DUZT 4NXMT 4DV7T 4K0KT 4KHPT 5LMNT 4YHHT 4DR3T 1XMQT 1IBMT 2ZM6T 2VQFT 4DV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 T;  4JI3 T;  4NXN T;  4LF7 T;  4JI5 T;  1XNQ T;  4LFA T;  4DV2 T;  4GKK T;  3OTO T;  1I94 T;  2VQE T;  4X62 T;  4LFC T;  4LF5 T;  2UU9 T;  4DR5 T;  2UXC T;  4DV0 T;  1J5E T;  2HHH T;  4JI8 T;  4JI4 T;  4B3M T;  4JI7 T;  1N34 T;  4DV1 T;  1HR0 T;  2F4V T;  4DUY T;  4DV6 T;  4OX9 T;  4LF6 T;  1FJG T;  5LMU T;  4B3R T;  1HNZ T;  1HNX T;  1IBK T;  2UUB T;  4DV3 T;  4DV4 T;  4JYA T;  4JI1 T;  4DR4 T;  1N32 T;  4X65 T;  3T1H T;  2UXD T;  4JI6 T;  4JV5 T;  4LF8 T;  4DR1 T;  4GKJ T;  4YY3 T;  4X66 T;  5BR8 T;  2E5L T;  2UUA T;  4B3S T;  4LF9 T;  5IWA T;  4JI0 T;  1HNW T;  1N33 T;  4X64 T;  4B3T T;  4DR2 T;  1XMO T;  1XNR T;  4LFB T;  2UXB T;  4LF4 T;  2UUC T;  4DR6 T;  3T1Y T;  4AQY T;  1IBL T;  1N36 T;  4DR7 T;  4DUZ T;  4NXM T;  4DV7 T;  4K0K T;  4KHP T;  5LMN T;  4YHH T;  4DR3 T;  1XMQ T;  1IBM T;  2ZM6 T;  2VQF T;  4DV5 T; 
#chains in the Genus database with same CATH topology
 3Q2M A;  1MNE A;  5AQO B;  5LA6 E;  2CA5 A;  2E9X B;  4NXN T;  2XAQ B;  4MHC A;  3TLU A;  3PUW F;  2Q9Q D;  5L47 A;  4AKG A;  3UU3 A;  4PK5 A;  4NUU A;  2B76 A;  2NTY A;  3O1J A;  3QC9 A;  3ABV A;  4U2Y A;  5L3E B;  2W61 A;  3FZK B;  3MA9 A;  5CA1 E;  2HHH T;  5LP6 E;  2WMO A;  3RH3 A;  1MIV A;  3K1S A;  4H9N C;  3N9M A;  4J2C A;  5LBQ B;  5E0O A;  2X51 A;  2VKO A;  4DV4 T;  1E7P A;  2LLY A;  4I43 B;  1MIY A;  2PG8 A;  5DAB A;  3ZN1 B;  3AED A;  4UEM A;  2V5D A;  4Z8X A;  2HPJ A;  3N9O A;  5FXW A;  5ABG A;  3WI3 A;  1D0Y A;  1YQ4 A;  3QUJ A;  3QB5 K;  3MXZ A;  2FUP A;  3QB5 A;  5LGT B;  3N9L A;  2WCA A;  3ONX A;  3T1Y T;  3UQ7 A;  4GK0 E;  2XAJ B;  2V7L A;  1IJ5 A;  3CIR A;  3P4P A;  1D0X A;  3K3N A;  2YKS A;  1E1H B;  2EHO A;  4TWD A;  2XSA A;  2CXL A;  3B13 A;  3Q5D A;  3O9X A;  4U7I A;  2YN6 A;  4LF7 T;  2I59 A;  5LJM A;  4GKK T;  5LYJ E;  1YW0 A;  2BBJ A;  2EHO B;  5LGN B;  3PUY F;  5ABE A;  1D0Z A;  1CHU A;  5AQV B;  2CLY C;  3NVO A;  2LRK A;  1OED B;  4JI7 T;  3UU4 A;  1UGO A;  1QLB A;  3SFE A;  4QH1 A;  5FYM A;  3ZYM A;  3FBZ A;  2JRK A;  2UUB T;  4IE4 A;  2JQ9 A;  2KMF A;  3AEF A;  4JI6 T;  4YY3 T;  2ZM0 A;  2CWY A;  4MAL A;  2E9X C;  4WBN E;  3BK9 A;  2X68 A;  4YXD A;  3UU8 A;  2LKG A;  1FIO A;  1I6Z A;  3N2G E;  4TX5 A;  2BG9 B;  4U2Z A;  2V26 A;  2X9H A;  4KBM B;  2CBI A;  3AXJ B;  5DJQ C;  3HKC E;  4ZI3 D;  4PNI A;  5CA0 E;  4O2B E;  1WRD A;  2ACX A;  3ZST A;  4ZI3 C;  5CJ5 A;  3H37 A;  4N78 D;  1XWM A;  2CWO A;  5LMN T;  1HFA A;  2P9B A;  5IYZ E;  3FZL B;  1XMQ T;  1IAP A;  3K3O A;  4QHO A;  1SE7 A;  2JQQ A;  3IHR A;  3ZN0 B;  2IC6 A;  4ERR A;  3UUM A;  4AQG A;  1WCR A;  3PDY A;  3PUR A;  2XY8 B;  4IE6 A;  5LCY A;  1T7S A;  3U3I A;  2CCQ A;  4HTE A;  2SPC A;  2FJD A;  5JRC B;  2JIW A;  1J5E T;  3BQI A;  4LMJ A;  5FMN A;  2LSG A;  4ZS3 A;  3NRX A;  3KV5 A;  4YT0 A;  1US7 B;  4WYV A;  3UU5 A;  4Z91 A;  2LSJ A;  4NUV A;  1HTJ F;  4JYA T;  4IRE A;  4DR4 T;  1SUM B;  3M3Z B;  1WFD A;  2MBG A;  2YK0 A;  2QYW A;  3IEE A;  4OHF A;  5LJN A;  2VK9 A;  3PUG A;  5FY0 A;  3C50 A;  2EHO C;  4YSX A;  3CX7 B;  5AQG B;  4X64 T;  2YEV C;  4DR2 T;  5ABH A;  3RYF E;  1OED C;  5LG4 A;  4X20 E;  4JUY A;  4P0B A;  3OKQ A;  3P4Q A;  4X1K E;  5C3J A;  4AKL A;  2I6H A;  4FI5 A;  1NEK A;  2WS3 A;  5F5W A;  3AA6 B;  3EHZ A;  3OYX A;  3LFM A;  4E7Z A;  1IBM T;  2ZM6 T;  1KNZ A;  2ODU A;  5JDF A;  2BG9 C;  5FNV E;  4G2A A;  3FHN A;  3OJA A;  1I94 T;  4P1N A;  1VRB A;  3AB3 B;  4U72 A;  2KWI B;  4JI8 T;  4HWF A;  3FB2 A;  2BKO A;  3P4R A;  4WZX A;  4AQF A;  3AVR A;  3N5L A;  3CX8 B;  2WDV A;  3HKD E;  4GK5 E;  4DUY T;  4DV6 T;  1UUR A;  3A5X A;  2XQ4 A;  1HG5 A;  4X65 T;  2CHN A;  4ZZC A;  4TWH A;  5J1G A;  4HFV A;  2C5J A;  5HXR A;  5L3B B;  1WR0 A;  5AQH B;  3LK4 2;  3AEE A;  3AAA B;  4JI0 T;  3MKD A;  2D9D A;  4B6X A;  5FXX A;  1L0V A;  3PU3 A;  5JTG A;  4UIG A;  3PV0 F;  2IAK A;  4GOU A;  2WWV A;  5HEU A;  3RKO A;  2NW7 A;  4U74 A;  3A7M A;  2PJQ A;  2WY2 A;  3TLS A;  2C5K T;  3RRW A;  2WZI A;  4O4L E;  2A9U A;  1CUN A;  2WU5 A;  5LBM A;  1NWM X;  2BKP A;  4TN7 B;  3VRA A;  5HCJ A;  4I55 E;  2Q9Q A;  4QX7 B;  2XSB A;  3GMI A;  4H63 V;  5AQL B;  2CXD A;  5M4Y A;  4ILB A;  5F3J A;  4CXY A;  3B57 A;  3OTO T;  2LE8 A;  5HXE A;  4K0U A;  4GYS A;  2IIU A;  3RC8 A;  2A2F X;  1UX4 A;  3KDS E;  4IT4 A;  5HWY A;  4EGW A;  2HH7 A;  3T8O A;  2BBH A;  3PJA A;  4U3C A;  1OXZ A;  1ZOY A;  3AE5 A;  3NRY A;  4YSZ A;  2QRX A;  1HX8 A;  3ZEF B;  3N9P A;  1N32 T;  5LXT E;  3T1H T;  1UCU A;  4YTP A;  4GKJ T;  3ZC0 A;  2W66 A;  4X66 T;  1KF6 A;  4PJM A;  1KNR A;  5HXS A;  1VCS A;  4AI6 A;  2MOZ A;  3ANW A;  2BS3 A;  2HN1 A;  5AQF B;  1HG2 A;  2CRB A;  2RP4 A;  2KSR A;  2E5V A;  2X0L B;  1S35 A;  5KMG P;  4B3T T;  3RLF F;  2AE9 A;  1S94 A;  4LFB T;  1J5W A;  3VR9 A;  4PFO A;  3ANW B;  2E8I A;  1MIW A;  3N2K E;  5CB4 E;  1AJ3 A;  3PUZ F;  2NP9 A;  2XM2 A;  1Y01 A;  4NXM T;  4IDN A;  4DV7 T;  2X67 A;  4ZI2 C;  2W00 A;  4YJ3 E;  4ZEY A;  5AQU B;  5ETW A;  5KXJ A;  2D0U A;  2HPL A;  3VKG A;  3AE2 A;  2J1D G;  3AAE B;  2VKJ A;  3ETU A;  3KBT A;  3Q5X A;  3UUX B;  1V9D A;  3VKH A;  3N9Q A;  3ZT5 A;  1WR6 A;  2UU9 T;  5AQR B;  4HFI A;  4COF A;  5HEJ A;  2X66 A;  4GIW A;  5HXH A;  3Q5W A;  1QSD A;  2ZLY A;  4H9Q C;  3RIU A;  3P4W A;  2XAS B;  1W9R A;  2L9Q A;  1HNZ T;  4JEU B;  2J4G A;  4YTN A;  2FJA A;  2WZH A;  3VHL A;  4UV9 B;  4DO0 A;  4IST A;  2BKN A;  2W63 A;  4H9R C;  3LK2 B;  2DI4 A;  3FXD B;  4P09 A;  3PUV F;  2IC9 A;  3UU6 A;  3G06 A;  4AXP A;  3HKE E;  2LHR A;  4QWN B;  4A97 A;  4EZH A;  4ILU A;  1UK5 A;  2XTL A;  5TAO A;  3P8C D;  2K3W A;  3MZK B;  2NOX A;  1M62 A;  3JC6 C;  4HFH A;  2L3L A;  3L39 A;  5H6Q B;  4I0U A;  2Y48 B;  2IDO B;  4DV5 T;  3AEG A;  2IML A;  3RIF A;  4ZI7 E;  3Q5E A;  4BAY B;  2WMN A;  5A1L A;  4YFS A;  4YHJ A;  4X62 T;  1ZHC A;  4LF5 T;  3ZPO A;  3N2O A;  2YDS A;  4EED A;  2UXC T;  1KEY A;  2LEH A;  5JRE A;  3ZYL A;  4UV8 B;  1VOM A;  1HR0 T;  3AE7 A;  3C4Z A;  2Y8D A;  4ZOL E;  1HNX T;  1IBK T;  4X5T A;  3ONL C;  2MYS A;  5LB7 B;  5FVK A;  5DQW A;  2H89 A;  5FL0 A;  4ZZB A;  2XQ8 A;  4WW0 A;  2B1E A;  1E2A A;  4LF9 T;  1O3X A;  2V7M A;  2M67 A;  1XMO T;  2CPT A;  4YLH A;  2E9X D;  4HFB A;  2V5C A;  5LHH B;  2V7J A;  5EK4 A;  2XAG B;  1GQE A;  3RYI E;  3GN5 A;  1T72 A;  2QA7 A;  2CBJ A;  3AVS A;  4U33 A;  4PJL A;  4NIQ A;  4XAX B;  2XQY A;  2V6X A;  3EUH A;  5AQK B;  5DQV A;  2UXN B;  3GN5 B;  4DMV A;  4UVA B;  3UUN A;  3ZT7 A;  3L8R A;  3RIU C;  2DLR A;  5JDL A;  3S4U A;  2J47 A;  2N2N A;  4IGU A;  4WNK A;  1XDO A;  2NR4 A;  1WYB A;  3SWH A;  5L3C B;  3P7I A;  4TUY E;  1NEN A;  2KT9 A;  3CML A;  4YJ2 E;  4O2A E;  3RGL A;  4L0R A;  2LSI A;  1LRZ A;  3NZQ A;  2JMK A;  5L3G B;  4KMC A;  3N9N A;  4EEB A;  2LHN A;  3RI5 A;  1FMW A;  4KHZ F;  3AE9 A;  4M1P A;  2DHR A;  5JR9 A;  5JQG E;  3BQK A;  3CK6 A;  2BS4 A;  2G0U A;  4CXX A;  1B7T A;  3C64 A;  1HCI A;  5FXV A;  4DMW A;  5JR9 B;  5J2T E;  4GYR A;  4V1A v;  4AKI A;  4IE5 A;  4QH5 A;  3AA0 B;  2XPK A;  4XZC A;  4QXB B;  2X9X A;  2EHO D;  3FZF B;  5FY7 A;  3GA8 A;  3NWI A;  3DTO A;  4LML A;  3RQU A;  4I50 E;  2DCF A;  2V7K A;  2XZE A;  4A98 A;  3LBX A;  2V8S V;  4PK6 A;  2YU2 A;  1W0B A;  4TV8 E;  4PAG A;  5HYA A;  4OYJ A;  5HWX A;  3RYC E;  1Z0P A;  2VL0 A;  1MMD A;  4MBQ A;  5L3D B;  4X1I E;  2BVM A;  2YDR A;  3LK3 B;  2H3R A;  4E7S A;  1YKE B;  2KLQ A;  4QXH B;  2XHE B;  3OVU A;  5FXZ A;  3W15 B;  4CZZ B;  1YQ3 A;  3RKG A;  1IZN B;  5LMU T;  3JAD A;  2WBL A;  2N9D A;  3AA7 B;  4LF8 T;  3J9X 1;  4DR1 T;  4F8H A;  2JQK A;  4UXN B;  4MFR A;  4KI0 F;  5FL1 A;  2W67 A;  2CXF A;  5JDQ A;  2WU2 A;  3L09 A;  1HNW T;  4CXW A;  2CMR A;  4DND A;  2H7V C;  3FBL A;  2DWK A;  3B5M A;  4YSY A;  3TLV A;  4IDQ A;  4DID B;  5EZY E;  4AQY T;  1MMG A;  2WM9 A;  5AFU L;  3R6N A;  1HF8 A;  4IDO A;  2CM0 A;  4DUZ T;  3AA1 B;  1WLX A;  3EDV A;  3RHW A;  4QXC B;  3PUA A;  4H9P C;  5EK2 A;  3ZMS B;  1KK7 A;  1MMN A;  5AQT B;  4DVD A;  2WB5 A;  2DL1 A;  2L8K A;  5LOV E;  3ZKR A;  3AE4 A;  2XQ6 A;  2DNX A;  2XAF B;  5KDM C;  1LKX A;  5HEG A;  5JR9 C;  1LVK A;  2XUE A;  2XQ9 A;  4OK0 A;  1HX1 B;  4JBW F;  3GWH A;  1ZP0 A;  4PJN A;  3UFG A;  4HFD A;  4HWC A;  3WAJ A;  4OX9 T;  4H9O C;  2CHO A;  2YIN A;  3CQG B;  4DV3 T;  2Q9Q B;  1D1C A;  3ZT6 A;  3AAI A;  3PJA J;  4TV9 E;  3UTK A;  5BR8 T;  2W0G A;  4C91 A;  2GK9 A;  5IWA T;  3OPC A;  1BR4 A;  3DJB A;  5HCM A;  2BZB A;  3V5S A;  3Q9D A;  2V6Y A;  4OFZ A;  2YU1 A;  4HE8 A;  4OYK A;  2JMH A;  2LM9 A;  3F2E A;  1IBL T;  1D1A A;  2K48 A;  4I4T E;  5HEO A;  1Y64 B;  3ZSS A;  1UX5 A;  2MAW A;  4EYU A;  4C90 A;  1BR0 A;  2IHR 1;  4YHH T;  5L4E A;  4EV6 A;  4AKR B;  1X9B A;  4KX6 A;  4ILA A;  2MTQ A;  4AKH A;  1IJ6 A;  3H3A A;  3KFW X;  4O4J E;  4ADZ A;  4ZI2 D;  3R84 B;  4KUM B;  3MJX A;  2IW5 B;  3VRB A;  2VVS A;  3AEB A;  1HS7 A;  2ODV A;  4U7Y A;  4AQF C;  2M6I A;  4CN6 A;  4DV0 T;  4L9I A;  5GON E;  3FZH B;  1G8X A;  5JH7 E;  4CI3 B;  3V5U A;  2JJ9 A;  2F4V T;  4UEL A;  1W09 A;  3D0T A;  3K3Q C;  4O4H E;  2H88 A;  1XZY A;  3CWZ B;  3RRC A;  2BVL A;  1ZEE A;  2C0S A;  3EVY A;  3ZMU B;  5L2L A;  4TWF A;  2KWH A;  2WDQ A;  3PUX F;  2LJL A;  3ZJ2 A;  3UUL A;  1U4Q A;  5CFB A;  3SRZ A;  2XJ7 A;  3MAC A;  5HAX A;  2WAU A;  2D5U A;  2CEA A;  1XNR T;  1WYC A;  2WDR A;  4ZS2 A;  1LVF A;  3HI2 A;  2N1G A;  3NBX X;  2J62 A;  2LRL A;  3CQX C;  4EZ4 A;  5KX5 E;  3UFE A;  3JAF A;  2W62 A;  1D1B A;  3PTR B;  4IDZ A;  4TNW A;  2Q9Q C;  2MPK A;  2VL8 A;  4HWI B;  3J7Y q;  5J0Z A;  5LHG B;  4DR3 T;  3EI0 A;  3CKD A;  2OV9 A;  4UR9 A;  3HL6 A;  4JI2 T;  2PTF A;  2V7I A;  5LGU B;  2VQE T;  3JC6 D;  4G63 A;  3AE1 A;  4AIS A;  2C5I T;  1FEW A;  2ZM2 A;  2VKD A;  3HKB E;  3E22 E;  4HFC A;  3TLT A;  3QNU A;  2I0M A;  2ES0 A;  2VUR A;  4EOZ B;  1N34 T;  1EZ3 A;  4UVB B;  2FJE A;  5EK3 A;  3ZCJ A;  2LKH A;  2WSS V;  5ABF A;  3RQW A;  2Z6E A;  3C4X A;  1G73 A;  3ZJ1 A;  2OLT A;  2R6G F;  5LNK A;  1YKH B;  4HWD A;  3PUS A;  5ABF B;  1UUS A;  4ZXL A;  4X1Y E;  4EYY R;  2JQH A;  2WP9 A;  1BR2 A;  2X9Y A;  4U31 A;  4HFE A;  1N36 T;  1OED A;  2PFV A;  4CI2 B;  5CGM A;  4K0K T;  4QX8 B;  4QKN A;  1YXR A;  3KBU A;  3KV6 A;  4JLE A;  4Z90 A;  3RIA A;  4CQI A;  5JDN A;  2RPA A;  3A8Y C;  3HA4 A;  3ZMV B;  3AEA A;  4H9S E;  4DV2 T;  4QH4 A;  4MLK A;  2KIN B;  2WQY A;  2DWG A;  2BG9 A;  5JDM A;  3I0Q A;  3ZMZ B;  3AXJ A;  4BJM A;  2PBI A;  2NW9 A;  3IBP A;  4CN1 A;  4B3M T;  3FZM B;  5AQP B;  2XM1 A;  4PJJ A;  4B3R T;  4IHJ E;  3EAM A;  3SS1 A;  4UF0 A;  4L5G A;  2IUB A;  2KZ7 B;  1JNZ A;  4IE7 A;  3F31 A;  3PE0 A;  4YTM A;  2VAS A;  5AQJ B;  1MND A;  2W4X A;  3EDU A;  3EAB A;  5IUX A;  4UF0 B;  1ZKE A;  5BMV E;  2HN2 A;  1N33 T;  4BA9 A;  2D2S A;  5JVD E;  1W0A A;  5L3F B;  1ZV4 X;  2ZM8 A;  3H3M A;  4UVC B;  1KFY A;  4CN4 A;  5JRC A;  4HKA A;  4HN9 A;  2XQ7 A;  4F6R C;  3AE3 A;  3IA3 A;  3SFD A;  2YDQ A;  1OWA A;  5HEH A;  1BR1 A;  2VVN A;  5HXC A;  5AQQ B;  4P0A A;  1H7C A;  4H63 H;  2W2U A;  5FKY A;  3C51 A;  4PW8 A;  2BDE A;  4IL9 A;  1XNQ T;  4LFA T;  3QK6 A;  4EB6 E;  4XBF B;  4AIU A;  2QGS A;  1NAF A;  3SOL A;  2XQ5 A;  3I0O A;  2VWA A;  5F8P A;  3PUQ A;  2NTX A;  4HGA A;  2VB6 A;  5AQN B;  2JPF A;  3C4W A;  3M65 A;  4LF6 T;  3AEC A;  3LBX B;  1FJG T;  2UXX B;  1Z8U A;  4HWH A;  4ASK A;  2QVA A;  3DP7 A;  5C8Y E;  2WWU A;  4JV5 T;  1QUU A;  5JDG A;  3RX6 A;  2ZMA A;  5H6R B;  3JAE A;  3VU7 H;  1J1J A;  3C98 B;  3RPU A;  3KV4 A;  2LSK A;  1T98 A;  4JEH B;  4WBO A;  4O4I E;  3ZMT B;  2XQ3 A;  4IL4 A;  2LSY A;  2CE7 A;  3ESL A;  4KP3 C;  2XAH B;  2NW8 A;  2UXB T;  3I9Y A;  3P50 A;  3K8P C;  1SA0 E;  4TNV A;  3FXE B;  4DBQ A;  4IIJ E;  3O1I A;  3LDQ B;  2ACZ A;  5C2T A;  3KIN B;  5LG3 A;  1DU2 A;  4BJN A;  3RF1 A;  1YD8 G;  4IE0 A;  4ILC A;  4ANJ A;  3LSV A;  3CQC B;  3NKZ A;  4JI5 T;  3I9W A;  3VR8 A;  1JNR A;  5L4H A;  3O4X E;  5ADX L;  4LFC T;  2K24 A;  2FBW A;  1R8I A;  5LHI B;  1X79 A;  2RA1 A;  3MK7 C;  2NWB A;  5FP3 A;  3IF8 B;  4JI4 T;  2M6B A;  3ZLI A;  3OYZ A;  4DV1 T;  3F57 A;  3UT5 E;  4HEA A;  2KND A;  2K5B B;  3CVR A;  4EIW A;  3CPZ A;  2LT3 A;  4JI1 T;  2Y6X A;  3E08 A;  2E5L T;  3U78 A;  2UUA T;  3QOF A;  3OBV E;  3AE8 A;  3O1H A;  3ZCI A;  5FVL A;  3ONJ A;  2V1D B;  4LF4 T;  3I1A A;  2A72 A;  3P4S A;  3KV9 A;  1SHZ C;  1T8B A;  3E0Z A;  4A56 A;  4DR7 T;  2E2A A;  4DBR A;  4KHP T;  5FY1 A;  3BQL A;  2FJB A;  3TKL B;  3TLW A;  4LMK A;  2VQF T;  3LJC A;  3ZYK A;  5AQI B;  2X9W A;  2A3D A;  4JI3 T;  3X1D A;  2V6Y B;  2X0Y A;  4PK4 A;  4Q25 A;  2XQA A;  5IHY A;  1FMV A;  5AQM B;  4NPP A;  3WAK A;  1KNP A;  4DR5 T;  4EAH A;  3RC3 A;  3ETV A;  4PFP A;  4CI1 B;  5J2U E;  1OED E;  3AE6 A;  1VCT A;  3UUB A;  3HR0 A;  4A5X A;  3JCF A;  4IDP A;  2BS2 A;  2H7O A;  2UXD T;  2KXP B;  3ZC1 A;  1M7K A;  3LG7 A;  5AQS B;  2LOS A;  4EXT A;  2OA5 A;  2D0T A;  3CX6 B;  4B3S T;  1XDP A;  3L3P A;  3PU8 A;  2BG9 E;  4FJO A;  3KVB A;  4O8S A;  2LOP A;  4ZHQ E;  2UUC T;  4DR6 T;  4ISS A;  2CLY B;  2X0H A;  4TZ4 C;  2YOE A;  2VKH A;  3RYH E;  1MMA A;  2AXD S;  2E9X A;  3KVA A;  2LM2 A;  1U5P A;  5JDH A;  3NZP A;  3UQ4 A;  2K9A A; 
#chains in the Genus database with same CATH homology
 4JI2 T;  4JI3 T;  4NXN T;  4LF7 T;  4JI5 T;  1XNQ T;  4LFA T;  4DV2 T;  4GKK T;  3OTO T;  1I94 T;  2VQE T;  4X62 T;  4LFC T;  4LF5 T;  2UU9 T;  4DR5 T;  2UXC T;  4DV0 T;  1J5E T;  2HHH T;  4JI8 T;  4JI4 T;  4B3M T;  4JI7 T;  1N34 T;  4DV1 T;  1HR0 T;  2F4V T;  4DUY T;  4DV6 T;  4OX9 T;  4LF6 T;  1FJG T;  5LMU T;  4B3R T;  1HNZ T;  1HNX T;  1IBK T;  2UUB T;  4DV3 T;  4DV4 T;  4JYA T;  4JI1 T;  4DR4 T;  1N32 T;  4X65 T;  3T1H T;  2UXD T;  4JI6 T;  4JV5 T;  4LF8 T;  4DR1 T;  4GKJ T;  4YY3 T;  4X66 T;  5BR8 T;  2E5L T;  2UUA T;  4B3S T;  4LF9 T;  5IWA T;  4JI0 T;  1HNW T;  1N33 T;  4X64 T;  4B3T T;  4DR2 T;  1XMO T;  1XNR T;  4LFB T;  2UXB T;  4LF4 T;  2UUC T;  4DR6 T;  3T1Y T;  4AQY T;  1IBL T;  1N36 T;  4DR7 T;  4DUZ T;  4NXM T;  4DV7 T;  4K0K T;  4KHP T;  5LMN T;  4YHH T;  4DR3 T;  1XMQ T;  1IBM T;  2ZM6 T;  2VQF T;  4DV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...