1XNAA

Nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
151
structure length
151
Chain Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the single-strand break repair protein XRCC1 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords PROTEIN (DNA-REPAIR PROTEIN XRCC1)
total genus 19
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xnaA00
2YC2A 4JKLA 4CUCA 5IYYA 4JX0A 3C7HA 3IAQA 1NUKA 2RVAA 3A7QA 4PQQA 1DLCA 1CZTA 5J1XA 2EIEA 4XVHA 3OG2A 4ARXA 1NKGA 4CU6A 4OUEA 1UMIA 2R7EB 1OH4A 4AG4A 2DCKA 1JI6A 2W1WA 2YG0A 1W9WA 1SG3A 2E26A 1L7QA 2LW8A 3WNKA 1K45A 3MUZ1 4UOJA 3MV01 4OZOA 5B4XA 4GWJA 2J1TA 3WF2A 2ZEWA 4W8JA 2WN3A 5C70A 1ULPA 3I2IA 5B4NA 2VCCA 5LA0A 2W91A 1F4HA 4UI9L 3A22A 3ACHA 2J1EA 3OBAA 2W94A 2BGOA 3I3DA 3C8XA 2ID4A 2J1AA 5FUIA 4DEQA 2Y6GA 2BBAA 4DXSA 3FL7A 2WZ8A 2VM9A 4KI5M 4DUVA 1US3A 3OGSA 1JZ2A 4ZXEA 3UETA 4MGQA 4LQRA 2VL4A 2VMFA 4QDSA 3FN9A 2VMEA 4BJ0A 1JYXA 1TVGA 3SEEA 4OMDA 2L9LA 1P8JA 2J7MA 2W5FA 4PF1A 4E8CA 3LEKA 2QQNA 2W9XA 5LCWL 3CMGA 2JD9A 2BERA 1UXXX 1EUTA 4QB2A 1CIYA 3GXUA 3VDAA 4P08A 3A23A 5IHRA 1JZ6A 2QQOA 2YFZA 4BDVB 4A45A 4A4AA 1RYYA 2CDOA 2ZEXA 5A1AA 2VOTA 1DYOA 2V4VA 5DQ0A 2HYXA 3I2JA 1OF4A 2W92A 1F4AA 1EUUA 1TG7A 1JYWA 2OKXA 1GNYA 1UZ0A 4A41A 1XNAA 4DXRA 2VTFA 2HLEA 3NQHA 3I2GA 2QBXA 2PQSA 2WDBA 5JR2A 1UMHA 2Y6KA 3ABZA 4XUQA 1PMHX 4XZUG 3HEIA 3WSOA 2ZEYA 5LA2A 4GZ9A 2VZTA 2QQKA 1UYZA 1H6YA 5JXGA 3WEZA 1UYYA 2WUHA 2BZDA 4QPWA 2VR4A 2B4KA 1CZVA 1YQ2A 3GDBA 4QX3A 4AAXA 4DUWA 3W5MA 4FI9A 4MADA 4QB1A 2J22A 2VQUA 1GOHA 4BK4A 3C7FA 3NJXA 3P1IA 2ORXA 1GUIA 1KEXA 3C7GA 4ZY9A 2YFUA 3VD4A 1DP0A 3PUHA 3PUIA 4HG6B 1UY2A 2WO1A 4A3ZA 2DCJA 4CUAA 3GGLA 1JU3A 1K42A 3BN6A 1UX7A 3FHQA 1GOGA 3FHAA 3NNGA 3C7EA 1LNSA 1KGYA 1ULOA 5I0DA 5HPOA 4MOAA 3U37A 1GU3A 1NAEA 1GQPA 3SKVA 3HNMA 1OT5A 4XUOA 3OEBA 2C4XA 1W0NA 3SKJE 1PMJX 1JHJA 2VJXA 4XUPA 3WNMA 2XHNA 1US2A 3VD9A 3CQOA 4LHSA 1O8SA 1O8PA 3WF4A 2WABA 3WQBA 2WZEA 2C26A 1XNTA 4CUBA 3LEGA 1SDDB 2JKXA 3VD7A 1UWWA 2LS6A 4IUGA 3OB8A 4JHZA 4TTGA 3K77A 3OEAA 3WF3A 1UY4A 2ZEZA 3LPGA 3JXSA 3E1F1 4KWUA 2VZSA 5JXJA 1JYNA 4P00B 2RJ2A 5G05L 3LQCA 3UESA 2X09A 1PX4A 4DXTA 4E8DA 2QQMA 1HN1A 1JYVA 4D0QA 2WO3A 3P6BA 5DN2A 2EICA 1D7PM 4GWIA 1JZ8A 3HJRA 4MO3M 2Y6HA 2WYSA 3THCA 2JE8A 3THDA 1UY1A 3OGVA 1GOFA 3W5NA 5F7UA 2JDAA 3DYMA 2W1UA 4JKMA 3D3AA 3A21A 1UY3A 4KMQA 1UYXA 3F2ZA 2VCAA 5C71A 2QQLA 2WAAA 1IQDC 3DYOA 3DYPA 3LPFA 4M4PA 2Z4FA 1XC6A 2J1SA 5CZKA 3ZM8A 4P5YA 2W3JA 3WNOA 2BGPA 2VZVA 2VZ3A 3NJVA 1JU4A 5HXMA 4BK5A 2EIBA 2QQIA 2VQTA 2WN2A 2VO5A 2ZXQA 3T2PA 2W47A 3HOBA 2VZRA 3T0AA 2E32A 2W1QA 2WAOA 4A6OA 4M4RA 3NRUA 1JZ5A 3IIIA 3WNLA 3ETPA 4QDQA 5G04L 4ZZ8A 5JUVA 3BGAA 4OYUA 3K4ZA 3VDBA 3I2KA 5JXHA 3WNNA 2VZQA 2Y8KA 3I2HA 3I2FA 2RV9A 2VZUA 3MBWA 1BHGA 1UXZA 1UY0A 2E31A 4CU8A 5EJ1B 3WF0A 4XURA 5IFPA 3EB7A 1NX9A 3WF1A 1K3IA 2V5DA 1W9TA 4DEVA 1SHWB 1T2XA 2VZOA 3IB3A 3T0BA 2V72A 2VCBA 3ACGA 5DPNA 1XPWA 1JZ3A 3ACIA 3UNPA 3J7HA 5C7GA 3T0DA 2Y64A 4YPJA 3VD3A 4ZZ5A 3T08A 2X10A 2W46A 1MPXA 2J1RA 2J1VA 2VMDA 5IJRA 1OF3A 3I3BA 1J84A 5EJZB 2QQJA 1PX3A 2ORZA 2Y6JA 4W4ZA 2XQXA 2J1UA 4QX2A 3VDCA 2XONA 4P02B 3MUY1 3T09A 3CZJA 3SEPA 2WO2A 3K75B 2WQ8A 3EYPA 4QX1A 1R64A 1O59A 5EIYB 3LE0A 3GM8A 1H6XA 1J83A 1W8NA 2Y6LA 2VC9A 3IDAA 2VZ1A 4A42A 2YC4A 4PT6A 3HPNA 4W50A 3K4AA 4QAWA 3DECA 3CKHA 3AC0A 1WCQA 4UAPA 4D8MA 1W8OA 1WKYA 2DDUA 5CYYA 4QB6A 4OMCA 4JKKA 2XOMA 4DUXA 3MO4A 2VMCA 4A44A 4QDRA 1JZ7A 2E33A 4LKSA 4Z2AA 4QX0A 3ECQA 2X05A 5JXIA 3VD5A 1W99A 3C7OA 4CU7A 3CDZB 5DMYA 3OGRA 2B9VA 4RN5A 1K12A 2YB7A 2VZPA 3K46A 4CVUA 4RYDA 3WNPA 1I5PA 3HNBM 3MV11 2W1SA 4L0PA 3HN3A 4LPLA 3IAPA 5IFTA 3I3EA 5JMOA 4ET7A 3CIHA 3HNYM 3T2QA 2C9KA 1W9SA 3I97A 3LEIA 1CX1A 4CU9A 1JZ4A 1OD3A 2W87A 4BXSV 2EIDA 3T2OA 3K4DA 2W95A 4XUTA 4MGSA 4ARYA 1CZSA 4TXWA 5LA1A 2CDPA 3ACFA 4XUNA 2WBKA 2KD7A 1GMMA 3CZUA 1L7RA
chains in the Genus database with same CATH superfamily
2D6PA 2SBAA 1XNBA 1AXKA 5I0SA 3IAQA 2VUAA 1DLCA 1CZTA 3LZZA 4KGGA 1G6NA 1O7FA 2A73B 2ZGRA 4YNIA 5LK5A 5AVPA 1F2NA 2EIGA 3ZMNA 2AEZA 4ARXA 4CU6A 4ZONA 3C3VA 5JWPA 4AVAA 5BNPC 5FPBA 4P9WA 4WV8A 1XE0A 4XJ9A 5FOJB 4JGYA 1YWKA 1OH4A 4AG4A 2VVDA 5FPXA 4BHPA 3AYAA 2YV8A 3J7LA 1OKOA 2W2IA 3CU7A 1W9WA 3KCXA 3H7YA 1NG0A 2KA3A 1OA3A 3B94A 3O1OA 1ZA7A 3I4IA 3MUZ1 3H50A 4UOJA 5LBFA 4TLFA 1XU1A 3FHIB 4QX7A 4IL7A 3VKLA 4R4XA 4XYXA 3SMHA 2FDIA 2RDRA 4EZHA 2BP6A 2RE9A 1PGW1 1YO8A 2HWF1 4FVVA 4IEVA 4AI9A 5LW9A 4IV1C 5FQ0A 1POV1 1Q43A 4YGDA 3AZVA 3E6CC 5A3NA 2WQ4A 5BXXA 4WM7A 2JECA 3FUOA 2OA2A 2CGOA 5L7OB 4UFKA 1YHFA 1VMJA 5F6KA 2W91A 5TSWA 4LITA 1PGL2 1TNFA 5GZFA 5CFCC 1F4HA 1G8WA 3SITA 4KU8A 3BOPA 4LO8A 1DQ0A 2J1EA 5FP3A 3FLRA 1SPPB 2QCSB 3I3DA 5IW0A 2WZR2 2ID4A 3MIBA 4YGBA 5I8YA 1W39A 3ZYIB 2A3WA 3U0ZA 4JDNA 5KWRA 4AHWA 1OVSA 2OS2A 4IE0A 1LU1A 2E9QA 4KI5M 3S7EA 1IGOA 2WC2A 3POIA 3OGSA 4FOQA 4TWTA 4ZXEA 4S2GA 3MF6A 4K1YA 5ABJC 3OBRA 1MEC2 3Q8AA 2R041 4YFWA 1HKDA 2VMFA 1FI2A 3ILNA 4EN0A 2VMEA 2WS91 5DAWA 1EV11 3O1PA 4OCTA 1PIV3 4DPNA 4FQ4A 1GANA 1MZFA 1TVGA 3SEEA 1VRH1 5GLZA 1PNFA 4PF1A 1IHMA 4V2WA 3ZN4A 3LEKA 4BQXA 5L73A 1WCKA 1X50A 3DL3A 1RHI3 4HK8A 2JD9A 3U14A 3V0BA 5DDJ1 3ETQA 3N9PA 1EUTA 4LO5B 3UV9A 3NWKA 1TZOA 1D4M2 1QY4A 1AL0G 1VBA2 3GALA 3GXUA 3CL1A 4FPGA 4LLFA 3A23A 2HWE3 1QJEA 5FYYA 4AGGA 5IHRA 1FXZA 3FLPA 5C4WB 1C8NA 3AKPA 1H1AA 2VVFA 2VOTA 2H6BA 1GZTA 2WA4A 1CQ9A 4I02A 4J1XA 4MX3A 4N8MA 1A3KA 3AXDA 1ONAA 4XF3A 3WP5A 3WT3A 3MICA 4CDWA 4GKYA 4AE2A 2RS11 1Z7S3 1WZXA 1CJDA 4MZUA 3ROUA 4WVVA 3AVSA 3O7OA 4XMIA 1ND3A 2PAEA 5JDBA 1AR82 3AFGA 1VAVA 1ODMA 1F4AA 4XQ4A 5IVJA 4AR2A 2OKXA 4YYOA 3UKNA 2O1QA 1QMJA 1GNYA 3V0AB 4B1LA 4YVSA 1N1YA 3S5AA 2AENA 2FQPA 2JB8A 2NZ9A 1OUXA 1DZTA 4XBLA 2VTFA 4FPHA 2HLEA 2O14A 4UFLA 1W28A 3TEWA 4Q4W3 5CKMA 4EV0A 1VRH3 4MG2A 1QJY3 2QBXA 2PQSA 2R6QA 3POFA 5JR2A 3ABZA 4XUQA 2PLV1 1PMHX 2A75A 3OF1A 3WSOA 5CADA 1X8EA 5LA2A 2A71A 2YROA 4GZ9A 2VZTA 3HBZA 3U10A 2WSVA 2Q8CA 4Y4YA 2PHWA 2GN7A 4S2DA 1FPN2 2Y33A 2WUHA 1RC6A 4IERA 3GDBA 5F3EA 1JMUB 4LIVA 4DUWA 4Z8BA 3LCPA 4FI9A 2VNGA 4U36A 2QDNA 2VQUA 2Z69A 2D6OX 1UPIA 3VGIA 4YARA 3V0BB 5DAQA 4ORFA 4XC9A 3S5QA 2CTVA 2Y6FA 5CKNA 5F37A 1W9YA 4RSUA 2IVJA 2GN3A 3C7GA 4LNVA 5A3TA 1BVP1 4GB32 3VD4A 4W6WA 1LCLA 3UJOA 1RUC1 2XUMA 3IM0A 2ZX2A 4FPOB 1AR71 2QVSB 3O0WA 1VRBA 2UU8A 3R05A 3IT8A 4N53A 3PURA 2JDUA 4N43B 4O65A 3ZFEB 4D6QA 2HWF3 4R52A 3ZFEC 1UX7A 1SFPA 3UT0A 1VBD1 2Q1ZB 1C3HA 1GOGA 1WMEA 2XJQA 1NOVA 4JZRA 4FTEA 2WT0A 2ZTNA 4QU1A 3C7EA 3H0OA 3LOIA 1Q5OA 1ZBE1 2XGXA 2YPDA 3DPRA 4HN0A 4NJ4A 5T54A 3KV6A 1LNSA 1ULOA 3WX5A 3PTRB 3KCYA 3O5SA 1PGW2 4ZS3A 2EXKA 3ZDSA 3H8OA 1RMU2 4J1WA 3DV8A 4V1PA 3AMPA 5A70A 1RUH1 1GU3A 1NAEA 3USUA 5I0TA 4IEQA 4FTSA 5CFCA 2P2KA 5EWSA 5FMBA 3SKVA 3PVOA 4XUOA 3PJYA 1H1IA 3Q8FA 3OBTA 4ASMB 1QQP3 3R4SA 4QPGA 2C4XA 1W0NA 1VE0A 3WNMA 2BEOA 2HEVF 2FD8A 1BMV2 2VOVA 2XH6A 1US2A 2XHNA 4B7KA 1LHOA 5A7NA 3CQOA 3HQUA 3I3MA 3PL0A 1F31A 5ERLA 3ZSJA 2DUPA 4LJHA 4RQPB 5F9TA 3WQBA 2D7FA 2WZEA 1BLZA 3QD6A 4UYBA 3T30A 4Y1ZA 1OFNA 1VALA 4QXCA 3LEGA 1SDDB 1SQ4A 4BOWA 2HEWF 1U5XA 5CEHA 5D2AA 1PK6C 2D5HA 3VD7A 2LS6A 4K1ZA 4R9DA 1DBNA 2ZGMA 4TTGA 2IWGB 3OEAA 2ZEZA 4AYUA 5C6CA 3JXSA 4LKEA 5FPZA 3AMMA 1HRV1 4XABA 3O1VA 4C1WA 4EZ4A 4LK6A 2VZSA 4H2AA 1IG0A 2BW8A 2RS33 2P17A 3N7KA 5J09A 3MLJA 3O1SA 3LIHA 2VQ0A 4B4PA 1LU2A 5LATA 3UESA 3RZLA 4DZGA 1I3HA 4K8FA 3QH6A 5A6QA 5FR3A 2X5IC 3VB9A 5EPAA 3A0NA 1S0GA 2WO3A 3P6BA 5ABJB 4JTNA 5C9AB 1GP5A 2FHRA 4AI2A 5A33A 3WG2A 2QUOA 1JZ8A 2FDHA 1C57A 1IS3A 3VZKA 3PIJA 4AFBA 3THCA 1AR83 4GQ7A 3WDTA 1UY1A 3ZFGB 1CWPA 3AP5A 2LTNA 4WM8C 2BUKA 2XDVA 5DG1A 3ZVXA 1C1LA 2XJUA 4XETA 5FZBA 2JG9A 4D6SA 4J25A 4CTEA 1RUD2 3BTYA 3EO6A 2XVLA 1W2OA 1NY72 2ZABA 2G9ZA 2YGMA 4BA6A 2RJLA 1MZ6A 3H1WA 2G1MA 4EE2A 4Y5Z0 5L7OC 5EYXA 1UU4A 1KXGA 1J3RA 1UYXA 2YPJA 3M7AA 4KMQA 4XDPA 1VPHA 2EXJA 3VBUB 3VV1A 2H0VA 5C71A 4UBGA 5IVEA 2XLGA 3DYOA 5C3QA 3JCIA 1QIQA 4RR3A 3RZGA 2Z4FA 5CZKA 2EALA 4LBOA 4O9GA 1L7LA 4H7MA 1NE6A 1UOGA 1X33A 2VZ3A 4RHV1 3FFZA 4XZPA 4BK5A 4NE9A 4Q4X3 2VQTA 2ZGOA 3MLLA 4YM0A 1ACCA 2ZXQA 2H6CA 2W47A 5GLWA 1MS5A 3VBOC 1RUG3 2VZRA 2WA3A 4QKBA 1O3SA 5E8AA 2CNAA 4AQ6A 2CV6A 5JSOA 2ARXA 2E32A 4OULA 2W1QA 2ZMKA 3SH3A 2F4LA 1YIFA 4HKOA 1VAMA 4N53B 1H2KA 5JSPA 3N9MA 4A6OA 4FPFA 4LBMA 2HWC1 4GJZA 1ASJ2 4M4RA 5A80A 4AVSA 4B4RA 2OZJA 2AYHA 2DURA 1KS4A 2WJSA 4Y26A 3RQ0A 1DQ6A 3IIIA 3WNLA 4E4ZA 5FY5A 4Z2WA 5DDJ2 4OLLA 4NRQA 1G9AA 3J8F1 1MR5A 4ZZ8A 5JUVA 3BGAA 4XIKA 1X8MA 5T55A 2A3YA 4MUVA 1XSRA 4YZ3A 1VJ2A 4AK3A 1LULA 3UGHA 3SCFA 1WA4A 3VDBA 3IWZA 5I91A 3FFQA 5FLIA 4HKWA 5FZCA 3I2FA 4MGKE 1WCDJ 4QQLA 2Z5WA 3NSTA 4G3YC 4KG8A 1BHGA 1UXZA 2QQVA 4A7KA 3RPQA 4OQ8A 1JYTA 4CU8A 1Y43B 4IV3C 3U4XA 5FZEA 3CJIB 3N7MA 1LR5A 2ZGUA 5IFPA 5F3IA 3WF1A 1IPSA 1K3IA 1IZ3A 4Y5TA 1YJLA 2PN5A 1H8VA 1OA4A 4IEXA 4DINB 1DYPA 4WVWA 3NO8A 3VHNA 4A7ZA 3CJIC 2VCBA 5DPNA 3VLBB 2YZ4A 1MQTB 3AYDA 1AR72 1XPWA 4CP9B 3ACIA 4QWNA 3B69A 2JDHA 3AM2A 5C7GA 5E88A 3J26N 3PIGA 2WNVA 2WS92 3LA2A 3DPRB 4Q0VA 3WDXA 1XNDA 4YZ1A 1S2KA 2X10A 1UKGA 2W46A 2ZOEB 4ES8A 3U4SA 2GP5A 2J1RA 4LA3A 1A6CA 5IJRA 5C3SA 2YDEA 1ZYBA 5E16A 5D1IA 1J84A 2ZZQA 4YWAA 4K6BA 3ZYHA 4N7UA 5JZGB 3VBHC 3IMMA 4NAOA 1VBB1 4DMIA 5T52A 3KQRA 2GH2A 2R073 1PO13 4AVCA 1E5SA 4P02B 1K5MA 2R1BA 3ZR5A 1HN0A 3UGFA 4FAHA 2BOJA 4AEMA 1NA1A 1IPJA 5L9BA 1A78A 1W6MA 5EFUA 2PYTA 4BM8A 2ZMLA 2VVEA 2WO2A 3ZYJB 1H8TA 3AL5A 2WQ8A 1SACA 4GMP1 3LE0A 3J7NA 4KWKA 4OUMA 5LZ6A 4KWLA 4CDXC 4GD4A 5FY9A 2WWUA 4Y1YA 4QXBA 1AR73 4IGPA 5EP9A 3V65A 3KV5A 3ZSEA 3ZXLA 4CDQB 3TEZA 2ZPXA 5FY0A 3IMNA 2I07B 4PJYA 4PT6A 5SV8A 4W50A 2CYFA 2YBPA 4QAWA 3VBSA 4NIGA 1QOSA 1AL23 5GZGA 1WCQA 3ZSLA 4D8MA 4K3UA 1CPNA 4LO4B 3S0MA 5APAA 1V6MA 3E5XA 5FUPA 1C28A 1WD3A 5K4LA 5HV0A 2XVKA 2RS32 3WR0A 4DUXA 4DY3A 5JCTA 4GMP3 2E7AA 4KL1A 4LKSA 1PZ9A 3ZFGC 3LGRA 3VD5A 1FAYA 5FOBB 3C7OA 3U11A 4QMAA 1HRI1 3CDZB 2ENRA 3T1MA 1XXNA 3HAGA 5FZIA 5FQ0B 3OUJA 4RS5C 3ZYRA 2VXRA 3GCXA 1ND3B 1PO11 4X6RB 3AYCA 3JD73 3TRSB 3K46A 4LE3A 4OHVA 3BIWE 4CVUA 1R083 4LMFA 5M0TA 1LGNA 1UZYA 4RYDA 3BOWA 1V6KA 3I59B 3WG1A 3VBFB 4FFGA 1DQ1A 3LF7A 1O5UA 1KS5A 5FZLA 3DGTA 5FMOS 2NN8A 2W1SA 2ZGQA 3MEPA 2ARBA 4P9GA 4XHBA 3ZXEA 1BYHA 3JZVA 2XBO3 3L2HA 1SZBA 2UWCA 5FZKA 4JGYB 3WVJA 5IFTA 5L36A 4JQRA 2RS13 1I9RA 3I3EA 4H55A 3VBRC 1WLWA 3IKWA 1NA1B 4WM7C 1YRZA 1TME3 3AZZA 4AAPA 4WZFA 1W6NA 1NT0A 3VUOA 2B5HA 3ZO0B 3N35A 4BXSV 4WM8B 3AZWA 1DGWA 2GZWA 1AL22 1G86A 1S1AA 1OXCA 2D44A 3ZSMA 2R1DA 3RZZA 4EYUA 4MGSA 2IUWA 1YFUA 4HSLA 4DXSA 5KXCA 3VN4A 4ASKA 5LA1A 2QKDA 2O8QA 4AEDC 5A7QA 3SNMA 2R0FA 4COYA 1RINA 1VB2A 2CDPA 4D7YA 3MW3A 4EJRA 2EXHA 3GF6A 3ACFA 4FOYA 5FP8A 4BQ5A 2WBKA 3N9LA 2KD7A 2XKOA 3ON7A 3LEMA 3CZUA 2BBVA 5I0RA 2YC2A 3C7HA 1NUKA 2RVAA 2DCTA 3A7QA 3GJBA 2QJVA 3VBRB 3DUIA 4QM8A 4LR4A 1G9CA 1TNRA 4K8RB 4PIYA 4QXKA 4XVHA 3OG2A 1V9U2 2F6BA 1NKGA 3USSA 5C8CA 4ONUA 3HVDA 3FC0A 2VAUA 3R6SA 4AF9A 1TME2 1BEV3 2NP0A 2BPA2 2V73A 4YM3A 1URXA 4NRMA 1W03A 1GWKA 2R072 2D98A 1UO9A 3NV1A 3W59A 1WMFA 2W1WA 4XF1A 1E57A 2YG0A 5LEJA 2GAUA 4H7LA 1RHI2 2V09A 2Z42A 1BMV1 1SG3A 1OD5A 1IOAA 2ATFA 1J1LA 4RS5B 5K8SA 1K45A 3RZKA 4B7EA 4GXLA 4G9SB 4OHWA 4OZOA 3K48A 3VBUA 3FE5A 3VKOA 5FYMA 1C5IA 3NJZA 3O12A 3RNSA 1DZRA 2VOWA 4NN0A 2ZEWA 3WF2A 4QHZA 3O1TA 1YFXA 1YXWA 4I2OA 2JDNA 2V5YA 1PO23 1WWYA 3E6BA 4Q4Y1 2WN3A 4JQTA 4XCBA 1GFF2 2FZ1A 1BBT2 1Y3TA 5F2SA 3NNMA 3K2OA 3WHTA 1D0HA 5FZOA 1GQGA 2DVAA 1VMHA 4NHXA 1G9FA 1W3VA 3A22A 4R8HA 1QKQA 4KQ7A 3DF0A 3MHZA 4NIAA 3X29B 1WD4A 1XE7A 1PGL1 2BVVA 2NLRA 3C8XA 3MIEA 4AFDA 1SLAA 2J1AA 1ENXA 1NCRC 2VMIA 4QPIC 4LTAA 5LWBA 3FL7A 3AKQA 3PDQA 3RZMA 1ND2A 2WZ8A 3FX3A 1CAWA 1HV0A 3M70A 1KQRA 4EWEA 1US3A 2FCUA 4AI0A 1AR93 2GC1A 5IVBA 4GKXA 1RITA 3AXEA 4MGQA 2NQYA 4S2FA 2VL4A 4QPIA 2ETEA 2IXLA 4QDSA 3AFKA 1RXFA 1LHUA 4M0HA 2GMMA 3A4UA 3KM5A 2OXBA 3VBSC 1NXMA 1GICA 3A0KA 4OMDA 5CNAA 1JS9A 2GMEA 2E7TA 4E8CA 1X9TA 2ZX1A 4Q4V2 2W9XA 2GMPA 2BTVC 2Z2SB 4BMEA 2IFRA 2AUYA 1UXXX 2BERA 2OIIA 2ZKLA 4AHYA 4CEWB 3S57A 1RJ8A 3ZFGA 4CEWA 3POEA 4MSVA 2JIJA 4HPKA 4P08A 4C8DA 2QQOA 1ENSA 4A45A 4A4AA 1J3QA 1RYYA 5FY7A 1OPOA 1R093 2ZEXA 5LBEA 3WQ0A 1CVNA 1BBT3 2V4VA 1H4GA 2RR12 5A1AA 2RHPA 3RYRA 1PO22 5CG8A 1R1A2 3AZYA 4QKFA 2HYXA 5FZFA 2JEMA 2A6XA 2ZHLA 3I2JA 1QWRA 3FMGA 5BYNA 1AUYA 2GDFA 4YVSC 2FMDA 4IE5A 4ZS2A 2JDZA 3V64A 1OF4A 2X53S 2W92A 4LHKA 3KB5A 1PO21 5A3PA 1TG7A 5L9VA 1JYWA 2KM2A 2RG4A 1UZ0A 2YY1A 3CHXA 1N1SA 3UJQA 2IXKA 2LM3A 1G7YA 4YRDA 4PF5A 1LGBA 4N43A 4OVEA 5EYYA 1FPN3 3I2GA 5AFBA 3SCHA 1FMD2 2ARAA 4XQDA 4YG3A 2F17A 1I1EA 4UF0A 1GQHA 2WNEA 2Y6KA 5A3UA 4XZUG 3HEIA 4Q1PA 3OGJA 1H9PA 4D6RA 2ZEYA 4IGQA 4Z92B 1ZX5A 3IPVB 5FZMA 4HETA 2QNKA 5C3PA 3AKSA 4GMP0 2BZDA 4QPWA 3HBKA 5GLTA 3RFRA 2CL2A 1AXZA 2WL1A 3OPZA 4AAXA 4MADA 4JDMA 5C5TA 2BV4A 3JB4C 1PK6A 1ZREA 3BODA 2HWD3 2MPFA 2K2SA 1RVF2 5IT6A 1RUOA 3VHRA 3NJXA 3R4DB 2ORXA 2FCTA 1GUIA 3RVHA 3IDCB 3MYXA 4GAZA 1ULEA 1W2NA 1CONA 4UW3A 5JPNB 4CRQA 1J59A 1RUG1 1VLNA 2N7GA 2YFUA 2CWMA 2QZ3A 3PUIA 4L11A 1OHFA 1QXRA 3LDBA 4QX8A 1AJKA 1UQXA 4CEYA 1RUH3 2RMU3 3NNLA 4LK7A 1O91A 3LWCA 3POJA 2WR9A 1IQAA 1PVC3 4GA9A 1JU3A 4BU2A 5C3RA 5C9AC 2XJRA 1QJX1 3I2OA 2X5IA 2R16A 4P5HA 4Y4RA 4ISQA 5IK8A 5T5LA 4XW3A 1W8FA 1STMA 3ELNA 3TEXA 2OQ6A 3H3ZA 5BNPB 3O1RA 4RGGA 3IIAA 1TQ5A 3QBQA 5HPOA 5BPXA 3KMHA 5J96B 4LLOA 1VB4A 4MHRA 3THPA 4CCDA 4L9BA 3DKWA 2ES3A 1B35A 1GQPA 4XF0A 1OT5A 3WINE 3SH4A 2FDGA 1RUNA 4JRLA 1FX5A 4CDWB 1GZCA 3VZNA 2CAVA 5JSRA 2PLV3 2ZS6B 1PMJX 1QQP2 3PU8A 2WSUA 4XOGA 3VD9A 4PDWB 4LHSA 2IVIB 1UCXA 4RQPC 3WF4A 4PCRA 5FDBA 2WABA 5FKCA 5FREA 2RM21 5DUUA 2W39A 5JOWA 5DZGA 1H8TB 1ASJ1 2D6KA 4UW5A 3NMBA 2C26A 1RUH2 2MEV1 4YVWC 4CUBA 1QGLA 1XNCA 2EAKA 1SLTA 3R0RA 4HXCA 4IEPA 4RQPA 4IUGA 1CAUA 4LULA 1UY4A 3LPGA 2WO7A 2VXJA 5CU1A 1AHSA 5GLUA 2W08A 2HWD2 3TN93 4Q1RA 3VDDA 5SV5A 1VBE2 1Q8OA 4RHV2 2JDMA 3ZXGA 2RJ2A 1JOBA 3TYJA 4BIOA 3JBG1 2ZZJA 4EN7B 3OJBA 2HWC3 5ACA2 4CP2A 4Y3OA 4XFAA 1ULFA 3RS6A 4E4DX 5DN2A 2EICA 1GZ9A 1JW6A 2XQRA 3FBYA 1AYN2 2K0GA 1H1MA 1ZBE3 3HJRA 5A3MA 4TSVA 4BQWA 2B8MA 2BGCA 4N90A 1R1ZA 3HWJA 5IAXA 4M3CA 3TB0A 4LIUA 5FY4A 4K20A 4NIDA 1QOTA 3O1MA 5FZGA 5IWFA 1W8HA 4RD7A 4G4FA 2HWE1 4YSFA 4DRRA 2RDQA 4CP1A 3MI8A 2PXJA 1DLLA 2JWPA 3W5NA 3AK0A 5F7UA 5CFDC 4YW4A 3H8RA 3WDVA 1ZBE2 5GALA 1VBB3 4CCNA 2F4PA 2P4EA 2YC0A 4AWDA 1JH5A 4B3NA 5DUVA 1GZWA 2PFWA 5ACA3 5KXBA 5FMDA 1FOD2 2AACA 2HH9A 3VKNA 1RGSA 1D2QA 1HDKA 1WLCA 1H0BA 2QQLA 4COWA 4NROA 4AFAA 3RJ2X 2VH9A 2WWJA 2RR13 4P14A 2WT1A 1VBE3 1NCRB 3JUUA 3IN9A 1COV2 4JV4A 5GZDA 2A6ZA 3OD4A 3OD0A 4Q0PA 3I59A 2J1SA 4FCAA 4AQTA 1CAXB 3WNOA 2W3JA 2DUQA 2WYFA 3MIDA 4QX5A 3WDUA 2VZVA 4LBJA 4BLIA 4AGRA 4BMBA 2CHHA 2RS31 2EIBA 2QQIA 2WN2A 2VO5A 3ZXJA 3LDKA 2OPKA 1WCSA 4HOOA 1LHNA 4LA2A 1R081 3T0AA 1OLRA 4JVAA 2XL9A 3JD71 5J48A 4I30A 2GC3A 5A32B 3M3CA 3HIFA 4SBVA 2WNVB 4XXPA 4E2QA 1D4M3 1VBA3 4D7SA 5B2GB 1AYM2 2PLV2 1B09A 4KH9A 4OI1A 1NQDA 1N3QA 1UZZA 3ETPA 3RSJA 3ZR6A 4BQ4A 3BTXA 1NE4A 1W05A 4MH0E 4Q8LA 4QM9A 5L19A 4WVMA 1C4RA 1KFUL 2ZHKA 5KHGA 1NLSA 3ASIA 4FO9A 2GC2A 2V4AA 4IV3A 3I2KA 4AFMA 4UW6A 2VZQA 2JE9A 2Y8KA 5C33A 1H8TC 5JXHA 1ZRCA 5FYCA 1ZZ9A 3WCRA 1R091 4C0BA 1KFXL 3M1HA 1GWMA 2VUDA 3IBMA 1RUJ2 4QQ2A 5EJ1B 2GNTA 1LOGA 1IKPA 2JG9B 4IE4A 3EB7A 4OZXA 1AJOA 5JIAA 2JDPA 1UF2C 1W9TA 2ARCA 2V5DA 1RIRA 4NWWA 1AZDA 1ST8A 3I8TA 4HLTA 3ILFA 4META 1JODA 5FPAA 2D3RA 4DEVA 1NA1C 1T2XA 4EROA 1NYWA 3IB3A 3KT4A 3T0BA 4AVVA 1SCSA 3GBGA 2QFEA 1L3JA 2JG9C 1AR62 4L92A 5KHHA 4Q4W1 4AHZA 2XB6C 3W9AA 5IK4A 3N4MA 1VRH2 2JKBA 1DYKA 1JZ3A 4Y1VA 2XJTA 2YMZA 3J7HA 3T0DA 3LAGA 4MGZE 2XWJB 4LKFA 3K3NA 5FP4A 4YPJA 1SLBA 3H9AA 4I0AA 1ENRA 2HKXA 1MPXA 3POBA 1V6LA 3URFA 3WW2A 2X5IB 2CGPA 1U0AA 1OC1A 1WW6A 2ZKNA 2EXIA 5A3OA 1APNA 4AXOA 1SPPA 4GH4C 3AMNA 3FJSA 5FZ6A 2XXZA 4CP9A 1NQJA 1REEA 2BFUL 4MXWB 2QQJA 2VCMA 2ZACA 2Y6JA 2CWSA 3M4FA 4W4ZA 5FV3A 1OUSA 1FMD3 3ENRA 5ANQA 1GWLA 1KITA 3POSA 3ZSKA 2AREA 2PAMA 2Q0AA 5L9RA 2XJVA 3MUY1 5FZAA 4YFZA 3OYWB 1POV3 5T50A 5CG9A 3H3UA 1H2LA 1XSQA 3LFIA 4RS5A 1PK6B 4UFHA 3CZJA 1W6QA 3WLUA 3ZFFB 1VBC1 3GYDA 1F5JA 1PM7A 2VW2A 3SEPA 1VBE1 2Q8EA 3UKVA 2MHFA 4UFJA 3WUDA 4W6XA 1AR63 1MS4A 1O59A 1X82A 4OI2A 4Q4Y2 5EIYB 1H6XA 1T6GC 1UKRA 2VC9A 2VZ1A 2DVBA 3IDAA 2R30A 2YC4A 4A42A 4DO0A 4UW4A 1W6PA 2RS12 3VDDC 4UFIA 3K4AA 2JG8B 3DECA 3DCQA 5CFCB 1EYBA 4UAPA 4ZU5A 1YQ6A 5FMCA 2RR11 2DDUA 1RUI2 4QB6A 5LA9A 2WFF2 1N3PA 2C6SA 3AP7A 3GBWA 1CIWA 4A44A 5DZEA 1JZ7A 2E33A 1H30A 1HV1A 3H7JA 3ECQA 3ZFEA 2WLQA 4LHLA 3ZPOA 1TME1 1W99A 2JDKA 1KDMA 2VY0A 4XFBA 5FIXA 4CU7A 1FOD1 2C9AA 1V6OA 3OGRA 2B9VA 2PHFA 4N43C 2YU2A 1XJAA 2VZPA 3R4UA 4CPBA 5T5PA 3N7JA 1WW7A 2PHTA 5F5CA 2ZGSA 4PQ9A 1YCIA 1MVEA 1YI7A 2VUJA 3WNPA 3INAA 4Q4X1 4GIQA 5HCBA 3VBHB 2HEYF 5AC92 4XFCA 1QJX2 1S0FA 3LA7A 3NAPB 4J6GA 1S55A 3GHMA 2VD7A 5EXOA 3ZYFA 3MW4A 1ULCA 4XJAA 3AMQA 2IXCA 2VBBA 4ET7A 5IVCA 1RUC2 1RB8G 2C9KA 3N3HA 4CCLA 1UOJA 4AW7A 1W90A 1NXD1 4M3CF 1CX1A 4CU9A 3AKTA 2XJPA 4PHZA 2KXLA 2O0OA 1UW8A 4IDZA 5F5QA 2D5FA 4DS0A 1S0BA 2WKKA 4HKLA 3TNQA 3CF6E 5AC91 4CUGA 2NPIA 1HXS1 3TWIA 4AI8A 5A32A 1N1VA 1FNZA 2BQPA 4CYDA 1GMMA 3L9JT 5IVVA 3T3YA 4CUCA 5IYYA 5J1XA 4PQQA 2VNVA 2NMNA 2YBSA 3CBNA 3KHBA 3AJYA 1AF9A 5C8WA 2I45A 3WOGA 1DGRA 3I49A 2RMU2 3KT7A 2DBIA 4IE7A 3VHPA 4Q27A 4LOTA 1HQLA 2QZ2A 1XBFA 3GCWA 1BJQA 4E9KA 1C8M1 4XAEA 5FK7A 4X8PA 1QJY2 2FMYA 3J9SA 5GM0A 3W58A 1MS9A 4PDWA 1PZ8A 3VBOB 2GNMA 2D40A 3ZFFC 2BNNA 4KWJA 3O0XA 4NPLA 4GH4A 1L7QA 2LW8A 5FO7B 1H2NA 2Q5TA 2DBNA 5KC6A 5DG2A 2R063 4QHBA 3MV01 3NV4A 2B9UA 5B4XA 2D3SA 4AQSA 1HB2A 1DFQA 3PUSA 4PDWC 4RFRB 4FTBA 1GZWB 3ZFFA 4JCKA 3WG4A 1W2UA 4W8JA 1YNAA 1LOBA 4CDWC 2VMGA 1LEDA 1SEFA 4I3GA 1GP4A 3E5UA 1ULPA 3I2IA 3KT1A 4JGZB 4EN6B 4N7IA 1UN1A 4FQZA 3WNXA 5LB6A 3M3QA 5B4NA 3BI3A 4Q4V1 1DDLA 4BE3A 2JG8C 5FO8B 5A7OA 3OY8A 3ACHA 5A6ZA 1Z0HA 1ZRIA 2R061 1ZNPA 3OBAA 2DVGA 2TEPA 2W94A 4FXKB 1TMF2 2BGOA 4MYEA 4AEJA 4AL9A 1ZBA2 2QQWA 3BPSA 4GB31 4HVRA 2E51A 5FUIA 5A1LA 3LSEA 2Y6GA 3U1XA 2NYYA 1S0DA 2XPJA 4LUKA 1LESA 2BBAA 1Y4WA 2B42B 5DDJ3 2CU5A 1WA6X 1NLRA 2LALA 2VM9A 5IAVA 3RYKA 2A7AA 4HVOA 4BQ3A 4DUVA 3S7IA 2VUCA 1R1A3 3J4UH 2WIIB 3QOPA 3AKRA 5C4WA 3LOBA 3N9NA 5IK5A 1QF3A 3BALA 2G9FA 3RZJA 1R092 4COUA 1WCUA 3FN9A 5D8AC 2HJIA 3S6PA 1FPN1 1UL9A 3PLQA 4IEWA 1ZA4A 1AYM3 1SDWA 1W8UA 2E63A 3EBRA 4BH9A 2AH2A 3ME2A 5F5IA 2J7MA 2W5FA 4MV2A 4OUSA 2PMWB 3W21A 3WCSA 2DUOA 3CMGA 1FYUA 4FBFA 3PNAA 3RYPA 4GH4B 4Q4Y3 3MIHA 2J42A 4AVBA 1HIXA 3UL2A 1W6MB 1OQDA 3FBMA 4QB2A 1F9KA 4CEYC 1J3PA 4Y22B 5FO9B 5A6XA 5A3WA 3K3OA 2Q1MA 4BDVB 5BY5A 3D0SA 2CDOA 3CO2A 1DYOA 3LB9A 1UD1A 1Q8VA 1RVF3 1HW5A 5DQ0A 3GJAA 3U78A 1MS1A 4P9XA 5BV6A 4I09A 4YZ4A 1LAJA 3EHKA 3T2TA 1R1A1 1PVXA 1QU0A 3AP6A 1JBCA 4LE4A 4E4HA 1QNWA 2R071 1ZM1A 3OPTA 2IZWA 1XNAA 5FXXA 4LBNA 5H9RA 4Q0SA 3NQHA 5JPMB 4TN7A 3VKMA 2VW1A 1S0IA 2W0XA 3CEWA 1VR3A 2P1BA 3B02A 2QE3A 3TOJA 3WW3A 1AYM1 1YQCA 3HT1A 4XMAA 1UMHA 2Y0OA 3PTYA 5JOYA 4KNCA 2OX0A 4ZU4A 5LY2A 3TNPB 4IESA 2DFCA 3MIFA 1LGCA 1W9FA 4CDQA 2IFWA 5EZWA 1NZIA 2QQKA 3EJKA 1MZ5A 4O61A 1DIWA 2WWSA 2R042 3O0VA 2ZGKA 4LBQB 1WBFA 2JIGA 3SISA 4A7YA 5JXGA 1EV12 1UYYA 1HLCA 4Y22A 3RJRA 3NW4A 1O4YA 1LECA 1W0PA 2LRPA 1FNYA 2P5BA 1CN1A 3BKZA 4QKDA 3HR9A 1MACA 2UYBA 4QB1A 2J22A 3ZYGA 1NCRA 2WS93 1K5MC 3H8UA 1GOHA 5JMCA 4FPYA 5F39A 5FLHA 4MHUA 1O6UA 2VULA 3C7FA 3NAPC 3P1IA 4AI3A 2GSYA 2X8KA 3OTFA 1ODNA 3ZYBA 3N9QA 5LBBA 3BTAA 5A7SA 5F6LB 3TN92 2K9ZA 2Y0IA 4RGAA 3U75A 3PUHA 4NPMA 3W5MA 2OUJA 1RUF3 2I74A 1CESA 1UY2A 3WG3A 5JLVA 1K5MB 5GLVA 5FYZA 2WO1A 2DCJA 3APBA 3GGLA 4HBNA 2DU1A 2DVDA 1NY71 2HWB2 3AB0A 4R4ZA 1OPMA 4XTMA 2HWD1 4LBQD 3FHAA 4EN8B 5C5UA 4DRVA 4W6YA 2PHRA 3NNGA 4BLJA 2A6VA 3Q8BA 1W2TA 2EAAA 3HQXA 1KGYA 1JXNA 2D6NA 1NCQA 3ORJA 3SH5A 1W6PB 4MOAA 3WZ1A 1MQTA 2D3PA 2DCZA 1JYCA 1EPZA 1AX1A 2VECA 4PBOA 1ND2C 4JTOA 1V6NA 3HNMA 5FXVA 4R9CA 3OEBA 2ZHNA 5KHKA 1ENQA 3WP6A 3VL9A 2D6LX 4B8EA 3BCWA 3N9OA 5FZDA 4R9AA 1VMFA 1JHJA 4RL7A 4AEDB 5CFDB 1EP0A 4CP0A 5LY1A 3WP3A 4XEZA 3EXUA 4IXLA 1O8PA 1V6IA 1UPSA 2XL7A 4XDQA 2YHJA 4YM2A 3RWKX 4DIQA 2VPVA 5ISLA 1GYKA 3SLIA 3VZJA 4D69A 3AZXA 4F8AA 5KC5A 4FPEA 3I3QA 4AGVA 5JI9A 5C4WC 5GJ6A 1NLQA 1UWWA 4GB33 3E6DA 1LRHA 5EJ3A 2DWRA 2ZCWA 1S0JA 1R082 3WF3A 4AFCA 5FYHA 1CAWB 5FZ1A 3C2UA 3KS7A 3AJZA 5BNOA 4KWUA 3G6JB 3VL8A 1MVQA 1NCQB 1W04A 1OA2A 2W68A 2WNUB 1D2SA 1LOCA 2PHUA 5A7WA 5J37A 1E5RA 3S30A 3N36A 4XFGA 3LQCA 2X09A 3B01A 2ERFA 4PI2A 4DXTA 4SLIA 2QQMA 4D0QA 1HJGA 3ZXKA 1GR3A 2DVFA 3NKTA 1D7PM 2WINB 3B3QE 4GWIA 5BNPA 4NHYA 1JUIA 1W6NB 5E1RA 4Q29A 1V9U3 4QGLA 1RMU1 2A3XA 1ULGA 2ZGNA 3FWEA 5FYIA 1DCSA 1W06A 1XYPA 3TAYA 4K7JA 2JE8A 3THDA 1IG3A 5FP9A 3RDIA 1POV0 3DEMA 2PTMA 1OURA 3UYJA 3DYMA 3M3EA 5D8AB 1CX4A 2W1UA 2ZBJA 3LDRA 3D3AA 4OI4A 2Y38A 1QXJA 4BISA 1F5FA 1EPWA 3EMRA 4P9YA 1W6QB 1AXYA 4F7ZA 1Y9GA 4RFT0 1ZRFA 3I2DA 4JGYC 3NAPA 3B5LB 4QQPA 1OOPC 3WHUA 1VIWB 3AP4A 3VBHA 5FJHA 4CDQC 4C90A 1B35C 4XJWA 4M4PA 3BUCA 1QEXA 1XC6A 3P3NA 3TBDA 3VBFC 4AEDA 5JOXA 2FDFA 5FUNA 2VTXA 4QPGB 2BGPA 4NVPA 3NJVA 2WFF1 3T2PA 3QCWA 4U2AA 1GSLA 4DY5A 1S2EA 3WV6A 2VOKA 4W65A 5FBZA 3OSDA 2PA7A 4LEJA 2QTWB 1BQPA 3RMXA 4YVWA 5FZOB 4NMIA 2P3YA 2WNUC 4BYYA 1NCQC 4K40A 4C1XA 2FZ2A 5JR7B 3LD8A 1RUF1 3NRUA 1WMXA 1CD3G 2JE7A 4NUBA 4RHV3 5HBAA 4QDQA 5G04L 1FMD1 2RJKA 1DGWX 4P9IA 1HB3A 1XE8A 4YW5A 3E5QA 5FYVA 2WZPP 1K5JA 5FZ0A 4WM8A 3WNNA 5GZCA 3I2HA 1XRUA 3AVRA 5DAPA 1YIPA 5HCHA 3POWA 3H1MA 1MQTC 2E31A 2XVGA 1FT9A 1QDCA 3PU3A 4XURA 3Q9OA 4N9HA 2CY6A 2R0HA 2RS53 1BCXA 1NX9A 2DF7A 2P34A 3BTZA 3B9IA 2E6VA 4AVTA 2BRTA 1N1TA 2WRAA 2DFBA 4KGQA 4UWDA 1JN2P 3PUQA 3ZKYA 4Q8KA 1SFNA 2GC0A 3LA3A 4IV3B 3UKTA 4A3ZA 2PHLA 1LTEA 4YVSB 4FPCA 1VBC3 1PHMA 1SBEA 2OPWA 5FYTA 5FZ7A 2IXIA 3UNPA 3OBZA 3ZN6A 5FWJA 1RUI3 2ET7A 4YG0A 1OMIA 3VD3A 4ZZ5A 2MEV3 5FJKA 4QT6A 3RMYA 1C1FA 4URAA 1RUE2 3MW2A 2PELA 1SCRA 2C24A 2J1VA 1QJU1 4L2NA 4QHOA 3UGGA 1OLMA 4YGEA 5DUWA 4DFSA 3T4HB 1V6JA 3J7MA 4Y1XA 3I3BA 1MZEA 3MZHA 1UIJA 1RTVA 4Y1UA 1LB2A 1T6BX 4O9EA 1ZBA1 4B29A 4LBLA 4BQ2A 5A1FA 2ORZA 1O3QA 1XNKA 2PHXA 1LKNA 2XQXA 5H9QA 2J1UA 4TYSA 4QD2A 4QX2A 1X9PA 5FP7A 3VBSB 5H9SA 1W8ZA 3VDCA 1U5IA 2RDSA 4I01A 5FMOL 4M00A 1OKQA 4XFHA 3T09A 4B1MA 2GALA 2WLPA 5FPLA 3OCPA 2XLFA 4CDUB 3VBOA 1XB9A 4E27A 4IEYA 1SLLA 2BU9A 4FPJA 1ULDA 4QX1A 1Q8PA 3NNFA 4QPGC 3OUIA 4CCMA 4E2GA 5LBCA 1TE1B 2R32A 1B35B 4ATFA 3VBFA 4CXYA 1QJX3 4F83A 1Q8SA 4EQVA 4B4QA 4LHNA 1F8VA 2EVXA 3B00A 3KZ4C 3HPNA 3NNJA 4KU7A 1RHI1 3CKHA 4PLNA 4IEZA 4HVQA 3AC0A 1QNYA 3VKFC 3OPWA 4C0HA 5E6HA 2B7YA 1MS8A 1YQ5A 1W8WA 3PJQA 4XXAA 3BIEA 5FTTC 1AR92 4OMCA 4JKKA 2XOMA 3MO4A 1V0AA 2VMCA 4QDRA 1HX6A 2ZAHA 4Z1VA 4Z2AA 1QQP1 5F5AA 4QX0A 1UX6A 2VG9A 1DGRN 5FWEA 1YLLA 3PHMA 4N53C 1WGPA 4JDOA 1D0GA 1J58A 2BJSA 5JXIA 4MGIE 5FFOC 5IVYA 4ITCA 2XKPA 2ZA9A 1C8M3 3DXTA 2Z79A 4MXVA 3CJXA 3ZLIA 2MNGA 4COVA 4RN5A 4UFMA 1K12A 5DAXA 2Q4SA 4XACA 2QDRA 3BB6A 4CXXA 4DXZA 2DCYA 3TEYA 4WM7B 1OSGA 4YZ2A 3D0JA 4YW1A 2AGSA 2PQQA 1I5PA 3M3IA 3BYWA 4Z82A 5FZ4A 2OVUA 3HNBM 3RGBA 1CAVA 3HN3A 1JYIA 4QGNA 4LPLA 4HMZA 4XJUA 4LUMA 1HXS3 3IAPA 3POYA 2O8OA 5F8PA 4Z07A 3VBUC 3LKJA 3K51A 5JMOA 3CIHA 3HNYM 5A3LA 1PNGA 4NR1A 4OHYA 1W9SA 3HD8B 3I97A 3LEIA 4A3XA 1Q56A 3MPPG 3TN91 4X6QB 2A1XA 1Y7BA 2A6YA 2DTWA 2YU1A 3IPVA 1YEWA 1OD3A 2AC1A 2W87A 5J98B 5A33B 2P3JA 2XUEA 3JBG2 2EIDA 3NVCA 3Q8CA 4XE9A 3NL1A 2XWBB 4XHXA 1RXGA 3NV3A 4XUTA 5IVFA 3ALQA 4ARYA 1ZZCA 4TXWA 4XILA 4YLZA 4ES9A 2A5ZA 5KBFA 1OH3A 2DV9A 1LODA 1OLME 3OY8B 4XUNA 5CISA 2QQPA 2BNOA 3ST7A 1L7RA 2TUNA 1LOEA 4JKLA 3ZOIA 4JX0A 4P9JA 1QJFA 5FPVA 3ZN6B 1PO12 3CLPA 4HONA 2ZGPA 3ZXFA 2EIEA 2VNOA 2H0BA 1VBD3 5C3OA 1IS4A 1COV3 3ZMOA 4HPKB 3T1LA 2FCVA 4IV1B 2FDJA 4OUEA 4L8QA 1UMIA 2CGNA 2R7EB 3AMHA 1CJPA 3V56A 1AR91 1FOD3 2JXAA 5L7OA 1ZRDA 2DCKA 2RMU1 2EA7A 1JI6A 1BKZA 3H3LA 3WQ1A 1VBB2 1DZQA 2G4IA 2XHKA 3GZEA 3N7LA 1ND3C 3F95A 2E26A 3ILRA 1ALYA 5CFDA 4ZPIA 4XTPA 4LOSA 4CEWC 4O7XA 2C0ZA 3WNKA 4ZU7A 1W0OA 3ZPYA 1OVPA 2ZX4A 4AZZA 5D8AA 1HQWA 2B46X 5FKBA 5CBLA 4LXLA 4GWJA 5GZEA 2J1TA 3QACA 2X29A 1QJU2 2MEV2 1LOFA 2UWAA 1BK0A 1RJ7A 2OZ6A 4M0NA 5CVRA 5KXDA 4XBNA 5CAZA 5LK7B 2RDNA 5FXZA 5C70A 1VBC2 5GKAC 1WMDA 1WLDA 3OGGA 1WLTA 1HJFA 2VCCA 5LA0A 3VHOA 1H9WA 4I0WB 2XG3A 2BVBA 2K46A 5DAVA 1WW4A 4Q4W2 4UI9L 2GP3A 3O14A 5FLJA 4NIHA 3FLTA 5CA6A 4DB5A 4YW2A 2OYZA 4LO7A 1CPMA 2KR2A 5I8SA 4DEQA 4NHLA 4LBKA 1YQ8A 4YW6A 4IQPA 5FZ8A 5DUXA 4FFFA 4GWMA 1S2BA 2RM23 4FFIA 1EAH2 2VNRA 4A2UA 4CCKA 1JZ2A 3UETA 1AVBA 3GHNA 4LQRA 1SBFA 3KF5A 3KSCA 5DABA 5I0UA 3VZMA 4EWAA 4BPZA 4FAGA 2AR6A 2WZR1 4JC1A 5CKQA 1TMF1 1IS5A 2BNMA 2Y60A 1I6XA 4XF4A 2R062 3WUCA 4BJ0A 1JYXA 2L9LA 1P8JA 4Y20A 1XOYA 2JB4A 1W6OB 4KBZA 2QQNA 1W6OA 5LCWL 1Q3EA 1X36A 1PMIA 1ZZ8A 2UY9A 1UAIA 2XBO2 4AOCA 4QGMA 1YYNA 4YZ5A 4IEOA 1QOOA 1W3XA 1RUG2 1CIYA 1U12A 3VDAA 2B45X 3PUAA 5FY8A 2BWAA 4NPRA 5JVVA 3U07A 1JZ6A 2YFZA 4PIZA 1N47A 4QQOA 1AX2A 3GZAA 3H42B 4BCUA 1MEC3 2VTXJ 3JD72 2Y34A 3D6EA 5C9AA 4KBBA 2OUHA 2EF6A 4IE6A 1QJU3 2VMHA 1GNHA 1UYPA 3MFCA 4HK9A 4UF0B 3POGA 5C8CC 1A8MA 1LHVA 1JOJA 3WQ7A 4FP2A 4N9IA 2I2SA 2WFPA 4XCAA 2VGDA 1EUUA 2GU9A 2LUWA 2Q30A 1PGSA 1FV3A 1PVC2 5ANNA 3ZXAC 3MF9A 3T4VA 2WT2A 1AYN3 4K9SA 4DXRA 1V00A 4AEKA 1N3OA 5JIUA 1OQEA 4M3CE 4YVWB 1EV13 1O4TA 4Q2FA 2WDBA 5AVAA 5T5OA 4XFIA 2HWC2 2R043 3DXUA 4QKNA 3ATGA 1QHDA 2CAUA 4CCOA 1U5YA 3HMYA 4HANA 2P3IA 4XJZA 4MGTA 1DGLA 2PHDA 4DOUA 4ASLA 2FBEA 3HN1A 1UYZA 5DZFA 1H6YA 1UNBA 1RUC3 4YW7A 1CAVB 1F15A 3ZIWA 3WEZA 3ITQA 1LENA 2YYOA 2VR4A 2B4KA 1CZVA 1YQ2A 3ZXDA 2ZHMA 4Q0QA 4QX3A 1PZ7A 4UXAA 1MEC1 3WDWA 4CDXA 2AEYA 3ZYPA 4R9BA 4X8NA 5KXEA 2BWCA 4H14A 5LASA 4HZFA 4BK4A 3BVCA 5KHJA 1KEXA 2D93A 4FOWA 3GBFA 2BDRA 3OOXA 1RUE1 5FXWA 4MLOA 1LOFC 1RL3A 3L2YA 4ZY9A 2Q8DA 4S2HA 2UY8A 1DP0A 4NOTA 5EHDA 4HG6B 4Q5OA 3JBG3 3OYWA 4MXWA 4YG6A 4M3CB 5IK7A 4LBQA 2ILMA 1OLQA 4CUAA 4GWNA 4HFSA 4Y5SA 3VBRA 2Q1FA 2FDKA 2JICA 2P3KA 5FYUA 1AR61 1K42A 2WNOA 3BN6A 3FHQA 1IS6A 3WD5A 3V0AA 1BBT1 3PVEA 4PIXA 3B9CA 3IDEA 1EAH1 3SCGA 4JGZA 4OHZA 1MS0A 5I0DA 1LEMA 3G7DA 3JQXA 1OOPB 3SQOA 3THTA 3I7DA 3U37A 4YGCA 3JU9A 1F35A 3GNEA 4BWOA 1XQNA 5FK8A 4FOVA 4MGYE 1GNZA 3OUHA 2DTYA 1HRI2 4JHTA 3LSDA 3QH7A 4JGZC 1VAKA 1S0CA 3PMEA 1BVVA 4ZXKA 3O1UA 5F32A 1O3TA 1QJY1 4IEUA 3SKJE 4BQYA 4XUPA 2VJXA 1RMU3 5ACA1 1C8M2 4WBBA 3ZX7A 1O8SA 2D97A 2BYVE 4L99A 1A8DA 1JUHA 4JRAA 5BNNA 5FY1A 5AFEA 3MIGA 2IXHA 4CCEA 2DYCA 3MLKA 3WP4A 1XNTA 5CIRA 4CDUC 1QDOA 2HWF2 4FSJA 3KF3A 1JTZX 1GLHA 2JKXA 2IC1A 3OB8A 4JHZA 3MPBA 3P5BA 1OI6A 3K77A 1M06G 1KRIA 2YGLA 3HQRA 5JI7A 4BB3A 2A6WA 2GNDA 2HWB3 2OT7A 3E1F1 1KJLA 4WVMB 5C8CB 3B93A 1ZZBA 3Q8EA 1XYNA 5JXJA 2ADEA 1JYNA 4FPKA 2WFF3 5F3CA 2WNVC 4P00B 3JB8A 4PLOA 3ZN5A 1ASJ3 5LRSA 5G05L 1UOBA 1POQA 4OQ9A 3WY6A 3USUB 3PMSA 5EV7A 1PX4A 4OHXA 5LRRA 3H1YA 3SC7X 3MGUA 1COV1 1HN1A 4E8DA 4XFFA 5IATA 4P9LA 1JYVA 2LROA 1Z78A 1PIV1 1ZVFA 4NRPA 1S0EA 3DPRC 4MO3M 2Y6HA 2OW4A 1YC61 5FYBA 5I93A 1NZCA 2WYSA 1KDKA 2JENA 4LORA 4Q4X2 3QLQA 1YFYA 3SXWA 1EY2A 2P6HA 3ES4A 1CAXA 4NWVA 1C5HA 3OGVA 4LT5A 4HN1A 1OBNA 1YUDA 1GOFA 2WQZC 3CJIA 3NV2A 3BPZA 3MFAA 2JDAA 3E97A 1DF0A 4JKMA 4COZA 1HRV3 3KV9A 3JQWA 2NM1A 4UT5A 3A21A 1UY3A 1VBD2 1KJRA 5K0UA 4BXFA 2HWB1 1RUE3 4NAMA 4Y33A 3RI9A 3F2ZA 2VCAA 1DQ2A 1BEV2 2WAAA 5HI0A 1BK1A 1FATA 3KHCA 5FBJA 1IQDC 1Z7S2 2QQUA 3D8CA 3DYPA 3LPFA 4NHKA 4D7TA 5K9YA 1RUD3 3FUQA 3HT2A 5K0UB 3M2MA 4Q4V3 5FAXA 3ZM8A 2XR4A 3WXPA 4P5YA 2JD4A 1RUI1 1REFA 4QQHA 5KR7A 1SFYA 1JU4A 2UYAA 4XPVA 1JHNA 3KD4A 1Y9QA 5HXMA 2SLIA 4IGOA 4CE8A 3HOBA 1SMVA 1IPKA 1OQ1A 1BXHA 2A70A 2UURA 2ZMNA 4Y24A 1XYOA 3RWNA 5A6YA 5JZGA 1D4VB 2E7QA 1LHWA 4NHMA 3ES1A 2NMOA 2RS52 4E2SA 4GALA 2C1FA 4A41A 2WAOA 3LIGA 5DXDA 1J1TA 5JAXA 1JOPA 3GZTB 3RRDA 4EWDA 1Q8QA 4ZKTB 1SLCA 4ZHNA 2RM22 1JZ5A 4AHXA 3P3PA 3RZHA 2XBO1 1HRI3 4HSJA 1CAUB 1RUF2 4OYUA 4F3JA 4XDOA 1KD7A 3K4ZA 4IETA 1SBDA 1YFWA 4WZCA 3VDDB 4CEYB 4MVTA 1AR81 5BUVA 1RUJ3 4FPLA 4KG0A 5E89A 3ZKUA 4D94A 1DU3D 3D5OA 1ZZ6A 2E53A 2RV9A 1OFSA 2VZUA 1WW5A 2WZR3 3KCCA 3MBWA 3KLSA 2JX9A 3PVBB 4FXGB 1UY0A 3WW4A 4AQ2A 5BNNB 2ZGTA 5FCCA 4FFHA 4L97A 3EQEA 3WF0A 4Y20B 3M3OA 3I54A 2VQAA 2GH8A 5FZ9A 4CDUA 3B7MA 2YUEA 2UWBA 1ZBA3 1WBLA 4BIFA 3BU0A 5T5JA 1SHWB 2HBUA 2B39A 1BZWA 1YJKA 2XMLA 2VZOA 2YBKA 1D4M1 1VBA1 2V72A 1QH6A 4RR3C 1QH7A 1E5HA 5CB7A 3ACGA 4Q26A 4WVZA 1UZVA 2R49A 2VU9A 4LKDA 1LOAA 5BNOC 3KVAA 5BNNC 5HCAA 4CZSA 4A6SA 1GBGA 3J8F3 1DG6A 2Y64A 5HV4A 4XQWA 4CA9A 3T08A 1W2AX 3ZDVA 1OOPA 1FV2A 1H2MA 1S4CA 4CXWA 4HT1T 2BOIA 2VMDA 5I8TA 1RVF1 1CGPA 1OF3A 4OI0A 1RUJ1 2VBDA 3ACLA 1AX0A 4ISRA 4QU2A 5A7WB 4TLGA 5EJZB 5F1RA 5FZHA 4H3WA 5F3GA 5FRAA 2VOXA 1WUVA 2D43A 4DQAA 5BNOB 4XF9A 1W8TA 3CNAA 1AYN1 1PX3A 1X7NA 2P37A 4INDA 3AP9A 4XIOA 3IDBB 4JAAA 4RR3B 4PBPA 4V2VA 1UU5A 5F2WA 5EQUA 1E5IA 2XONA 3NKGA 4CPBD 3J8F2 1XU2A 1REDA 4GULA 1CR7A 1GKBA 5H9PA 1V9U1 3K75B 3KGZA 3WW1A 5LEKA 1UOFA 5JOZA 4TZDA 3EYPA 2ZAAA 4RGKA 1R64A 2Y26A 2CSGA 3GM8A 4M01A 1PVC1 1DHKB 3DN7A 5J36A 1J83A 4ATEA 1W8NA 4LO6B 4CCJA 2RS51 4CDXB 3LFMA 2Y6LA 1HB4A 2VBPA 4PLMA 4IV1A 1YI9A 2OQ7A 2G9GA 2ZX0A 3MDPA 5FZ3A 1ZZ7A 4I3PA 3PVNA 4K21A 1HXS2 4UBHA 2AZ5A 4XAAA 3RG0A 3KQ4B 2TBVA 1QJZA 1GP6A 1HQNA 3FZ3A 2C5DA 4QXHA 1W8OA 2JDYA 4XJ8A 4NIIA 1ND2B 1WKYA 1DQ5A 2W52A 5CYYA 3VZOA 2G19A 5ABJA 2VE1A 1DQ4A 5KHIA 1UMZA 2IXJA 3W20A 1TMF3 3H8XA 4HL0A 3NJYA 1O3RA 4NO4A 4QPYA 4FP3A 5J3UA 1V70A 2TNFA 4CSWA 1TEIA 1PM4A 2WNUA 2X05A 5IUQA 3VZLA 3BU7A 3GZUC 4AI1A 1M4WA 2D6MA 1VP6A 5DMYA 1BEV1 5A7PA 5AC93 4IW3A 2DU0A 2JG8A 1EAH3 1O5LA 1RUD1 2HBTA 2JJ6A 2YB7A 2HYKA 4RA0A 5T3NA 3RI8A 2P6CA 3D4KA 1GV9A 3KV4A 3UK9A 1LJ7A 4URTA 1O4ZA 2HWE2 3WDYA 5BNQA 4BZ4A 5K0UC 3IZOA 3MV11 4DNYA 1ZRRA 1AL21 2XJSA 5JZGC 5FPUA 4L0PA 4EN9B 1UU6A 5D21A 2GNBA 4C91A 1MS3A 1H4HA 4Q0UA 3ZIXA 4I0BA 5K7PA 1A34A 4E4SA 5J7MA 2BFUS 4FT8A 4D3WA 1G9BA 3T2QA 3KWVA 1I5ZA 3KGLA 4GJYA 5FYSA 1PIV2 2ZGLA 1QXPA 3AX4A 1HB1A 1Z7S1 5HXVA 4YW3A 3AYEA 3SHRA 4CCCA 1JZ4A 3M8LA 1G9DA 4OFGA 2ADDA 3D82A 2VW0A 1UZWA 4XBQA 2XLAA 3AL6A 4PI0A 4BQ1A 3T2OA 4QPIB 3DKQA 2ET1A 3KVBA 2Q8OA 3K4DA 2W95A 4YM1A 1Y9MA 1CZSA 1HRV2 5HCFA 1UIKA 2YXSA 2ZJCA 1U5ZA 2ZX3A 1SLIA 1IKQA 2PAKA
chains in the Genus database with same CATH topology
2YC2A 4JKLA 4CUCA 5IYYA 4JX0A 3C7HA 3IAQA 1NUKA 2RVAA 3A7QA 4PQQA 1DLCA 1CZTA 5J1XA 2EIEA 4XVHA 3OG2A 4ARXA 1NKGA 4CU6A 4OUEA 1UMIA 2R7EB 1OH4A 4AG4A 2DCKA 1JI6A 2W1WA 2YG0A 1W9WA 1SG3A 2E26A 1L7QA 2LW8A 3WNKA 1K45A 3MUZ1 4UOJA 3MV01 4OZOA 5B4XA 4GWJA 2J1TA 3WF2A 2ZEWA 4W8JA 2WN3A 5C70A 1ULPA 3I2IA 5B4NA 2VCCA 5LA0A 2W91A 1F4HA 4UI9L 3A22A 3ACHA 2J1EA 3OBAA 2W94A 2BGOA 3I3DA 3C8XA 2ID4A 2J1AA 5FUIA 4DEQA 2Y6GA 2BBAA 4DXSA 3FL7A 2WZ8A 2VM9A 4KI5M 4DUVA 1US3A 3OGSA 1JZ2A 4ZXEA 3UETA 4MGQA 4LQRA 2VL4A 2VMFA 4QDSA 3FN9A 2VMEA 4BJ0A 1JYXA 1TVGA 3SEEA 4OMDA 2L9LA 1P8JA 2J7MA 2W5FA 4PF1A 4E8CA 3LEKA 2QQNA 2W9XA 5LCWL 3CMGA 2JD9A 2BERA 1UXXX 1EUTA 4QB2A 1CIYA 3GXUA 3VDAA 4P08A 3A23A 5IHRA 1JZ6A 2QQOA 2YFZA 4BDVB 4A45A 4A4AA 1RYYA 2CDOA 2ZEXA 5A1AA 2VOTA 1DYOA 2V4VA 5DQ0A 2HYXA 3I2JA 1OF4A 2W92A 1F4AA 1EUUA 1TG7A 1JYWA 2OKXA 1GNYA 1UZ0A 4A41A 1XNAA 4DXRA 2VTFA 2HLEA 3NQHA 3I2GA 2QBXA 2PQSA 2WDBA 5JR2A 1UMHA 2Y6KA 3ABZA 4XUQA 1PMHX 4XZUG 3HEIA 3WSOA 2ZEYA 5LA2A 4GZ9A 2VZTA 2QQKA 1UYZA 1H6YA 5JXGA 3WEZA 1UYYA 2WUHA 2BZDA 4QPWA 2VR4A 2B4KA 1CZVA 1YQ2A 3GDBA 4QX3A 4AAXA 4DUWA 3W5MA 4FI9A 4MADA 4QB1A 2J22A 2VQUA 1GOHA 4BK4A 3C7FA 3NJXA 3P1IA 2ORXA 1GUIA 1KEXA 3C7GA 4ZY9A 2YFUA 3VD4A 1DP0A 3PUHA 3PUIA 4HG6B 1UY2A 2WO1A 4A3ZA 2DCJA 4CUAA 3GGLA 1JU3A 1K42A 3BN6A 1UX7A 3FHQA 1GOGA 3FHAA 3NNGA 3C7EA 1LNSA 1KGYA 1ULOA 5I0DA 5HPOA 4MOAA 3U37A 1GU3A 1NAEA 1GQPA 3SKVA 3HNMA 1OT5A 4XUOA 3OEBA 2C4XA 1W0NA 3SKJE 1PMJX 1JHJA 2VJXA 4XUPA 3WNMA 2XHNA 1US2A 3VD9A 3CQOA 4LHSA 1O8SA 1O8PA 3WF4A 2WABA 3WQBA 2WZEA 2C26A 1XNTA 4CUBA 3LEGA 1SDDB 2JKXA 3VD7A 1UWWA 2LS6A 4IUGA 3OB8A 4JHZA 4TTGA 3K77A 3OEAA 3WF3A 1UY4A 2ZEZA 3LPGA 3JXSA 3E1F1 4KWUA 2VZSA 5JXJA 1JYNA 4P00B 2RJ2A 5G05L 3LQCA 3UESA 2X09A 1PX4A 4DXTA 4E8DA 2QQMA 1HN1A 1JYVA 4D0QA 2WO3A 3P6BA 5DN2A 2EICA 1D7PM 4GWIA 1JZ8A 3HJRA 4MO3M 2Y6HA 2WYSA 3THCA 2JE8A 3THDA 1UY1A 3OGVA 1GOFA 3W5NA 5F7UA 2JDAA 3DYMA 2W1UA 4JKMA 3D3AA 3A21A 1UY3A 4KMQA 1UYXA 3F2ZA 2VCAA 5C71A 2QQLA 2WAAA 1IQDC 3DYOA 3DYPA 3LPFA 4M4PA 2Z4FA 1XC6A 2J1SA 5CZKA 3ZM8A 4P5YA 2W3JA 3WNOA 2BGPA 2VZVA 2VZ3A 3NJVA 1JU4A 5HXMA 4BK5A 2EIBA 2QQIA 2VQTA 2WN2A 2VO5A 2ZXQA 3T2PA 2W47A 3HOBA 2VZRA 3T0AA 2E32A 2W1QA 2WAOA 4A6OA 4M4RA 3NRUA 1JZ5A 3IIIA 3WNLA 3ETPA 4QDQA 5G04L 4ZZ8A 5JUVA 3BGAA 4OYUA 3K4ZA 3VDBA 3I2KA 5JXHA 3WNNA 2VZQA 2Y8KA 3I2HA 3I2FA 2RV9A 2VZUA 3MBWA 1BHGA 1UXZA 1UY0A 2E31A 4CU8A 5EJ1B 3WF0A 4XURA 5IFPA 3EB7A 1NX9A 3WF1A 1K3IA 2V5DA 1W9TA 4DEVA 1SHWB 1T2XA 2VZOA 3IB3A 3T0BA 2V72A 2VCBA 3ACGA 5DPNA 1XPWA 1JZ3A 3ACIA 3UNPA 3J7HA 5C7GA 3T0DA 2Y64A 4YPJA 3VD3A 4ZZ5A 3T08A 2X10A 2W46A 1MPXA 2J1RA 2J1VA 2VMDA 5IJRA 1OF3A 3I3BA 1J84A 5EJZB 2QQJA 1PX3A 2ORZA 2Y6JA 4W4ZA 2XQXA 2J1UA 4QX2A 3VDCA 2XONA 4P02B 3MUY1 3T09A 3CZJA 3SEPA 2WO2A 3K75B 2WQ8A 3EYPA 4QX1A 1R64A 1O59A 5EIYB 3LE0A 3GM8A 1H6XA 1J83A 1W8NA 2Y6LA 2VC9A 3IDAA 2VZ1A 4A42A 2YC4A 4PT6A 3HPNA 4W50A 3K4AA 4QAWA 3DECA 3CKHA 3AC0A 1WCQA 4UAPA 4D8MA 1W8OA 1WKYA 2DDUA 5CYYA 4QB6A 4OMCA 4JKKA 2XOMA 4DUXA 3MO4A 2VMCA 4A44A 4QDRA 1JZ7A 2E33A 4LKSA 4Z2AA 4QX0A 3ECQA 2X05A 5JXIA 3VD5A 1W99A 3C7OA 4CU7A 3CDZB 5DMYA 3OGRA 2B9VA 4RN5A 1K12A 2YB7A 2VZPA 3K46A 4CVUA 4RYDA 3WNPA 1I5PA 3HNBM 3MV11 2W1SA 4L0PA 3HN3A 4LPLA 3IAPA 5IFTA 3I3EA 5JMOA 4ET7A 3CIHA 3HNYM 3T2QA 2C9KA 1W9SA 3I97A 3LEIA 1CX1A 4CU9A 1JZ4A 1OD3A 2W87A 4BXSV 2EIDA 3T2OA 3K4DA 2W95A 4XUTA 4MGSA 4ARYA 1CZSA 4TXWA 5LA1A 2CDPA 3ACFA 4XUNA 2WBKA 2KD7A 1GMMA 3CZUA 1L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YC2 A;  4JKL A;  4CUC A;  5IYY A;  4JX0 A;  3C7H A;  3IAQ A;  1NUK A;  2RVA A;  3A7Q A;  4PQQ A;  1DLC A;  1CZT A;  5J1X A;  2EIE A;  4XVH A;  3OG2 A;  4ARX A;  1NKG A;  4CU6 A;  4OUE A;  1UMI A;  2R7E B;  1OH4 A;  4AG4 A;  2DCK A;  1JI6 A;  2W1W A;  2YG0 A;  1W9W A;  1SG3 A;  2E26 A;  1L7Q A;  2LW8 A;  3WNK A;  1K45 A;  3MUZ 1;  4UOJ A;  3MV0 1;  4OZO A;  5B4X A;  4GWJ A;  2J1T A;  3WF2 A;  2ZEW A;  4W8J A;  2WN3 A;  5C70 A;  1ULP A;  3I2I A;  5B4N A;  2VCC A;  5LA0 A;  2W91 A;  1F4H A;  4UI9 L;  3A22 A;  3ACH A;  2J1E A;  3OBA A;  2W94 A;  2BGO A;  3I3D A;  3C8X A;  2ID4 A;  2J1A A;  5FUI A;  4DEQ A;  2Y6G A;  2BBA A;  4DXS A;  3FL7 A;  2WZ8 A;  2VM9 A;  4KI5 M;  4DUV A;  1US3 A;  3OGS A;  1JZ2 A;  4ZXE A;  3UET A;  4MGQ A;  4LQR A;  2VL4 A;  2VMF A;  4QDS A;  3FN9 A;  2VME A;  4BJ0 A;  1JYX A;  1TVG A;  3SEE A;  4OMD A;  2L9L A;  1P8J A;  2J7M A;  2W5F A;  4PF1 A;  4E8C A;  3LEK A;  2QQN A;  2W9X A;  5LCW L;  3CMG A;  2JD9 A;  2BER A;  1UXX X;  1EUT A;  4QB2 A;  1CIY A;  3GXU A;  3VDA A;  4P08 A;  3A23 A;  5IHR A;  1JZ6 A;  2QQO A;  2YFZ A;  4BDV B;  4A45 A;  4A4A A;  1RYY A;  2CDO A;  2ZEX A;  5A1A A;  2VOT A;  1DYO A;  2V4V A;  5DQ0 A;  2HYX A;  3I2J A;  1OF4 A;  2W92 A;  1F4A A;  1EUU A;  1TG7 A;  1JYW A;  2OKX A;  1GNY A;  1UZ0 A;  4A41 A;  1XNA A;  4DXR A;  2VTF A;  2HLE A;  3NQH A;  3I2G A;  2QBX A;  2PQS A;  2WDB A;  5JR2 A;  1UMH A;  2Y6K A;  3ABZ A;  4XUQ A;  1PMH X;  4XZU G;  3HEI A;  3WSO A;  2ZEY A;  5LA2 A;  4GZ9 A;  2VZT A;  2QQK A;  1UYZ A;  1H6Y A;  5JXG A;  3WEZ A;  1UYY A;  2WUH A;  2BZD A;  4QPW A;  2VR4 A;  2B4K A;  1CZV A;  1YQ2 A;  3GDB A;  4QX3 A;  4AAX A;  4DUW A;  3W5M A;  4FI9 A;  4MAD A;  4QB1 A;  2J22 A;  2VQU A;  1GOH A;  4BK4 A;  3C7F A;  3NJX A;  3P1I A;  2ORX A;  1GUI A;  1KEX A;  3C7G A;  4ZY9 A;  2YFU A;  3VD4 A;  1DP0 A;  3PUH A;  3PUI A;  4HG6 B;  1UY2 A;  2WO1 A;  4A3Z A;  2DCJ A;  4CUA A;  3GGL A;  1JU3 A;  1K42 A;  3BN6 A;  1UX7 A;  3FHQ A;  1GOG A;  3FHA A;  3NNG A;  3C7E A;  1LNS A;  1KGY A;  1ULO A;  5I0D A;  5HPO A;  4MOA A;  3U37 A;  1GU3 A;  1NAE A;  1GQP A;  3SKV A;  3HNM A;  1OT5 A;  4XUO A;  3OEB A;  2C4X A;  1W0N A;  3SKJ E;  1PMJ X;  1JHJ A;  2VJX A;  4XUP A;  3WNM A;  2XHN A;  1US2 A;  3VD9 A;  3CQO A;  4LHS A;  1O8S A;  1O8P A;  3WF4 A;  2WAB A;  3WQB A;  2WZE A;  2C26 A;  1XNT A;  4CUB A;  3LEG A;  1SDD B;  2JKX A;  3VD7 A;  1UWW A;  2LS6 A;  4IUG A;  3OB8 A;  4JHZ A;  4TTG A;  3K77 A;  3OEA A;  3WF3 A;  1UY4 A;  2ZEZ A;  3LPG A;  3JXS A;  3E1F 1;  4KWU A;  2VZS A;  5JXJ A;  1JYN A;  4P00 B;  2RJ2 A;  5G05 L;  3LQC A;  3UES A;  2X09 A;  1PX4 A;  4DXT A;  4E8D A;  2QQM A;  1HN1 A;  1JYV A;  4D0Q A;  2WO3 A;  3P6B A;  5DN2 A;  2EIC A;  1D7P M;  4GWI A;  1JZ8 A;  3HJR A;  4MO3 M;  2Y6H A;  2WYS A;  3THC A;  2JE8 A;  3THD A;  1UY1 A;  3OGV A;  1GOF A;  3W5N A;  5F7U A;  2JDA A;  3DYM A;  2W1U A;  4JKM A;  3D3A A;  3A21 A;  1UY3 A;  4KMQ A;  1UYX A;  3F2Z A;  2VCA A;  5C71 A;  2QQL A;  2WAA A;  1IQD C;  3DYO A;  3DYP A;  3LPF A;  4M4P A;  2Z4F A;  1XC6 A;  2J1S A;  5CZK A;  3ZM8 A;  4P5Y A;  2W3J A;  3WNO A;  2BGP A;  2VZV A;  2VZ3 A;  3NJV A;  1JU4 A;  5HXM A;  4BK5 A;  2EIB A;  2QQI A;  2VQT A;  2WN2 A;  2VO5 A;  2ZXQ A;  3T2P A;  2W47 A;  3HOB A;  2VZR A;  3T0A A;  2E32 A;  2W1Q A;  2WAO A;  4A6O A;  4M4R A;  3NRU A;  1JZ5 A;  3III A;  3WNL A;  3ETP A;  4QDQ A;  5G04 L;  4ZZ8 A;  5JUV A;  3BGA A;  4OYU A;  3K4Z A;  3VDB A;  3I2K A;  5JXH A;  3WNN A;  2VZQ A;  2Y8K A;  3I2H A;  3I2F A;  2RV9 A;  2VZU A;  3MBW A;  1BHG A;  1UXZ A;  1UY0 A;  2E31 A;  4CU8 A;  5EJ1 B;  3WF0 A;  4XUR A;  5IFP A;  3EB7 A;  1NX9 A;  3WF1 A;  1K3I A;  2V5D A;  1W9T A;  4DEV A;  1SHW B;  1T2X A;  2VZO A;  3IB3 A;  3T0B A;  2V72 A;  2VCB A;  3ACG A;  5DPN A;  1XPW A;  1JZ3 A;  3ACI A;  3UNP A;  3J7H A;  5C7G A;  3T0D A;  2Y64 A;  4YPJ A;  3VD3 A;  4ZZ5 A;  3T08 A;  2X10 A;  2W46 A;  1MPX A;  2J1R A;  2J1V A;  2VMD A;  5IJR A;  1OF3 A;  3I3B A;  1J84 A;  5EJZ B;  2QQJ A;  1PX3 A;  2ORZ A;  2Y6J A;  4W4Z A;  2XQX A;  2J1U A;  4QX2 A;  3VDC A;  2XON A;  4P02 B;  3MUY 1;  3T09 A;  3CZJ A;  3SEP A;  2WO2 A;  3K75 B;  2WQ8 A;  3EYP A;  4QX1 A;  1R64 A;  1O59 A;  5EIY B;  3LE0 A;  3GM8 A;  1H6X A;  1J83 A;  1W8N A;  2Y6L A;  2VC9 A;  3IDA A;  2VZ1 A;  4A42 A;  2YC4 A;  4PT6 A;  3HPN A;  4W50 A;  3K4A A;  4QAW A;  3DEC A;  3CKH A;  3AC0 A;  1WCQ A;  4UAP A;  4D8M A;  1W8O A;  1WKY A;  2DDU A;  5CYY A;  4QB6 A;  4OMC A;  4JKK A;  2XOM A;  4DUX A;  3MO4 A;  2VMC A;  4A44 A;  4QDR A;  1JZ7 A;  2E33 A;  4LKS A;  4Z2A A;  4QX0 A;  3ECQ A;  2X05 A;  5JXI A;  3VD5 A;  1W99 A;  3C7O A;  4CU7 A;  3CDZ B;  5DMY A;  3OGR A;  2B9V A;  4RN5 A;  1K12 A;  2YB7 A;  2VZP A;  3K46 A;  4CVU A;  4RYD A;  3WNP A;  1I5P A;  3HNB M;  3MV1 1;  2W1S A;  4L0P A;  3HN3 A;  4LPL A;  3IAP A;  5IFT A;  3I3E A;  5JMO A;  4ET7 A;  3CIH A;  3HNY M;  3T2Q A;  2C9K A;  1W9S A;  3I97 A;  3LEI A;  1CX1 A;  4CU9 A;  1JZ4 A;  1OD3 A;  2W87 A;  4BXS V;  2EID A;  3T2O A;  3K4D A;  2W95 A;  4XUT A;  4MGS A;  4ARY A;  1CZS A;  4TXW A;  5LA1 A;  2CDP A;  3ACF A;  4XUN A;  2WBK A;  2KD7 A;  1GMM A;  3CZU A;  1L7R A; 
#chains in the Genus database with same CATH topology
 2D6P A;  2SBA A;  1XNB A;  1AXK A;  5I0S A;  3IAQ A;  2VUA A;  1DLC A;  1CZT A;  3LZZ A;  4KGG A;  1G6N A;  1O7F A;  2A73 B;  2ZGR A;  4YNI A;  5LK5 A;  5AVP A;  1F2N A;  2EIG A;  3ZMN A;  2AEZ A;  4ARX A;  4CU6 A;  4ZON A;  3C3V A;  5JWP A;  4AVA A;  5BNP C;  5FPB A;  4P9W A;  4WV8 A;  1XE0 A;  4XJ9 A;  5FOJ B;  4JGY A;  1YWK A;  1OH4 A;  4AG4 A;  2VVD A;  5FPX A;  4BHP A;  3AYA A;  2YV8 A;  3J7L A;  1OKO A;  2W2I A;  3CU7 A;  1W9W A;  3KCX A;  3H7Y A;  1NG0 A;  2KA3 A;  1OA3 A;  3B94 A;  3O1O A;  1ZA7 A;  3I4I A;  3MUZ 1;  3H50 A;  4UOJ A;  5LBF A;  4TLF A;  1XU1 A;  3FHI B;  4QX7 A;  4IL7 A;  3VKL A;  4R4X A;  4XYX A;  3SMH A;  2FDI A;  2RDR A;  4EZH A;  2BP6 A;  2RE9 A;  1PGW 1;  1YO8 A;  2HWF 1;  4FVV A;  4IEV A;  4AI9 A;  5LW9 A;  4IV1 C;  5FQ0 A;  1POV 1;  1Q43 A;  4YGD A;  3AZV A;  3E6C C;  5A3N A;  2WQ4 A;  5BXX A;  4WM7 A;  2JEC A;  3FUO A;  2OA2 A;  2CGO A;  5L7O B;  4UFK A;  1YHF A;  1VMJ A;  5F6K A;  2W91 A;  5TSW A;  4LIT A;  1PGL 2;  1TNF A;  5GZF A;  5CFC C;  1F4H A;  1G8W A;  3SIT A;  4KU8 A;  3BOP A;  4LO8 A;  1DQ0 A;  2J1E A;  5FP3 A;  3FLR A;  1SPP B;  2QCS B;  3I3D A;  5IW0 A;  2WZR 2;  2ID4 A;  3MIB A;  4YGB A;  5I8Y A;  1W39 A;  3ZYI B;  2A3W A;  3U0Z A;  4JDN A;  5KWR A;  4AHW A;  1OVS A;  2OS2 A;  4IE0 A;  1LU1 A;  2E9Q A;  4KI5 M;  3S7E A;  1IGO A;  2WC2 A;  3POI A;  3OGS A;  4FOQ A;  4TWT A;  4ZXE A;  4S2G A;  3MF6 A;  4K1Y A;  5ABJ C;  3OBR A;  1MEC 2;  3Q8A A;  2R04 1;  4YFW A;  1HKD A;  2VMF A;  1FI2 A;  3ILN A;  4EN0 A;  2VME A;  2WS9 1;  5DAW A;  1EV1 1;  3O1P A;  4OCT A;  1PIV 3;  4DPN A;  4FQ4 A;  1GAN A;  1MZF A;  1TVG A;  3SEE A;  1VRH 1;  5GLZ A;  1PNF A;  4PF1 A;  1IHM A;  4V2W A;  3ZN4 A;  3LEK A;  4BQX A;  5L73 A;  1WCK A;  1X50 A;  3DL3 A;  1RHI 3;  4HK8 A;  2JD9 A;  3U14 A;  3V0B A;  5DDJ 1;  3ETQ A;  3N9P A;  1EUT A;  4LO5 B;  3UV9 A;  3NWK A;  1TZO A;  1D4M 2;  1QY4 A;  1AL0 G;  1VBA 2;  3GAL A;  3GXU A;  3CL1 A;  4FPG A;  4LLF A;  3A23 A;  2HWE 3;  1QJE A;  5FYY A;  4AGG A;  5IHR A;  1FXZ A;  3FLP A;  5C4W B;  1C8N A;  3AKP A;  1H1A A;  2VVF A;  2VOT A;  2H6B A;  1GZT A;  2WA4 A;  1CQ9 A;  4I02 A;  4J1X A;  4MX3 A;  4N8M A;  1A3K A;  3AXD A;  1ONA A;  4XF3 A;  3WP5 A;  3WT3 A;  3MIC A;  4CDW A;  4GKY A;  4AE2 A;  2RS1 1;  1Z7S 3;  1WZX A;  1CJD A;  4MZU A;  3ROU A;  4WVV A;  3AVS A;  3O7O A;  4XMI A;  1ND3 A;  2PAE A;  5JDB A;  1AR8 2;  3AFG A;  1VAV A;  1ODM A;  1F4A A;  4XQ4 A;  5IVJ A;  4AR2 A;  2OKX A;  4YYO A;  3UKN A;  2O1Q A;  1QMJ A;  1GNY A;  3V0A B;  4B1L A;  4YVS A;  1N1Y A;  3S5A A;  2AEN A;  2FQP A;  2JB8 A;  2NZ9 A;  1OUX A;  1DZT A;  4XBL A;  2VTF A;  4FPH A;  2HLE A;  2O14 A;  4UFL A;  1W28 A;  3TEW A;  4Q4W 3;  5CKM A;  4EV0 A;  1VRH 3;  4MG2 A;  1QJY 3;  2QBX A;  2PQS A;  2R6Q A;  3POF A;  5JR2 A;  3ABZ A;  4XUQ A;  2PLV 1;  1PMH X;  2A75 A;  3OF1 A;  3WSO A;  5CAD A;  1X8E A;  5LA2 A;  2A71 A;  2YRO A;  4GZ9 A;  2VZT A;  3HBZ A;  3U10 A;  2WSV A;  2Q8C A;  4Y4Y A;  2PHW A;  2GN7 A;  4S2D A;  1FPN 2;  2Y33 A;  2WUH A;  1RC6 A;  4IER A;  3GDB A;  5F3E A;  1JMU B;  4LIV A;  4DUW A;  4Z8B A;  3LCP A;  4FI9 A;  2VNG A;  4U36 A;  2QDN A;  2VQU A;  2Z69 A;  2D6O X;  1UPI A;  3VGI A;  4YAR A;  3V0B B;  5DAQ A;  4ORF A;  4XC9 A;  3S5Q A;  2CTV A;  2Y6F A;  5CKN A;  5F37 A;  1W9Y A;  4RSU A;  2IVJ A;  2GN3 A;  3C7G A;  4LNV A;  5A3T A;  1BVP 1;  4GB3 2;  3VD4 A;  4W6W A;  1LCL A;  3UJO A;  1RUC 1;  2XUM A;  3IM0 A;  2ZX2 A;  4FPO B;  1AR7 1;  2QVS B;  3O0W A;  1VRB A;  2UU8 A;  3R05 A;  3IT8 A;  4N53 A;  3PUR A;  2JDU A;  4N43 B;  4O65 A;  3ZFE B;  4D6Q A;  2HWF 3;  4R52 A;  3ZFE C;  1UX7 A;  1SFP A;  3UT0 A;  1VBD 1;  2Q1Z B;  1C3H A;  1GOG A;  1WME A;  2XJQ A;  1NOV A;  4JZR A;  4FTE A;  2WT0 A;  2ZTN A;  4QU1 A;  3C7E A;  3H0O A;  3LOI A;  1Q5O A;  1ZBE 1;  2XGX A;  2YPD A;  3DPR A;  4HN0 A;  4NJ4 A;  5T54 A;  3KV6 A;  1LNS A;  1ULO A;  3WX5 A;  3PTR B;  3KCY A;  3O5S A;  1PGW 2;  4ZS3 A;  2EXK A;  3ZDS A;  3H8O A;  1RMU 2;  4J1W A;  3DV8 A;  4V1P A;  3AMP A;  5A70 A;  1RUH 1;  1GU3 A;  1NAE A;  3USU A;  5I0T A;  4IEQ A;  4FTS A;  5CFC A;  2P2K A;  5EWS A;  5FMB A;  3SKV A;  3PVO A;  4XUO A;  3PJY A;  1H1I A;  3Q8F A;  3OBT A;  4ASM B;  1QQP 3;  3R4S A;  4QPG A;  2C4X A;  1W0N A;  1VE0 A;  3WNM A;  2BEO A;  2HEV F;  2FD8 A;  1BMV 2;  2VOV A;  2XH6 A;  1US2 A;  2XHN A;  4B7K A;  1LHO A;  5A7N A;  3CQO A;  3HQU A;  3I3M A;  3PL0 A;  1F31 A;  5ERL A;  3ZSJ A;  2DUP A;  4LJH A;  4RQP B;  5F9T A;  3WQB A;  2D7F A;  2WZE A;  1BLZ A;  3QD6 A;  4UYB A;  3T30 A;  4Y1Z A;  1OFN A;  1VAL A;  4QXC A;  3LEG A;  1SDD B;  1SQ4 A;  4BOW A;  2HEW F;  1U5X A;  5CEH A;  5D2A A;  1PK6 C;  2D5H A;  3VD7 A;  2LS6 A;  4K1Z A;  4R9D A;  1DBN A;  2ZGM A;  4TTG A;  2IWG B;  3OEA A;  2ZEZ A;  4AYU A;  5C6C A;  3JXS A;  4LKE A;  5FPZ A;  3AMM A;  1HRV 1;  4XAB A;  3O1V A;  4C1W A;  4EZ4 A;  4LK6 A;  2VZS A;  4H2A A;  1IG0 A;  2BW8 A;  2RS3 3;  2P17 A;  3N7K A;  5J09 A;  3MLJ A;  3O1S A;  3LIH A;  2VQ0 A;  4B4P A;  1LU2 A;  5LAT A;  3UES A;  3RZL A;  4DZG A;  1I3H A;  4K8F A;  3QH6 A;  5A6Q A;  5FR3 A;  2X5I C;  3VB9 A;  5EPA A;  3A0N A;  1S0G A;  2WO3 A;  3P6B A;  5ABJ B;  4JTN A;  5C9A B;  1GP5 A;  2FHR A;  4AI2 A;  5A33 A;  3WG2 A;  2QUO A;  1JZ8 A;  2FDH A;  1C57 A;  1IS3 A;  3VZK A;  3PIJ A;  4AFB A;  3THC A;  1AR8 3;  4GQ7 A;  3WDT A;  1UY1 A;  3ZFG B;  1CWP A;  3AP5 A;  2LTN A;  4WM8 C;  2BUK A;  2XDV A;  5DG1 A;  3ZVX A;  1C1L A;  2XJU A;  4XET A;  5FZB A;  2JG9 A;  4D6S A;  4J25 A;  4CTE A;  1RUD 2;  3BTY A;  3EO6 A;  2XVL A;  1W2O A;  1NY7 2;  2ZAB A;  2G9Z A;  2YGM A;  4BA6 A;  2RJL A;  1MZ6 A;  3H1W A;  2G1M A;  4EE2 A;  4Y5Z 0;  5L7O C;  5EYX A;  1UU4 A;  1KXG A;  1J3R A;  1UYX A;  2YPJ A;  3M7A A;  4KMQ A;  4XDP A;  1VPH A;  2EXJ A;  3VBU B;  3VV1 A;  2H0V A;  5C71 A;  4UBG A;  5IVE A;  2XLG A;  3DYO A;  5C3Q A;  3JCI A;  1QIQ A;  4RR3 A;  3RZG A;  2Z4F A;  5CZK A;  2EAL A;  4LBO A;  4O9G A;  1L7L A;  4H7M A;  1NE6 A;  1UOG A;  1X33 A;  2VZ3 A;  4RHV 1;  3FFZ A;  4XZP A;  4BK5 A;  4NE9 A;  4Q4X 3;  2VQT A;  2ZGO A;  3MLL A;  4YM0 A;  1ACC A;  2ZXQ A;  2H6C A;  2W47 A;  5GLW A;  1MS5 A;  3VBO C;  1RUG 3;  2VZR A;  2WA3 A;  4QKB A;  1O3S A;  5E8A A;  2CNA A;  4AQ6 A;  2CV6 A;  5JSO A;  2ARX A;  2E32 A;  4OUL A;  2W1Q A;  2ZMK A;  3SH3 A;  2F4L A;  1YIF A;  4HKO A;  1VAM A;  4N53 B;  1H2K A;  5JSP A;  3N9M A;  4A6O A;  4FPF A;  4LBM A;  2HWC 1;  4GJZ A;  1ASJ 2;  4M4R A;  5A80 A;  4AVS A;  4B4R A;  2OZJ A;  2AYH A;  2DUR A;  1KS4 A;  2WJS A;  4Y26 A;  3RQ0 A;  1DQ6 A;  3III A;  3WNL A;  4E4Z A;  5FY5 A;  4Z2W A;  5DDJ 2;  4OLL A;  4NRQ A;  1G9A A;  3J8F 1;  1MR5 A;  4ZZ8 A;  5JUV A;  3BGA A;  4XIK A;  1X8M A;  5T55 A;  2A3Y A;  4MUV A;  1XSR A;  4YZ3 A;  1VJ2 A;  4AK3 A;  1LUL A;  3UGH A;  3SCF A;  1WA4 A;  3VDB A;  3IWZ A;  5I91 A;  3FFQ A;  5FLI A;  4HKW A;  5FZC A;  3I2F A;  4MGK E;  1WCD J;  4QQL A;  2Z5W A;  3NST A;  4G3Y C;  4KG8 A;  1BHG A;  1UXZ A;  2QQV A;  4A7K A;  3RPQ A;  4OQ8 A;  1JYT A;  4CU8 A;  1Y43 B;  4IV3 C;  3U4X A;  5FZE A;  3CJI B;  3N7M A;  1LR5 A;  2ZGU A;  5IFP A;  5F3I A;  3WF1 A;  1IPS A;  1K3I A;  1IZ3 A;  4Y5T A;  1YJL A;  2PN5 A;  1H8V A;  1OA4 A;  4IEX A;  4DIN B;  1DYP A;  4WVW A;  3NO8 A;  3VHN A;  4A7Z A;  3CJI C;  2VCB A;  5DPN A;  3VLB B;  2YZ4 A;  1MQT B;  3AYD A;  1AR7 2;  1XPW A;  4CP9 B;  3ACI A;  4QWN A;  3B69 A;  2JDH A;  3AM2 A;  5C7G A;  5E88 A;  3J26 N;  3PIG A;  2WNV A;  2WS9 2;  3LA2 A;  3DPR B;  4Q0V A;  3WDX A;  1XND A;  4YZ1 A;  1S2K A;  2X10 A;  1UKG A;  2W46 A;  2ZOE B;  4ES8 A;  3U4S A;  2GP5 A;  2J1R A;  4LA3 A;  1A6C A;  5IJR A;  5C3S A;  2YDE A;  1ZYB A;  5E16 A;  5D1I A;  1J84 A;  2ZZQ A;  4YWA A;  4K6B A;  3ZYH A;  4N7U A;  5JZG B;  3VBH C;  3IMM A;  4NAO A;  1VBB 1;  4DMI A;  5T52 A;  3KQR A;  2GH2 A;  2R07 3;  1PO1 3;  4AVC A;  1E5S A;  4P02 B;  1K5M A;  2R1B A;  3ZR5 A;  1HN0 A;  3UGF A;  4FAH A;  2BOJ A;  4AEM A;  1NA1 A;  1IPJ A;  5L9B A;  1A78 A;  1W6M A;  5EFU A;  2PYT A;  4BM8 A;  2ZML A;  2VVE A;  2WO2 A;  3ZYJ B;  1H8T A;  3AL5 A;  2WQ8 A;  1SAC A;  4GMP 1;  3LE0 A;  3J7N A;  4KWK A;  4OUM A;  5LZ6 A;  4KWL A;  4CDX C;  4GD4 A;  5FY9 A;  2WWU A;  4Y1Y A;  4QXB A;  1AR7 3;  4IGP A;  5EP9 A;  3V65 A;  3KV5 A;  3ZSE A;  3ZXL A;  4CDQ B;  3TEZ A;  2ZPX A;  5FY0 A;  3IMN A;  2I07 B;  4PJY A;  4PT6 A;  5SV8 A;  4W50 A;  2CYF A;  2YBP A;  4QAW A;  3VBS A;  4NIG A;  1QOS A;  1AL2 3;  5GZG A;  1WCQ A;  3ZSL A;  4D8M A;  4K3U A;  1CPN A;  4LO4 B;  3S0M A;  5APA A;  1V6M A;  3E5X A;  5FUP A;  1C28 A;  1WD3 A;  5K4L A;  5HV0 A;  2XVK A;  2RS3 2;  3WR0 A;  4DUX A;  4DY3 A;  5JCT A;  4GMP 3;  2E7A A;  4KL1 A;  4LKS A;  1PZ9 A;  3ZFG C;  3LGR A;  3VD5 A;  1FAY A;  5FOB B;  3C7O A;  3U11 A;  4QMA A;  1HRI 1;  3CDZ B;  2ENR A;  3T1M A;  1XXN A;  3HAG A;  5FZI A;  5FQ0 B;  3OUJ A;  4RS5 C;  3ZYR A;  2VXR A;  3GCX A;  1ND3 B;  1PO1 1;  4X6R B;  3AYC A;  3JD7 3;  3TRS B;  3K46 A;  4LE3 A;  4OHV A;  3BIW E;  4CVU A;  1R08 3;  4LMF A;  5M0T A;  1LGN A;  1UZY A;  4RYD A;  3BOW A;  1V6K A;  3I59 B;  3WG1 A;  3VBF B;  4FFG A;  1DQ1 A;  3LF7 A;  1O5U A;  1KS5 A;  5FZL A;  3DGT A;  5FMO S;  2NN8 A;  2W1S A;  2ZGQ A;  3MEP A;  2ARB A;  4P9G A;  4XHB A;  3ZXE A;  1BYH A;  3JZV A;  2XBO 3;  3L2H A;  1SZB A;  2UWC A;  5FZK A;  4JGY B;  3WVJ A;  5IFT A;  5L36 A;  4JQR A;  2RS1 3;  1I9R A;  3I3E A;  4H55 A;  3VBR C;  1WLW A;  3IKW A;  1NA1 B;  4WM7 C;  1YRZ A;  1TME 3;  3AZZ A;  4AAP A;  4WZF A;  1W6N A;  1NT0 A;  3VUO A;  2B5H A;  3ZO0 B;  3N35 A;  4BXS V;  4WM8 B;  3AZW A;  1DGW A;  2GZW A;  1AL2 2;  1G86 A;  1S1A A;  1OXC A;  2D44 A;  3ZSM A;  2R1D A;  3RZZ A;  4EYU A;  4MGS A;  2IUW A;  1YFU A;  4HSL A;  4DXS A;  5KXC A;  3VN4 A;  4ASK A;  5LA1 A;  2QKD A;  2O8Q A;  4AED C;  5A7Q A;  3SNM A;  2R0F A;  4COY A;  1RIN A;  1VB2 A;  2CDP A;  4D7Y A;  3MW3 A;  4EJR A;  2EXH A;  3GF6 A;  3ACF A;  4FOY A;  5FP8 A;  4BQ5 A;  2WBK A;  3N9L A;  2KD7 A;  2XKO A;  3ON7 A;  3LEM A;  3CZU A;  2BBV A;  5I0R A;  2YC2 A;  3C7H A;  1NUK A;  2RVA A;  2DCT A;  3A7Q A;  3GJB A;  2QJV A;  3VBR B;  3DUI A;  4QM8 A;  4LR4 A;  1G9C A;  1TNR A;  4K8R B;  4PIY A;  4QXK A;  4XVH A;  3OG2 A;  1V9U 2;  2F6B A;  1NKG A;  3USS A;  5C8C A;  4ONU A;  3HVD A;  3FC0 A;  2VAU A;  3R6S A;  4AF9 A;  1TME 2;  1BEV 3;  2NP0 A;  2BPA 2;  2V73 A;  4YM3 A;  1URX A;  4NRM A;  1W03 A;  1GWK A;  2R07 2;  2D98 A;  1UO9 A;  3NV1 A;  3W59 A;  1WMF A;  2W1W A;  4XF1 A;  1E57 A;  2YG0 A;  5LEJ A;  2GAU A;  4H7L A;  1RHI 2;  2V09 A;  2Z42 A;  1BMV 1;  1SG3 A;  1OD5 A;  1IOA A;  2ATF A;  1J1L A;  4RS5 B;  5K8S A;  1K45 A;  3RZK A;  4B7E A;  4GXL A;  4G9S B;  4OHW A;  4OZO A;  3K48 A;  3VBU A;  3FE5 A;  3VKO A;  5FYM A;  1C5I A;  3NJZ A;  3O12 A;  3RNS A;  1DZR A;  2VOW A;  4NN0 A;  2ZEW A;  3WF2 A;  4QHZ A;  3O1T A;  1YFX A;  1YXW A;  4I2O A;  2JDN A;  2V5Y A;  1PO2 3;  1WWY A;  3E6B A;  4Q4Y 1;  2WN3 A;  4JQT A;  4XCB A;  1GFF 2;  2FZ1 A;  1BBT 2;  1Y3T A;  5F2S A;  3NNM A;  3K2O A;  3WHT A;  1D0H A;  5FZO A;  1GQG A;  2DVA A;  1VMH A;  4NHX A;  1G9F A;  1W3V A;  3A22 A;  4R8H A;  1QKQ A;  4KQ7 A;  3DF0 A;  3MHZ A;  4NIA A;  3X29 B;  1WD4 A;  1XE7 A;  1PGL 1;  2BVV A;  2NLR A;  3C8X A;  3MIE A;  4AFD A;  1SLA A;  2J1A A;  1ENX A;  1NCR C;  2VMI A;  4QPI C;  4LTA A;  5LWB A;  3FL7 A;  3AKQ A;  3PDQ A;  3RZM A;  1ND2 A;  2WZ8 A;  3FX3 A;  1CAW A;  1HV0 A;  3M70 A;  1KQR A;  4EWE A;  1US3 A;  2FCU A;  4AI0 A;  1AR9 3;  2GC1 A;  5IVB A;  4GKX A;  1RIT A;  3AXE A;  4MGQ A;  2NQY A;  4S2F A;  2VL4 A;  4QPI A;  2ETE A;  2IXL A;  4QDS A;  3AFK A;  1RXF A;  1LHU A;  4M0H A;  2GMM A;  3A4U A;  3KM5 A;  2OXB A;  3VBS C;  1NXM A;  1GIC A;  3A0K A;  4OMD A;  5CNA A;  1JS9 A;  2GME A;  2E7T A;  4E8C A;  1X9T A;  2ZX1 A;  4Q4V 2;  2W9X A;  2GMP A;  2BTV C;  2Z2S B;  4BME A;  2IFR A;  2AUY A;  1UXX X;  2BER A;  2OII A;  2ZKL A;  4AHY A;  4CEW B;  3S57 A;  1RJ8 A;  3ZFG A;  4CEW A;  3POE A;  4MSV A;  2JIJ A;  4HPK A;  4P08 A;  4C8D A;  2QQO A;  1ENS A;  4A45 A;  4A4A A;  1J3Q A;  1RYY A;  5FY7 A;  1OPO A;  1R09 3;  2ZEX A;  5LBE A;  3WQ0 A;  1CVN A;  1BBT 3;  2V4V A;  1H4G A;  2RR1 2;  5A1A A;  2RHP A;  3RYR A;  1PO2 2;  5CG8 A;  1R1A 2;  3AZY A;  4QKF A;  2HYX A;  5FZF A;  2JEM A;  2A6X A;  2ZHL A;  3I2J A;  1QWR A;  3FMG A;  5BYN A;  1AUY A;  2GDF A;  4YVS C;  2FMD A;  4IE5 A;  4ZS2 A;  2JDZ A;  3V64 A;  1OF4 A;  2X53 S;  2W92 A;  4LHK A;  3KB5 A;  1PO2 1;  5A3P A;  1TG7 A;  5L9V A;  1JYW A;  2KM2 A;  2RG4 A;  1UZ0 A;  2YY1 A;  3CHX A;  1N1S A;  3UJQ A;  2IXK A;  2LM3 A;  1G7Y A;  4YRD A;  4PF5 A;  1LGB A;  4N43 A;  4OVE A;  5EYY A;  1FPN 3;  3I2G A;  5AFB A;  3SCH A;  1FMD 2;  2ARA A;  4XQD A;  4YG3 A;  2F17 A;  1I1E A;  4UF0 A;  1GQH A;  2WNE A;  2Y6K A;  5A3U A;  4XZU G;  3HEI A;  4Q1P A;  3OGJ A;  1H9P A;  4D6R A;  2ZEY A;  4IGQ A;  4Z92 B;  1ZX5 A;  3IPV B;  5FZM A;  4HET A;  2QNK A;  5C3P A;  3AKS A;  4GMP 0;  2BZD A;  4QPW A;  3HBK A;  5GLT A;  3RFR A;  2CL2 A;  1AXZ A;  2WL1 A;  3OPZ A;  4AAX A;  4MAD A;  4JDM A;  5C5T A;  2BV4 A;  3JB4 C;  1PK6 A;  1ZRE A;  3BOD A;  2HWD 3;  2MPF A;  2K2S A;  1RVF 2;  5IT6 A;  1RUO A;  3VHR A;  3NJX A;  3R4D B;  2ORX A;  2FCT A;  1GUI A;  3RVH A;  3IDC B;  3MYX A;  4GAZ A;  1ULE A;  1W2N A;  1CON A;  4UW3 A;  5JPN B;  4CRQ A;  1J59 A;  1RUG 1;  1VLN A;  2N7G A;  2YFU A;  2CWM A;  2QZ3 A;  3PUI A;  4L11 A;  1OHF A;  1QXR A;  3LDB A;  4QX8 A;  1AJK A;  1UQX A;  4CEY A;  1RUH 3;  2RMU 3;  3NNL A;  4LK7 A;  1O91 A;  3LWC A;  3POJ A;  2WR9 A;  1IQA A;  1PVC 3;  4GA9 A;  1JU3 A;  4BU2 A;  5C3R A;  5C9A C;  2XJR A;  1QJX 1;  3I2O A;  2X5I A;  2R16 A;  4P5H A;  4Y4R A;  4ISQ A;  5IK8 A;  5T5L A;  4XW3 A;  1W8F A;  1STM A;  3ELN A;  3TEX A;  2OQ6 A;  3H3Z A;  5BNP B;  3O1R A;  4RGG A;  3IIA A;  1TQ5 A;  3QBQ A;  5HPO A;  5BPX A;  3KMH A;  5J96 B;  4LLO A;  1VB4 A;  4MHR A;  3THP A;  4CCD A;  4L9B A;  3DKW A;  2ES3 A;  1B35 A;  1GQP A;  4XF0 A;  1OT5 A;  3WIN E;  3SH4 A;  2FDG A;  1RUN A;  4JRL A;  1FX5 A;  4CDW B;  1GZC A;  3VZN A;  2CAV A;  5JSR A;  2PLV 3;  2ZS6 B;  1PMJ X;  1QQP 2;  3PU8 A;  2WSU A;  4XOG A;  3VD9 A;  4PDW B;  4LHS A;  2IVI B;  1UCX A;  4RQP C;  3WF4 A;  4PCR A;  5FDB A;  2WAB A;  5FKC A;  5FRE A;  2RM2 1;  5DUU A;  2W39 A;  5JOW A;  5DZG A;  1H8T B;  1ASJ 1;  2D6K A;  4UW5 A;  3NMB A;  2C26 A;  1RUH 2;  2MEV 1;  4YVW C;  4CUB A;  1QGL A;  1XNC A;  2EAK A;  1SLT A;  3R0R A;  4HXC A;  4IEP A;  4RQP A;  4IUG A;  1CAU A;  4LUL A;  1UY4 A;  3LPG A;  2WO7 A;  2VXJ A;  5CU1 A;  1AHS A;  5GLU A;  2W08 A;  2HWD 2;  3TN9 3;  4Q1R A;  3VDD A;  5SV5 A;  1VBE 2;  1Q8O A;  4RHV 2;  2JDM A;  3ZXG A;  2RJ2 A;  1JOB A;  3TYJ A;  4BIO A;  3JBG 1;  2ZZJ A;  4EN7 B;  3OJB A;  2HWC 3;  5ACA 2;  4CP2 A;  4Y3O A;  4XFA A;  1ULF A;  3RS6 A;  4E4D X;  5DN2 A;  2EIC A;  1GZ9 A;  1JW6 A;  2XQR A;  3FBY A;  1AYN 2;  2K0G A;  1H1M A;  1ZBE 3;  3HJR A;  5A3M A;  4TSV A;  4BQW A;  2B8M A;  2BGC A;  4N90 A;  1R1Z A;  3HWJ A;  5IAX A;  4M3C A;  3TB0 A;  4LIU A;  5FY4 A;  4K20 A;  4NID A;  1QOT A;  3O1M A;  5FZG A;  5IWF A;  1W8H A;  4RD7 A;  4G4F A;  2HWE 1;  4YSF A;  4DRR A;  2RDQ A;  4CP1 A;  3MI8 A;  2PXJ A;  1DLL A;  2JWP A;  3W5N A;  3AK0 A;  5F7U A;  5CFD C;  4YW4 A;  3H8R A;  3WDV A;  1ZBE 2;  5GAL A;  1VBB 3;  4CCN A;  2F4P A;  2P4E A;  2YC0 A;  4AWD A;  1JH5 A;  4B3N A;  5DUV A;  1GZW A;  2PFW A;  5ACA 3;  5KXB A;  5FMD A;  1FOD 2;  2AAC A;  2HH9 A;  3VKN A;  1RGS A;  1D2Q A;  1HDK A;  1WLC A;  1H0B A;  2QQL A;  4COW A;  4NRO A;  4AFA A;  3RJ2 X;  2VH9 A;  2WWJ A;  2RR1 3;  4P14 A;  2WT1 A;  1VBE 3;  1NCR B;  3JUU A;  3IN9 A;  1COV 2;  4JV4 A;  5GZD A;  2A6Z A;  3OD4 A;  3OD0 A;  4Q0P A;  3I59 A;  2J1S A;  4FCA A;  4AQT A;  1CAX B;  3WNO A;  2W3J A;  2DUQ A;  2WYF A;  3MID A;  4QX5 A;  3WDU A;  2VZV A;  4LBJ A;  4BLI A;  4AGR A;  4BMB A;  2CHH A;  2RS3 1;  2EIB A;  2QQI A;  2WN2 A;  2VO5 A;  3ZXJ A;  3LDK A;  2OPK A;  1WCS A;  4HOO A;  1LHN A;  4LA2 A;  1R08 1;  3T0A A;  1OLR A;  4JVA A;  2XL9 A;  3JD7 1;  5J48 A;  4I30 A;  2GC3 A;  5A32 B;  3M3C A;  3HIF A;  4SBV A;  2WNV B;  4XXP A;  4E2Q A;  1D4M 3;  1VBA 3;  4D7S A;  5B2G B;  1AYM 2;  2PLV 2;  1B09 A;  4KH9 A;  4OI1 A;  1NQD A;  1N3Q A;  1UZZ A;  3ETP A;  3RSJ A;  3ZR6 A;  4BQ4 A;  3BTX A;  1NE4 A;  1W05 A;  4MH0 E;  4Q8L A;  4QM9 A;  5L19 A;  4WVM A;  1C4R A;  1KFU L;  2ZHK A;  5KHG A;  1NLS A;  3ASI A;  4FO9 A;  2GC2 A;  2V4A A;  4IV3 A;  3I2K A;  4AFM A;  4UW6 A;  2VZQ A;  2JE9 A;  2Y8K A;  5C33 A;  1H8T C;  5JXH A;  1ZRC A;  5FYC A;  1ZZ9 A;  3WCR A;  1R09 1;  4C0B A;  1KFX L;  3M1H A;  1GWM A;  2VUD A;  3IBM A;  1RUJ 2;  4QQ2 A;  5EJ1 B;  2GNT A;  1LOG A;  1IKP A;  2JG9 B;  4IE4 A;  3EB7 A;  4OZX A;  1AJO A;  5JIA A;  2JDP A;  1UF2 C;  1W9T A;  2ARC A;  2V5D A;  1RIR A;  4NWW A;  1AZD A;  1ST8 A;  3I8T A;  4HLT A;  3ILF A;  4MET A;  1JOD A;  5FPA A;  2D3R A;  4DEV A;  1NA1 C;  1T2X A;  4ERO A;  1NYW A;  3IB3 A;  3KT4 A;  3T0B A;  4AVV A;  1SCS A;  3GBG A;  2QFE A;  1L3J A;  2JG9 C;  1AR6 2;  4L92 A;  5KHH A;  4Q4W 1;  4AHZ A;  2XB6 C;  3W9A A;  5IK4 A;  3N4M A;  1VRH 2;  2JKB A;  1DYK A;  1JZ3 A;  4Y1V A;  2XJT A;  2YMZ A;  3J7H A;  3T0D A;  3LAG A;  4MGZ E;  2XWJ B;  4LKF A;  3K3N A;  5FP4 A;  4YPJ A;  1SLB A;  3H9A A;  4I0A A;  1ENR A;  2HKX A;  1MPX A;  3POB A;  1V6L A;  3URF A;  3WW2 A;  2X5I B;  2CGP A;  1U0A A;  1OC1 A;  1WW6 A;  2ZKN A;  2EXI A;  5A3O A;  1APN A;  4AXO A;  1SPP A;  4GH4 C;  3AMN A;  3FJS A;  5FZ6 A;  2XXZ A;  4CP9 A;  1NQJ A;  1REE A;  2BFU L;  4MXW B;  2QQJ A;  2VCM A;  2ZAC A;  2Y6J A;  2CWS A;  3M4F A;  4W4Z A;  5FV3 A;  1OUS A;  1FMD 3;  3ENR A;  5ANQ A;  1GWL A;  1KIT A;  3POS A;  3ZSK A;  2ARE A;  2PAM A;  2Q0A A;  5L9R A;  2XJV A;  3MUY 1;  5FZA A;  4YFZ A;  3OYW B;  1POV 3;  5T50 A;  5CG9 A;  3H3U A;  1H2L A;  1XSQ A;  3LFI A;  4RS5 A;  1PK6 B;  4UFH A;  3CZJ A;  1W6Q A;  3WLU A;  3ZFF B;  1VBC 1;  3GYD A;  1F5J A;  1PM7 A;  2VW2 A;  3SEP A;  1VBE 1;  2Q8E A;  3UKV A;  2MHF A;  4UFJ A;  3WUD A;  4W6X A;  1AR6 3;  1MS4 A;  1O59 A;  1X82 A;  4OI2 A;  4Q4Y 2;  5EIY B;  1H6X A;  1T6G C;  1UKR A;  2VC9 A;  2VZ1 A;  2DVB A;  3IDA A;  2R30 A;  2YC4 A;  4A42 A;  4DO0 A;  4UW4 A;  1W6P A;  2RS1 2;  3VDD C;  4UFI A;  3K4A A;  2JG8 B;  3DEC A;  3DCQ A;  5CFC B;  1EYB A;  4UAP A;  4ZU5 A;  1YQ6 A;  5FMC A;  2RR1 1;  2DDU A;  1RUI 2;  4QB6 A;  5LA9 A;  2WFF 2;  1N3P A;  2C6S A;  3AP7 A;  3GBW A;  1CIW A;  4A44 A;  5DZE A;  1JZ7 A;  2E33 A;  1H30 A;  1HV1 A;  3H7J A;  3ECQ A;  3ZFE A;  2WLQ A;  4LHL A;  3ZPO A;  1TME 1;  1W99 A;  2JDK A;  1KDM A;  2VY0 A;  4XFB A;  5FIX A;  4CU7 A;  1FOD 1;  2C9A A;  1V6O A;  3OGR A;  2B9V A;  2PHF A;  4N43 C;  2YU2 A;  1XJA A;  2VZP A;  3R4U A;  4CPB A;  5T5P A;  3N7J A;  1WW7 A;  2PHT A;  5F5C A;  2ZGS A;  4PQ9 A;  1YCI A;  1MVE A;  1YI7 A;  2VUJ A;  3WNP A;  3INA A;  4Q4X 1;  4GIQ A;  5HCB A;  3VBH B;  2HEY F;  5AC9 2;  4XFC A;  1QJX 2;  1S0F A;  3LA7 A;  3NAP B;  4J6G A;  1S55 A;  3GHM A;  2VD7 A;  5EXO A;  3ZYF A;  3MW4 A;  1ULC A;  4XJA A;  3AMQ A;  2IXC A;  2VBB A;  4ET7 A;  5IVC A;  1RUC 2;  1RB8 G;  2C9K A;  3N3H A;  4CCL A;  1UOJ A;  4AW7 A;  1W90 A;  1NXD 1;  4M3C F;  1CX1 A;  4CU9 A;  3AKT A;  2XJP A;  4PHZ A;  2KXL A;  2O0O A;  1UW8 A;  4IDZ A;  5F5Q A;  2D5F A;  4DS0 A;  1S0B A;  2WKK A;  4HKL A;  3TNQ A;  3CF6 E;  5AC9 1;  4CUG A;  2NPI A;  1HXS 1;  3TWI A;  4AI8 A;  5A32 A;  1N1V A;  1FNZ A;  2BQP A;  4CYD A;  1GMM A;  3L9J T;  5IVV A;  3T3Y A;  4CUC A;  5IYY A;  5J1X A;  4PQQ A;  2VNV A;  2NMN A;  2YBS A;  3CBN A;  3KHB A;  3AJY A;  1AF9 A;  5C8W A;  2I45 A;  3WOG A;  1DGR A;  3I49 A;  2RMU 2;  3KT7 A;  2DBI A;  4IE7 A;  3VHP A;  4Q27 A;  4LOT A;  1HQL A;  2QZ2 A;  1XBF A;  3GCW A;  1BJQ A;  4E9K A;  1C8M 1;  4XAE A;  5FK7 A;  4X8P A;  1QJY 2;  2FMY A;  3J9S A;  5GM0 A;  3W58 A;  1MS9 A;  4PDW A;  1PZ8 A;  3VBO B;  2GNM A;  2D40 A;  3ZFF C;  2BNN A;  4KWJ A;  3O0X A;  4NPL A;  4GH4 A;  1L7Q A;  2LW8 A;  5FO7 B;  1H2N A;  2Q5T A;  2DBN A;  5KC6 A;  5DG2 A;  2R06 3;  4QHB A;  3MV0 1;  3NV4 A;  2B9U A;  5B4X A;  2D3S A;  4AQS A;  1HB2 A;  1DFQ A;  3PUS A;  4PDW C;  4RFR B;  4FTB A;  1GZW B;  3ZFF A;  4JCK A;  3WG4 A;  1W2U A;  4W8J A;  1YNA A;  1LOB A;  4CDW C;  2VMG A;  1LED A;  1SEF A;  4I3G A;  1GP4 A;  3E5U A;  1ULP A;  3I2I A;  3KT1 A;  4JGZ B;  4EN6 B;  4N7I A;  1UN1 A;  4FQZ A;  3WNX A;  5LB6 A;  3M3Q A;  5B4N A;  3BI3 A;  4Q4V 1;  1DDL A;  4BE3 A;  2JG8 C;  5FO8 B;  5A7O A;  3OY8 A;  3ACH A;  5A6Z A;  1Z0H A;  1ZRI A;  2R06 1;  1ZNP A;  3OBA A;  2DVG A;  2TEP A;  2W94 A;  4FXK B;  1TMF 2;  2BGO A;  4MYE A;  4AEJ A;  4AL9 A;  1ZBA 2;  2QQW A;  3BPS A;  4GB3 1;  4HVR A;  2E51 A;  5FUI A;  5A1L A;  3LSE A;  2Y6G A;  3U1X A;  2NYY A;  1S0D A;  2XPJ A;  4LUK A;  1LES A;  2BBA A;  1Y4W A;  2B42 B;  5DDJ 3;  2CU5 A;  1WA6 X;  1NLR A;  2LAL A;  2VM9 A;  5IAV A;  3RYK A;  2A7A A;  4HVO A;  4BQ3 A;  4DUV A;  3S7I A;  2VUC A;  1R1A 3;  3J4U H;  2WII B;  3QOP A;  3AKR A;  5C4W A;  3LOB A;  3N9N A;  5IK5 A;  1QF3 A;  3BAL A;  2G9F A;  3RZJ A;  1R09 2;  4COU A;  1WCU A;  3FN9 A;  5D8A C;  2HJI A;  3S6P A;  1FPN 1;  1UL9 A;  3PLQ A;  4IEW A;  1ZA4 A;  1AYM 3;  1SDW A;  1W8U A;  2E63 A;  3EBR A;  4BH9 A;  2AH2 A;  3ME2 A;  5F5I A;  2J7M A;  2W5F A;  4MV2 A;  4OUS A;  2PMW B;  3W21 A;  3WCS A;  2DUO A;  3CMG A;  1FYU A;  4FBF A;  3PNA A;  3RYP A;  4GH4 B;  4Q4Y 3;  3MIH A;  2J42 A;  4AVB A;  1HIX A;  3UL2 A;  1W6M B;  1OQD A;  3FBM A;  4QB2 A;  1F9K A;  4CEY C;  1J3P A;  4Y22 B;  5FO9 B;  5A6X A;  5A3W A;  3K3O A;  2Q1M A;  4BDV B;  5BY5 A;  3D0S A;  2CDO A;  3CO2 A;  1DYO A;  3LB9 A;  1UD1 A;  1Q8V A;  1RVF 3;  1HW5 A;  5DQ0 A;  3GJA A;  3U78 A;  1MS1 A;  4P9X A;  5BV6 A;  4I09 A;  4YZ4 A;  1LAJ A;  3EHK A;  3T2T A;  1R1A 1;  1PVX A;  1QU0 A;  3AP6 A;  1JBC A;  4LE4 A;  4E4H A;  1QNW A;  2R07 1;  1ZM1 A;  3OPT A;  2IZW A;  1XNA A;  5FXX A;  4LBN A;  5H9R A;  4Q0S A;  3NQH A;  5JPM B;  4TN7 A;  3VKM A;  2VW1 A;  1S0I A;  2W0X A;  3CEW A;  1VR3 A;  2P1B A;  3B02 A;  2QE3 A;  3TOJ A;  3WW3 A;  1AYM 1;  1YQC A;  3HT1 A;  4XMA A;  1UMH A;  2Y0O A;  3PTY A;  5JOY A;  4KNC A;  2OX0 A;  4ZU4 A;  5LY2 A;  3TNP B;  4IES A;  2DFC A;  3MIF A;  1LGC A;  1W9F A;  4CDQ A;  2IFW A;  5EZW A;  1NZI A;  2QQK A;  3EJK A;  1MZ5 A;  4O61 A;  1DIW A;  2WWS A;  2R04 2;  3O0V A;  2ZGK A;  4LBQ B;  1WBF A;  2JIG A;  3SIS A;  4A7Y A;  5JXG A;  1EV1 2;  1UYY A;  1HLC A;  4Y22 A;  3RJR A;  3NW4 A;  1O4Y A;  1LEC A;  1W0P A;  2LRP A;  1FNY A;  2P5B A;  1CN1 A;  3BKZ A;  4QKD A;  3HR9 A;  1MAC A;  2UYB A;  4QB1 A;  2J22 A;  3ZYG A;  1NCR A;  2WS9 3;  1K5M C;  3H8U A;  1GOH A;  5JMC A;  4FPY A;  5F39 A;  5FLH A;  4MHU A;  1O6U A;  2VUL A;  3C7F A;  3NAP C;  3P1I A;  4AI3 A;  2GSY A;  2X8K A;  3OTF A;  1ODN A;  3ZYB A;  3N9Q A;  5LBB A;  3BTA A;  5A7S A;  5F6L B;  3TN9 2;  2K9Z A;  2Y0I A;  4RGA A;  3U75 A;  3PUH A;  4NPM A;  3W5M A;  2OUJ A;  1RUF 3;  2I74 A;  1CES A;  1UY2 A;  3WG3 A;  5JLV A;  1K5M B;  5GLV A;  5FYZ A;  2WO1 A;  2DCJ A;  3APB A;  3GGL A;  4HBN A;  2DU1 A;  2DVD A;  1NY7 1;  2HWB 2;  3AB0 A;  4R4Z A;  1OPM A;  4XTM A;  2HWD 1;  4LBQ D;  3FHA A;  4EN8 B;  5C5U A;  4DRV A;  4W6Y A;  2PHR A;  3NNG A;  4BLJ A;  2A6V A;  3Q8B A;  1W2T A;  2EAA A;  3HQX A;  1KGY A;  1JXN A;  2D6N A;  1NCQ A;  3ORJ A;  3SH5 A;  1W6P B;  4MOA A;  3WZ1 A;  1MQT A;  2D3P A;  2DCZ A;  1JYC A;  1EPZ A;  1AX1 A;  2VEC A;  4PBO A;  1ND2 C;  4JTO A;  1V6N A;  3HNM A;  5FXV A;  4R9C A;  3OEB A;  2ZHN A;  5KHK A;  1ENQ A;  3WP6 A;  3VL9 A;  2D6L X;  4B8E A;  3BCW A;  3N9O A;  5FZD A;  4R9A A;  1VMF A;  1JHJ A;  4RL7 A;  4AED B;  5CFD B;  1EP0 A;  4CP0 A;  5LY1 A;  3WP3 A;  4XEZ A;  3EXU A;  4IXL A;  1O8P A;  1V6I A;  1UPS A;  2XL7 A;  4XDQ A;  2YHJ A;  4YM2 A;  3RWK X;  4DIQ A;  2VPV A;  5ISL A;  1GYK A;  3SLI A;  3VZJ A;  4D69 A;  3AZX A;  4F8A A;  5KC5 A;  4FPE A;  3I3Q A;  4AGV A;  5JI9 A;  5C4W C;  5GJ6 A;  1NLQ A;  1UWW A;  4GB3 3;  3E6D A;  1LRH A;  5EJ3 A;  2DWR A;  2ZCW A;  1S0J A;  1R08 2;  3WF3 A;  4AFC A;  5FYH A;  1CAW B;  5FZ1 A;  3C2U A;  3KS7 A;  3AJZ A;  5BNO A;  4KWU A;  3G6J B;  3VL8 A;  1MVQ A;  1NCQ B;  1W04 A;  1OA2 A;  2W68 A;  2WNU B;  1D2S A;  1LOC A;  2PHU A;  5A7W A;  5J37 A;  1E5R A;  3S30 A;  3N36 A;  4XFG A;  3LQC A;  2X09 A;  3B01 A;  2ERF A;  4PI2 A;  4DXT A;  4SLI A;  2QQM A;  4D0Q A;  1HJG A;  3ZXK A;  1GR3 A;  2DVF A;  3NKT A;  1D7P M;  2WIN B;  3B3Q E;  4GWI A;  5BNP A;  4NHY A;  1JUI A;  1W6N B;  5E1R A;  4Q29 A;  1V9U 3;  4QGL A;  1RMU 1;  2A3X A;  1ULG A;  2ZGN A;  3FWE A;  5FYI A;  1DCS A;  1W06 A;  1XYP A;  3TAY A;  4K7J A;  2JE8 A;  3THD A;  1IG3 A;  5FP9 A;  3RDI A;  1POV 0;  3DEM A;  2PTM A;  1OUR A;  3UYJ A;  3DYM A;  3M3E A;  5D8A B;  1CX4 A;  2W1U A;  2ZBJ A;  3LDR A;  3D3A A;  4OI4 A;  2Y38 A;  1QXJ A;  4BIS A;  1F5F A;  1EPW A;  3EMR A;  4P9Y A;  1W6Q B;  1AXY A;  4F7Z A;  1Y9G A;  4RFT 0;  1ZRF A;  3I2D A;  4JGY C;  3NAP A;  3B5L B;  4QQP A;  1OOP C;  3WHU A;  1VIW B;  3AP4 A;  3VBH A;  5FJH A;  4CDQ C;  4C90 A;  1B35 C;  4XJW A;  4M4P A;  3BUC A;  1QEX A;  1XC6 A;  3P3N A;  3TBD A;  3VBF C;  4AED A;  5JOX A;  2FDF A;  5FUN A;  2VTX A;  4QPG B;  2BGP A;  4NVP A;  3NJV A;  2WFF 1;  3T2P A;  3QCW A;  4U2A A;  1GSL A;  4DY5 A;  1S2E A;  3WV6 A;  2VOK A;  4W65 A;  5FBZ A;  3OSD A;  2PA7 A;  4LEJ A;  2QTW B;  1BQP A;  3RMX A;  4YVW A;  5FZO B;  4NMI A;  2P3Y A;  2WNU C;  4BYY A;  1NCQ C;  4K40 A;  4C1X A;  2FZ2 A;  5JR7 B;  3LD8 A;  1RUF 1;  3NRU A;  1WMX A;  1CD3 G;  2JE7 A;  4NUB A;  4RHV 3;  5HBA A;  4QDQ A;  5G04 L;  1FMD 1;  2RJK A;  1DGW X;  4P9I A;  1HB3 A;  1XE8 A;  4YW5 A;  3E5Q A;  5FYV A;  2WZP P;  1K5J A;  5FZ0 A;  4WM8 A;  3WNN A;  5GZC A;  3I2H A;  1XRU A;  3AVR A;  5DAP A;  1YIP A;  5HCH A;  3POW A;  3H1M A;  1MQT C;  2E31 A;  2XVG A;  1FT9 A;  1QDC A;  3PU3 A;  4XUR A;  3Q9O A;  4N9H A;  2CY6 A;  2R0H A;  2RS5 3;  1BCX A;  1NX9 A;  2DF7 A;  2P34 A;  3BTZ A;  3B9I A;  2E6V A;  4AVT A;  2BRT A;  1N1T A;  2WRA A;  2DFB A;  4KGQ A;  4UWD A;  1JN2 P;  3PUQ A;  3ZKY A;  4Q8K A;  1SFN A;  2GC0 A;  3LA3 A;  4IV3 B;  3UKT A;  4A3Z A;  2PHL A;  1LTE A;  4YVS B;  4FPC A;  1VBC 3;  1PHM A;  1SBE A;  2OPW A;  5FYT A;  5FZ7 A;  2IXI A;  3UNP A;  3OBZ A;  3ZN6 A;  5FWJ A;  1RUI 3;  2ET7 A;  4YG0 A;  1OMI A;  3VD3 A;  4ZZ5 A;  2MEV 3;  5FJK A;  4QT6 A;  3RMY A;  1C1F A;  4URA A;  1RUE 2;  3MW2 A;  2PEL A;  1SCR A;  2C24 A;  2J1V A;  1QJU 1;  4L2N A;  4QHO A;  3UGG A;  1OLM A;  4YGE A;  5DUW A;  4DFS A;  3T4H B;  1V6J A;  3J7M A;  4Y1X A;  3I3B A;  1MZE A;  3MZH A;  1UIJ A;  1RTV A;  4Y1U A;  1LB2 A;  1T6B X;  4O9E A;  1ZBA 1;  4B29 A;  4LBL A;  4BQ2 A;  5A1F A;  2ORZ A;  1O3Q A;  1XNK A;  2PHX A;  1LKN A;  2XQX A;  5H9Q A;  2J1U A;  4TYS A;  4QD2 A;  4QX2 A;  1X9P A;  5FP7 A;  3VBS B;  5H9S A;  1W8Z A;  3VDC A;  1U5I A;  2RDS A;  4I01 A;  5FMO L;  4M00 A;  1OKQ A;  4XFH A;  3T09 A;  4B1M A;  2GAL A;  2WLP A;  5FPL A;  3OCP A;  2XLF A;  4CDU B;  3VBO A;  1XB9 A;  4E27 A;  4IEY A;  1SLL A;  2BU9 A;  4FPJ A;  1ULD A;  4QX1 A;  1Q8P A;  3NNF A;  4QPG C;  3OUI A;  4CCM A;  4E2G A;  5LBC A;  1TE1 B;  2R32 A;  1B35 B;  4ATF A;  3VBF A;  4CXY A;  1QJX 3;  4F83 A;  1Q8S A;  4EQV A;  4B4Q A;  4LHN A;  1F8V A;  2EVX A;  3B00 A;  3KZ4 C;  3HPN A;  3NNJ A;  4KU7 A;  1RHI 1;  3CKH A;  4PLN A;  4IEZ A;  4HVQ A;  3AC0 A;  1QNY A;  3VKF C;  3OPW A;  4C0H A;  5E6H A;  2B7Y A;  1MS8 A;  1YQ5 A;  1W8W A;  3PJQ A;  4XXA A;  3BIE A;  5FTT C;  1AR9 2;  4OMC A;  4JKK A;  2XOM A;  3MO4 A;  1V0A A;  2VMC A;  4QDR A;  1HX6 A;  2ZAH A;  4Z1V A;  4Z2A A;  1QQP 1;  5F5A A;  4QX0 A;  1UX6 A;  2VG9 A;  1DGR N;  5FWE A;  1YLL A;  3PHM A;  4N53 C;  1WGP A;  4JDO A;  1D0G A;  1J58 A;  2BJS A;  5JXI A;  4MGI E;  5FFO C;  5IVY A;  4ITC A;  2XKP A;  2ZA9 A;  1C8M 3;  3DXT A;  2Z79 A;  4MXV A;  3CJX A;  3ZLI A;  2MNG A;  4COV A;  4RN5 A;  4UFM A;  1K12 A;  5DAX A;  2Q4S A;  4XAC A;  2QDR A;  3BB6 A;  4CXX A;  4DXZ A;  2DCY A;  3TEY A;  4WM7 B;  1OSG A;  4YZ2 A;  3D0J A;  4YW1 A;  2AGS A;  2PQQ A;  1I5P A;  3M3I A;  3BYW A;  4Z82 A;  5FZ4 A;  2OVU A;  3HNB M;  3RGB A;  1CAV A;  3HN3 A;  1JYI A;  4QGN A;  4LPL A;  4HMZ A;  4XJU A;  4LUM A;  1HXS 3;  3IAP A;  3POY A;  2O8O A;  5F8P A;  4Z07 A;  3VBU C;  3LKJ A;  3K51 A;  5JMO A;  3CIH A;  3HNY M;  5A3L A;  1PNG A;  4NR1 A;  4OHY A;  1W9S A;  3HD8 B;  3I97 A;  3LEI A;  4A3X A;  1Q56 A;  3MPP G;  3TN9 1;  4X6Q B;  2A1X A;  1Y7B A;  2A6Y A;  2DTW A;  2YU1 A;  3IPV A;  1YEW A;  1OD3 A;  2AC1 A;  2W87 A;  5J98 B;  5A33 B;  2P3J A;  2XUE A;  3JBG 2;  2EID A;  3NVC A;  3Q8C A;  4XE9 A;  3NL1 A;  2XWB B;  4XHX A;  1RXG A;  3NV3 A;  4XUT A;  5IVF A;  3ALQ A;  4ARY A;  1ZZC A;  4TXW A;  4XIL A;  4YLZ A;  4ES9 A;  2A5Z A;  5KBF A;  1OH3 A;  2DV9 A;  1LOD A;  1OLM E;  3OY8 B;  4XUN A;  5CIS A;  2QQP A;  2BNO A;  3ST7 A;  1L7R A;  2TUN A;  1LOE A;  4JKL A;  3ZOI A;  4JX0 A;  4P9J A;  1QJF A;  5FPV A;  3ZN6 B;  1PO1 2;  3CLP A;  4HON A;  2ZGP A;  3ZXF A;  2EIE A;  2VNO A;  2H0B A;  1VBD 3;  5C3O A;  1IS4 A;  1COV 3;  3ZMO A;  4HPK B;  3T1L A;  2FCV A;  4IV1 B;  2FDJ A;  4OUE A;  4L8Q A;  1UMI A;  2CGN A;  2R7E B;  3AMH A;  1CJP A;  3V56 A;  1AR9 1;  1FOD 3;  2JXA A;  5L7O A;  1ZRD A;  2DCK A;  2RMU 1;  2EA7 A;  1JI6 A;  1BKZ A;  3H3L A;  3WQ1 A;  1VBB 2;  1DZQ A;  2G4I A;  2XHK A;  3GZE A;  3N7L A;  1ND3 C;  3F95 A;  2E26 A;  3ILR A;  1ALY A;  5CFD A;  4ZPI A;  4XTP A;  4LOS A;  4CEW C;  4O7X A;  2C0Z A;  3WNK A;  4ZU7 A;  1W0O A;  3ZPY A;  1OVP A;  2ZX4 A;  4AZZ A;  5D8A A;  1HQW A;  2B46 X;  5FKB A;  5CBL A;  4LXL A;  4GWJ A;  5GZE A;  2J1T A;  3QAC A;  2X29 A;  1QJU 2;  2MEV 2;  1LOF A;  2UWA A;  1BK0 A;  1RJ7 A;  2OZ6 A;  4M0N A;  5CVR A;  5KXD A;  4XBN A;  5CAZ A;  5LK7 B;  2RDN A;  5FXZ A;  5C70 A;  1VBC 2;  5GKA C;  1WMD A;  1WLD A;  3OGG A;  1WLT A;  1HJF A;  2VCC A;  5LA0 A;  3VHO A;  1H9W A;  4I0W B;  2XG3 A;  2BVB A;  2K46 A;  5DAV A;  1WW4 A;  4Q4W 2;  4UI9 L;  2GP3 A;  3O14 A;  5FLJ A;  4NIH A;  3FLT A;  5CA6 A;  4DB5 A;  4YW2 A;  2OYZ A;  4LO7 A;  1CPM A;  2KR2 A;  5I8S A;  4DEQ A;  4NHL A;  4LBK A;  1YQ8 A;  4YW6 A;  4IQP A;  5FZ8 A;  5DUX A;  4FFF A;  4GWM A;  1S2B A;  2RM2 3;  4FFI A;  1EAH 2;  2VNR A;  4A2U A;  4CCK A;  1JZ2 A;  3UET A;  1AVB A;  3GHN A;  4LQR A;  1SBF A;  3KF5 A;  3KSC A;  5DAB A;  5I0U A;  3VZM A;  4EWA A;  4BPZ A;  4FAG A;  2AR6 A;  2WZR 1;  4JC1 A;  5CKQ A;  1TMF 1;  1IS5 A;  2BNM A;  2Y60 A;  1I6X A;  4XF4 A;  2R06 2;  3WUC A;  4BJ0 A;  1JYX A;  2L9L A;  1P8J A;  4Y20 A;  1XOY A;  2JB4 A;  1W6O B;  4KBZ A;  2QQN A;  1W6O A;  5LCW L;  1Q3E A;  1X36 A;  1PMI A;  1ZZ8 A;  2UY9 A;  1UAI A;  2XBO 2;  4AOC A;  4QGM A;  1YYN A;  4YZ5 A;  4IEO A;  1QOO A;  1W3X A;  1RUG 2;  1CIY A;  1U12 A;  3VDA A;  2B45 X;  3PUA A;  5FY8 A;  2BWA A;  4NPR A;  5JVV A;  3U07 A;  1JZ6 A;  2YFZ A;  4PIZ A;  1N47 A;  4QQO A;  1AX2 A;  3GZA A;  3H42 B;  4BCU A;  1MEC 3;  2VTX J;  3JD7 2;  2Y34 A;  3D6E A;  5C9A A;  4KBB A;  2OUH A;  2EF6 A;  4IE6 A;  1QJU 3;  2VMH A;  1GNH A;  1UYP A;  3MFC A;  4HK9 A;  4UF0 B;  3POG A;  5C8C C;  1A8M A;  1LHV A;  1JOJ A;  3WQ7 A;  4FP2 A;  4N9I A;  2I2S A;  2WFP A;  4XCA A;  2VGD A;  1EUU A;  2GU9 A;  2LUW A;  2Q30 A;  1PGS A;  1FV3 A;  1PVC 2;  5ANN A;  3ZXA C;  3MF9 A;  3T4V A;  2WT2 A;  1AYN 3;  4K9S A;  4DXR A;  1V00 A;  4AEK A;  1N3O A;  5JIU A;  1OQE A;  4M3C E;  4YVW B;  1EV1 3;  1O4T A;  4Q2F A;  2WDB A;  5AVA A;  5T5O A;  4XFI A;  2HWC 2;  2R04 3;  3DXU A;  4QKN A;  3ATG A;  1QHD A;  2CAU A;  4CCO A;  1U5Y A;  3HMY A;  4HAN A;  2P3I A;  4XJZ A;  4MGT A;  1DGL A;  2PHD A;  4DOU A;  4ASL A;  2FBE A;  3HN1 A;  1UYZ A;  5DZF A;  1H6Y A;  1UNB A;  1RUC 3;  4YW7 A;  1CAV B;  1F15 A;  3ZIW A;  3WEZ A;  3ITQ A;  1LEN A;  2YYO A;  2VR4 A;  2B4K A;  1CZV A;  1YQ2 A;  3ZXD A;  2ZHM A;  4Q0Q A;  4QX3 A;  1PZ7 A;  4UXA A;  1MEC 1;  3WDW A;  4CDX A;  2AEY A;  3ZYP A;  4R9B A;  4X8N A;  5KXE A;  2BWC A;  4H14 A;  5LAS A;  4HZF A;  4BK4 A;  3BVC A;  5KHJ A;  1KEX A;  2D93 A;  4FOW A;  3GBF A;  2BDR A;  3OOX A;  1RUE 1;  5FXW A;  4MLO A;  1LOF C;  1RL3 A;  3L2Y A;  4ZY9 A;  2Q8D A;  4S2H A;  2UY8 A;  1DP0 A;  4NOT A;  5EHD A;  4HG6 B;  4Q5O A;  3JBG 3;  3OYW A;  4MXW A;  4YG6 A;  4M3C B;  5IK7 A;  4LBQ A;  2ILM A;  1OLQ A;  4CUA A;  4GWN A;  4HFS A;  4Y5S A;  3VBR A;  2Q1F A;  2FDK A;  2JIC A;  2P3K A;  5FYU A;  1AR6 1;  1K42 A;  2WNO A;  3BN6 A;  3FHQ A;  1IS6 A;  3WD5 A;  3V0A A;  1BBT 1;  3PVE A;  4PIX A;  3B9C A;  3IDE A;  1EAH 1;  3SCG A;  4JGZ A;  4OHZ A;  1MS0 A;  5I0D A;  1LEM A;  3G7D A;  3JQX A;  1OOP B;  3SQO A;  3THT A;  3I7D A;  3U37 A;  4YGC A;  3JU9 A;  1F35 A;  3GNE A;  4BWO A;  1XQN A;  5FK8 A;  4FOV A;  4MGY E;  1GNZ A;  3OUH A;  2DTY A;  1HRI 2;  4JHT A;  3LSD A;  3QH7 A;  4JGZ C;  1VAK A;  1S0C A;  3PME A;  1BVV A;  4ZXK A;  3O1U A;  5F32 A;  1O3T A;  1QJY 1;  4IEU A;  3SKJ E;  4BQY A;  4XUP A;  2VJX A;  1RMU 3;  5ACA 1;  1C8M 2;  4WBB A;  3ZX7 A;  1O8S A;  2D97 A;  2BYV E;  4L99 A;  1A8D A;  1JUH A;  4JRA A;  5BNN A;  5FY1 A;  5AFE A;  3MIG A;  2IXH A;  4CCE A;  2DYC A;  3MLK A;  3WP4 A;  1XNT A;  5CIR A;  4CDU C;  1QDO A;  2HWF 2;  4FSJ A;  3KF3 A;  1JTZ X;  1GLH A;  2JKX A;  2IC1 A;  3OB8 A;  4JHZ A;  3MPB A;  3P5B A;  1OI6 A;  3K77 A;  1M06 G;  1KRI A;  2YGL A;  3HQR A;  5JI7 A;  4BB3 A;  2A6W A;  2GND A;  2HWB 3;  2OT7 A;  3E1F 1;  1KJL A;  4WVM B;  5C8C B;  3B93 A;  1ZZB A;  3Q8E A;  1XYN A;  5JXJ A;  2ADE A;  1JYN A;  4FPK A;  2WFF 3;  5F3C A;  2WNV C;  4P00 B;  3JB8 A;  4PLO A;  3ZN5 A;  1ASJ 3;  5LRS A;  5G05 L;  1UOB A;  1POQ A;  4OQ9 A;  3WY6 A;  3USU B;  3PMS A;  5EV7 A;  1PX4 A;  4OHX A;  5LRR A;  3H1Y A;  3SC7 X;  3MGU A;  1COV 1;  1HN1 A;  4E8D A;  4XFF A;  5IAT A;  4P9L A;  1JYV A;  2LRO A;  1Z78 A;  1PIV 1;  1ZVF A;  4NRP A;  1S0E A;  3DPR C;  4MO3 M;  2Y6H A;  2OW4 A;  1YC6 1;  5FYB A;  5I93 A;  1NZC A;  2WYS A;  1KDK A;  2JEN A;  4LOR A;  4Q4X 2;  3QLQ A;  1YFY A;  3SXW A;  1EY2 A;  2P6H A;  3ES4 A;  1CAX A;  4NWV A;  1C5H A;  3OGV A;  4LT5 A;  4HN1 A;  1OBN A;  1YUD A;  1GOF A;  2WQZ C;  3CJI A;  3NV2 A;  3BPZ A;  3MFA A;  2JDA A;  3E97 A;  1DF0 A;  4JKM A;  4COZ A;  1HRV 3;  3KV9 A;  3JQW A;  2NM1 A;  4UT5 A;  3A21 A;  1UY3 A;  1VBD 2;  1KJR A;  5K0U A;  4BXF A;  2HWB 1;  1RUE 3;  4NAM A;  4Y33 A;  3RI9 A;  3F2Z A;  2VCA A;  1DQ2 A;  1BEV 2;  2WAA A;  5HI0 A;  1BK1 A;  1FAT A;  3KHC A;  5FBJ A;  1IQD C;  1Z7S 2;  2QQU A;  3D8C A;  3DYP A;  3LPF A;  4NHK A;  4D7T A;  5K9Y A;  1RUD 3;  3FUQ A;  3HT2 A;  5K0U B;  3M2M A;  4Q4V 3;  5FAX A;  3ZM8 A;  2XR4 A;  3WXP A;  4P5Y A;  2JD4 A;  1RUI 1;  1REF A;  4QQH A;  5KR7 A;  1SFY A;  1JU4 A;  2UYA A;  4XPV A;  1JHN A;  3KD4 A;  1Y9Q A;  5HXM A;  2SLI A;  4IGO A;  4CE8 A;  3HOB A;  1SMV A;  1IPK A;  1OQ1 A;  1BXH A;  2A70 A;  2UUR A;  2ZMN A;  4Y24 A;  1XYO A;  3RWN A;  5A6Y A;  5JZG A;  1D4V B;  2E7Q A;  1LHW A;  4NHM A;  3ES1 A;  2NMO A;  2RS5 2;  4E2S A;  4GAL A;  2C1F A;  4A41 A;  2WAO A;  3LIG A;  5DXD A;  1J1T A;  5JAX A;  1JOP A;  3GZT B;  3RRD A;  4EWD A;  1Q8Q A;  4ZKT B;  1SLC A;  4ZHN A;  2RM2 2;  1JZ5 A;  4AHX A;  3P3P A;  3RZH A;  2XBO 1;  1HRI 3;  4HSJ A;  1CAU B;  1RUF 2;  4OYU A;  4F3J A;  4XDO A;  1KD7 A;  3K4Z A;  4IET A;  1SBD A;  1YFW A;  4WZC A;  3VDD B;  4CEY B;  4MVT A;  1AR8 1;  5BUV A;  1RUJ 3;  4FPL A;  4KG0 A;  5E89 A;  3ZKU A;  4D94 A;  1DU3 D;  3D5O A;  1ZZ6 A;  2E53 A;  2RV9 A;  1OFS A;  2VZU A;  1WW5 A;  2WZR 3;  3KCC A;  3MBW A;  3KLS A;  2JX9 A;  3PVB B;  4FXG B;  1UY0 A;  3WW4 A;  4AQ2 A;  5BNN B;  2ZGT A;  5FCC A;  4FFH A;  4L97 A;  3EQE A;  3WF0 A;  4Y20 B;  3M3O A;  3I54 A;  2VQA A;  2GH8 A;  5FZ9 A;  4CDU A;  3B7M A;  2YUE A;  2UWB A;  1ZBA 3;  1WBL A;  4BIF A;  3BU0 A;  5T5J A;  1SHW B;  2HBU A;  2B39 A;  1BZW A;  1YJK A;  2XML A;  2VZO A;  2YBK A;  1D4M 1;  1VBA 1;  2V72 A;  1QH6 A;  4RR3 C;  1QH7 A;  1E5H A;  5CB7 A;  3ACG A;  4Q26 A;  4WVZ A;  1UZV A;  2R49 A;  2VU9 A;  4LKD A;  1LOA A;  5BNO C;  3KVA A;  5BNN C;  5HCA A;  4CZS A;  4A6S A;  1GBG A;  3J8F 3;  1DG6 A;  2Y64 A;  5HV4 A;  4XQW A;  4CA9 A;  3T08 A;  1W2A X;  3ZDV A;  1OOP A;  1FV2 A;  1H2M A;  1S4C A;  4CXW A;  4HT1 T;  2BOI A;  2VMD A;  5I8T A;  1RVF 1;  1CGP A;  1OF3 A;  4OI0 A;  1RUJ 1;  2VBD A;  3ACL A;  1AX0 A;  4ISR A;  4QU2 A;  5A7W B;  4TLG A;  5EJZ B;  5F1R A;  5FZH A;  4H3W A;  5F3G A;  5FRA A;  2VOX A;  1WUV A;  2D43 A;  4DQA A;  5BNO B;  4XF9 A;  1W8T A;  3CNA A;  1AYN 1;  1PX3 A;  1X7N A;  2P37 A;  4IND A;  3AP9 A;  4XIO A;  3IDB B;  4JAA A;  4RR3 B;  4PBP A;  4V2V A;  1UU5 A;  5F2W A;  5EQU A;  1E5I A;  2XON A;  3NKG A;  4CPB D;  3J8F 2;  1XU2 A;  1RED A;  4GUL A;  1CR7 A;  1GKB A;  5H9P A;  1V9U 1;  3K75 B;  3KGZ A;  3WW1 A;  5LEK A;  1UOF A;  5JOZ A;  4TZD A;  3EYP A;  2ZAA A;  4RGK A;  1R64 A;  2Y26 A;  2CSG A;  3GM8 A;  4M01 A;  1PVC 1;  1DHK B;  3DN7 A;  5J36 A;  1J83 A;  4ATE A;  1W8N A;  4LO6 B;  4CCJ A;  2RS5 1;  4CDX B;  3LFM A;  2Y6L A;  1HB4 A;  2VBP A;  4PLM A;  4IV1 A;  1YI9 A;  2OQ7 A;  2G9G A;  2ZX0 A;  3MDP A;  5FZ3 A;  1ZZ7 A;  4I3P A;  3PVN A;  4K21 A;  1HXS 2;  4UBH A;  2AZ5 A;  4XAA A;  3RG0 A;  3KQ4 B;  2TBV A;  1QJZ A;  1GP6 A;  1HQN A;  3FZ3 A;  2C5D A;  4QXH A;  1W8O A;  2JDY A;  4XJ8 A;  4NII A;  1ND2 B;  1WKY A;  1DQ5 A;  2W52 A;  5CYY A;  3VZO A;  2G19 A;  5ABJ A;  2VE1 A;  1DQ4 A;  5KHI A;  1UMZ A;  2IXJ A;  3W20 A;  1TMF 3;  3H8X A;  4HL0 A;  3NJY A;  1O3R A;  4NO4 A;  4QPY A;  4FP3 A;  5J3U A;  1V70 A;  2TNF A;  4CSW A;  1TEI A;  1PM4 A;  2WNU A;  2X05 A;  5IUQ A;  3VZL A;  3BU7 A;  3GZU C;  4AI1 A;  1M4W A;  2D6M A;  1VP6 A;  5DMY A;  1BEV 1;  5A7P A;  5AC9 3;  4IW3 A;  2DU0 A;  2JG8 A;  1EAH 3;  1O5L A;  1RUD 1;  2HBT A;  2JJ6 A;  2YB7 A;  2HYK A;  4RA0 A;  5T3N A;  3RI8 A;  2P6C A;  3D4K A;  1GV9 A;  3KV4 A;  3UK9 A;  1LJ7 A;  4URT A;  1O4Z A;  2HWE 2;  3WDY A;  5BNQ A;  4BZ4 A;  5K0U C;  3IZO A;  3MV1 1;  4DNY A;  1ZRR A;  1AL2 1;  2XJS A;  5JZG C;  5FPU A;  4L0P A;  4EN9 B;  1UU6 A;  5D21 A;  2GNB A;  4C91 A;  1MS3 A;  1H4H A;  4Q0U A;  3ZIX A;  4I0B A;  5K7P A;  1A34 A;  4E4S A;  5J7M A;  2BFU S;  4FT8 A;  4D3W A;  1G9B A;  3T2Q A;  3KWV A;  1I5Z A;  3KGL A;  4GJY A;  5FYS A;  1PIV 2;  2ZGL A;  1QXP A;  3AX4 A;  1HB1 A;  1Z7S 1;  5HXV A;  4YW3 A;  3AYE A;  3SHR A;  4CCC A;  1JZ4 A;  3M8L A;  1G9D A;  4OFG A;  2ADD A;  3D82 A;  2VW0 A;  1UZW A;  4XBQ A;  2XLA A;  3AL6 A;  4PI0 A;  4BQ1 A;  3T2O A;  4QPI B;  3DKQ A;  2ET1 A;  3KVB A;  2Q8O A;  3K4D A;  2W95 A;  4YM1 A;  1Y9M A;  1CZS A;  1HRV 2;  5HCF A;  1UIK A;  2YXS A;  2ZJC A;  1U5Z A;  2ZX3 A;  1SLI A;  1IKQ A;  2PAK A; 
#chains in the Genus database with same CATH homology
 2YC2 A;  4JKL A;  4CUC A;  5IYY A;  4JX0 A;  3C7H A;  3IAQ A;  1NUK A;  2RVA A;  3A7Q A;  4PQQ A;  1DLC A;  1CZT A;  5J1X A;  2EIE A;  4XVH A;  3OG2 A;  4ARX A;  1NKG A;  4CU6 A;  4OUE A;  1UMI A;  2R7E B;  1OH4 A;  4AG4 A;  2DCK A;  1JI6 A;  2W1W A;  2YG0 A;  1W9W A;  1SG3 A;  2E26 A;  1L7Q A;  2LW8 A;  3WNK A;  1K45 A;  3MUZ 1;  4UOJ A;  3MV0 1;  4OZO A;  5B4X A;  4GWJ A;  2J1T A;  3WF2 A;  2ZEW A;  4W8J A;  2WN3 A;  5C70 A;  1ULP A;  3I2I A;  5B4N A;  2VCC A;  5LA0 A;  2W91 A;  1F4H A;  4UI9 L;  3A22 A;  3ACH A;  2J1E A;  3OBA A;  2W94 A;  2BGO A;  3I3D A;  3C8X A;  2ID4 A;  2J1A A;  5FUI A;  4DEQ A;  2Y6G A;  2BBA A;  4DXS A;  3FL7 A;  2WZ8 A;  2VM9 A;  4KI5 M;  4DUV A;  1US3 A;  3OGS A;  1JZ2 A;  4ZXE A;  3UET A;  4MGQ A;  4LQR A;  2VL4 A;  2VMF A;  4QDS A;  3FN9 A;  2VME A;  4BJ0 A;  1JYX A;  1TVG A;  3SEE A;  4OMD A;  2L9L A;  1P8J A;  2J7M A;  2W5F A;  4PF1 A;  4E8C A;  3LEK A;  2QQN A;  2W9X A;  5LCW L;  3CMG A;  2JD9 A;  2BER A;  1UXX X;  1EUT A;  4QB2 A;  1CIY A;  3GXU A;  3VDA A;  4P08 A;  3A23 A;  5IHR A;  1JZ6 A;  2QQO A;  2YFZ A;  4BDV B;  4A45 A;  4A4A A;  1RYY A;  2CDO A;  2ZEX A;  5A1A A;  2VOT A;  1DYO A;  2V4V A;  5DQ0 A;  2HYX A;  3I2J A;  1OF4 A;  2W92 A;  1F4A A;  1EUU A;  1TG7 A;  1JYW A;  2OKX A;  1GNY A;  1UZ0 A;  4A41 A;  1XNA A;  4DXR A;  2VTF A;  2HLE A;  3NQH A;  3I2G A;  2QBX A;  2PQS A;  2WDB A;  5JR2 A;  1UMH A;  2Y6K A;  3ABZ A;  4XUQ A;  1PMH X;  4XZU G;  3HEI A;  3WSO A;  2ZEY A;  5LA2 A;  4GZ9 A;  2VZT A;  2QQK A;  1UYZ A;  1H6Y A;  5JXG A;  3WEZ A;  1UYY A;  2WUH A;  2BZD A;  4QPW A;  2VR4 A;  2B4K A;  1CZV A;  1YQ2 A;  3GDB A;  4QX3 A;  4AAX A;  4DUW A;  3W5M A;  4FI9 A;  4MAD A;  4QB1 A;  2J22 A;  2VQU A;  1GOH A;  4BK4 A;  3C7F A;  3NJX A;  3P1I A;  2ORX A;  1GUI A;  1KEX A;  3C7G A;  4ZY9 A;  2YFU A;  3VD4 A;  1DP0 A;  3PUH A;  3PUI A;  4HG6 B;  1UY2 A;  2WO1 A;  4A3Z A;  2DCJ A;  4CUA A;  3GGL A;  1JU3 A;  1K42 A;  3BN6 A;  1UX7 A;  3FHQ A;  1GOG A;  3FHA A;  3NNG A;  3C7E A;  1LNS A;  1KGY A;  1ULO A;  5I0D A;  5HPO A;  4MOA A;  3U37 A;  1GU3 A;  1NAE A;  1GQP A;  3SKV A;  3HNM A;  1OT5 A;  4XUO A;  3OEB A;  2C4X A;  1W0N A;  3SKJ E;  1PMJ X;  1JHJ A;  2VJX A;  4XUP A;  3WNM A;  2XHN A;  1US2 A;  3VD9 A;  3CQO A;  4LHS A;  1O8S A;  1O8P A;  3WF4 A;  2WAB A;  3WQB A;  2WZE A;  2C26 A;  1XNT A;  4CUB A;  3LEG A;  1SDD B;  2JKX A;  3VD7 A;  1UWW A;  2LS6 A;  4IUG A;  3OB8 A;  4JHZ A;  4TTG A;  3K77 A;  3OEA A;  3WF3 A;  1UY4 A;  2ZEZ A;  3LPG A;  3JXS A;  3E1F 1;  4KWU A;  2VZS A;  5JXJ A;  1JYN A;  4P00 B;  2RJ2 A;  5G05 L;  3LQC A;  3UES A;  2X09 A;  1PX4 A;  4DXT A;  4E8D A;  2QQM A;  1HN1 A;  1JYV A;  4D0Q A;  2WO3 A;  3P6B A;  5DN2 A;  2EIC A;  1D7P M;  4GWI A;  1JZ8 A;  3HJR A;  4MO3 M;  2Y6H A;  2WYS A;  3THC A;  2JE8 A;  3THD A;  1UY1 A;  3OGV A;  1GOF A;  3W5N A;  5F7U A;  2JDA A;  3DYM A;  2W1U A;  4JKM A;  3D3A A;  3A21 A;  1UY3 A;  4KMQ A;  1UYX A;  3F2Z A;  2VCA A;  5C71 A;  2QQL A;  2WAA A;  1IQD C;  3DYO A;  3DYP A;  3LPF A;  4M4P A;  2Z4F A;  1XC6 A;  2J1S A;  5CZK A;  3ZM8 A;  4P5Y A;  2W3J A;  3WNO A;  2BGP A;  2VZV A;  2VZ3 A;  3NJV A;  1JU4 A;  5HXM A;  4BK5 A;  2EIB A;  2QQI A;  2VQT A;  2WN2 A;  2VO5 A;  2ZXQ A;  3T2P A;  2W47 A;  3HOB A;  2VZR A;  3T0A A;  2E32 A;  2W1Q A;  2WAO A;  4A6O A;  4M4R A;  3NRU A;  1JZ5 A;  3III A;  3WNL A;  3ETP A;  4QDQ A;  5G04 L;  4ZZ8 A;  5JUV A;  3BGA A;  4OYU A;  3K4Z A;  3VDB A;  3I2K A;  5JXH A;  3WNN A;  2VZQ A;  2Y8K A;  3I2H A;  3I2F A;  2RV9 A;  2VZU A;  3MBW A;  1BHG A;  1UXZ A;  1UY0 A;  2E31 A;  4CU8 A;  5EJ1 B;  3WF0 A;  4XUR A;  5IFP A;  3EB7 A;  1NX9 A;  3WF1 A;  1K3I A;  2V5D A;  1W9T A;  4DEV A;  1SHW B;  1T2X A;  2VZO A;  3IB3 A;  3T0B A;  2V72 A;  2VCB A;  3ACG A;  5DPN A;  1XPW A;  1JZ3 A;  3ACI A;  3UNP A;  3J7H A;  5C7G A;  3T0D A;  2Y64 A;  4YPJ A;  3VD3 A;  4ZZ5 A;  3T08 A;  2X10 A;  2W46 A;  1MPX A;  2J1R A;  2J1V A;  2VMD A;  5IJR A;  1OF3 A;  3I3B A;  1J84 A;  5EJZ B;  2QQJ A;  1PX3 A;  2ORZ A;  2Y6J A;  4W4Z A;  2XQX A;  2J1U A;  4QX2 A;  3VDC A;  2XON A;  4P02 B;  3MUY 1;  3T09 A;  3CZJ A;  3SEP A;  2WO2 A;  3K75 B;  2WQ8 A;  3EYP A;  4QX1 A;  1R64 A;  1O59 A;  5EIY B;  3LE0 A;  3GM8 A;  1H6X A;  1J83 A;  1W8N A;  2Y6L A;  2VC9 A;  3IDA A;  2VZ1 A;  4A42 A;  2YC4 A;  4PT6 A;  3HPN A;  4W50 A;  3K4A A;  4QAW A;  3DEC A;  3CKH A;  3AC0 A;  1WCQ A;  4UAP A;  4D8M A;  1W8O A;  1WKY A;  2DDU A;  5CYY A;  4QB6 A;  4OMC A;  4JKK A;  2XOM A;  4DUX A;  3MO4 A;  2VMC A;  4A44 A;  4QDR A;  1JZ7 A;  2E33 A;  4LKS A;  4Z2A A;  4QX0 A;  3ECQ A;  2X05 A;  5JXI A;  3VD5 A;  1W99 A;  3C7O A;  4CU7 A;  3CDZ B;  5DMY A;  3OGR A;  2B9V A;  4RN5 A;  1K12 A;  2YB7 A;  2VZP A;  3K46 A;  4CVU A;  4RYD A;  3WNP A;  1I5P A;  3HNB M;  3MV1 1;  2W1S A;  4L0P A;  3HN3 A;  4LPL A;  3IAP A;  5IFT A;  3I3E A;  5JMO A;  4ET7 A;  3CIH A;  3HNY M;  3T2Q A;  2C9K A;  1W9S A;  3I97 A;  3LEI A;  1CX1 A;  4CU9 A;  1JZ4 A;  1OD3 A;  2W87 A;  4BXS V;  2EID A;  3T2O A;  3K4D A;  2W95 A;  4XUT A;  4MGS A;  4ARY A;  1CZS A;  4TXW A;  5LA1 A;  2CDP A;  3ACF A;  4XUN A;  2WBK A;  2KD7 A;  1GMM A;  3CZU A;  1L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...