1XNAA

Nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
151
structure length
151
Chain Sequence
b'MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DNA-REPAIR PROTEIN XRCC1)
publication title Solution structure of the single-strand break repair protein XRCC1 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xnaA00
2QQNA 3VD7A 2BZDA 3WNMA 2WUHA 3LE0A 1J84A 2WZ8A 2W92A 2VZRA 3LEIA 5C71A 1XC6A 1BHGA 1CZVA 2KD7A 3DYMA 3LQCA 3AC0A 4OMDA 5C7GA 1UY3A 4A3ZA 2YG0A 3EB7A 1US3A 2VTFA 4QB2A 3PUIA 1NUKA 3WNNA 3ACIA 1ULOA 4XUNA 4QPWA 1UZ0A 1L7QA 4MGSA 1IQDC 3U37A 3HOBA 3ACHA 2J22A 4OMCA 3EYPA 3K4ZA 2DCJA 4UOJA 3SEPA 3PUHA 1KEXA 3ABZA 5IJRA 3HPNA 3W5MA 5JUVA 2Y6LA 5A1AA 4FI9A 1J83A 2VL4A 4D0QA 4DEVA 2BBAA 1OD3A 4BK5A 2W46A 4RYDA 2XQXA 4D8MA 2Y6GA 3MV01 4CU8A 3CMGA 3OGVA 2VR4A 2ID4A 3P6BA 4KWUA 4ZZ8A 3LPFA 2ZEWA 3OEBA 2VMEA 4DXTA 1JYNA 3T08A 3K4AA 3I2KA 4ARYA 4JKKA 4CUBA 3HEIA 1PMJX 2Y64A 2W1QA 3CQOA 5CZKA 5EIYB 5I0DA 2C9KA 1JZ7A 4JX0A 4P5YA 2HYXA 2VCBA 5DMYA 3THCA 5F7UA 3VD3A 3WF2A 4QX1A 3T0DA 3C7OA 1PX3A 2VC9A 2JD9A 1UYZA 2XHNA 1UY4A 3LEKA 4JHZA 4AG4A 4P08A 4GWIA 2E33A 3D3AA 5LCWL 4DUXA 3C7EA 2LW8A 4A44A 3CDZB 2OKXA 3K77A 3A22A 3I2FA 4DXRA 2J1UA 2RV9A 3VD5A 4DUVA 4GZ9A 3C7GA 1OH4A 1DYOA 1DP0A 2W87A 2WN2A 3DYOA 4PQQA 5EJZB 1W9TA 4A42A 4QX2A 3NQHA 3NNGA 1DLCA 3MV11 3T0AA 4QDQA 1P8JA 2EICA 4KMQA 5J1XA 3UESA 2LS6A 4XUPA 2VJXA 1JYVA 5IYYA 1HN1A 5C70A 3C8XA 2W9XA 1UXXX 1F4AA 1O59A 3DYPA 4ZZ5A 1W8OA 3NJXA 3WF1A 4AAXA 4LQRA 3GGLA 2W5FA 1XPWA 3WNOA 4QDRA 3HN3A 4XZUG 2CDOA 2YB7A 4PT6A 1JHJA 1SG3A 2PQSA 5EJ1B 5JXGA 2E31A 3ACFA 3UNPA 3T2PA 3CKHA 3VDBA 1JZ3A 2Y6KA 2YC2A 2RJ2A 3WNKA 1O8PA 3JXSA 5JMOA 4DUWA 5IHRA 4LKSA 4XUQA 3J7HA 4XVHA 2J1EA 2E26A 1K45A 5G04L 3CIHA 3MUZ1 3CZUA 3I2HA 3HJRA 3A7QA 2WN3A 2Y6HA 5LA0A 4GWJA 3A21A 3OEAA 4JKMA 2VM9A 1GUIA 3ECQA 2WYSA 4CUCA 4IUGA 2VOTA 3LEGA 4M4PA 2W3JA 1O8SA 2J1SA 1UX7A 1F4HA 4ZY9A 1SDDB 1GOGA 2B9VA 3IAPA 3MBWA 4UAPA 1JZ2A 3WEZA 2VZ1A 2XONA 4CUAA 3ZM8A 3C7HA 5JXIA 3HNMA 1W9SA 2WAAA 1GOFA 2VZQA 2Z4FA 1H6XA 2QQJA 2VCAA 4TXWA 5LA1A 2DDUA 4TTGA 4Z2AA 4M4RA 1NAEA 2BGOA 3OBAA 1OF4A 3VD9A 1UMIA 4QX3A 3THDA 4W8JA 3OGSA 1JI6A 1GOHA 3K46A 1JYWA 1K3IA 4BK4A 1JZ8A 4BDVB 2X05A 2JE8A 2B4KA 1PMHX 2YFUA 2WO2A 4ARXA 1GMMA 3FL7A 3VD4A 1EUUA 1T2XA 5DN2A 2VZ3A 2VCCA 3ACGA 4LHSA 1JZ6A 1JU4A 1WCQA 2QQLA 3I3DA 3OB8A 2W1SA 1NX9A 4MADA 5CYYA 3NRUA 4L0PA 2YFZA 1UY0A 1JZ4A 2J1RA 3VDAA 2EIEA 3SKJE 2VZUA 5DPNA 1W0NA 5IFPA 4RN5A 3A23A 3BGAA 2Y6JA 2VMFA 2WO3A 1SHWB 4XUTA 3SKVA 2JKXA 4OYUA 1W8NA 3CZJA 5HPOA 2VQUA 4P00B 4QB6A 4ZXEA 4CU9A 3I3EA 4P02B 4A41A 4E8DA 3T0BA 1US2A 5JR2A 2WDBA 1UYXA 3I2GA 5FUIA 1CZTA 2WO1A 3ETPA 1W9WA 2J1TA 2W1WA 1NKGA 4UI9L 3IB3A 3C7FA 1K12A 4BJ0A 2V72A 4YPJA 1JYXA 4MOAA 1MPXA 2DCKA 2C26A 2VZSA 1UXZA 4OZOA 3UETA 4CU7A 2VQTA 4QAWA 2WABA 3WSOA 2BERA 2J1AA 2ZEYA 3HNBM 4OUEA 4QB1A 5JXHA 1R64A 2EIBA 5JXJA 3T09A 2E32A 2X10A 4LPLA 3GDBA 2HLEA 1D7PM 4W50A 3T2OA 3DECA 1ULPA 3I2IA 2VZOA 2W95A 2R7EB 5B4NA 1XNTA 2W91A 1OF3A 1UWWA 4A45A 2QQKA 1K42A 3I97A 4MGQA 2BGPA 3MUY1 2WQ8A 2WAOA 3NJVA 4ET7A 2J1VA 1UMHA 1UY2A 1UYYA 3T2QA 1TVGA 3WF0A 3K75B 3IAQA 3I3BA 4QDSA 3W5NA 3LPGA 1GNYA 5LA2A 1WKYA 1TG7A 1I5PA 3WF3A 4XUOA 4KI5M 2RVAA 3GM8A 2QQMA 2ZEXA 3FN9A 3WQBA 1GQPA 2YC4A 4CU6A 2VMDA 4BXSV 4DXSA 2W1UA 3WNLA 3SEEA 2VMCA 3IIIA 2V5DA 2XOMA 4PF1A 2ZXQA 5B4XA 2ZEZA 4E8CA 4A4AA 4A6OA 4HG6B 5IFTA 2W94A 2QQOA 3BN6A 2QQIA 2C4XA 1RYYA 1W99A 1UY1A 2ORZA 2CDPA 2ORXA 1JU3A 2Y8KA 1CX1A 1OT5A 2JDAA 3IDAA 3P1IA 2WZEA 3F2ZA 3GXUA 1YQ2A 3FHAA 1JZ5A 2V4VA 4XURA 3VDCA 2EIDA 1H6YA 2QBXA 4JKLA 1PX4A 2WBKA 2VZTA 3MO4A 2W47A 1XNAA 4DEQA 3WF4A 2VZVA 1GU3A 4CVUA 3FHQA 2VZPA 1KGYA 2J7MA 1EUTA 3OG2A 3OGRA 2VO5A 1L7RA 3K4DA 3I2JA 5HXMA 1CZSA 2L9LA 5G05L 3HNYM 4QX0A 3WNPA 2X09A 3E1F1 4W4ZA 1CIYA 5DQ0A 4MO3M 1LNSA
chains in the Genus database with same CATH superfamily
1UCXA 1X8EA 2QQNA 3T1MA 2XXZA 2EXKA 1W8UA 2OZ6A 3WCRA 5I8TA 4CZSA 1HDKA 4QXHA 1NCQA 3K2OA 3UKVA 2W92A 5F5QA 3WW1A 4DOUA 1MEC1 1V6JA 5K0UB 5FZOB 5CFDB 5C71A 2ZBJA 5FPBA 1R1ZA 1JOPA 1O91A 4WM8C 3O0VA 4B1LA 5BYNA 4AYUA 2XLAA 4AQTA 4DO0A 2H0BA 5JPMB 1UY3A 2YGLA 4LA2A 5JCTA 4MUVA 1US3A 2DFCA 3SITA 2XHKA 4QB2A 4TSVA 4GQ7A 3ACIA 1EY2A 3UGFA 5DAWA 3PVEA 4K3UA 3Q8AA 4RQPA 2BYVE 5FZ7A 4CA9A 5LEJA 4CEYC 4GJYA 3RYPA 4KH9A 2JDUA 3N7MA 3B7MA 2DVAA 4HZFA 2XB6C 3AFKA 1MS1A 1W2OA 4R8HA 4YGDA 3IN9A 4OMCA 3K4ZA 4I3PA 4HXCA 4UOJA 4LO5B 3NNLA 4RS5C 3PVOA 4WM7C 1UW8A 2RMU2 3VZJA 1OXCA 2DVGA 4MHUA 3V56A 4Q27A 4D6SA 5CBLA 2ZABA 4F83A 5A1AA 4FI9A 1HRV1 2VL4A 4YW1A 4Q4W3 4NUBA 3AKQA 3POSA 4OHWA 4L11A 3E5XA 3M3EA 4Y5SA 5A32B 3SQOA 4D6RA 4AEDA 5FZEA 1X50A 4HLTA 1W6MB 2D6NA 1ZRIA 3MV01 4R9DA 5FZ9A 2YPJA 4UWDA 4HT1T 4LIVA 3CJIB 2VR4A 2FDIA 4CP9A 3P6BA 3NV3A 2VVEA 2IXKA 4DIQA 2AREA 2OIIA 2BQPA 5TSWA 2UWAA 1RVF1 1A8MA 1RUF1 2QFEA 5EP9A 4CP1A 4UW6A 1EP0A 1BLZA 1XYOA 4QPIA 3U0ZA 1MS4A 1GICA 3RZLA 4JKKA 4CUBA 5I0SA 2IWGB 4YW3A 4G3YC 3VHPA 3BOWA 2PHTA 5ACA1 2RDRA 4M0HA 3ZDVA 2ILMA 3DEMA 4COUA 4FSJA 5ANQA 4QD2A 4M00A 1AYM3 3I3QA 1WCDJ 1TZOA 4JX0A 3U07A 3E97A 2BUKA 3N9MA 3LOIA 4QT6A 3W9AA 5IUQA 3WUDA 1RUE1 2PAKA 1V6OA 1UOFA 2VCBA 4C90A 3JBG3 1FOD3 3SH4A 1TMF3 2GNMA 4RA0A 4CEWC 1CVNA 2FHRA 4KWKA 3WF2A 1ZZBA 1KJLA 1VBC3 2JB4A 2NPIA 3C7OA 1DGWX 2WO7A 2UYBA 4CDWA 1PX3A 5FAXA 3KCXA 2YBPA 3JU9A 2BNMA 3MPBA 1NA1C 3LA3A 4N53A 4PLOA 1GWMA 4JGYC 4KG0A 3I2DA 4P08A 5F3EA 2I07B 4LA3A 4GWIA 3VL9A 3ZN5A 4HANA 1W39A 4N9IA 3T4VA 5JI7A 1GWLA 2RS33 2WLPA 4FQ4A 1COV2 4HKWA 5A7PA 1ZZ7A 3RYKA 1BEV2 3KS7A 3AYCA 3NAPB 5K0UC 1UKGA 5CFDC 3VD5A 2B5HA 4GA9A 4I0WB 3RWKX 1DHKB 3K51A 1R081 4BU2A 1NE4A 4NIHA 5L73A 2HBTA 3CHXA 3DYOA 3O0XA 3ZR6A 3CLPA 4AK3A 2RMU1 1PK6A 4MHRA 5A7OA 2YBKA 1ND3A 3RI8A 2E63A 3T0AA 4Y33A 2AC1A 3CJXA 2WNVB 3TNPB 4KMQA 4B1MA 3R6SA 1QDOA 1IG3A 4KL1A 1BVP1 1QJU1 2ENRA 2JKBA 4GKYA 4XUPA 2C6SA 5FBJA 5FXWA 1PIV1 2ZHKA 3F95A 4PBOA 5C70A 3LDKA 3VBRA 3E6BA 3C8XA 3GYDA 2W9XA 2RS51 3POBA 1OFSA 1J59A 1O4YA 4ZXKA 3ORJA 3ZFFA 4ZZ5A 2FZ2A 1QU0A 2ZS6B 3WF1A 2PHWA 5FZ8A 3DPRB 3OOXA 4AAXA 3ZSLA 1CIWA 1RIRA 2W5FA 1IKPA 1MR5A 2I2SA 1IS4A 2W08A 1D2QA 4LTAA 4QU1A 3ZXEA 1WW4A 4ATFA 1VJ2A 4OUMA 4PT6A 1JHJA 1DQ6A 1SG3A 1ULFA 3P3NA 1AUYA 5EJ1B 1UN1A 2ZGPA 3ACFA 3MF6A 3UNPA 4H55A 4U2AA 5FYTA 3KWVA 4SLIA 4UFKA 1Q43A 2G9ZA 3ZX7A 4IEPA 5J48A 2Y6KA 4YRDA 2FMYA 5H9PA 1M06G 1AJOA 2IC1A 3JXSA 3CJIC 1F2NA 1NCRA 2GNBA 4XUQA 4XVHA 3TEYA 1GP4A 3ZYRA 1Y3TA 4XAAA 1MZFA 1JHNA 4Y1UA 4ZS3A 1SZBA 1JYIA 3DV8A 3L2HA 4XTMA 5FWJA 4M01A 1WMFA 5DG1A 3CIHA 3MUZ1 5J36A 3PVNA 1FAYA 1OUXA 5IFPA 4N90A 1S0CA 2IVJA 4CP0A 4Q4W2 2GNTA 1OD5A 3A21A 3ZN6B 3SHRA 3URFA 4CDUA 1BK1A 2DUQA 2PN5A 3APBA 4OHZA 5A1FA 2CY6A 2UURA 2YU2A 3BU7A 2J1SA 2JDNA 4Q26A 1UX7A 1REEA 2CAUA 4ONUA 4A7ZA 4I3GA 3ZMOA 4YW7A 4DZGA 1UZVA 3GBWA 1YYNA 4XOGA 2OT7A 1Z7S3 4UAPA 4DRRA 4CCKA 1JZ2A 4CCLA 3OYWB 1OQEA 2VZ1A 2TUNA 3IDEA 1IPKA 1T6BX 2O0OA 1COV1 3AM2A 3C7HA 4GB31 4R52A 3J9SA 5F32A 1BKZA 3ZMNA 2WAAA 1OLMA 3VLBB 1CGPA 1CJDA 3JQXA 1UAIA 2VQAA 4URAA 4IERA 2VCAA 1DZQA 2D7FA 4O61A 3H8OA 4BQ1A 4Z2AA 3HN1A 2D97A 2GH8A 3OBAA 4RHV3 5CU1A 1OF4A 5KC6A 4BQWA 4ZU7A 2D40A 4WZFA 3ZFEB 5BNPA 4RS5A 2PAEA 3BB6A 4BB3A 4XF3A 5A3UA 1GOHA 1JYWA 4EWEA 1CAWA 4LUMA 2HKXA 4MXWA 2Z5WA 3WINE 1VBC2 2ZX3A 2IUWA 2WFF3 5K9YA 2ZX4A 5DDJ3 2GMEA 2B4KA 1W9FA 4NPMA 1AZDA 4E2QA 1I3HA 4PHZA 4KWLA 3AKPA 5CG9A 4CP2A 2WNVC 3N7LA 4XQDA 1T2XA 2A7AA 3LCPA 3NKTA 4Y24A 5HCFA 1S0FA 1V9U3 2XR4A 1G86A 4QX7A 5FP3A 5FZFA 3V0AA 4FT8A 4RGAA 1HLCA 5IVFA 4JTOA 5KXDA 3TB0A 3LB9A 4TN7A 1WCQA 5F6KA 5L19A 3I3DA 1K5JA 4H3WA 4X8PA 4FPOB 5C8CB 5I91A 4AGVA 1LOGA 3AVRA 3NRUA 4L0PA 5T5LA 4AF9A 1VPHA 3INAA 2R49A 1W0PA 1PO12 3VDAA 3DPRC 1DDLA 4E9KA 2EIEA 4QGNA 2KR2A 1ZBA1 1S4CA 4NVPA 2A6XA 4K7JA 1UPIA 1ZZCA 3N9LA 2Y6JA 3BPZA 1IGOA 5IATA 1W6QA 1W9YA 1RL3A 4YARA 1OVSA 2WO3A 3MIGA 4XUTA 2ARCA 3SKVA 2JKXA 1WD4A 2NMOA 2XWJB 4OYUA 5FMCA 4YSFA 5ABJB 4ATEA 3CZJA 1C1FA 4BIFA 5A3NA 1W6PA 5EV7A 2MPFA 1RMU3 5FFOC 5LRRA 5DUUA 1G8WA 1DGRA 1PNFA 4P02B 5J09A 2RG4A 1J3PA 1H0BA 4K1ZA 4MVTA 5DZEA 5A3LA 3I2OA 2BFUL 5FP7A 3SCGA 5FUIA 4AVAA 2QTWB 1CZTA 2WO1A 3OBZA 1W9WA 3N7KA 4OCTA 2J1TA 1XSRA 2ERFA 5DZFA 4XJ8A 3AL6A 1QEXA 2D3PA 1LOFA 1SCSA 2XKOA 3MFAA 4BJ0A 5A3PA 1D4VB 5K4LA 4YPJA 1URXA 5A7WA 4IEXA 1CAVA 2DCKA 3ELNA 1Y9QA 2XLGA 4GMP0 3UETA 4CPBD 4QAWA 2HWC1 3OPWA 4EWDA 3ZOIA 1WCSA 2J1AA 3J8F3 4OUEA 4PCRA 2H0VA 4XETA 4YFWA 2EIBA 5EYYA 1ND2B 3T09A 4HKLA 2X10A 5GZDA 5HBAA 2VNGA 3GDBA 3ZSMA 5AFEA 1GANA 2HLEA 2NYYA 4LBQD 4LHKA 4NHMA 5L9VA 4HOOA 5FV3A 5FZKA 2QQWA 2VUCA 4QHZA 1JYTA 3I2IA 2HH9A 3K3OA 5I8YA 2JDYA 4FP2A 1AXKA 4YW5A 4HETA 5B4NA 1FX5A 3USUB 3RS6A 1Z7S2 3ZFEC 4C0HA 3BPSA 4A45A 5FPUA 5J3UA 1G6NA 2P3JA 3BTXA 1XSQA 2JG9B 1PGW1 2BGPA 3O5SA 2QDRA 3NJVA 5FO8B 4BQ3A 1XYNA 3PVBB 3M8LA 1DF0A 1POV0 3T2QA 1UZZA 1OPOA 1PO11 2ZAAA 1VBB2 4NPLA 5KXBA 3KV4A 3GCXA 4BH9A 3LWCA 3VHNA 3WF0A 2FCTA 4RHV2 1PO23 2Z2SB 4IV1B 4JRAA 1K5MA 2IFRA 3LPGA 5FXZA 5LA2A 4B3NA 1WKYA 1I5PA 1N1VA 5AFBA 1AYN1 5T5OA 3S30A 2RVAA 2RE9A 1ZVFA 1R091 5LASA 2QQMA 3VKLA 4B4RA 4U36A 2ZEXA 2XUEA 1AVBA 1FMD1 1SLIA 5F8PA 1GQPA 3WP4A 1IPJA 4Y1XA 2VMDA 2P17A 3E6DA 2WFF2 3EQEA 5C8CC 4DXSA 1MEC3 2F4PA 1RUH2 3VBHB 2VW1A 4P9YA 1SEFA 1CAUB 3VL8A 3ROUA 3VBUB 2D5HA 4N43B 1S0GA 3AK0A 2ZXQA 2CGNA 2ZEZA 3OSDA 4HN1A 5B4XA 4IXLA 4EZ4A 4FBFA 3PUSA 2XJRA 4O7XA 1LB2A 1ULGA 2Z69A 3IPVA 1EAH2 1Q3EA 1QDCA 2ORZA 4BISA 1R1A2 5LK5A 5ABJC 2ORXA 5FMOL 2D44A 4JVAA 3HR9A 1YHFA 4M0NA 4WVMB 3I3MA 4Q8LA 4IEYA 3WT3A 1OT5A 2AENA 3MIBA 4GULA 2UWBA 4HVRA 5KHKA 5FMOS 3EJKA 3LZZA 3UK9A 4LT5A 5C4WB 5FREA 1ENSA 2R042 1RUD2 3ZXFA 1YQ2A 1AR61 4YVSA 4AL9A 5A3TA 1H6YA 2QBXA 2GC3A 1HRV3 2WS91 3MEPA 4URTA 3POJA 1CX4A 4D6QA 1LOAA 4FQZA 2JE9A 3IMNA 1MZEA 4GWMA 3KGLA 4IV3A 4XCAA 4XXPA 1Q8QA 4UT5A 3OY8B 3O14A 1OKQA 5SV8A 4NO4A 3NAPA 1HB4A 3WW4A 4DEQA 3U4XA 1KDMA 2VTXJ 2VZVA 2ZZQA 3S57A 3RQ0A 5FY7A 1DYPA 1GFF2 2RDQA 4A7YA 4CVUA 2H6BA 1W2TA 1MS5A 3WQ7A 4D3WA 5A7NA 3THPA 4AQ2A 5F5AA 1DIWA 3N9NA 4Y4RA 1W03A 2VOVA 1RVF3 1RUF3 1EUTA 2ZKLA 1LHVA 1MZ6A 1ND2C 2WNVA 4LBNA 4OHYA 5IT6A 1L7RA 5CFCB 3I2JA 2L9LA 3HNYM 5F2WA 4NIGA 3N35A 2WT1A 1CIYA 5C9AA 4YW2A 1OOPB 1EYBA 1VBB1 5DQ0A 5ACA3 1LNSA 3POEA 3LSDA 4I0BA 1H4HA 3JQWA 4L99A 4MX3A 2RS11 3LEMA 4XF0A 5FPLA 3B02A 2OQ7A 3TOJA 1S2KA 4WBBA 1SCRA 5T5PA 1H1IA 2JG9C 2WUHA 3MFCA 1PZ9A 4XFHA 3T2TA 2ADDA 3J8F2 3LE0A 1RUE3 2X53S 1J84A 1VMHA 2PHUA 5HCAA 3HIFA 1I5ZA 2D6OX 2VZRA 1SPPB 2B7YA 1UX6A 1DQ2A 1H30A 4V1PA 2P37A 1XC6A 3U14A 2KD7A 1HB2A 4YYOA 3LQCA 4YW6A 1RUH1 4OMDA 5FRAA 1JBCA 1DGWA 1N3PA 2WINB 4D94A 5IK5A 3EB7A 1CESA 2VTFA 2HBUA 2ZGTA 3PUIA 4IV1C 4HK8A 4XFGA 1LAJA 1LHNA 4AAPA 3NV1A 5T55A 3GZTB 4QU2A 2BJSA 1UZ0A 2ZGUA 1EAH1 1L7QA 4MGSA 5FZBA 4ES9A 3HOBA 4RGKA 1O5LA 1R1A1 2IXCA 1IPSA 4BWOA 5LBBA 3M3QA 5CG8A 2WZR2 4AW7A 4NWWA 3VBOB 3ZN6A 3SEPA 3VBHC 3PUHA 2QQPA 4FFGA 4AE2A 5D2AA 4YM3A 4Q0QA 3VBUC 1R083 5IVJA 1H2LA 2O14A 1OH3A 3GBFA 4N43C 4XEZA 3H3LA 1FT9A 2R041 5FYHA 5LW9A 1DZRA 2R071 1RUD1 5IK7A 1YCIA 2BOJA 2P2KA 1XNKA 3FLRA 3KGZA 2AYHA 3R05A 4Y20A 1TME1 2JDPA 4DMIA 2ZGOA 1EV12 3WQ0A 1OD3A 3IDBB 1G9DA 2CHHA 2YZ4A 1QJU3 2E7TA 2OXBA 2Q1FA 1A6CA 3VBSB 5DABA 1PIV3 2ZGQA 2F6BA 1QJEA 2GC1A 3CMGA 3O0WA 5CB7A 2CNAA 3OGVA 4YGBA 5GJ6A 3V0BA 4ZZ8A 2RS53 4XMAA 3LPFA 4ASKA 2BDRA 1NYWA 4FVVA 2YY1A 2FZ1A 5DAQA 2Q8OA 5C4WC 3FMGA 4DXTA 1D0HA 3KZ4C 1AR82 3T08A 3FBYA 4ORFA 1Q56A 3ATGA 3VV1A 2CYFA 4GH4B 4HPKB 4YFZA 3IM0A 1KXGA 3VZLA 5HV0A 2VNOA 3ES1A 3ZIXA 4YG6A 2W1QA 4MLOA 1UO9A 1O4TA 3CQOA 3EHKA 2DU1A 1RXGA 3B01A 3KVBA 1U5ZA 2C9KA 4E4DX 1JTZX 4UFLA 2C1FA 2Q30A 1Z78A 4DQAA 3KD4A 5FXVA 2HYXA 3QD6A 2VQ0A 4QHOA 5H9QA 4LE4A 1W6NA 2GZWA 1VIWB 1HQWA 4ZU5A 4PDWB 3H0OA 1WW6A 3VD3A 4QX1A 2VXJA 4L92A 3UJOA 4AHZA 1AHSA 3O1UA 1HRV2 1XRUA 3ZPYA 3MIDA 5CFCC 3LDBA 1C5HA 3BOPA 4A2UA 2EAKA 1OKOA 4B4PA 4GWNA 5J7MA 2XL9A 3FJSA 1OOPC 3AB0A 1H8TC 1UY4A 3LEKA 1YWKA 2YC0A 4NJ4A 4QPGB 4YGCA 5GLVA 3WUCA 2FDKA 5C8CA 2QE3A 4H7MA 2E33A 4YG0A 5LCWL 5ANNA 5GM0A 2A6VA 1WWYA 3C7EA 4DUXA 1POQA 1UF2C 3FUQA 1DGRN 1VRBA 2VGDA 4ASLA 4I0AA 4C91A 1WBFA 3K77A 4NHXA 1O3QA 4GB33 2RV9A 2BWAA 4DUVA 2LRPA 2WZR1 2VOWA 4IETA 4COWA 1XBFA 2BNOA 1DYOA 4J25A 4PQQA 3RI9A 1S55A 3S0MA 1RJ7A 3VUOA 4AVVA 4META 5CVRA 1ZNPA 1V6IA 2BV4A 2J42A 4FPKA 4QDQA 5FP9A 5KXEA 2D93A 3MYXA 4BLJA 1N3QA 4PJYA 1EV11 2LALA 2VJXA 5FYVA 4CUAA 1DQ1A 1RUE2 1JYVA 2AH2A 4AWDA 1WMDA 1RXFA 4UF0B 5FZLA 1CPNA 5IYYA 3LA2A 1VBE2 3WNXA 1T6GC 5FTTC 3VBOC 3LIHA 1L3JA 5EYXA 1JYCA 1AR92 3NJXA 4AVBA 5GLTA 1GBGA 3BKZA 1Q5OA 4JV4A 3TN91 5FY8A 5FZAA 3SNMA 1F8VA 3V64A 4LBQB 3HN3A 3RZHA 2CDOA 1LEDA 1QWRA 4OI0A 2XBO2 3WQ1A 3AZVA 5KXCA 3O1TA 1XNBA 1AR81 5HV4A 3MLJA 2K0GA 1SBEA 4JCKA 4K6BA 3T2PA 4Y26A 2KM2A 2WNOA 1TNRA 1ALYA 3T1LA 4OI2A 3WDUA 4IE7A 2BEOA 3LFMA 4B7KA 3VBSC 4RFRB 5F37A 2YC2A 4FXKB 4HK9A 5DZGA 1UIJA 2HWB2 3WNKA 1O8PA 4TWTA 1ND2A 3ITQA 3ZLIA 4UW4A 1Q8OA 5FKBA 1QJZA 5A3OA 1VBA1 1NT0A 5JMOA 3O1MA 2E26A 3N7JA 1R082 2W52A 3PUQA 1NXD1 4Q1RA 4B7EA 5FPVA 4AI8A 4LNVA 5C6CA 1ZBA3 1WLCA 1WZXA 2C5DA 2DUPA 2WN3A 4IL7A 4GH4C 4JKMA 2VM9A 5GZEA 3ECQA 3QACA 5C3RA 2JG9A 1QJU2 2VOTA 3LEGA 2W3JA 2HEYF 5FZMA 1O8SA 4QX5A 4AFCA 1PIV2 1W28A 1MS9A 2XJUA 3U1XA 2CAVA 4ZY9A 3WDWA 3M1HA 1SDDB 3NNFA 2DYCA 1GOGA 5I0UA 4LITA 1YRZA 2RS52 2EXIA 3IAPA 5IK8A 2OPKA 4CYDA 2OA2A 2ZOEB 5FCCA 4QKFA 4IW3A 2ZZJA 4O9GA 5J98B 1SLBA 2XONA 1YIFA 1Y7BA 1ZZ6A 2D43A 4PDWC 1G9AA 1W9SA 3IZOA 2ZGRA 1GOFA 4IV1A 1OQDA 2QKDA 4IEWA 4N9HA 4EQVA 5C3QA 3K3NA 2PA7A 1CJPA 3OBRA 2IXLA 2QQJA 1C28A 3VZNA 2JENA 1IQAA 2VOKA 4TXWA 5GZFA 1VAKA 2DDUA 5EWSA 4EV0A 3D0SA 1GP5A 2DBIA 3ZYPA 1CONA 4M4RA 4QPGC 4PQ9A 5JSOA 1NAEA 2BGOA 3WHTA 5IW0A 3VD9A 2CU5A 4YM2A 1JS9A 4BE3A 2Y6FA 3VBHA 4QX3A 1D2SA 1OMIA 3THDA 3ZYIB 2NM1A 2PTMA 4P5HA 1B35B 3GZUC 1BK0A 3VBUA 5FOJB 1DG6A 3BTAA 4KU7A 2PHXA 2HWC3 5A6QA 1JZ8A 4XPVA 1VBE1 4BDVB 5BNOA 2Z79A 2OYZA 1XOYA 1GQGA 5A33B 3AFGA 5FYSA 2YDEA 1AR91 4YVWB 1PGL2 2B39A 2P4EA 5JDBA 3H42B 4ARXA 1IHMA 1XNCA 4IDZA 2FDGA 1PVC1 1UOJA 1C1LA 4WVMA 1GMMA 1F35A 3FL7A 3VD4A 2HWE1 2XBO1 1SFNA 3ME2A 2V73A 3THTA 2FDFA 4J6GA 4YZ5A 1LGCA 2Q8DA 2BTVC 1JZ6A 1LGBA 1XYPA 5CNAA 2BRTA 2QQLA 4FFFA 3OJBA 3OB8A 2YV8A 2W1SA 4GB32 4YWAA 2VH9A 2HWB1 3GCWA 3ENRA 2XL7A 2YFZA 1UY0A 4QPYA 1C57A 3RMYA 1FYUA 1UU6A 4XCBA 4Y22B 1ZREA 2FD8A 2WWUA 4AQSA 1N1TA 1O6UA 1QH6A 1PO13 2VZUA 5DPNA 5JIAA 5I0TA 5FPXA 4B8EA 5E6HA 2XJVA 2GN7A 4DS0A 3WY6A 1N3OA 5JOXA 2A6YA 4TLGA 3TEZA 3BGAA 4S2FA 3TWIA 4WZCA 2BVBA 1SHWB 2TNFA 1VAMA 3BI3A 2NP0A 1AYN3 1W8NA 3WXPA 1CQ9A 1C8NA 1QJY2 3I59A 1R093 5CISA 5H9RA 1ENXA 1FMD3 5CFCA 3UJQA 3DL3A 4JC1A 4C1XA 3UKTA 4CU9A 4A41A 4IQPA 3AMMA 1YFYA 3GJAA 1US2A 1QOTA 4Q0UA 3J7MA 4EE2A 1O5UA 2JG8A 3PLQA 1UYXA 4IEQA 5L7OB 4ZS2A 3ETPA 2HJIA 1WCUA 2RM22 2P3YA 5F5CA 2ZGSA 3G6JB 2W1WA 3ZYJB 3POGA 1VRH1 4OFGA 4PIXA 3AP9A 1AL21 2YROA 3VHRA 5KC5A 1QJFA 2HWD2 2QZ3A 3ZO0B 1F31A 4M3CB 1W2UA 3UKNA 3LAGA 5BNQA 4WVZA 4BMBA 2C26A 3BTYA 1ZA7A 2X29A 3H8UA 4LIUA 1LKNA 2WWJA 1CAXA 3KVAA 4CU7A 2VQTA 3KB5A 3OCPA 2WABA 1YQCA 3N3HA 1O4ZA 2BERA 3HNBM 3UT0A 1S2EA 1R64A 5FLIA 3RWNA 5KBFA 1ZBA2 3U78A 1ZRDA 3POYA 2E32A 3QH6A 4QGLA 1O7FA 1AR63 3U4SA 2Q4SA 2QJVA 2WS93 4CCJA 1RUG1 3T2OA 4AXOA 5F3CA 2A3XA 4GIQA 3I49A 1ULPA 1DQ4A 5C3OA 1PGL1 2KXLA 2VE1A 4AVTA 4CDXB 3WDVA 3HMYA 4YZ3A 4JDNA 5AC92 5LA9A 1MQTB 1AR72 2ZGLA 1OF3A 3T3YA 1JZ7A 4LBJA 2PMWB 2BBVA 1QXPA 2QQKA 4MGQA 5FZ3A 1B35C 2LUWA 2O8OA 1IKQA 4WM8A 4OQ9A 4DPNA 4FTSA 2WAOA 1E5IA 1LODA 2WSVA 2ATFA 2TEPA 2WNUB 3D0JA 3KCYA 2B42B 3OUJA 4NHYA 3R0RA 2XG3A 1XU2A 3KQ4B 3D8CA 4YVWC 4EWAA 1TVGA 4QXCA 5JR7B 3LFIA 3NKGA 4UBGA 2Y33A 3U11A 3ZSKA 5JOWA 4CSWA 3MIFA 4I09A 4CEYA 1VBB3 5C5TA 2BP6A 4OVEA 1GNYA 1ZBE3 2F17A 2RS13 4JDOA 4NAOA 1ZZ9A 4JAAA 5BUVA 5FKCA 3WF3A 2D98A 4KI5M 4HBNA 5A1LA 4ASMB 2VG9A 1G9CA 2HWC2 2DCTA 4WM7A 2WZPP 4BMEA 4BPZA 2R6QA 1TE1B 2OVUA 2YC4A 2GH2A 4FPJA 1QJY1 4BXSV 4N8MA 4YG3A 5B2GB 1X9PA 5BY5A 4XBNA 1WLDA 4KBZA 3SEEA 2VMCA 4H7LA 5FZGA 5JZGB 1Z0HA 1S0JA 2Y0OA 2PXJA 1RUH3 1PZ8A 4PF1A 1LULA 2DCYA 4Z82A 1LEMA 5CA6A 4HG6B 1GYKA 2W94A 1DQ5A 2VU9A 2QQIA 2RM21 3ZFGB 4AFDA 1UZYA 2C4XA 2V5YA 5CKNA 1SMVA 1W99A 2FDJA 4IEUA 4ITCA 3CBNA 4JHTA 2OZJA 1XE8A 3VDDB 4E4ZA 1PGW2 1PNGA 2CDPA 3ZXJA 4BM8A 1EAH3 1VBD2 4COZA 4DY5A 3E6CC 1QQP2 1QNYA 2HWD1 4AEJA 1R1A3 2V4AA 2Y8KA 5CKMA 1HX6A 3GF6A 1H2KA 2DUOA 4XFAA 3IDAA 4NN0A 2FMDA 1RHI1 2RR13 3N4MA 1GR3A 1HJFA 1W6OA 2ADEA 4IE6A 5KR7A 1YIPA 3VBFB 4CDQB 2CL2A 2Y26A 1KD7A 2Y0IA 3FHAA 4CCEA 5L7OC 4MGTA 2WNEA 2V4VA 2FDHA 2R043 4SBVA 5DUXA 2R073 5IVCA 1RUD3 1YQ8A 1PX4A 1VB4A 4LKFA 3WD5A 5I8SA 1TME3 2WBKA 1BXHA 1U5XA 3H50A 3RG0A 2P5BA 1UIKA 1ULCA 2CSGA 1AYN2 1LTEA 4Q4Y2 3WG1A 1LENA 4D7TA 1R092 2C0ZA 4QQ2A 1YQ5A 4CEWA 1XNAA 2VOXA 3WF4A 1FMD2 5DG2A 3T30A 4P9IA 5FYIA 1XJAA 5AC91 1AR71 5A70A 1RTVA 4NIAA 1W0OA 4S2DA 1UD1A 3PU3A 4Q5OA 1KGYA 3AKSA 2JDKA 2YPDA 1WCKA 5EXOA 1OPMA 4ISRA 1O3RA 3PJQA 3SCFA 4PBPA 3GHNA 1SBDA 3VN4A 1O3TA 1FPN1 3OUHA 4RR3B 3IIAA 2DVBA 1NA1A 3BTZA 1CZSA 5G05L 4JGYA 4XQ4A 3WNPA 4Z8BA 2X09A 1A8DA 4FXGB 2YMZA 2YUEA 3JB4C 1QNWA 4UF0A 4UFJA 4CDXC 1Q8VA 1NLRA 4LLFA 3PDQA 3OGGA 3U10A 1MQTC 3VD7A 1VE0A 2GMMA 4XHBA 4Y5Z0 5A7QA 3PTYA 4E2SA 5K7PA 1UOGA 4XHXA 3WNMA 1OA4A 5K0UA 5FZOA 5CFDA 4EN7B 2I45A 3UGGA 3H7JA 1ZRRA 2P6CA 2WT2A 3FBMA 1HV0A 2WNUC 1SFPA 3LEIA 4XF4A 3WCSA 3I8TA 1UOBA 1D4M1 1BHGA 1AR62 4R9CA 1O3SA 4IE5A 2WS92 3ZXGA 4FPLA 5C7GA 1YXWA 1XB9A 2K46A 2ZAHA 4A3ZA 1YFWA 3GHMA 4UFHA 1MVQA 2GMPA 5KHJA 1V6NA 4P9XA 3WNNA 1UU5A 3TAYA 1ULOA 1WUVA 4B4QA 4XUNA 1KDKA 2ET7A 4HONA 4Y5TA 1H2MA 5A3MA 4QPWA 1ODMA 3WHUA 3N9PA 4FOVA 4X8NA 4WVVA 4FFIA 2MNGA 2I74A 3M70A 3OD0A 4I02A 3QBQA 4AHWA 5FO9B 5HCHA 4FTBA 3R4DB 5IAVA 1NLSA 4CCMA 1VBD1 2DTYA 2Y60A 3EYPA 3S7IA 5FK7A 1QQP1 2DCJA 2FCUA 4LK6A 3WLUA 4ZKTB 4Q1PA 5FLJA 3S7EA 2WZR3 5JZGC 3ABZA 1GZTA 3W5MA 5DAXA 2GAUA 3KV9A 5A32A 3SC7X 3MDPA 1GQHA 1VLNA 2PQQA 1W6MA 1ZBE2 2OX0A 2RS12 4D0QA 4QQOA 1OQ1A 4DEVA 3ZFGC 2D5FA 2UYAA 2GC0A 3CJIA 2W46A 2UU8A 3OUIA 4RYDA 3VDDC 3FUOA 3KM5A 3B94A 1EV13 2DURA 5JSPA 1RUI1 3TEXA 4Q4Y1 5JPNB 5FZIA 1LHWA 5A33A 2ID4A 3RZGA 4FFHA 4KWUA 2GDFA 4QKNA 2X5IB 5F9TA 4GKXA 2W68A 5F3GA 4S2GA 5F39A 3OEBA 1NZCA 5IK4A 3S5QA 3BVCA 1JODA 3TN93 5CIRA 4LO7A 2VMEA 4CP9B 3VBFC 4CDQC 1JYNA 1BMV2 2JIGA 2HWF1 4YLZA 2DCZA 4MYEA 2ZGNA 2Q8CA 3VKMA 5BV6A 1FNZA 1AR83 1SLTA 4KWJA 4P9LA 5IVEA 2JB8A 1AJKA 1S0DA 1B35A 3HEIA 4IGOA 4QX8A 1LOEA 2GSYA 3ILFA 1PMJX 1LESA 1YI9A 2Y64A 4LUKA 5FY4A 1C4RA 3ETQA 3ZIWA 1TQ5A 2FQPA 4LXLA 5CZKA 5APAA 4I01A 1JOBA 3HQRA 2A70A 1HIXA 1S0EA 2OS2A 3SMHA 3O1VA 5GLUA 3W20A 4YM0A 4P5YA 1VBA3 1HJGA 3UL2A 5H9SA 4Z1VA 2RR12 3A0NA 3T4HB 1W8WA 5DMYA 3KMHA 4JGZB 3O1SA 1YFUA 3KHCA 1IG0A 2X8KA 5F7UA 1J58A 4LBLA 5LBFA 4F3JA 1UMZA 4YW4A 2NMNA 2R072 4RR3C 2B46X 2OQ6A 1TME2 3JCIA 4XDPA 1H1MA 1S0IA 4LK7A 3ZXDA 5IVYA 2XHNA 3AP7A 2EF6A 4JHZA 4CDWB 3WP6A 4XABA 2R32A 5T3NA 4QQHA 5D8AB 1DU3D 1HXS1 5JVVA 2VY0A 3POIA 4P9JA 4N53B 3A4UA 4KGQA 4Y22A 5FQ0B 2LW8A 3CDZB 4FPYA 1BJQA 2OKXA 3I2FA 4K8RB 4DXRA 1JOJA 4LO8A 1I1EA 4AI9A 5A80A 3RZZA 4DFSA 4JTNA 1PM7A 3B5LB 1OUSA 4V2WA 4NIIA 5EJZB 5FK8A 1CD3G 4A42A 2IZWA 4XACA 4QX2A 1DLCA 3PL0A 1X8MA 3FFZA 2EICA 4K9SA 2DVFA 1TNFA 1H8TB 1W3XA 1ZBE1 2LS6A 3HBZA 1W04A 3LIGA 1ND3B 2ZPXA 3AMQA 4IEVA 4S2HA 5FP4A 3WR0A 4UW3A 3ST7A 3X29B 2SBAA 3VHOA 5AVAA 2B9UA 5DAPA 4LMFA 1HN1A 3DPRA 2Q5TA 4AOCA 2QCSB 4BA6A 2ZTNA 1F4AA 1O59A 2BW8A 2E53A 1CPMA 2CGOA 1YJLA 3DXUA 3Q8EA 1VBE3 3ILRA 2BOIA 1Q8SA 2E6VA 3GGLA 3AYAA 4NOTA 5EZWA 2RHPA 3PMSA 4OUSA 1F9KA 1G9FA 1LOBA 1AR93 3OBTA 1GLHA 3ZFFB 4CTEA 2EAAA 5IVVA 2WT0A 4FPGA 2HYKA 1BMV1 2PQSA 4FPHA 4UFIA 1PVC3 2F4LA 3CKHA 1OC1A 1D0GA 2HWE3 2XBO3 3VDBA 3R4SA 3IDCB 1W8ZA 1Y9GA 4JZRA 1JZ3A 1QY4A 2JD4A 4BCUA 4DINB 2XPJA 3AVSA 1YI7A 5EJ3A 1E5RA 1DCSA 5IHRA 3J7HA 1SACA 3JD71 2X5IC 3VB9A 5IAXA 4XYXA 2HWB3 4AI3A 1Y43B 4UXAA 3HVDA 3MGUA 4KQ7A 4K1YA 1VALA 3AZWA 1NCRB 2RR11 4FAGA 1A34A 4E4SA 4EROA 3I2HA 3BIWE 3A7QA 2Y6HA 3HJRA 3J26N 5LA0A 1OA2A 1QOSA 3A0KA 3MW3A 3OF1A 3OEAA 4GWJA 5F3IA 5AVPA 1MS8A 1GUIA 4HFSA 2WYSA 2PAMA 4IUGA 1PVXA 5FYYA 1IS5A 3KV5A 4QQPA 2G1MA 1V6KA 1LU1A 3OYWA 4CDUB 2XVGA 5CAZA 4QM9A 3KLSA 3P5BA 1TEIA 4MGYE 3MBWA 4EN0A 3AX4A 3H9AA 2B8MA 2VULA 3KQRA 3LF7A 2G4IA 4JGZC 3TN92 5JXIA 1KS4A 5FXXA 4R4ZA 3ES4A 3U75A 3HNMA 4DXZA 4GJZA 4OI1A 1OFNA 3WOGA 2VBBA 2VZQA 2Z4FA 4G9SB 2XDVA 1C5IA 3O7OA 5T5JA 5FJHA 4BQ5A 1DFQA 5BNNB 4AHXA 3RYRA 1ODNA 5LA1A 3ZFEA 4TTGA 2MEV3 1W8FA 1VRH3 1LRHA 3AP5A 4OQ8A 3IBMA 3Q8FA 1AL23 1QMJA 2JDZA 4W6YA 4CDWC 3WP3A 3BIEA 3HD8B 5FYBA 4L2NA 5D8AC 3VKOA 3VZKA 1QHDA 1UMIA 1SLLA 1POV1 1VBA2 2Q1MA 4W8JA 3OGSA 4N53C 4ZONA 3KF5A 4G4FA 4QXBA 1GZ9A 1K3IA 3M4FA 4PI0A 3VGIA 4JRLA 3SCHA 2DU0A 4BK4A 2VMHA 5BNPB 2B45X 5EFUA 3AKTA 4XJUA 3RZJA 1QIQA 3ILNA 2JE8A 4XW3A 1CN1A 2XQRA 1GWKA 5JOYA 5FZ4A 3M7AA 5CEHA 2ARAA 3PJYA 1RUG3 4XJWA 1NQDA 2WRAA 1OLRA 1ASJ1 2ZX2A 3OPTA 3H1MA 5DN2A 4TZDA 2JECA 1QXJA 5FPAA 1ND3C 1MS3A 2VZ3A 3AMPA 4J1WA 4NMIA 3ZSEA 2VW0A 1JU4A 1UPSA 3VBFA 4MSVA 2DBNA 4P9GA 1RUC2 3V0AB 1H1AA 4AEMA 4FPFA 3RRDA 4XZPA 2WQZC 2YGMA 4XQWA 3VBRC 2R1DA 3LA7A 2W2IA 4XIKA 3DF0A 4AI1A 3AXDA 5JIUA 2A3WA 1OLME 1YUDA 3ZFFC 1W0NA 2D6KA 4YZ1A 1WGPA 5ABJA 1WW7A 2WA3A 4RGGA 4ZPIA 3J4UH 3E5UA 2GN3A 2ET1A 2VMGA 1S1AA 3LD8A 2QQVA 3PUAA 4QXKA 4COVA 1M4WA 1W6QB 2AEYA 3Q8CA 4K40A 4P00B 3MZHA 1LOCA 2JDMA 4QB6A 1QJY3 5A3WA 1RUOA 2PELA 4YZ2A 3LKJA 3I3EA 4IGPA 4XXAA 4AGGA 1HQLA 3OGJA 1NCRC 1RC6A 2AEZA 3T0BA 1W6PB 1XE7A 3QOPA 5CKQA 1UU4A 2WDBA 2PHRA 3I2GA 3PIGA 2ARBA 1PVC2 3P3PA 4FO9A 1HKDA 1AXYA 1Y9MA 2HWE2 1DLLA 3M3IA 4MXVA 3D5OA 4UI9L 1OSGA 2RM23 1H8VA 2ZA9A 4LOSA 4AZZA 3N9QA 1G7YA 4MGZE 4H14A 1N47A 2V72A 4OHXA 4CDUC 1JYXA 4J1XA 4P14A 2HWD3 4NIDA 1QOOA 1GKBA 5M0TA 5C8WA 1RINA 2GNDA 5A7WB 4Q4X2 4MG2A 2E7QA 1RHI3 1CAVB 1GNHA 5A6ZA 1OURA 2RDSA 4HL0A 4LPLA 4A7KA 3J7NA 2P6HA 3ALQA 4YZ4A 4PIYA 2D6MA 4NHLA 1XQNA 2Y38A 5BNNC 3O1RA 1D7PM 3LDRA 5D1IA 3VZMA 4FTEA 3USUA 4W50A 4XFFA 3HT1A 1ONAA 2CWMA 3W58A 2DF7A 2W95A 3HQUA 4Q0PA 4XDOA 4EN6B 3MIHA 2VAUA 2R7EB 3FWEA 2QZ2A 3WG2A 2P34A 1XNTA 3D6EA 1ULDA 2NLRA 4YNIA 3ZR5A 4AQ6A 1K42A 3I97A 5AC93 2QQUA 1AR73 3H8RA 1U0AA 1HRI1 1RJ8A 5T50A 2WQ8A 4QMAA 5GKAC 2CGPA 5BNPC 1ACCA 4NR1A 3NMBA 1UMHA 3VKNA 2FCVA 3CO2A 1RUC1 2XJPA 5GLZA 3H3ZA 1FPN3 1SFYA 1GP6A 3IWZA 4KU8A 4OULA 4XBLA 4BQXA 2MEV2 3HAGA 3DKWA 1VRH2 2JXAA 1KITA 1PHMA 3QH7A 1AL22 4E4HA 2HEVF 3IMMA 4UFMA 2N7GA 3WVJA 3I3BA 5FJKA 3W5NA 4AFMA 2UY8A 1JUIA 1GZWB 2ZGKA 2X5IA 3KF3A 4MGKE 5FUPA 1ENRA 4Q0SA 4QHBA 4XUOA 1APNA 4JDMA 3GJBA 1PGSA 1H2NA 1K5MB 3MIEA 4PLNA 2JIJA 5EQUA 5FY1A 1CAUA 3WQBA 3BODA 2RDNA 3AZYA 3AP4A 3KCCA 4N43A 3B93A 4Q0VA 1FV2A 2WJSA 1D4M3 3NV4A 1KJRA 3IIIA 2V5DA 3K48A 2AR6A 1RUG2 3WG4A 2XOMA 1QGLA 3CEWA 2QDNA 4V2VA 4IEOA 4A4AA 2H6CA 2JX9A 5IFTA 4GALA 4NE9A 4QWNA 1F5FA 4CCCA 3VKFC 4A3XA 3NL1A 4JGZA 2IXHA 2R0FA 3D4KA 5FY5A 2JEMA 4O65A 5C4WA 5D21A 2VXRA 3IPVB 1JU3A 2JJ6A 4D7SA 1CX1A 1C8M2 2D6PA 2WR9A 1VBD3 2JDAA 1DYKA 2NN8A 4C0BA 1QQP3 3WZ1A 4AHYA 1MZ5A 5JLVA 3IKWA 3PNAA 2PHFA 3P1IA 2WZEA 2A71A 3AJYA 2VBDA 4Q4X1 3ZKYA 5E1RA 3VDCA 4XURA 1JW6A 1S2BA 2EIDA 3OY8A 1LJ7A 3OD4A 4INDA 4LJHA 1GZCA 2ZJCA 5D8AA 1W2NA 2VW2A 5FYUA 3ZSJA 3ZVXA 4E27A 2KA3A 5GZGA 2IFWA 2VZTA 3MO4A 4TYSA 3L2YA 3NW4A 2G9GA 1J1LA 1QJX3 3DN7A 5FQ0A 1U5YA 4MGIE 4RSUA 3ZYHA 4YVSB 3N9OA 5FPZA 5T52A 5C33A 5C3SA 4RFT0 1RUI3 1DQ0A 1N1SA 1W05A 4Q4Y3 1CWPA 4IV3B 1LOFC 1STMA 2WSUA 3KV6A 2R062 1L7LA 3FHQA 3RJRA 1YQ6A 4FCAA 1SDWA 2YYOA 3KHBA 2D3RA 4AEKA 4XJ9A 3HT2A 1N1YA 2JDHA 5FLHA 1OOPA 1QXRA 4CRQA 2PYTA 1H8TA 2HWF3 3K4DA 2ZACA 3CL1A 3FLPA 4LO4B 3NNJA 1WA6X 4QX0A 1HN0A 1J3RA 3JB8A 3E1F1 4W4ZA 2A73B 3GBGA 5FY9A 3HBKA 4CCNA 3FX3A 2UWCA 2ZCWA 3RPQA 4MO3M 3RFRA 2MEV1 2ES3A 5HCBA 3TYJA 2VUDA 4LBOA 3W21A 4BYYA 1LU2A 5JWPA 4K21A 4DB5A 2AUYA 2BZDA 5C9AB 1SPPA 2YHJA 4WV8A 4XJAA 4K8FA 2WLQA 2MHFA 2VPVA 4XJZA 5F2SA 1KRIA 1RHI2 2P3KA 2WZ8A 2LM3A 1NOVA 3LGRA 5FZDA 2WWSA 2XH6A 5LZ6A 2JWPA 3LOBA 4C1WA 1CZVA 1HQNA 1W90A 3DYMA 4W65A 3AC0A 3DCQA 3NVCA 3KT7A 2A1XA 3PU8A 4HKOA 1W8HA 2YG0A 4Y3OA 2QNKA 4CUGA 2NQYA 5L36A 5LBEA 1NUKA 3ZXLA 4XF9A 4I2OA 5J37A 1SBFA 5KHGA 1ZRCA 1UYPA 2JE7A 1HXS3 2VNVA 3VBOA 1PM4A 4XMIA 1IQDC 3R4UA 3G7DA 1K5MC 3U37A 3WG3A 2XVKA 3ACHA 2J22A 1GSLA 3O1OA 1W8TA 1FPN2 1U5IA 3KSCA 4XBQA 1C8M1 1KEXA 3FLTA 3AKRA 5IJRA 4BQ2A 3HPNA 3ACLA 4CCDA 5JUVA 2Y6LA 1JMUB 1WMXA 3B69A 4UW5A 1ENQA 3MHZA 3VBSA 1J83A 1OLQA 5BXXA 4D7YA 1FNYA 2IXIA 1IS6A 2ZHLA 4QKDA 4CXXA 4L8QA 2BBAA 3AXEA 3C3VA 4M3CE 4BK5A 4ZHNA 2GC2A 1V6MA 2XQXA 3O12A 4Y20B 4D8MA 3RZMA 2Y6GA 3MF9A 4CU8A 4Z07A 4LO6B 2XUMA 3Q9OA 1MVEA 5L9RA 1NQJA 4COYA 1D4M2 1JXNA 5BNNA 2ZEWA 2ARXA 2GALA 2V09A 2W0XA 4GH4A 2R061 4HPKA 2G19A 3V0BB 1BEV1 3EBRA 4O9EA 3K4AA 3I2KA 4QQLA 4ARYA 4BLIA 1BZWA 2VVDA 1UNBA 1X9TA 2ZGMA 3HQXA 4EYUA 1AL0G 4FAHA 2R16A 3ZN4A 3AYDA 4YVSC 4FOWA 1AYM2 4XDQA 1W06A 4DNYA 5JAXA 4FPEA 5LBCA 3B9IA 4AVCA 4FP3A 5A6XA 5EIYB 5I0DA 5FMBA 3JBG2 1FOD2 1Y4WA 1TMF2 3I54A 4IV3C 3LSEA 4PDWA 3DGTA 4Q4V3 4PIZA 5SV5A 1UKRA 4LR4A 3JD73 3RZKA 1LHUA 3NAPC 1IS3A 3THCA 1YJKA 5FZ0A 2DTWA 2WQ4A 3T0DA 4LORA 4LLOA 2XWBB 1W6NB 4QPGA 2BU9A 2VC9A 1QKQA 4MH0E 3ON7A 2ZX0A 1AX0A 1AX2A 1QJX2 2OPWA 2JD9A 3CNAA 4P9WA 1UYZA 3NO8A 2HEWF 3ZYGA 4XFIA 2XKPA 4GMP3 4B29A 4DRVA 1QF3A 2RS32 4AG4A 4UYBA 1RUI2 2GU9A 4KGGA 1LECA 3D3AA 5C9AC 3NV2A 4R9BA 4Q2FA 2LROA 2AACA 3FHIB 4FPCA 3MI8A 1KFXL 2ETEA 2A6ZA 4A44A 4Z2WA 1V0AA 2VVFA 3A22A 5C5UA 1HV1A 1QH7A 2VNRA 4L9BA 1VR3A 2J1UA 2DV9A 3H1YA 3AZZA 1IOAA 2HWF2 2XJTA 4NROA 4E2GA 4GZ9A 3C7GA 4BQYA 1YC61 5JI9A 1DGLA 1OH4A 1DP0A 1OA3A 2W87A 2WN2A 1W9TA 1V00A 1WBLA 3NQHA 3NNGA 5E88A 3MV11 4Q4W1 3RJ2X 1P8JA 1E5HA 1WLTA 4NRPA 1RUJ3 3RMXA 3M3CA 3B00A 5J1XA 4CPBA 3UESA 2LTNA 1BBT3 1NXMA 3AL5A 4JQRA 3ZDSA 4AR2A 1W3VA 3WV6A 4LBKA 4K20A 1POV3 3EMRA 2DVDA 2ZMKA 4OLLA 5GALA 2VUJA 3AMHA 3E5QA 4AVSA 1B09A 3MW4A 1UXXX 2PHLA 4LBQA 5A7SA 3DYPA 3M3OA 5JMCA 3WW3A 1W8OA 3EO6A 1G9BA 1LHOA 3L9JT 5FY0A 2A75A 4LQRA 4BOWA 1XPWA 1ST8A 1V70A 1UQXA 4GD4A 4QDRA 1MACA 3C2UA 3WNOA 1NCQB 4XZUG 3SH3A 2YB7A 1CR7A 2PLV3 2BFUS 1ASJ3 2E31A 3ZYFA 5J96B 3ZYBA 5JXGA 4BZ4A 2GP3A 4ISQA 1HW5A 4AI2A 3QLQA 2C24A 1HXS2 5LWBA 4NHKA 1X7NA 1AX1A 3GNEA 5C3PA 1UZWA 3H1WA 4LEJA 1REFA 2O1QA 2RJ2A 4XF1A 4UBHA 2ZHNA 3KT4A 4YGEA 1AYM1 1ZX5A 5FWEA 3CU7A 4DUWA 3NWKA 4LKSA 2E9QA 1H9PA 2J1EA 4RQPB 1PMIA 4XAEA 2DWRA 3JBG1 1FOD1 4IE4A 1TMF1 5FZCA 3USSA 1AXZA 4N7IA 2QVSB 5DUWA 3NSTA 1K45A 5T54A 2E51A 5DXDA 2CWSA 1RB8G 5G04L 3UV9A 5LY2A 1VBC1 1WMEA 1ZM1A 3CZUA 2XMLA 1AF9A 3MW2A 5LB6A 1MS0A 1YLLA 2ZHMA 3MICA 1EPZA 1REDA 2A3YA 4CUCA 5E16A 4M4PA 3I4IA 2YBSA 2YXSA 1QJX1 1NLQA 5F1RA 3O1PA 1F4HA 5FOBB 3BYWA 1S0BA 1IZ3A 1ZYBA 5L9BA 2RS31 2B9VA 2DFBA 1ZRFA 3JZVA 4JQTA 3WEZA 4AEDB 1YO8A 3EXUA 1NE6A 3ZM8A 5LATA 4RD7A 4MZUA 4A6SA 4XILA 1H9WA 4Z92B 1SLCA 3PTRB 4KG8A 1LGNA 4Q8KA 1H6XA 1GZWA 2K9ZA 3PURA 3I7DA 1BVVA 4IE0A 4XFBA 1KS5A 3AYEA 4XE9A 3AMNA 1VB2A 2OW4A 1SLAA 3W59A 3UGHA 4QPIB 3AZXA 4LKEA 3RNSA 5FIXA 3WW2A 4NAMA 4NWVA 1OVPA 4Q4V2 4IEZA 4EZHA 3JD72 1BCXA 4CXWA 1JI6A 3RDIA 2BVVA 3K46A 5ERLA 4LHNA 1OI6A 4YVWA 5DDJ2 3TBDA 1NY72 4R9AA 2R0HA 2XVLA 4X6RB 5ISLA 4OZXA 2X05A 2AZ5A 5JSRA 1EPWA 1SQ4A 5LEKA 2PFWA 1PMHX 2VBPA 2YFUA 1FV3A 4Y4YA 2Q0AA 2WO2A 5FUNA 1V9U2 5BNOB 3Q8BA 4QM8A 3WDXA 1NZIA 1RGSA 1EUUA 3S6PA 1LCLA 1ULEA 4Y1YA 1GNZA 4RL7A 5DUVA 1E5SA 2EALA 2OUHA 2VCCA 3ACGA 3OTFA 3UYJA 4LHSA 1NG0A 4MV2A 3V65A 1HRI3 5LY1A 5I93A 1NX9A 4MADA 3BCWA 5FYZA 5CYYA 4CCOA 4IESA 2R30A 3B3QE 2J1RA 1JZ4A 4KBBA 4ES8A 2ZMNA 1RUC3 3POWA 2AGSA 3CF6E 3SKJE 3NNMA 3BU0A 1F5JA 5KWRA 1NCQC 3DUIA 4QKBA 4OHVA 3H7YA 1RUJ2 1JN2P 1HB3A 2XGXA 3MPPG 3A23A 1PZ7A 1X33A 4HN0A 4RN5A 3PMEA 1RUNA 1BBT2 2P1BA 2VMFA 1YEWA 3H8XA 1PK6B 1RMU2 4GAZA 5HPOA 2VQUA 4Y1VA 1Z7S1 1XXNA 4LOTA 4RQPC 5L7OA 4ZXEA 5CADA 3WX5A 3I59B 4HSLA 1YFXA 5FYCA 3OPZA 4OI4A 4E8DA 3ZPOA 4GXLA 4LULA 3VBRB 5JR2A 4KNCA 2PLV2 3FE5A 1ASJ2 2GP5A 4Y1ZA 4M3CF 4AFAA 2WIIB 5JOZA 4M3CA 1NKGA 1UL9A 2JG8B 5EHDA 5F5IA 3IB3A 2D3SA 4W6WA 1FXZA 1K12A 1WD3A 3C7FA 2VTXA 4RHV1 1A3KA 1BQPA 2FBEA 2PHDA 3AP6A 1OHFA 1MPXA 4MOAA 4PF5A 1GV9A 4ZU4A 4XIOA 5FMDA 2WA4A 2VZSA 4QGMA 1UXZA 4OZOA 4AEDC 4Q4V1 5I0RA 3QCWA 2BWCA 4XFCA 5FYMA 3WSOA 2VECA 3WDTA 2ZEYA 2UY9A 4QB1A 1VP6A 4X6QB 5JXHA 1U12A 2WFF1 3SISA 4BQ4A 5JXJA 5F6LB 1ZA4A 5FZHA 1DZTA 1CAXB 4Q4X3 2R1BA 1I6XA 5DDJ1 4TLFA 1NY71 2P3IA 3RVHA 4CDXA 4LKDA 2TBVA 3GZEA 2Q1ZB 1MQTA 5LK7B 3BALA 3DECA 3GALA 5FZ1A 1FI2A 4F7ZA 2JICA 2VZOA 4QPIC 2SLIA 3ASIA 4GMP1 4YM1A 3SH5A 3GZAA 1FATA 1V9U1 4FOYA 5K8SA 2W91A 1UWWA 3SXWA 1HB1A 2WNUA 4LHLA 4IGQA 3B9CA 3FZ3A 3MUY1 2OUJA 4ET7A 2CV6A 1KFUL 2IVIB 2J1VA 3WP5A 2EIGA 2RJKA 3FC0A 3WDYA 2WC2A 2CTVA 1UY2A 1UYYA 4H2AA 4WM8B 5DAVA 1ZZ8A 3TNQA 2RMU3 4C8DA 1PO22 1VMFA 4NPRA 2BGCA 1KQRA 1J3QA 5BNOC 2D6LX 5HXVA 3K75B 3IAQA 4QDSA 3M2MA 2QUOA 2Y34A 1RUJ1 2ZKNA 1TG7A 2EXJA 1BBT1 3ZXAC 5A6YA 4LBMA 4CEYB 2WFPA 1A78A 2XJSA 3GM8A 1Q8PA 1MEC2 1W2AX 3NJYA 4PLMA 3IT8A 4BHPA 1JH5A 5JZGA 3FN9A 4XTPA 1RMU1 4CU6A 5BPXA 1OBNA 3RSJA 5FR3A 3ZKUA 2K2SA 5FBZA 1YNAA 2A5ZA 2W1UA 2XLFA 3RGBA 3WNLA 4RS5B 3J7LA 4WM7B 4FOQA 2EA7A 4D69A 2WKKA 4CXYA 3ZFGA 4EN8B 2VCMA 5IVBA 1RITA 1CAWB 4HMZA 1VAVA 3DKQA 4MXWB 4NRQA 5E8AA 3VDDA 4E8CA 2BNNA 3NJZA 4A6OA 5GLWA 5IWFA 2EVXA 4LE3A 2PLV1 4EN9B 2Z42A 1BYHA 3H3UA 2QQOA 1WW5A 3BN6A 3FFQA 1WLWA 2A6WA 1RYYA 3KT1A 2XJQA 1UY1A 3TEWA 4AI0A 1WA4A 2IXJA 1PK6C 1HRI2 1XU1A 3AJZA 5KHHA 4AFBA 5EPAA 3S5AA 4CDQA 2EXHA 3TRSB 5KHIA 3HWJA 3VZOA 1X36A 4BXFA 3J8F1 1C3HA 1JUHA 1C8M3 3D82A 3F2ZA 3GXUA 5LRSA 4DY3A 2BPA2 1E57A 1XNDA 1JZ5A 3MLLA 2C9AA 4JKLA 3ZXKA 2ZX1A 5HI0A 1I9RA 1W6OB 4XC9A 2O8QA 1V6LA 4N7UA 3PIJA 2JG8C 1F15A 4PI2A 4CE8A 2VMIA 5GZCA 1LR5A 4AGRA 2W47A 2E7AA 4HVQA 4I30A 5FDBA 3N36A 1DBNA 3SLIA 2Q8EA 4BIOA 5FO7B 1GU3A 4WVWA 5E89A 3POFA 1RVF2 2G9FA 4HSJA 2WYFA 1RUF2 5FZ6A 4RR3A 1X82A 2VZPA 2VUAA 1COV3 2WL1A 4CEWB 2J7MA 1VMJA 4HVOA 4NRMA 3DXTA 2W39A 2R063 2YU1A 3OG2A 2ZMLA 2RJLA 1BEV3 4W6XA 3OGRA 4Q29A 2VO5A 1H4GA 2VD7A 3MLKA 5HXMA 3BUCA 3PHMA 5ACA2 4F8AA 5FP8A 3JUUA 2NZ9A 4L97A 4EJRA 1PO21 1J1TA 1XE0A 4R4XA 1NA1B 4JGYB
chains in the Genus database with same CATH topology
2QQNA 3VD7A 2BZDA 3WNMA 2WUHA 3LE0A 1J84A 2WZ8A 2W92A 2VZRA 3LEIA 5C71A 1XC6A 1BHGA 1CZVA 2KD7A 3DYMA 3LQCA 3AC0A 4OMDA 5C7GA 1UY3A 4A3ZA 2YG0A 3EB7A 1US3A 2VTFA 4QB2A 3PUIA 1NUKA 3WNNA 3ACIA 1ULOA 4XUNA 4QPWA 1UZ0A 1L7QA 4MGSA 1IQDC 3U37A 3HOBA 3ACHA 2J22A 4OMCA 3EYPA 3K4ZA 2DCJA 4UOJA 3SEPA 3PUHA 1KEXA 3ABZA 5IJRA 3HPNA 3W5MA 5JUVA 2Y6LA 5A1AA 4FI9A 1J83A 2VL4A 4D0QA 4DEVA 2BBAA 1OD3A 4BK5A 2W46A 4RYDA 2XQXA 4D8MA 2Y6GA 3MV01 4CU8A 3CMGA 3OGVA 2VR4A 2ID4A 3P6BA 4KWUA 4ZZ8A 3LPFA 2ZEWA 3OEBA 2VMEA 4DXTA 1JYNA 3T08A 3K4AA 3I2KA 4ARYA 4JKKA 4CUBA 3HEIA 1PMJX 2Y64A 2W1QA 3CQOA 5CZKA 5EIYB 5I0DA 2C9KA 1JZ7A 4JX0A 4P5YA 2HYXA 2VCBA 5DMYA 3THCA 5F7UA 3VD3A 3WF2A 4QX1A 3T0DA 3C7OA 1PX3A 2VC9A 2JD9A 1UYZA 2XHNA 1UY4A 3LEKA 4JHZA 4AG4A 4P08A 4GWIA 2E33A 3D3AA 5LCWL 4DUXA 3C7EA 2LW8A 4A44A 3CDZB 2OKXA 3K77A 3A22A 3I2FA 4DXRA 2J1UA 2RV9A 3VD5A 4DUVA 4GZ9A 3C7GA 1OH4A 1DYOA 1DP0A 2W87A 2WN2A 3DYOA 4PQQA 5EJZB 1W9TA 4A42A 4QX2A 3NQHA 3NNGA 1DLCA 3MV11 3T0AA 4QDQA 1P8JA 2EICA 4KMQA 5J1XA 3UESA 2LS6A 4XUPA 2VJXA 1JYVA 5IYYA 1HN1A 5C70A 3C8XA 2W9XA 1UXXX 1F4AA 1O59A 3DYPA 4ZZ5A 1W8OA 3NJXA 3WF1A 4AAXA 4LQRA 3GGLA 2W5FA 1XPWA 3WNOA 4QDRA 3HN3A 4XZUG 2CDOA 2YB7A 4PT6A 1JHJA 1SG3A 2PQSA 5EJ1B 5JXGA 2E31A 3ACFA 3UNPA 3T2PA 3CKHA 3VDBA 1JZ3A 2Y6KA 2YC2A 2RJ2A 3WNKA 1O8PA 3JXSA 5JMOA 4DUWA 5IHRA 4LKSA 4XUQA 3J7HA 4XVHA 2J1EA 2E26A 1K45A 5G04L 3CIHA 3MUZ1 3CZUA 3I2HA 3HJRA 3A7QA 2WN3A 2Y6HA 5LA0A 4GWJA 3A21A 3OEAA 4JKMA 2VM9A 1GUIA 3ECQA 2WYSA 4CUCA 4IUGA 2VOTA 3LEGA 4M4PA 2W3JA 1O8SA 2J1SA 1UX7A 1F4HA 4ZY9A 1SDDB 1GOGA 2B9VA 3IAPA 3MBWA 4UAPA 1JZ2A 3WEZA 2VZ1A 2XONA 4CUAA 3ZM8A 3C7HA 5JXIA 3HNMA 1W9SA 2WAAA 1GOFA 2VZQA 2Z4FA 1H6XA 2QQJA 2VCAA 4TXWA 5LA1A 2DDUA 4TTGA 4Z2AA 4M4RA 1NAEA 2BGOA 3OBAA 1OF4A 3VD9A 1UMIA 4QX3A 3THDA 4W8JA 3OGSA 1JI6A 1GOHA 3K46A 1JYWA 1K3IA 4BK4A 1JZ8A 4BDVB 2X05A 2JE8A 2B4KA 1PMHX 2YFUA 2WO2A 4ARXA 1GMMA 3FL7A 3VD4A 1EUUA 1T2XA 5DN2A 2VZ3A 2VCCA 3ACGA 4LHSA 1JZ6A 1JU4A 1WCQA 2QQLA 3I3DA 3OB8A 2W1SA 1NX9A 4MADA 5CYYA 3NRUA 4L0PA 2YFZA 1UY0A 1JZ4A 2J1RA 3VDAA 2EIEA 3SKJE 2VZUA 5DPNA 1W0NA 5IFPA 4RN5A 3A23A 3BGAA 2Y6JA 2VMFA 2WO3A 1SHWB 4XUTA 3SKVA 2JKXA 4OYUA 1W8NA 3CZJA 5HPOA 2VQUA 4P00B 4QB6A 4ZXEA 4CU9A 3I3EA 4P02B 4A41A 4E8DA 3T0BA 1US2A 5JR2A 2WDBA 1UYXA 3I2GA 5FUIA 1CZTA 2WO1A 3ETPA 1W9WA 2J1TA 2W1WA 1NKGA 4UI9L 3IB3A 3C7FA 1K12A 4BJ0A 2V72A 4YPJA 1JYXA 4MOAA 1MPXA 2DCKA 2C26A 2VZSA 1UXZA 4OZOA 3UETA 4CU7A 2VQTA 4QAWA 2WABA 3WSOA 2BERA 2J1AA 2ZEYA 3HNBM 4OUEA 4QB1A 5JXHA 1R64A 2EIBA 5JXJA 3T09A 2E32A 2X10A 4LPLA 3GDBA 2HLEA 1D7PM 4W50A 3T2OA 3DECA 1ULPA 3I2IA 2VZOA 2W95A 2R7EB 5B4NA 1XNTA 2W91A 1OF3A 1UWWA 4A45A 2QQKA 1K42A 3I97A 4MGQA 2BGPA 3MUY1 2WQ8A 2WAOA 3NJVA 4ET7A 2J1VA 1UMHA 1UY2A 1UYYA 3T2QA 1TVGA 3WF0A 3K75B 3IAQA 3I3BA 4QDSA 3W5NA 3LPGA 1GNYA 5LA2A 1WKYA 1TG7A 1I5PA 3WF3A 4XUOA 4KI5M 2RVAA 3GM8A 2QQMA 2ZEXA 3FN9A 3WQBA 1GQPA 2YC4A 4CU6A 2VMDA 4BXSV 4DXSA 2W1UA 3WNLA 3SEEA 2VMCA 3IIIA 2V5DA 2XOMA 4PF1A 2ZXQA 5B4XA 2ZEZA 4E8CA 4A4AA 4A6OA 4HG6B 5IFTA 2W94A 2QQOA 3BN6A 2QQIA 2C4XA 1RYYA 1W99A 1UY1A 2ORZA 2CDPA 2ORXA 1JU3A 2Y8KA 1CX1A 1OT5A 2JDAA 3IDAA 3P1IA 2WZEA 3F2ZA 3GXUA 1YQ2A 3FHAA 1JZ5A 2V4VA 4XURA 3VDCA 2EIDA 1H6YA 2QBXA 4JKLA 1PX4A 2WBKA 2VZTA 3MO4A 2W47A 1XNAA 4DEQA 3WF4A 2VZVA 1GU3A 4CVUA 3FHQA 2VZPA 1KGYA 2J7MA 1EUTA 3OG2A 3OGRA 2VO5A 1L7RA 3K4DA 3I2JA 5HXMA 1CZSA 2L9LA 5G05L 3HNYM 4QX0A 3WNPA 2X09A 3E1F1 4W4ZA 1CIYA 5DQ0A 4MO3M 1LNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQN A;  3VD7 A;  2BZD A;  3WNM A;  2WUH A;  3LE0 A;  1J84 A;  2WZ8 A;  2W92 A;  2VZR A;  3LEI A;  5C71 A;  1XC6 A;  1BHG A;  1CZV A;  2KD7 A;  3DYM A;  3LQC A;  3AC0 A;  4OMD A;  5C7G A;  1UY3 A;  4A3Z A;  2YG0 A;  3EB7 A;  1US3 A;  2VTF A;  4QB2 A;  3PUI A;  1NUK A;  3WNN A;  3ACI A;  1ULO A;  4XUN A;  4QPW A;  1UZ0 A;  1L7Q A;  4MGS A;  1IQD C;  3U37 A;  3HOB A;  3ACH A;  2J22 A;  4OMC A;  3EYP A;  3K4Z A;  2DCJ A;  4UOJ A;  3SEP A;  3PUH A;  1KEX A;  3ABZ A;  5IJR A;  3HPN A;  3W5M A;  5JUV A;  2Y6L A;  5A1A A;  4FI9 A;  1J83 A;  2VL4 A;  4D0Q A;  4DEV A;  2BBA A;  1OD3 A;  4BK5 A;  2W46 A;  4RYD A;  2XQX A;  4D8M A;  2Y6G A;  3MV0 1;  4CU8 A;  3CMG A;  3OGV A;  2VR4 A;  2ID4 A;  3P6B A;  4KWU A;  4ZZ8 A;  3LPF A;  2ZEW A;  3OEB A;  2VME A;  4DXT A;  1JYN A;  3T08 A;  3K4A A;  3I2K A;  4ARY A;  4JKK A;  4CUB A;  3HEI A;  1PMJ X;  2Y64 A;  2W1Q A;  3CQO A;  5CZK A;  5EIY B;  5I0D A;  2C9K A;  1JZ7 A;  4JX0 A;  4P5Y A;  2HYX A;  2VCB A;  5DMY A;  3THC A;  5F7U A;  3VD3 A;  3WF2 A;  4QX1 A;  3T0D A;  3C7O A;  1PX3 A;  2VC9 A;  2JD9 A;  1UYZ A;  2XHN A;  1UY4 A;  3LEK A;  4JHZ A;  4AG4 A;  4P08 A;  4GWI A;  2E33 A;  3D3A A;  5LCW L;  4DUX A;  3C7E A;  2LW8 A;  4A44 A;  3CDZ B;  2OKX A;  3K77 A;  3A22 A;  3I2F A;  4DXR A;  2J1U A;  2RV9 A;  3VD5 A;  4DUV A;  4GZ9 A;  3C7G A;  1OH4 A;  1DYO A;  1DP0 A;  2W87 A;  2WN2 A;  3DYO A;  4PQQ A;  5EJZ B;  1W9T A;  4A42 A;  4QX2 A;  3NQH A;  3NNG A;  1DLC A;  3MV1 1;  3T0A A;  4QDQ A;  1P8J A;  2EIC A;  4KMQ A;  5J1X A;  3UES A;  2LS6 A;  4XUP A;  2VJX A;  1JYV A;  5IYY A;  1HN1 A;  5C70 A;  3C8X A;  2W9X A;  1UXX X;  1F4A A;  1O59 A;  3DYP A;  4ZZ5 A;  1W8O A;  3NJX A;  3WF1 A;  4AAX A;  4LQR A;  3GGL A;  2W5F A;  1XPW A;  3WNO A;  4QDR A;  3HN3 A;  4XZU G;  2CDO A;  2YB7 A;  4PT6 A;  1JHJ A;  1SG3 A;  2PQS A;  5EJ1 B;  5JXG A;  2E31 A;  3ACF A;  3UNP A;  3T2P A;  3CKH A;  3VDB A;  1JZ3 A;  2Y6K A;  2YC2 A;  2RJ2 A;  3WNK A;  1O8P A;  3JXS A;  5JMO A;  4DUW A;  5IHR A;  4LKS A;  4XUQ A;  3J7H A;  4XVH A;  2J1E A;  2E26 A;  1K45 A;  5G04 L;  3CIH A;  3MUZ 1;  3CZU A;  3I2H A;  3HJR A;  3A7Q A;  2WN3 A;  2Y6H A;  5LA0 A;  4GWJ A;  3A21 A;  3OEA A;  4JKM A;  2VM9 A;  1GUI A;  3ECQ A;  2WYS A;  4CUC A;  4IUG A;  2VOT A;  3LEG A;  4M4P A;  2W3J A;  1O8S A;  2J1S A;  1UX7 A;  1F4H A;  4ZY9 A;  1SDD B;  1GOG A;  2B9V A;  3IAP A;  3MBW A;  4UAP A;  1JZ2 A;  3WEZ A;  2VZ1 A;  2XON A;  4CUA A;  3ZM8 A;  3C7H A;  5JXI A;  3HNM A;  1W9S A;  2WAA A;  1GOF A;  2VZQ A;  2Z4F A;  1H6X A;  2QQJ A;  2VCA A;  4TXW A;  5LA1 A;  2DDU A;  4TTG A;  4Z2A A;  4M4R A;  1NAE A;  2BGO A;  3OBA A;  1OF4 A;  3VD9 A;  1UMI A;  4QX3 A;  3THD A;  4W8J A;  3OGS A;  1JI6 A;  1GOH A;  3K46 A;  1JYW A;  1K3I A;  4BK4 A;  1JZ8 A;  4BDV B;  2X05 A;  2JE8 A;  2B4K A;  1PMH X;  2YFU A;  2WO2 A;  4ARX A;  1GMM A;  3FL7 A;  3VD4 A;  1EUU A;  1T2X A;  5DN2 A;  2VZ3 A;  2VCC A;  3ACG A;  4LHS A;  1JZ6 A;  1JU4 A;  1WCQ A;  2QQL A;  3I3D A;  3OB8 A;  2W1S A;  1NX9 A;  4MAD A;  5CYY A;  3NRU A;  4L0P A;  2YFZ A;  1UY0 A;  1JZ4 A;  2J1R A;  3VDA A;  2EIE A;  3SKJ E;  2VZU A;  5DPN A;  1W0N A;  5IFP A;  4RN5 A;  3A23 A;  3BGA A;  2Y6J A;  2VMF A;  2WO3 A;  1SHW B;  4XUT A;  3SKV A;  2JKX A;  4OYU A;  1W8N A;  3CZJ A;  5HPO A;  2VQU A;  4P00 B;  4QB6 A;  4ZXE A;  4CU9 A;  3I3E A;  4P02 B;  4A41 A;  4E8D A;  3T0B A;  1US2 A;  5JR2 A;  2WDB A;  1UYX A;  3I2G A;  5FUI A;  1CZT A;  2WO1 A;  3ETP A;  1W9W A;  2J1T A;  2W1W A;  1NKG A;  4UI9 L;  3IB3 A;  3C7F A;  1K12 A;  4BJ0 A;  2V72 A;  4YPJ A;  1JYX A;  4MOA A;  1MPX A;  2DCK A;  2C26 A;  2VZS A;  1UXZ A;  4OZO A;  3UET A;  4CU7 A;  2VQT A;  4QAW A;  2WAB A;  3WSO A;  2BER A;  2J1A A;  2ZEY A;  3HNB M;  4OUE A;  4QB1 A;  5JXH A;  1R64 A;  2EIB A;  5JXJ A;  3T09 A;  2E32 A;  2X10 A;  4LPL A;  3GDB A;  2HLE A;  1D7P M;  4W50 A;  3T2O A;  3DEC A;  1ULP A;  3I2I A;  2VZO A;  2W95 A;  2R7E B;  5B4N A;  1XNT A;  2W91 A;  1OF3 A;  1UWW A;  4A45 A;  2QQK A;  1K42 A;  3I97 A;  4MGQ A;  2BGP A;  3MUY 1;  2WQ8 A;  2WAO A;  3NJV A;  4ET7 A;  2J1V A;  1UMH A;  1UY2 A;  1UYY A;  3T2Q A;  1TVG A;  3WF0 A;  3K75 B;  3IAQ A;  3I3B A;  4QDS A;  3W5N A;  3LPG A;  1GNY A;  5LA2 A;  1WKY A;  1TG7 A;  1I5P A;  3WF3 A;  4XUO A;  4KI5 M;  2RVA A;  3GM8 A;  2QQM A;  2ZEX A;  3FN9 A;  3WQB A;  1GQP A;  2YC4 A;  4CU6 A;  2VMD A;  4BXS V;  4DXS A;  2W1U A;  3WNL A;  3SEE A;  2VMC A;  3III A;  2V5D A;  2XOM A;  4PF1 A;  2ZXQ A;  5B4X A;  2ZEZ A;  4E8C A;  4A4A A;  4A6O A;  4HG6 B;  5IFT A;  2W94 A;  2QQO A;  3BN6 A;  2QQI A;  2C4X A;  1RYY A;  1W99 A;  1UY1 A;  2ORZ A;  2CDP A;  2ORX A;  1JU3 A;  2Y8K A;  1CX1 A;  1OT5 A;  2JDA A;  3IDA A;  3P1I A;  2WZE A;  3F2Z A;  3GXU A;  1YQ2 A;  3FHA A;  1JZ5 A;  2V4V A;  4XUR A;  3VDC A;  2EID A;  1H6Y A;  2QBX A;  4JKL A;  1PX4 A;  2WBK A;  2VZT A;  3MO4 A;  2W47 A;  1XNA A;  4DEQ A;  3WF4 A;  2VZV A;  1GU3 A;  4CVU A;  3FHQ A;  2VZP A;  1KGY A;  2J7M A;  1EUT A;  3OG2 A;  3OGR A;  2VO5 A;  1L7R A;  3K4D A;  3I2J A;  5HXM A;  1CZS A;  2L9L A;  5G05 L;  3HNY M;  4QX0 A;  3WNP A;  2X09 A;  3E1F 1;  4W4Z A;  1CIY A;  5DQ0 A;  4MO3 M;  1LNS A; 
#chains in the Genus database with same CATH topology
 1UCX A;  1X8E A;  2QQN A;  3T1M A;  2XXZ A;  2EXK A;  1W8U A;  2OZ6 A;  3WCR A;  5I8T A;  4CZS A;  1HDK A;  4QXH A;  1NCQ A;  3K2O A;  3UKV A;  2W92 A;  5F5Q A;  3WW1 A;  4DOU A;  1MEC 1;  1V6J A;  5K0U B;  5FZO B;  5CFD B;  5C71 A;  2ZBJ A;  5FPB A;  1R1Z A;  1JOP A;  1O91 A;  4WM8 C;  3O0V A;  4B1L A;  5BYN A;  4AYU A;  2XLA A;  4AQT A;  4DO0 A;  2H0B A;  5JPM B;  1UY3 A;  2YGL A;  4LA2 A;  5JCT A;  4MUV A;  1US3 A;  2DFC A;  3SIT A;  2XHK A;  4QB2 A;  4TSV A;  4GQ7 A;  3ACI A;  1EY2 A;  3UGF A;  5DAW A;  3PVE A;  4K3U A;  3Q8A A;  4RQP A;  2BYV E;  5FZ7 A;  4CA9 A;  5LEJ A;  4CEY C;  4GJY A;  3RYP A;  4KH9 A;  2JDU A;  3N7M A;  3B7M A;  2DVA A;  4HZF A;  2XB6 C;  3AFK A;  1MS1 A;  1W2O A;  4R8H A;  4YGD A;  3IN9 A;  4OMC A;  3K4Z A;  4I3P A;  4HXC A;  4UOJ A;  4LO5 B;  3NNL A;  4RS5 C;  3PVO A;  4WM7 C;  1UW8 A;  2RMU 2;  3VZJ A;  1OXC A;  2DVG A;  4MHU A;  3V56 A;  4Q27 A;  4D6S A;  5CBL A;  2ZAB A;  4F83 A;  5A1A A;  4FI9 A;  1HRV 1;  2VL4 A;  4YW1 A;  4Q4W 3;  4NUB A;  3AKQ A;  3POS A;  4OHW A;  4L11 A;  3E5X A;  3M3E A;  4Y5S A;  5A32 B;  3SQO A;  4D6R A;  4AED A;  5FZE A;  1X50 A;  4HLT A;  1W6M B;  2D6N A;  1ZRI A;  3MV0 1;  4R9D A;  5FZ9 A;  2YPJ A;  4UWD A;  4HT1 T;  4LIV A;  3CJI B;  2VR4 A;  2FDI A;  4CP9 A;  3P6B A;  3NV3 A;  2VVE A;  2IXK A;  4DIQ A;  2ARE A;  2OII A;  2BQP A;  5TSW A;  2UWA A;  1RVF 1;  1A8M A;  1RUF 1;  2QFE A;  5EP9 A;  4CP1 A;  4UW6 A;  1EP0 A;  1BLZ A;  1XYO A;  4QPI A;  3U0Z A;  1MS4 A;  1GIC A;  3RZL A;  4JKK A;  4CUB A;  5I0S A;  2IWG B;  4YW3 A;  4G3Y C;  3VHP A;  3BOW A;  2PHT A;  5ACA 1;  2RDR A;  4M0H A;  3ZDV A;  2ILM A;  3DEM A;  4COU A;  4FSJ A;  5ANQ A;  4QD2 A;  4M00 A;  1AYM 3;  3I3Q A;  1WCD J;  1TZO A;  4JX0 A;  3U07 A;  3E97 A;  2BUK A;  3N9M A;  3LOI A;  4QT6 A;  3W9A A;  5IUQ A;  3WUD A;  1RUE 1;  2PAK A;  1V6O A;  1UOF A;  2VCB A;  4C90 A;  3JBG 3;  1FOD 3;  3SH4 A;  1TMF 3;  2GNM A;  4RA0 A;  4CEW C;  1CVN A;  2FHR A;  4KWK A;  3WF2 A;  1ZZB A;  1KJL A;  1VBC 3;  2JB4 A;  2NPI A;  3C7O A;  1DGW X;  2WO7 A;  2UYB A;  4CDW A;  1PX3 A;  5FAX A;  3KCX A;  2YBP A;  3JU9 A;  2BNM A;  3MPB A;  1NA1 C;  3LA3 A;  4N53 A;  4PLO A;  1GWM A;  4JGY C;  4KG0 A;  3I2D A;  4P08 A;  5F3E A;  2I07 B;  4LA3 A;  4GWI A;  3VL9 A;  3ZN5 A;  4HAN A;  1W39 A;  4N9I A;  3T4V A;  5JI7 A;  1GWL A;  2RS3 3;  2WLP A;  4FQ4 A;  1COV 2;  4HKW A;  5A7P A;  1ZZ7 A;  3RYK A;  1BEV 2;  3KS7 A;  3AYC A;  3NAP B;  5K0U C;  1UKG A;  5CFD C;  3VD5 A;  2B5H A;  4GA9 A;  4I0W B;  3RWK X;  1DHK B;  3K51 A;  1R08 1;  4BU2 A;  1NE4 A;  4NIH A;  5L73 A;  2HBT A;  3CHX A;  3DYO A;  3O0X A;  3ZR6 A;  3CLP A;  4AK3 A;  2RMU 1;  1PK6 A;  4MHR A;  5A7O A;  2YBK A;  1ND3 A;  3RI8 A;  2E63 A;  3T0A A;  4Y33 A;  2AC1 A;  3CJX A;  2WNV B;  3TNP B;  4KMQ A;  4B1M A;  3R6S A;  1QDO A;  1IG3 A;  4KL1 A;  1BVP 1;  1QJU 1;  2ENR A;  2JKB A;  4GKY A;  4XUP A;  2C6S A;  5FBJ A;  5FXW A;  1PIV 1;  2ZHK A;  3F95 A;  4PBO A;  5C70 A;  3LDK A;  3VBR A;  3E6B A;  3C8X A;  3GYD A;  2W9X A;  2RS5 1;  3POB A;  1OFS A;  1J59 A;  1O4Y A;  4ZXK A;  3ORJ A;  3ZFF A;  4ZZ5 A;  2FZ2 A;  1QU0 A;  2ZS6 B;  3WF1 A;  2PHW A;  5FZ8 A;  3DPR B;  3OOX A;  4AAX A;  3ZSL A;  1CIW A;  1RIR A;  2W5F A;  1IKP A;  1MR5 A;  2I2S A;  1IS4 A;  2W08 A;  1D2Q A;  4LTA A;  4QU1 A;  3ZXE A;  1WW4 A;  4ATF A;  1VJ2 A;  4OUM A;  4PT6 A;  1JHJ A;  1DQ6 A;  1SG3 A;  1ULF A;  3P3N A;  1AUY A;  5EJ1 B;  1UN1 A;  2ZGP A;  3ACF A;  3MF6 A;  3UNP A;  4H55 A;  4U2A A;  5FYT A;  3KWV A;  4SLI A;  4UFK A;  1Q43 A;  2G9Z A;  3ZX7 A;  4IEP A;  5J48 A;  2Y6K A;  4YRD A;  2FMY A;  5H9P A;  1M06 G;  1AJO A;  2IC1 A;  3JXS A;  3CJI C;  1F2N A;  1NCR A;  2GNB A;  4XUQ A;  4XVH A;  3TEY A;  1GP4 A;  3ZYR A;  1Y3T A;  4XAA A;  1MZF A;  1JHN A;  4Y1U A;  4ZS3 A;  1SZB A;  1JYI A;  3DV8 A;  3L2H A;  4XTM A;  5FWJ A;  4M01 A;  1WMF A;  5DG1 A;  3CIH A;  3MUZ 1;  5J36 A;  3PVN A;  1FAY A;  1OUX A;  5IFP A;  4N90 A;  1S0C A;  2IVJ A;  4CP0 A;  4Q4W 2;  2GNT A;  1OD5 A;  3A21 A;  3ZN6 B;  3SHR A;  3URF A;  4CDU A;  1BK1 A;  2DUQ A;  2PN5 A;  3APB A;  4OHZ A;  5A1F A;  2CY6 A;  2UUR A;  2YU2 A;  3BU7 A;  2J1S A;  2JDN A;  4Q26 A;  1UX7 A;  1REE A;  2CAU A;  4ONU A;  4A7Z A;  4I3G A;  3ZMO A;  4YW7 A;  4DZG A;  1UZV A;  3GBW A;  1YYN A;  4XOG A;  2OT7 A;  1Z7S 3;  4UAP A;  4DRR A;  4CCK A;  1JZ2 A;  4CCL A;  3OYW B;  1OQE A;  2VZ1 A;  2TUN A;  3IDE A;  1IPK A;  1T6B X;  2O0O A;  1COV 1;  3AM2 A;  3C7H A;  4GB3 1;  4R52 A;  3J9S A;  5F32 A;  1BKZ A;  3ZMN A;  2WAA A;  1OLM A;  3VLB B;  1CGP A;  1CJD A;  3JQX A;  1UAI A;  2VQA A;  4URA A;  4IER A;  2VCA A;  1DZQ A;  2D7F A;  4O61 A;  3H8O A;  4BQ1 A;  4Z2A A;  3HN1 A;  2D97 A;  2GH8 A;  3OBA A;  4RHV 3;  5CU1 A;  1OF4 A;  5KC6 A;  4BQW A;  4ZU7 A;  2D40 A;  4WZF A;  3ZFE B;  5BNP A;  4RS5 A;  2PAE A;  3BB6 A;  4BB3 A;  4XF3 A;  5A3U A;  1GOH A;  1JYW A;  4EWE A;  1CAW A;  4LUM A;  2HKX A;  4MXW A;  2Z5W A;  3WIN E;  1VBC 2;  2ZX3 A;  2IUW A;  2WFF 3;  5K9Y A;  2ZX4 A;  5DDJ 3;  2GME A;  2B4K A;  1W9F A;  4NPM A;  1AZD A;  4E2Q A;  1I3H A;  4PHZ A;  4KWL A;  3AKP A;  5CG9 A;  4CP2 A;  2WNV C;  3N7L A;  4XQD A;  1T2X A;  2A7A A;  3LCP A;  3NKT A;  4Y24 A;  5HCF A;  1S0F A;  1V9U 3;  2XR4 A;  1G86 A;  4QX7 A;  5FP3 A;  5FZF A;  3V0A A;  4FT8 A;  4RGA A;  1HLC A;  5IVF A;  4JTO A;  5KXD A;  3TB0 A;  3LB9 A;  4TN7 A;  1WCQ A;  5F6K A;  5L19 A;  3I3D A;  1K5J A;  4H3W A;  4X8P A;  4FPO B;  5C8C B;  5I91 A;  4AGV A;  1LOG A;  3AVR A;  3NRU A;  4L0P A;  5T5L A;  4AF9 A;  1VPH A;  3INA A;  2R49 A;  1W0P A;  1PO1 2;  3VDA A;  3DPR C;  1DDL A;  4E9K A;  2EIE A;  4QGN A;  2KR2 A;  1ZBA 1;  1S4C A;  4NVP A;  2A6X A;  4K7J A;  1UPI A;  1ZZC A;  3N9L A;  2Y6J A;  3BPZ A;  1IGO A;  5IAT A;  1W6Q A;  1W9Y A;  1RL3 A;  4YAR A;  1OVS A;  2WO3 A;  3MIG A;  4XUT A;  2ARC A;  3SKV A;  2JKX A;  1WD4 A;  2NMO A;  2XWJ B;  4OYU A;  5FMC A;  4YSF A;  5ABJ B;  4ATE A;  3CZJ A;  1C1F A;  4BIF A;  5A3N A;  1W6P A;  5EV7 A;  2MPF A;  1RMU 3;  5FFO C;  5LRR A;  5DUU A;  1G8W A;  1DGR A;  1PNF A;  4P02 B;  5J09 A;  2RG4 A;  1J3P A;  1H0B A;  4K1Z A;  4MVT A;  5DZE A;  5A3L A;  3I2O A;  2BFU L;  5FP7 A;  3SCG A;  5FUI A;  4AVA A;  2QTW B;  1CZT A;  2WO1 A;  3OBZ A;  1W9W A;  3N7K A;  4OCT A;  2J1T A;  1XSR A;  2ERF A;  5DZF A;  4XJ8 A;  3AL6 A;  1QEX A;  2D3P A;  1LOF A;  1SCS A;  2XKO A;  3MFA A;  4BJ0 A;  5A3P A;  1D4V B;  5K4L A;  4YPJ A;  1URX A;  5A7W A;  4IEX A;  1CAV A;  2DCK A;  3ELN A;  1Y9Q A;  2XLG A;  4GMP 0;  3UET A;  4CPB D;  4QAW A;  2HWC 1;  3OPW A;  4EWD A;  3ZOI A;  1WCS A;  2J1A A;  3J8F 3;  4OUE A;  4PCR A;  2H0V A;  4XET A;  4YFW A;  2EIB A;  5EYY A;  1ND2 B;  3T09 A;  4HKL A;  2X10 A;  5GZD A;  5HBA A;  2VNG A;  3GDB A;  3ZSM A;  5AFE A;  1GAN A;  2HLE A;  2NYY A;  4LBQ D;  4LHK A;  4NHM A;  5L9V A;  4HOO A;  5FV3 A;  5FZK A;  2QQW A;  2VUC A;  4QHZ A;  1JYT A;  3I2I A;  2HH9 A;  3K3O A;  5I8Y A;  2JDY A;  4FP2 A;  1AXK A;  4YW5 A;  4HET A;  5B4N A;  1FX5 A;  3USU B;  3RS6 A;  1Z7S 2;  3ZFE C;  4C0H A;  3BPS A;  4A45 A;  5FPU A;  5J3U A;  1G6N A;  2P3J A;  3BTX A;  1XSQ A;  2JG9 B;  1PGW 1;  2BGP A;  3O5S A;  2QDR A;  3NJV A;  5FO8 B;  4BQ3 A;  1XYN A;  3PVB B;  3M8L A;  1DF0 A;  1POV 0;  3T2Q A;  1UZZ A;  1OPO A;  1PO1 1;  2ZAA A;  1VBB 2;  4NPL A;  5KXB A;  3KV4 A;  3GCX A;  4BH9 A;  3LWC A;  3VHN A;  3WF0 A;  2FCT A;  4RHV 2;  1PO2 3;  2Z2S B;  4IV1 B;  4JRA A;  1K5M A;  2IFR A;  3LPG A;  5FXZ A;  5LA2 A;  4B3N A;  1WKY A;  1I5P A;  1N1V A;  5AFB A;  1AYN 1;  5T5O A;  3S30 A;  2RVA A;  2RE9 A;  1ZVF A;  1R09 1;  5LAS A;  2QQM A;  3VKL A;  4B4R A;  4U36 A;  2ZEX A;  2XUE A;  1AVB A;  1FMD 1;  1SLI A;  5F8P A;  1GQP A;  3WP4 A;  1IPJ A;  4Y1X A;  2VMD A;  2P17 A;  3E6D A;  2WFF 2;  3EQE A;  5C8C C;  4DXS A;  1MEC 3;  2F4P A;  1RUH 2;  3VBH B;  2VW1 A;  4P9Y A;  1SEF A;  1CAU B;  3VL8 A;  3ROU A;  3VBU B;  2D5H A;  4N43 B;  1S0G A;  3AK0 A;  2ZXQ A;  2CGN A;  2ZEZ A;  3OSD A;  4HN1 A;  5B4X A;  4IXL A;  4EZ4 A;  4FBF A;  3PUS A;  2XJR A;  4O7X A;  1LB2 A;  1ULG A;  2Z69 A;  3IPV A;  1EAH 2;  1Q3E A;  1QDC A;  2ORZ A;  4BIS A;  1R1A 2;  5LK5 A;  5ABJ C;  2ORX A;  5FMO L;  2D44 A;  4JVA A;  3HR9 A;  1YHF A;  4M0N A;  4WVM B;  3I3M A;  4Q8L A;  4IEY A;  3WT3 A;  1OT5 A;  2AEN A;  3MIB A;  4GUL A;  2UWB A;  4HVR A;  5KHK A;  5FMO S;  3EJK A;  3LZZ A;  3UK9 A;  4LT5 A;  5C4W B;  5FRE A;  1ENS A;  2R04 2;  1RUD 2;  3ZXF A;  1YQ2 A;  1AR6 1;  4YVS A;  4AL9 A;  5A3T A;  1H6Y A;  2QBX A;  2GC3 A;  1HRV 3;  2WS9 1;  3MEP A;  4URT A;  3POJ A;  1CX4 A;  4D6Q A;  1LOA A;  4FQZ A;  2JE9 A;  3IMN A;  1MZE A;  4GWM A;  3KGL A;  4IV3 A;  4XCA A;  4XXP A;  1Q8Q A;  4UT5 A;  3OY8 B;  3O14 A;  1OKQ A;  5SV8 A;  4NO4 A;  3NAP A;  1HB4 A;  3WW4 A;  4DEQ A;  3U4X A;  1KDM A;  2VTX J;  2VZV A;  2ZZQ A;  3S57 A;  3RQ0 A;  5FY7 A;  1DYP A;  1GFF 2;  2RDQ A;  4A7Y A;  4CVU A;  2H6B A;  1W2T A;  1MS5 A;  3WQ7 A;  4D3W A;  5A7N A;  3THP A;  4AQ2 A;  5F5A A;  1DIW A;  3N9N A;  4Y4R A;  1W03 A;  2VOV A;  1RVF 3;  1RUF 3;  1EUT A;  2ZKL A;  1LHV A;  1MZ6 A;  1ND2 C;  2WNV A;  4LBN A;  4OHY A;  5IT6 A;  1L7R A;  5CFC B;  3I2J A;  2L9L A;  3HNY M;  5F2W A;  4NIG A;  3N35 A;  2WT1 A;  1CIY A;  5C9A A;  4YW2 A;  1OOP B;  1EYB A;  1VBB 1;  5DQ0 A;  5ACA 3;  1LNS A;  3POE A;  3LSD A;  4I0B A;  1H4H A;  3JQW A;  4L99 A;  4MX3 A;  2RS1 1;  3LEM A;  4XF0 A;  5FPL A;  3B02 A;  2OQ7 A;  3TOJ A;  1S2K A;  4WBB A;  1SCR A;  5T5P A;  1H1I A;  2JG9 C;  2WUH A;  3MFC A;  1PZ9 A;  4XFH A;  3T2T A;  2ADD A;  3J8F 2;  3LE0 A;  1RUE 3;  2X53 S;  1J84 A;  1VMH A;  2PHU A;  5HCA A;  3HIF A;  1I5Z A;  2D6O X;  2VZR A;  1SPP B;  2B7Y A;  1UX6 A;  1DQ2 A;  1H30 A;  4V1P A;  2P37 A;  1XC6 A;  3U14 A;  2KD7 A;  1HB2 A;  4YYO A;  3LQC A;  4YW6 A;  1RUH 1;  4OMD A;  5FRA A;  1JBC A;  1DGW A;  1N3P A;  2WIN B;  4D94 A;  5IK5 A;  3EB7 A;  1CES A;  2VTF A;  2HBU A;  2ZGT A;  3PUI A;  4IV1 C;  4HK8 A;  4XFG A;  1LAJ A;  1LHN A;  4AAP A;  3NV1 A;  5T55 A;  3GZT B;  4QU2 A;  2BJS A;  1UZ0 A;  2ZGU A;  1EAH 1;  1L7Q A;  4MGS A;  5FZB A;  4ES9 A;  3HOB A;  4RGK A;  1O5L A;  1R1A 1;  2IXC A;  1IPS A;  4BWO A;  5LBB A;  3M3Q A;  5CG8 A;  2WZR 2;  4AW7 A;  4NWW A;  3VBO B;  3ZN6 A;  3SEP A;  3VBH C;  3PUH A;  2QQP A;  4FFG A;  4AE2 A;  5D2A A;  4YM3 A;  4Q0Q A;  3VBU C;  1R08 3;  5IVJ A;  1H2L A;  2O14 A;  1OH3 A;  3GBF A;  4N43 C;  4XEZ A;  3H3L A;  1FT9 A;  2R04 1;  5FYH A;  5LW9 A;  1DZR A;  2R07 1;  1RUD 1;  5IK7 A;  1YCI A;  2BOJ A;  2P2K A;  1XNK A;  3FLR A;  3KGZ A;  2AYH A;  3R05 A;  4Y20 A;  1TME 1;  2JDP A;  4DMI A;  2ZGO A;  1EV1 2;  3WQ0 A;  1OD3 A;  3IDB B;  1G9D A;  2CHH A;  2YZ4 A;  1QJU 3;  2E7T A;  2OXB A;  2Q1F A;  1A6C A;  3VBS B;  5DAB A;  1PIV 3;  2ZGQ A;  2F6B A;  1QJE A;  2GC1 A;  3CMG A;  3O0W A;  5CB7 A;  2CNA A;  3OGV A;  4YGB A;  5GJ6 A;  3V0B A;  4ZZ8 A;  2RS5 3;  4XMA A;  3LPF A;  4ASK A;  2BDR A;  1NYW A;  4FVV A;  2YY1 A;  2FZ1 A;  5DAQ A;  2Q8O A;  5C4W C;  3FMG A;  4DXT A;  1D0H A;  3KZ4 C;  1AR8 2;  3T08 A;  3FBY A;  4ORF A;  1Q56 A;  3ATG A;  3VV1 A;  2CYF A;  4GH4 B;  4HPK B;  4YFZ A;  3IM0 A;  1KXG A;  3VZL A;  5HV0 A;  2VNO A;  3ES1 A;  3ZIX A;  4YG6 A;  2W1Q A;  4MLO A;  1UO9 A;  1O4T A;  3CQO A;  3EHK A;  2DU1 A;  1RXG A;  3B01 A;  3KVB A;  1U5Z A;  2C9K A;  4E4D X;  1JTZ X;  4UFL A;  2C1F A;  2Q30 A;  1Z78 A;  4DQA A;  3KD4 A;  5FXV A;  2HYX A;  3QD6 A;  2VQ0 A;  4QHO A;  5H9Q A;  4LE4 A;  1W6N A;  2GZW A;  1VIW B;  1HQW A;  4ZU5 A;  4PDW B;  3H0O A;  1WW6 A;  3VD3 A;  4QX1 A;  2VXJ A;  4L92 A;  3UJO A;  4AHZ A;  1AHS A;  3O1U A;  1HRV 2;  1XRU A;  3ZPY A;  3MID A;  5CFC C;  3LDB A;  1C5H A;  3BOP A;  4A2U A;  2EAK A;  1OKO A;  4B4P A;  4GWN A;  5J7M A;  2XL9 A;  3FJS A;  1OOP C;  3AB0 A;  1H8T C;  1UY4 A;  3LEK A;  1YWK A;  2YC0 A;  4NJ4 A;  4QPG B;  4YGC A;  5GLV A;  3WUC A;  2FDK A;  5C8C A;  2QE3 A;  4H7M A;  2E33 A;  4YG0 A;  5LCW L;  5ANN A;  5GM0 A;  2A6V A;  1WWY A;  3C7E A;  4DUX A;  1POQ A;  1UF2 C;  3FUQ A;  1DGR N;  1VRB A;  2VGD A;  4ASL A;  4I0A A;  4C91 A;  1WBF A;  3K77 A;  4NHX A;  1O3Q A;  4GB3 3;  2RV9 A;  2BWA A;  4DUV A;  2LRP A;  2WZR 1;  2VOW A;  4IET A;  4COW A;  1XBF A;  2BNO A;  1DYO A;  4J25 A;  4PQQ A;  3RI9 A;  1S55 A;  3S0M A;  1RJ7 A;  3VUO A;  4AVV A;  4MET A;  5CVR A;  1ZNP A;  1V6I A;  2BV4 A;  2J42 A;  4FPK A;  4QDQ A;  5FP9 A;  5KXE A;  2D93 A;  3MYX A;  4BLJ A;  1N3Q A;  4PJY A;  1EV1 1;  2LAL A;  2VJX A;  5FYV A;  4CUA A;  1DQ1 A;  1RUE 2;  1JYV A;  2AH2 A;  4AWD A;  1WMD A;  1RXF A;  4UF0 B;  5FZL A;  1CPN A;  5IYY A;  3LA2 A;  1VBE 2;  3WNX A;  1T6G C;  5FTT C;  3VBO C;  3LIH A;  1L3J A;  5EYX A;  1JYC A;  1AR9 2;  3NJX A;  4AVB A;  5GLT A;  1GBG A;  3BKZ A;  1Q5O A;  4JV4 A;  3TN9 1;  5FY8 A;  5FZA A;  3SNM A;  1F8V A;  3V64 A;  4LBQ B;  3HN3 A;  3RZH A;  2CDO A;  1LED A;  1QWR A;  4OI0 A;  2XBO 2;  3WQ1 A;  3AZV A;  5KXC A;  3O1T A;  1XNB A;  1AR8 1;  5HV4 A;  3MLJ A;  2K0G A;  1SBE A;  4JCK A;  4K6B A;  3T2P A;  4Y26 A;  2KM2 A;  2WNO A;  1TNR A;  1ALY A;  3T1L A;  4OI2 A;  3WDU A;  4IE7 A;  2BEO A;  3LFM A;  4B7K A;  3VBS C;  4RFR B;  5F37 A;  2YC2 A;  4FXK B;  4HK9 A;  5DZG A;  1UIJ A;  2HWB 2;  3WNK A;  1O8P A;  4TWT A;  1ND2 A;  3ITQ A;  3ZLI A;  4UW4 A;  1Q8O A;  5FKB A;  1QJZ A;  5A3O A;  1VBA 1;  1NT0 A;  5JMO A;  3O1M A;  2E26 A;  3N7J A;  1R08 2;  2W52 A;  3PUQ A;  1NXD 1;  4Q1R A;  4B7E A;  5FPV A;  4AI8 A;  4LNV A;  5C6C A;  1ZBA 3;  1WLC A;  1WZX A;  2C5D A;  2DUP A;  2WN3 A;  4IL7 A;  4GH4 C;  4JKM A;  2VM9 A;  5GZE A;  3ECQ A;  3QAC A;  5C3R A;  2JG9 A;  1QJU 2;  2VOT A;  3LEG A;  2W3J A;  2HEY F;  5FZM A;  1O8S A;  4QX5 A;  4AFC A;  1PIV 2;  1W28 A;  1MS9 A;  2XJU A;  3U1X A;  2CAV A;  4ZY9 A;  3WDW A;  3M1H A;  1SDD B;  3NNF A;  2DYC A;  1GOG A;  5I0U A;  4LIT A;  1YRZ A;  2RS5 2;  2EXI A;  3IAP A;  5IK8 A;  2OPK A;  4CYD A;  2OA2 A;  2ZOE B;  5FCC A;  4QKF A;  4IW3 A;  2ZZJ A;  4O9G A;  5J98 B;  1SLB A;  2XON A;  1YIF A;  1Y7B A;  1ZZ6 A;  2D43 A;  4PDW C;  1G9A A;  1W9S A;  3IZO A;  2ZGR A;  1GOF A;  4IV1 A;  1OQD A;  2QKD A;  4IEW A;  4N9H A;  4EQV A;  5C3Q A;  3K3N A;  2PA7 A;  1CJP A;  3OBR A;  2IXL A;  2QQJ A;  1C28 A;  3VZN A;  2JEN A;  1IQA A;  2VOK A;  4TXW A;  5GZF A;  1VAK A;  2DDU A;  5EWS A;  4EV0 A;  3D0S A;  1GP5 A;  2DBI A;  3ZYP A;  1CON A;  4M4R A;  4QPG C;  4PQ9 A;  5JSO A;  1NAE A;  2BGO A;  3WHT A;  5IW0 A;  3VD9 A;  2CU5 A;  4YM2 A;  1JS9 A;  4BE3 A;  2Y6F A;  3VBH A;  4QX3 A;  1D2S A;  1OMI A;  3THD A;  3ZYI B;  2NM1 A;  2PTM A;  4P5H A;  1B35 B;  3GZU C;  1BK0 A;  3VBU A;  5FOJ B;  1DG6 A;  3BTA A;  4KU7 A;  2PHX A;  2HWC 3;  5A6Q A;  1JZ8 A;  4XPV A;  1VBE 1;  4BDV B;  5BNO A;  2Z79 A;  2OYZ A;  1XOY A;  1GQG A;  5A33 B;  3AFG A;  5FYS A;  2YDE A;  1AR9 1;  4YVW B;  1PGL 2;  2B39 A;  2P4E A;  5JDB A;  3H42 B;  4ARX A;  1IHM A;  1XNC A;  4IDZ A;  2FDG A;  1PVC 1;  1UOJ A;  1C1L A;  4WVM A;  1GMM A;  1F35 A;  3FL7 A;  3VD4 A;  2HWE 1;  2XBO 1;  1SFN A;  3ME2 A;  2V73 A;  3THT A;  2FDF A;  4J6G A;  4YZ5 A;  1LGC A;  2Q8D A;  2BTV C;  1JZ6 A;  1LGB A;  1XYP A;  5CNA A;  2BRT A;  2QQL A;  4FFF A;  3OJB A;  3OB8 A;  2YV8 A;  2W1S A;  4GB3 2;  4YWA A;  2VH9 A;  2HWB 1;  3GCW A;  3ENR A;  2XL7 A;  2YFZ A;  1UY0 A;  4QPY A;  1C57 A;  3RMY A;  1FYU A;  1UU6 A;  4XCB A;  4Y22 B;  1ZRE A;  2FD8 A;  2WWU A;  4AQS A;  1N1T A;  1O6U A;  1QH6 A;  1PO1 3;  2VZU A;  5DPN A;  5JIA A;  5I0T A;  5FPX A;  4B8E A;  5E6H A;  2XJV A;  2GN7 A;  4DS0 A;  3WY6 A;  1N3O A;  5JOX A;  2A6Y A;  4TLG A;  3TEZ A;  3BGA A;  4S2F A;  3TWI A;  4WZC A;  2BVB A;  1SHW B;  2TNF A;  1VAM A;  3BI3 A;  2NP0 A;  1AYN 3;  1W8N A;  3WXP A;  1CQ9 A;  1C8N A;  1QJY 2;  3I59 A;  1R09 3;  5CIS A;  5H9R A;  1ENX A;  1FMD 3;  5CFC A;  3UJQ A;  3DL3 A;  4JC1 A;  4C1X A;  3UKT A;  4CU9 A;  4A41 A;  4IQP A;  3AMM A;  1YFY A;  3GJA A;  1US2 A;  1QOT A;  4Q0U A;  3J7M A;  4EE2 A;  1O5U A;  2JG8 A;  3PLQ A;  1UYX A;  4IEQ A;  5L7O B;  4ZS2 A;  3ETP A;  2HJI A;  1WCU A;  2RM2 2;  2P3Y A;  5F5C A;  2ZGS A;  3G6J B;  2W1W A;  3ZYJ B;  3POG A;  1VRH 1;  4OFG A;  4PIX A;  3AP9 A;  1AL2 1;  2YRO A;  3VHR A;  5KC5 A;  1QJF A;  2HWD 2;  2QZ3 A;  3ZO0 B;  1F31 A;  4M3C B;  1W2U A;  3UKN A;  3LAG A;  5BNQ A;  4WVZ A;  4BMB A;  2C26 A;  3BTY A;  1ZA7 A;  2X29 A;  3H8U A;  4LIU A;  1LKN A;  2WWJ A;  1CAX A;  3KVA A;  4CU7 A;  2VQT A;  3KB5 A;  3OCP A;  2WAB A;  1YQC A;  3N3H A;  1O4Z A;  2BER A;  3HNB M;  3UT0 A;  1S2E A;  1R64 A;  5FLI A;  3RWN A;  5KBF A;  1ZBA 2;  3U78 A;  1ZRD A;  3POY A;  2E32 A;  3QH6 A;  4QGL A;  1O7F A;  1AR6 3;  3U4S A;  2Q4S A;  2QJV A;  2WS9 3;  4CCJ A;  1RUG 1;  3T2O A;  4AXO A;  5F3C A;  2A3X A;  4GIQ A;  3I49 A;  1ULP A;  1DQ4 A;  5C3O A;  1PGL 1;  2KXL A;  2VE1 A;  4AVT A;  4CDX B;  3WDV A;  3HMY A;  4YZ3 A;  4JDN A;  5AC9 2;  5LA9 A;  1MQT B;  1AR7 2;  2ZGL A;  1OF3 A;  3T3Y A;  1JZ7 A;  4LBJ A;  2PMW B;  2BBV A;  1QXP A;  2QQK A;  4MGQ A;  5FZ3 A;  1B35 C;  2LUW A;  2O8O A;  1IKQ A;  4WM8 A;  4OQ9 A;  4DPN A;  4FTS A;  2WAO A;  1E5I A;  1LOD A;  2WSV A;  2ATF A;  2TEP A;  2WNU B;  3D0J A;  3KCY A;  2B42 B;  3OUJ A;  4NHY A;  3R0R A;  2XG3 A;  1XU2 A;  3KQ4 B;  3D8C A;  4YVW C;  4EWA A;  1TVG A;  4QXC A;  5JR7 B;  3LFI A;  3NKG A;  4UBG A;  2Y33 A;  3U11 A;  3ZSK A;  5JOW A;  4CSW A;  3MIF A;  4I09 A;  4CEY A;  1VBB 3;  5C5T A;  2BP6 A;  4OVE A;  1GNY A;  1ZBE 3;  2F17 A;  2RS1 3;  4JDO A;  4NAO A;  1ZZ9 A;  4JAA A;  5BUV A;  5FKC A;  3WF3 A;  2D98 A;  4KI5 M;  4HBN A;  5A1L A;  4ASM B;  2VG9 A;  1G9C A;  2HWC 2;  2DCT A;  4WM7 A;  2WZP P;  4BME A;  4BPZ A;  2R6Q A;  1TE1 B;  2OVU A;  2YC4 A;  2GH2 A;  4FPJ A;  1QJY 1;  4BXS V;  4N8M A;  4YG3 A;  5B2G B;  1X9P A;  5BY5 A;  4XBN A;  1WLD A;  4KBZ A;  3SEE A;  2VMC A;  4H7L A;  5FZG A;  5JZG B;  1Z0H A;  1S0J A;  2Y0O A;  2PXJ A;  1RUH 3;  1PZ8 A;  4PF1 A;  1LUL A;  2DCY A;  4Z82 A;  1LEM A;  5CA6 A;  4HG6 B;  1GYK A;  2W94 A;  1DQ5 A;  2VU9 A;  2QQI A;  2RM2 1;  3ZFG B;  4AFD A;  1UZY A;  2C4X A;  2V5Y A;  5CKN A;  1SMV A;  1W99 A;  2FDJ A;  4IEU A;  4ITC A;  3CBN A;  4JHT A;  2OZJ A;  1XE8 A;  3VDD B;  4E4Z A;  1PGW 2;  1PNG A;  2CDP A;  3ZXJ A;  4BM8 A;  1EAH 3;  1VBD 2;  4COZ A;  4DY5 A;  3E6C C;  1QQP 2;  1QNY A;  2HWD 1;  4AEJ A;  1R1A 3;  2V4A A;  2Y8K A;  5CKM A;  1HX6 A;  3GF6 A;  1H2K A;  2DUO A;  4XFA A;  3IDA A;  4NN0 A;  2FMD A;  1RHI 1;  2RR1 3;  3N4M A;  1GR3 A;  1HJF A;  1W6O A;  2ADE A;  4IE6 A;  5KR7 A;  1YIP A;  3VBF B;  4CDQ B;  2CL2 A;  2Y26 A;  1KD7 A;  2Y0I A;  3FHA A;  4CCE A;  5L7O C;  4MGT A;  2WNE A;  2V4V A;  2FDH A;  2R04 3;  4SBV A;  5DUX A;  2R07 3;  5IVC A;  1RUD 3;  1YQ8 A;  1PX4 A;  1VB4 A;  4LKF A;  3WD5 A;  5I8S A;  1TME 3;  2WBK A;  1BXH A;  1U5X A;  3H50 A;  3RG0 A;  2P5B A;  1UIK A;  1ULC A;  2CSG A;  1AYN 2;  1LTE A;  4Q4Y 2;  3WG1 A;  1LEN A;  4D7T A;  1R09 2;  2C0Z A;  4QQ2 A;  1YQ5 A;  4CEW A;  1XNA A;  2VOX A;  3WF4 A;  1FMD 2;  5DG2 A;  3T30 A;  4P9I A;  5FYI A;  1XJA A;  5AC9 1;  1AR7 1;  5A70 A;  1RTV A;  4NIA A;  1W0O A;  4S2D A;  1UD1 A;  3PU3 A;  4Q5O A;  1KGY A;  3AKS A;  2JDK A;  2YPD A;  1WCK A;  5EXO A;  1OPM A;  4ISR A;  1O3R A;  3PJQ A;  3SCF A;  4PBP A;  3GHN A;  1SBD A;  3VN4 A;  1O3T A;  1FPN 1;  3OUH A;  4RR3 B;  3IIA A;  2DVB A;  1NA1 A;  3BTZ A;  1CZS A;  5G05 L;  4JGY A;  4XQ4 A;  3WNP A;  4Z8B A;  2X09 A;  1A8D A;  4FXG B;  2YMZ A;  2YUE A;  3JB4 C;  1QNW A;  4UF0 A;  4UFJ A;  4CDX C;  1Q8V A;  1NLR A;  4LLF A;  3PDQ A;  3OGG A;  3U10 A;  1MQT C;  3VD7 A;  1VE0 A;  2GMM A;  4XHB A;  4Y5Z 0;  5A7Q A;  3PTY A;  4E2S A;  5K7P A;  1UOG A;  4XHX A;  3WNM A;  1OA4 A;  5K0U A;  5FZO A;  5CFD A;  4EN7 B;  2I45 A;  3UGG A;  3H7J A;  1ZRR A;  2P6C A;  2WT2 A;  3FBM A;  1HV0 A;  2WNU C;  1SFP A;  3LEI A;  4XF4 A;  3WCS A;  3I8T A;  1UOB A;  1D4M 1;  1BHG A;  1AR6 2;  4R9C A;  1O3S A;  4IE5 A;  2WS9 2;  3ZXG A;  4FPL A;  5C7G A;  1YXW A;  1XB9 A;  2K46 A;  2ZAH A;  4A3Z A;  1YFW A;  3GHM A;  4UFH A;  1MVQ A;  2GMP A;  5KHJ A;  1V6N A;  4P9X A;  3WNN A;  1UU5 A;  3TAY A;  1ULO A;  1WUV A;  4B4Q A;  4XUN A;  1KDK A;  2ET7 A;  4HON A;  4Y5T A;  1H2M A;  5A3M A;  4QPW A;  1ODM A;  3WHU A;  3N9P A;  4FOV A;  4X8N A;  4WVV A;  4FFI A;  2MNG A;  2I74 A;  3M70 A;  3OD0 A;  4I02 A;  3QBQ A;  4AHW A;  5FO9 B;  5HCH A;  4FTB A;  3R4D B;  5IAV A;  1NLS A;  4CCM A;  1VBD 1;  2DTY A;  2Y60 A;  3EYP A;  3S7I A;  5FK7 A;  1QQP 1;  2DCJ A;  2FCU A;  4LK6 A;  3WLU A;  4ZKT B;  4Q1P A;  5FLJ A;  3S7E A;  2WZR 3;  5JZG C;  3ABZ A;  1GZT A;  3W5M A;  5DAX A;  2GAU A;  3KV9 A;  5A32 A;  3SC7 X;  3MDP A;  1GQH A;  1VLN A;  2PQQ A;  1W6M A;  1ZBE 2;  2OX0 A;  2RS1 2;  4D0Q A;  4QQO A;  1OQ1 A;  4DEV A;  3ZFG C;  2D5F A;  2UYA A;  2GC0 A;  3CJI A;  2W46 A;  2UU8 A;  3OUI A;  4RYD A;  3VDD C;  3FUO A;  3KM5 A;  3B94 A;  1EV1 3;  2DUR A;  5JSP A;  1RUI 1;  3TEX A;  4Q4Y 1;  5JPN B;  5FZI A;  1LHW A;  5A33 A;  2ID4 A;  3RZG A;  4FFH A;  4KWU A;  2GDF A;  4QKN A;  2X5I B;  5F9T A;  4GKX A;  2W68 A;  5F3G A;  4S2G A;  5F39 A;  3OEB A;  1NZC A;  5IK4 A;  3S5Q A;  3BVC A;  1JOD A;  3TN9 3;  5CIR A;  4LO7 A;  2VME A;  4CP9 B;  3VBF C;  4CDQ C;  1JYN A;  1BMV 2;  2JIG A;  2HWF 1;  4YLZ A;  2DCZ A;  4MYE A;  2ZGN A;  2Q8C A;  3VKM A;  5BV6 A;  1FNZ A;  1AR8 3;  1SLT A;  4KWJ A;  4P9L A;  5IVE A;  2JB8 A;  1AJK A;  1S0D A;  1B35 A;  3HEI A;  4IGO A;  4QX8 A;  1LOE A;  2GSY A;  3ILF A;  1PMJ X;  1LES A;  1YI9 A;  2Y64 A;  4LUK A;  5FY4 A;  1C4R A;  3ETQ A;  3ZIW A;  1TQ5 A;  2FQP A;  4LXL A;  5CZK A;  5APA A;  4I01 A;  1JOB A;  3HQR A;  2A70 A;  1HIX A;  1S0E A;  2OS2 A;  3SMH A;  3O1V A;  5GLU A;  3W20 A;  4YM0 A;  4P5Y A;  1VBA 3;  1HJG A;  3UL2 A;  5H9S A;  4Z1V A;  2RR1 2;  3A0N A;  3T4H B;  1W8W A;  5DMY A;  3KMH A;  4JGZ B;  3O1S A;  1YFU A;  3KHC A;  1IG0 A;  2X8K A;  5F7U A;  1J58 A;  4LBL A;  5LBF A;  4F3J A;  1UMZ A;  4YW4 A;  2NMN A;  2R07 2;  4RR3 C;  2B46 X;  2OQ6 A;  1TME 2;  3JCI A;  4XDP A;  1H1M A;  1S0I A;  4LK7 A;  3ZXD A;  5IVY A;  2XHN A;  3AP7 A;  2EF6 A;  4JHZ A;  4CDW B;  3WP6 A;  4XAB A;  2R32 A;  5T3N A;  4QQH A;  5D8A B;  1DU3 D;  1HXS 1;  5JVV A;  2VY0 A;  3POI A;  4P9J A;  4N53 B;  3A4U A;  4KGQ A;  4Y22 A;  5FQ0 B;  2LW8 A;  3CDZ B;  4FPY A;  1BJQ A;  2OKX A;  3I2F A;  4K8R B;  4DXR A;  1JOJ A;  4LO8 A;  1I1E A;  4AI9 A;  5A80 A;  3RZZ A;  4DFS A;  4JTN A;  1PM7 A;  3B5L B;  1OUS A;  4V2W A;  4NII A;  5EJZ B;  5FK8 A;  1CD3 G;  4A42 A;  2IZW A;  4XAC A;  4QX2 A;  1DLC A;  3PL0 A;  1X8M A;  3FFZ A;  2EIC A;  4K9S A;  2DVF A;  1TNF A;  1H8T B;  1W3X A;  1ZBE 1;  2LS6 A;  3HBZ A;  1W04 A;  3LIG A;  1ND3 B;  2ZPX A;  3AMQ A;  4IEV A;  4S2H A;  5FP4 A;  3WR0 A;  4UW3 A;  3ST7 A;  3X29 B;  2SBA A;  3VHO A;  5AVA A;  2B9U A;  5DAP A;  4LMF A;  1HN1 A;  3DPR A;  2Q5T A;  4AOC A;  2QCS B;  4BA6 A;  2ZTN A;  1F4A A;  1O59 A;  2BW8 A;  2E53 A;  1CPM A;  2CGO A;  1YJL A;  3DXU A;  3Q8E A;  1VBE 3;  3ILR A;  2BOI A;  1Q8S A;  2E6V A;  3GGL A;  3AYA A;  4NOT A;  5EZW A;  2RHP A;  3PMS A;  4OUS A;  1F9K A;  1G9F A;  1LOB A;  1AR9 3;  3OBT A;  1GLH A;  3ZFF B;  4CTE A;  2EAA A;  5IVV A;  2WT0 A;  4FPG A;  2HYK A;  1BMV 1;  2PQS A;  4FPH A;  4UFI A;  1PVC 3;  2F4L A;  3CKH A;  1OC1 A;  1D0G A;  2HWE 3;  2XBO 3;  3VDB A;  3R4S A;  3IDC B;  1W8Z A;  1Y9G A;  4JZR A;  1JZ3 A;  1QY4 A;  2JD4 A;  4BCU A;  4DIN B;  2XPJ A;  3AVS A;  1YI7 A;  5EJ3 A;  1E5R A;  1DCS A;  5IHR A;  3J7H A;  1SAC A;  3JD7 1;  2X5I C;  3VB9 A;  5IAX A;  4XYX A;  2HWB 3;  4AI3 A;  1Y43 B;  4UXA A;  3HVD A;  3MGU A;  4KQ7 A;  4K1Y A;  1VAL A;  3AZW A;  1NCR B;  2RR1 1;  4FAG A;  1A34 A;  4E4S A;  4ERO A;  3I2H A;  3BIW E;  3A7Q A;  2Y6H A;  3HJR A;  3J26 N;  5LA0 A;  1OA2 A;  1QOS A;  3A0K A;  3MW3 A;  3OF1 A;  3OEA A;  4GWJ A;  5F3I A;  5AVP A;  1MS8 A;  1GUI A;  4HFS A;  2WYS A;  2PAM A;  4IUG A;  1PVX A;  5FYY A;  1IS5 A;  3KV5 A;  4QQP A;  2G1M A;  1V6K A;  1LU1 A;  3OYW A;  4CDU B;  2XVG A;  5CAZ A;  4QM9 A;  3KLS A;  3P5B A;  1TEI A;  4MGY E;  3MBW A;  4EN0 A;  3AX4 A;  3H9A A;  2B8M A;  2VUL A;  3KQR A;  3LF7 A;  2G4I A;  4JGZ C;  3TN9 2;  5JXI A;  1KS4 A;  5FXX A;  4R4Z A;  3ES4 A;  3U75 A;  3HNM A;  4DXZ A;  4GJZ A;  4OI1 A;  1OFN A;  3WOG A;  2VBB A;  2VZQ A;  2Z4F A;  4G9S B;  2XDV A;  1C5I A;  3O7O A;  5T5J A;  5FJH A;  4BQ5 A;  1DFQ A;  5BNN B;  4AHX A;  3RYR A;  1ODN A;  5LA1 A;  3ZFE A;  4TTG A;  2MEV 3;  1W8F A;  1VRH 3;  1LRH A;  3AP5 A;  4OQ8 A;  3IBM A;  3Q8F A;  1AL2 3;  1QMJ A;  2JDZ A;  4W6Y A;  4CDW C;  3WP3 A;  3BIE A;  3HD8 B;  5FYB A;  4L2N A;  5D8A C;  3VKO A;  3VZK A;  1QHD A;  1UMI A;  1SLL A;  1POV 1;  1VBA 2;  2Q1M A;  4W8J A;  3OGS A;  4N53 C;  4ZON A;  3KF5 A;  4G4F A;  4QXB A;  1GZ9 A;  1K3I A;  3M4F A;  4PI0 A;  3VGI A;  4JRL A;  3SCH A;  2DU0 A;  4BK4 A;  2VMH A;  5BNP B;  2B45 X;  5EFU A;  3AKT A;  4XJU A;  3RZJ A;  1QIQ A;  3ILN A;  2JE8 A;  4XW3 A;  1CN1 A;  2XQR A;  1GWK A;  5JOY A;  5FZ4 A;  3M7A A;  5CEH A;  2ARA A;  3PJY A;  1RUG 3;  4XJW A;  1NQD A;  2WRA A;  1OLR A;  1ASJ 1;  2ZX2 A;  3OPT A;  3H1M A;  5DN2 A;  4TZD A;  2JEC A;  1QXJ A;  5FPA A;  1ND3 C;  1MS3 A;  2VZ3 A;  3AMP A;  4J1W A;  4NMI A;  3ZSE A;  2VW0 A;  1JU4 A;  1UPS A;  3VBF A;  4MSV A;  2DBN A;  4P9G A;  1RUC 2;  3V0A B;  1H1A A;  4AEM A;  4FPF A;  3RRD A;  4XZP A;  2WQZ C;  2YGM A;  4XQW A;  3VBR C;  2R1D A;  3LA7 A;  2W2I A;  4XIK A;  3DF0 A;  4AI1 A;  3AXD A;  5JIU A;  2A3W A;  1OLM E;  1YUD A;  3ZFF C;  1W0N A;  2D6K A;  4YZ1 A;  1WGP A;  5ABJ A;  1WW7 A;  2WA3 A;  4RGG A;  4ZPI A;  3J4U H;  3E5U A;  2GN3 A;  2ET1 A;  2VMG A;  1S1A A;  3LD8 A;  2QQV A;  3PUA A;  4QXK A;  4COV A;  1M4W A;  1W6Q B;  2AEY A;  3Q8C A;  4K40 A;  4P00 B;  3MZH A;  1LOC A;  2JDM A;  4QB6 A;  1QJY 3;  5A3W A;  1RUO A;  2PEL A;  4YZ2 A;  3LKJ A;  3I3E A;  4IGP A;  4XXA A;  4AGG A;  1HQL A;  3OGJ A;  1NCR C;  1RC6 A;  2AEZ A;  3T0B A;  1W6P B;  1XE7 A;  3QOP A;  5CKQ A;  1UU4 A;  2WDB A;  2PHR A;  3I2G A;  3PIG A;  2ARB A;  1PVC 2;  3P3P A;  4FO9 A;  1HKD A;  1AXY A;  1Y9M A;  2HWE 2;  1DLL A;  3M3I A;  4MXV A;  3D5O A;  4UI9 L;  1OSG A;  2RM2 3;  1H8V A;  2ZA9 A;  4LOS A;  4AZZ A;  3N9Q A;  1G7Y A;  4MGZ E;  4H14 A;  1N47 A;  2V72 A;  4OHX A;  4CDU C;  1JYX A;  4J1X A;  4P14 A;  2HWD 3;  4NID A;  1QOO A;  1GKB A;  5M0T A;  5C8W A;  1RIN A;  2GND A;  5A7W B;  4Q4X 2;  4MG2 A;  2E7Q A;  1RHI 3;  1CAV B;  1GNH A;  5A6Z A;  1OUR A;  2RDS A;  4HL0 A;  4LPL A;  4A7K A;  3J7N A;  2P6H A;  3ALQ A;  4YZ4 A;  4PIY A;  2D6M A;  4NHL A;  1XQN A;  2Y38 A;  5BNN C;  3O1R A;  1D7P M;  3LDR A;  5D1I A;  3VZM A;  4FTE A;  3USU A;  4W50 A;  4XFF A;  3HT1 A;  1ONA A;  2CWM A;  3W58 A;  2DF7 A;  2W95 A;  3HQU A;  4Q0P A;  4XDO A;  4EN6 B;  3MIH A;  2VAU A;  2R7E B;  3FWE A;  2QZ2 A;  3WG2 A;  2P34 A;  1XNT A;  3D6E A;  1ULD A;  2NLR A;  4YNI A;  3ZR5 A;  4AQ6 A;  1K42 A;  3I97 A;  5AC9 3;  2QQU A;  1AR7 3;  3H8R A;  1U0A A;  1HRI 1;  1RJ8 A;  5T50 A;  2WQ8 A;  4QMA A;  5GKA C;  2CGP A;  5BNP C;  1ACC A;  4NR1 A;  3NMB A;  1UMH A;  3VKN A;  2FCV A;  3CO2 A;  1RUC 1;  2XJP A;  5GLZ A;  3H3Z A;  1FPN 3;  1SFY A;  1GP6 A;  3IWZ A;  4KU8 A;  4OUL A;  4XBL A;  4BQX A;  2MEV 2;  3HAG A;  3DKW A;  1VRH 2;  2JXA A;  1KIT A;  1PHM A;  3QH7 A;  1AL2 2;  4E4H A;  2HEV F;  3IMM A;  4UFM A;  2N7G A;  3WVJ A;  3I3B A;  5FJK A;  3W5N A;  4AFM A;  2UY8 A;  1JUI A;  1GZW B;  2ZGK A;  2X5I A;  3KF3 A;  4MGK E;  5FUP A;  1ENR A;  4Q0S A;  4QHB A;  4XUO A;  1APN A;  4JDM A;  3GJB A;  1PGS A;  1H2N A;  1K5M B;  3MIE A;  4PLN A;  2JIJ A;  5EQU A;  5FY1 A;  1CAU A;  3WQB A;  3BOD A;  2RDN A;  3AZY A;  3AP4 A;  3KCC A;  4N43 A;  3B93 A;  4Q0V A;  1FV2 A;  2WJS A;  1D4M 3;  3NV4 A;  1KJR A;  3III A;  2V5D A;  3K48 A;  2AR6 A;  1RUG 2;  3WG4 A;  2XOM A;  1QGL A;  3CEW A;  2QDN A;  4V2V A;  4IEO A;  4A4A A;  2H6C A;  2JX9 A;  5IFT A;  4GAL A;  4NE9 A;  4QWN A;  1F5F A;  4CCC A;  3VKF C;  4A3X A;  3NL1 A;  4JGZ A;  2IXH A;  2R0F A;  3D4K A;  5FY5 A;  2JEM A;  4O65 A;  5C4W A;  5D21 A;  2VXR A;  3IPV B;  1JU3 A;  2JJ6 A;  4D7S A;  1CX1 A;  1C8M 2;  2D6P A;  2WR9 A;  1VBD 3;  2JDA A;  1DYK A;  2NN8 A;  4C0B A;  1QQP 3;  3WZ1 A;  4AHY A;  1MZ5 A;  5JLV A;  3IKW A;  3PNA A;  2PHF A;  3P1I A;  2WZE A;  2A71 A;  3AJY A;  2VBD A;  4Q4X 1;  3ZKY A;  5E1R A;  3VDC A;  4XUR A;  1JW6 A;  1S2B A;  2EID A;  3OY8 A;  1LJ7 A;  3OD4 A;  4IND A;  4LJH A;  1GZC A;  2ZJC A;  5D8A A;  1W2N A;  2VW2 A;  5FYU A;  3ZSJ A;  3ZVX A;  4E27 A;  2KA3 A;  5GZG A;  2IFW A;  2VZT A;  3MO4 A;  4TYS A;  3L2Y A;  3NW4 A;  2G9G A;  1J1L A;  1QJX 3;  3DN7 A;  5FQ0 A;  1U5Y A;  4MGI E;  4RSU A;  3ZYH A;  4YVS B;  3N9O A;  5FPZ A;  5T52 A;  5C33 A;  5C3S A;  4RFT 0;  1RUI 3;  1DQ0 A;  1N1S A;  1W05 A;  4Q4Y 3;  1CWP A;  4IV3 B;  1LOF C;  1STM A;  2WSU A;  3KV6 A;  2R06 2;  1L7L A;  3FHQ A;  3RJR A;  1YQ6 A;  4FCA A;  1SDW A;  2YYO A;  3KHB A;  2D3R A;  4AEK A;  4XJ9 A;  3HT2 A;  1N1Y A;  2JDH A;  5FLH A;  1OOP A;  1QXR A;  4CRQ A;  2PYT A;  1H8T A;  2HWF 3;  3K4D A;  2ZAC A;  3CL1 A;  3FLP A;  4LO4 B;  3NNJ A;  1WA6 X;  4QX0 A;  1HN0 A;  1J3R A;  3JB8 A;  3E1F 1;  4W4Z A;  2A73 B;  3GBG A;  5FY9 A;  3HBK A;  4CCN A;  3FX3 A;  2UWC A;  2ZCW A;  3RPQ A;  4MO3 M;  3RFR A;  2MEV 1;  2ES3 A;  5HCB A;  3TYJ A;  2VUD A;  4LBO A;  3W21 A;  4BYY A;  1LU2 A;  5JWP A;  4K21 A;  4DB5 A;  2AUY A;  2BZD A;  5C9A B;  1SPP A;  2YHJ A;  4WV8 A;  4XJA A;  4K8F A;  2WLQ A;  2MHF A;  2VPV A;  4XJZ A;  5F2S A;  1KRI A;  1RHI 2;  2P3K A;  2WZ8 A;  2LM3 A;  1NOV A;  3LGR A;  5FZD A;  2WWS A;  2XH6 A;  5LZ6 A;  2JWP A;  3LOB A;  4C1W A;  1CZV A;  1HQN A;  1W90 A;  3DYM A;  4W65 A;  3AC0 A;  3DCQ A;  3NVC A;  3KT7 A;  2A1X A;  3PU8 A;  4HKO A;  1W8H A;  2YG0 A;  4Y3O A;  2QNK A;  4CUG A;  2NQY A;  5L36 A;  5LBE A;  1NUK A;  3ZXL A;  4XF9 A;  4I2O A;  5J37 A;  1SBF A;  5KHG A;  1ZRC A;  1UYP A;  2JE7 A;  1HXS 3;  2VNV A;  3VBO A;  1PM4 A;  4XMI A;  1IQD C;  3R4U A;  3G7D A;  1K5M C;  3U37 A;  3WG3 A;  2XVK A;  3ACH A;  2J22 A;  1GSL A;  3O1O A;  1W8T A;  1FPN 2;  1U5I A;  3KSC A;  4XBQ A;  1C8M 1;  1KEX A;  3FLT A;  3AKR A;  5IJR A;  4BQ2 A;  3HPN A;  3ACL A;  4CCD A;  5JUV A;  2Y6L A;  1JMU B;  1WMX A;  3B69 A;  4UW5 A;  1ENQ A;  3MHZ A;  3VBS A;  1J83 A;  1OLQ A;  5BXX A;  4D7Y A;  1FNY A;  2IXI A;  1IS6 A;  2ZHL A;  4QKD A;  4CXX A;  4L8Q A;  2BBA A;  3AXE A;  3C3V A;  4M3C E;  4BK5 A;  4ZHN A;  2GC2 A;  1V6M A;  2XQX A;  3O12 A;  4Y20 B;  4D8M A;  3RZM A;  2Y6G A;  3MF9 A;  4CU8 A;  4Z07 A;  4LO6 B;  2XUM A;  3Q9O A;  1MVE A;  5L9R A;  1NQJ A;  4COY A;  1D4M 2;  1JXN A;  5BNN A;  2ZEW A;  2ARX A;  2GAL A;  2V09 A;  2W0X A;  4GH4 A;  2R06 1;  4HPK A;  2G19 A;  3V0B B;  1BEV 1;  3EBR A;  4O9E A;  3K4A A;  3I2K A;  4QQL A;  4ARY A;  4BLI A;  1BZW A;  2VVD A;  1UNB A;  1X9T A;  2ZGM A;  3HQX A;  4EYU A;  1AL0 G;  4FAH A;  2R16 A;  3ZN4 A;  3AYD A;  4YVS C;  4FOW A;  1AYM 2;  4XDQ A;  1W06 A;  4DNY A;  5JAX A;  4FPE A;  5LBC A;  3B9I A;  4AVC A;  4FP3 A;  5A6X A;  5EIY B;  5I0D A;  5FMB A;  3JBG 2;  1FOD 2;  1Y4W A;  1TMF 2;  3I54 A;  4IV3 C;  3LSE A;  4PDW A;  3DGT A;  4Q4V 3;  4PIZ A;  5SV5 A;  1UKR A;  4LR4 A;  3JD7 3;  3RZK A;  1LHU A;  3NAP C;  1IS3 A;  3THC A;  1YJK A;  5FZ0 A;  2DTW A;  2WQ4 A;  3T0D A;  4LOR A;  4LLO A;  2XWB B;  1W6N B;  4QPG A;  2BU9 A;  2VC9 A;  1QKQ A;  4MH0 E;  3ON7 A;  2ZX0 A;  1AX0 A;  1AX2 A;  1QJX 2;  2OPW A;  2JD9 A;  3CNA A;  4P9W A;  1UYZ A;  3NO8 A;  2HEW F;  3ZYG A;  4XFI A;  2XKP A;  4GMP 3;  4B29 A;  4DRV A;  1QF3 A;  2RS3 2;  4AG4 A;  4UYB A;  1RUI 2;  2GU9 A;  4KGG A;  1LEC A;  3D3A A;  5C9A C;  3NV2 A;  4R9B A;  4Q2F A;  2LRO A;  2AAC A;  3FHI B;  4FPC A;  3MI8 A;  1KFX L;  2ETE A;  2A6Z A;  4A44 A;  4Z2W A;  1V0A A;  2VVF A;  3A22 A;  5C5U A;  1HV1 A;  1QH7 A;  2VNR A;  4L9B A;  1VR3 A;  2J1U A;  2DV9 A;  3H1Y A;  3AZZ A;  1IOA A;  2HWF 2;  2XJT A;  4NRO A;  4E2G A;  4GZ9 A;  3C7G A;  4BQY A;  1YC6 1;  5JI9 A;  1DGL A;  1OH4 A;  1DP0 A;  1OA3 A;  2W87 A;  2WN2 A;  1W9T A;  1V00 A;  1WBL A;  3NQH A;  3NNG A;  5E88 A;  3MV1 1;  4Q4W 1;  3RJ2 X;  1P8J A;  1E5H A;  1WLT A;  4NRP A;  1RUJ 3;  3RMX A;  3M3C A;  3B00 A;  5J1X A;  4CPB A;  3UES A;  2LTN A;  1BBT 3;  1NXM A;  3AL5 A;  4JQR A;  3ZDS A;  4AR2 A;  1W3V A;  3WV6 A;  4LBK A;  4K20 A;  1POV 3;  3EMR A;  2DVD A;  2ZMK A;  4OLL A;  5GAL A;  2VUJ A;  3AMH A;  3E5Q A;  4AVS A;  1B09 A;  3MW4 A;  1UXX X;  2PHL A;  4LBQ A;  5A7S A;  3DYP A;  3M3O A;  5JMC A;  3WW3 A;  1W8O A;  3EO6 A;  1G9B A;  1LHO A;  3L9J T;  5FY0 A;  2A75 A;  4LQR A;  4BOW A;  1XPW A;  1ST8 A;  1V70 A;  1UQX A;  4GD4 A;  4QDR A;  1MAC A;  3C2U A;  3WNO A;  1NCQ B;  4XZU G;  3SH3 A;  2YB7 A;  1CR7 A;  2PLV 3;  2BFU S;  1ASJ 3;  2E31 A;  3ZYF A;  5J96 B;  3ZYB A;  5JXG A;  4BZ4 A;  2GP3 A;  4ISQ A;  1HW5 A;  4AI2 A;  3QLQ A;  2C24 A;  1HXS 2;  5LWB A;  4NHK A;  1X7N A;  1AX1 A;  3GNE A;  5C3P A;  1UZW A;  3H1W A;  4LEJ A;  1REF A;  2O1Q A;  2RJ2 A;  4XF1 A;  4UBH A;  2ZHN A;  3KT4 A;  4YGE A;  1AYM 1;  1ZX5 A;  5FWE A;  3CU7 A;  4DUW A;  3NWK A;  4LKS A;  2E9Q A;  1H9P A;  2J1E A;  4RQP B;  1PMI A;  4XAE A;  2DWR A;  3JBG 1;  1FOD 1;  4IE4 A;  1TMF 1;  5FZC A;  3USS A;  1AXZ A;  4N7I A;  2QVS B;  5DUW A;  3NST A;  1K45 A;  5T54 A;  2E51 A;  5DXD A;  2CWS A;  1RB8 G;  5G04 L;  3UV9 A;  5LY2 A;  1VBC 1;  1WME A;  1ZM1 A;  3CZU A;  2XML A;  1AF9 A;  3MW2 A;  5LB6 A;  1MS0 A;  1YLL A;  2ZHM A;  3MIC A;  1EPZ A;  1RED A;  2A3Y A;  4CUC A;  5E16 A;  4M4P A;  3I4I A;  2YBS A;  2YXS A;  1QJX 1;  1NLQ A;  5F1R A;  3O1P A;  1F4H A;  5FOB B;  3BYW A;  1S0B A;  1IZ3 A;  1ZYB A;  5L9B A;  2RS3 1;  2B9V A;  2DFB A;  1ZRF A;  3JZV A;  4JQT A;  3WEZ A;  4AED B;  1YO8 A;  3EXU A;  1NE6 A;  3ZM8 A;  5LAT A;  4RD7 A;  4MZU A;  4A6S A;  4XIL A;  1H9W A;  4Z92 B;  1SLC A;  3PTR B;  4KG8 A;  1LGN A;  4Q8K A;  1H6X A;  1GZW A;  2K9Z A;  3PUR A;  3I7D A;  1BVV A;  4IE0 A;  4XFB A;  1KS5 A;  3AYE A;  4XE9 A;  3AMN A;  1VB2 A;  2OW4 A;  1SLA A;  3W59 A;  3UGH A;  4QPI B;  3AZX A;  4LKE A;  3RNS A;  5FIX A;  3WW2 A;  4NAM A;  4NWV A;  1OVP A;  4Q4V 2;  4IEZ A;  4EZH A;  3JD7 2;  1BCX A;  4CXW A;  1JI6 A;  3RDI A;  2BVV A;  3K46 A;  5ERL A;  4LHN A;  1OI6 A;  4YVW A;  5DDJ 2;  3TBD A;  1NY7 2;  4R9A A;  2R0H A;  2XVL A;  4X6R B;  5ISL A;  4OZX A;  2X05 A;  2AZ5 A;  5JSR A;  1EPW A;  1SQ4 A;  5LEK A;  2PFW A;  1PMH X;  2VBP A;  2YFU A;  1FV3 A;  4Y4Y A;  2Q0A A;  2WO2 A;  5FUN A;  1V9U 2;  5BNO B;  3Q8B A;  4QM8 A;  3WDX A;  1NZI A;  1RGS A;  1EUU A;  3S6P A;  1LCL A;  1ULE A;  4Y1Y A;  1GNZ A;  4RL7 A;  5DUV A;  1E5S A;  2EAL A;  2OUH A;  2VCC A;  3ACG A;  3OTF A;  3UYJ A;  4LHS A;  1NG0 A;  4MV2 A;  3V65 A;  1HRI 3;  5LY1 A;  5I93 A;  1NX9 A;  4MAD A;  3BCW A;  5FYZ A;  5CYY A;  4CCO A;  4IES A;  2R30 A;  3B3Q E;  2J1R A;  1JZ4 A;  4KBB A;  4ES8 A;  2ZMN A;  1RUC 3;  3POW A;  2AGS A;  3CF6 E;  3SKJ E;  3NNM A;  3BU0 A;  1F5J A;  5KWR A;  1NCQ C;  3DUI A;  4QKB A;  4OHV A;  3H7Y A;  1RUJ 2;  1JN2 P;  1HB3 A;  2XGX A;  3MPP G;  3A23 A;  1PZ7 A;  1X33 A;  4HN0 A;  4RN5 A;  3PME A;  1RUN A;  1BBT 2;  2P1B A;  2VMF A;  1YEW A;  3H8X A;  1PK6 B;  1RMU 2;  4GAZ A;  5HPO A;  2VQU A;  4Y1V A;  1Z7S 1;  1XXN A;  4LOT A;  4RQP C;  5L7O A;  4ZXE A;  5CAD A;  3WX5 A;  3I59 B;  4HSL A;  1YFX A;  5FYC A;  3OPZ A;  4OI4 A;  4E8D A;  3ZPO A;  4GXL A;  4LUL A;  3VBR B;  5JR2 A;  4KNC A;  2PLV 2;  3FE5 A;  1ASJ 2;  2GP5 A;  4Y1Z A;  4M3C F;  4AFA A;  2WII B;  5JOZ A;  4M3C A;  1NKG A;  1UL9 A;  2JG8 B;  5EHD A;  5F5I A;  3IB3 A;  2D3S A;  4W6W A;  1FXZ A;  1K12 A;  1WD3 A;  3C7F A;  2VTX A;  4RHV 1;  1A3K A;  1BQP A;  2FBE A;  2PHD A;  3AP6 A;  1OHF A;  1MPX A;  4MOA A;  4PF5 A;  1GV9 A;  4ZU4 A;  4XIO A;  5FMD A;  2WA4 A;  2VZS A;  4QGM A;  1UXZ A;  4OZO A;  4AED C;  4Q4V 1;  5I0R A;  3QCW A;  2BWC A;  4XFC A;  5FYM A;  3WSO A;  2VEC A;  3WDT A;  2ZEY A;  2UY9 A;  4QB1 A;  1VP6 A;  4X6Q B;  5JXH A;  1U12 A;  2WFF 1;  3SIS A;  4BQ4 A;  5JXJ A;  5F6L B;  1ZA4 A;  5FZH A;  1DZT A;  1CAX B;  4Q4X 3;  2R1B A;  1I6X A;  5DDJ 1;  4TLF A;  1NY7 1;  2P3I A;  3RVH A;  4CDX A;  4LKD A;  2TBV A;  3GZE A;  2Q1Z B;  1MQT A;  5LK7 B;  3BAL A;  3DEC A;  3GAL A;  5FZ1 A;  1FI2 A;  4F7Z A;  2JIC A;  2VZO A;  4QPI C;  2SLI A;  3ASI A;  4GMP 1;  4YM1 A;  3SH5 A;  3GZA A;  1FAT A;  1V9U 1;  4FOY A;  5K8S A;  2W91 A;  1UWW A;  3SXW A;  1HB1 A;  2WNU A;  4LHL A;  4IGQ A;  3B9C A;  3FZ3 A;  3MUY 1;  2OUJ A;  4ET7 A;  2CV6 A;  1KFU L;  2IVI B;  2J1V A;  3WP5 A;  2EIG A;  2RJK A;  3FC0 A;  3WDY A;  2WC2 A;  2CTV A;  1UY2 A;  1UYY A;  4H2A A;  4WM8 B;  5DAV A;  1ZZ8 A;  3TNQ A;  2RMU 3;  4C8D A;  1PO2 2;  1VMF A;  4NPR A;  2BGC A;  1KQR A;  1J3Q A;  5BNO C;  2D6L X;  5HXV A;  3K75 B;  3IAQ A;  4QDS A;  3M2M A;  2QUO A;  2Y34 A;  1RUJ 1;  2ZKN A;  1TG7 A;  2EXJ A;  1BBT 1;  3ZXA C;  5A6Y A;  4LBM A;  4CEY B;  2WFP A;  1A78 A;  2XJS A;  3GM8 A;  1Q8P A;  1MEC 2;  1W2A X;  3NJY A;  4PLM A;  3IT8 A;  4BHP A;  1JH5 A;  5JZG A;  3FN9 A;  4XTP A;  1RMU 1;  4CU6 A;  5BPX A;  1OBN A;  3RSJ A;  5FR3 A;  3ZKU A;  2K2S A;  5FBZ A;  1YNA A;  2A5Z A;  2W1U A;  2XLF A;  3RGB A;  3WNL A;  4RS5 B;  3J7L A;  4WM7 B;  4FOQ A;  2EA7 A;  4D69 A;  2WKK A;  4CXY A;  3ZFG A;  4EN8 B;  2VCM A;  5IVB A;  1RIT A;  1CAW B;  4HMZ A;  1VAV A;  3DKQ A;  4MXW B;  4NRQ A;  5E8A A;  3VDD A;  4E8C A;  2BNN A;  3NJZ A;  4A6O A;  5GLW A;  5IWF A;  2EVX A;  4LE3 A;  2PLV 1;  4EN9 B;  2Z42 A;  1BYH A;  3H3U A;  2QQO A;  1WW5 A;  3BN6 A;  3FFQ A;  1WLW A;  2A6W A;  1RYY A;  3KT1 A;  2XJQ A;  1UY1 A;  3TEW A;  4AI0 A;  1WA4 A;  2IXJ A;  1PK6 C;  1HRI 2;  1XU1 A;  3AJZ A;  5KHH A;  4AFB A;  5EPA A;  3S5A A;  4CDQ A;  2EXH A;  3TRS B;  5KHI A;  3HWJ A;  3VZO A;  1X36 A;  4BXF A;  3J8F 1;  1C3H A;  1JUH A;  1C8M 3;  3D82 A;  3F2Z A;  3GXU A;  5LRS A;  4DY3 A;  2BPA 2;  1E57 A;  1XND A;  1JZ5 A;  3MLL A;  2C9A A;  4JKL A;  3ZXK A;  2ZX1 A;  5HI0 A;  1I9R A;  1W6O B;  4XC9 A;  2O8Q A;  1V6L A;  4N7U A;  3PIJ A;  2JG8 C;  1F15 A;  4PI2 A;  4CE8 A;  2VMI A;  5GZC A;  1LR5 A;  4AGR A;  2W47 A;  2E7A A;  4HVQ A;  4I30 A;  5FDB A;  3N36 A;  1DBN A;  3SLI A;  2Q8E A;  4BIO A;  5FO7 B;  1GU3 A;  4WVW A;  5E89 A;  3POF A;  1RVF 2;  2G9F A;  4HSJ A;  2WYF A;  1RUF 2;  5FZ6 A;  4RR3 A;  1X82 A;  2VZP A;  2VUA A;  1COV 3;  2WL1 A;  4CEW B;  2J7M A;  1VMJ A;  4HVO A;  4NRM A;  3DXT A;  2W39 A;  2R06 3;  2YU1 A;  3OG2 A;  2ZML A;  2RJL A;  1BEV 3;  4W6X A;  3OGR A;  4Q29 A;  2VO5 A;  1H4G A;  2VD7 A;  3MLK A;  5HXM A;  3BUC A;  3PHM A;  5ACA 2;  4F8A A;  5FP8 A;  3JUU A;  2NZ9 A;  4L97 A;  4EJR A;  1PO2 1;  1J1T A;  1XE0 A;  4R4X A;  1NA1 B;  4JGY B; 
#chains in the Genus database with same CATH homology
 2QQN A;  3VD7 A;  2BZD A;  3WNM A;  2WUH A;  3LE0 A;  1J84 A;  2WZ8 A;  2W92 A;  2VZR A;  3LEI A;  5C71 A;  1XC6 A;  1BHG A;  1CZV A;  2KD7 A;  3DYM A;  3LQC A;  3AC0 A;  4OMD A;  5C7G A;  1UY3 A;  4A3Z A;  2YG0 A;  3EB7 A;  1US3 A;  2VTF A;  4QB2 A;  3PUI A;  1NUK A;  3WNN A;  3ACI A;  1ULO A;  4XUN A;  4QPW A;  1UZ0 A;  1L7Q A;  4MGS A;  1IQD C;  3U37 A;  3HOB A;  3ACH A;  2J22 A;  4OMC A;  3EYP A;  3K4Z A;  2DCJ A;  4UOJ A;  3SEP A;  3PUH A;  1KEX A;  3ABZ A;  5IJR A;  3HPN A;  3W5M A;  5JUV A;  2Y6L A;  5A1A A;  4FI9 A;  1J83 A;  2VL4 A;  4D0Q A;  4DEV A;  2BBA A;  1OD3 A;  4BK5 A;  2W46 A;  4RYD A;  2XQX A;  4D8M A;  2Y6G A;  3MV0 1;  4CU8 A;  3CMG A;  3OGV A;  2VR4 A;  2ID4 A;  3P6B A;  4KWU A;  4ZZ8 A;  3LPF A;  2ZEW A;  3OEB A;  2VME A;  4DXT A;  1JYN A;  3T08 A;  3K4A A;  3I2K A;  4ARY A;  4JKK A;  4CUB A;  3HEI A;  1PMJ X;  2Y64 A;  2W1Q A;  3CQO A;  5CZK A;  5EIY B;  5I0D A;  2C9K A;  1JZ7 A;  4JX0 A;  4P5Y A;  2HYX A;  2VCB A;  5DMY A;  3THC A;  5F7U A;  3VD3 A;  3WF2 A;  4QX1 A;  3T0D A;  3C7O A;  1PX3 A;  2VC9 A;  2JD9 A;  1UYZ A;  2XHN A;  1UY4 A;  3LEK A;  4JHZ A;  4AG4 A;  4P08 A;  4GWI A;  2E33 A;  3D3A A;  5LCW L;  4DUX A;  3C7E A;  2LW8 A;  4A44 A;  3CDZ B;  2OKX A;  3K77 A;  3A22 A;  3I2F A;  4DXR A;  2J1U A;  2RV9 A;  3VD5 A;  4DUV A;  4GZ9 A;  3C7G A;  1OH4 A;  1DYO A;  1DP0 A;  2W87 A;  2WN2 A;  3DYO A;  4PQQ A;  5EJZ B;  1W9T A;  4A42 A;  4QX2 A;  3NQH A;  3NNG A;  1DLC A;  3MV1 1;  3T0A A;  4QDQ A;  1P8J A;  2EIC A;  4KMQ A;  5J1X A;  3UES A;  2LS6 A;  4XUP A;  2VJX A;  1JYV A;  5IYY A;  1HN1 A;  5C70 A;  3C8X A;  2W9X A;  1UXX X;  1F4A A;  1O59 A;  3DYP A;  4ZZ5 A;  1W8O A;  3NJX A;  3WF1 A;  4AAX A;  4LQR A;  3GGL A;  2W5F A;  1XPW A;  3WNO A;  4QDR A;  3HN3 A;  4XZU G;  2CDO A;  2YB7 A;  4PT6 A;  1JHJ A;  1SG3 A;  2PQS A;  5EJ1 B;  5JXG A;  2E31 A;  3ACF A;  3UNP A;  3T2P A;  3CKH A;  3VDB A;  1JZ3 A;  2Y6K A;  2YC2 A;  2RJ2 A;  3WNK A;  1O8P A;  3JXS A;  5JMO A;  4DUW A;  5IHR A;  4LKS A;  4XUQ A;  3J7H A;  4XVH A;  2J1E A;  2E26 A;  1K45 A;  5G04 L;  3CIH A;  3MUZ 1;  3CZU A;  3I2H A;  3HJR A;  3A7Q A;  2WN3 A;  2Y6H A;  5LA0 A;  4GWJ A;  3A21 A;  3OEA A;  4JKM A;  2VM9 A;  1GUI A;  3ECQ A;  2WYS A;  4CUC A;  4IUG A;  2VOT A;  3LEG A;  4M4P A;  2W3J A;  1O8S A;  2J1S A;  1UX7 A;  1F4H A;  4ZY9 A;  1SDD B;  1GOG A;  2B9V A;  3IAP A;  3MBW A;  4UAP A;  1JZ2 A;  3WEZ A;  2VZ1 A;  2XON A;  4CUA A;  3ZM8 A;  3C7H A;  5JXI A;  3HNM A;  1W9S A;  2WAA A;  1GOF A;  2VZQ A;  2Z4F A;  1H6X A;  2QQJ A;  2VCA A;  4TXW A;  5LA1 A;  2DDU A;  4TTG A;  4Z2A A;  4M4R A;  1NAE A;  2BGO A;  3OBA A;  1OF4 A;  3VD9 A;  1UMI A;  4QX3 A;  3THD A;  4W8J A;  3OGS A;  1JI6 A;  1GOH A;  3K46 A;  1JYW A;  1K3I A;  4BK4 A;  1JZ8 A;  4BDV B;  2X05 A;  2JE8 A;  2B4K A;  1PMH X;  2YFU A;  2WO2 A;  4ARX A;  1GMM A;  3FL7 A;  3VD4 A;  1EUU A;  1T2X A;  5DN2 A;  2VZ3 A;  2VCC A;  3ACG A;  4LHS A;  1JZ6 A;  1JU4 A;  1WCQ A;  2QQL A;  3I3D A;  3OB8 A;  2W1S A;  1NX9 A;  4MAD A;  5CYY A;  3NRU A;  4L0P A;  2YFZ A;  1UY0 A;  1JZ4 A;  2J1R A;  3VDA A;  2EIE A;  3SKJ E;  2VZU A;  5DPN A;  1W0N A;  5IFP A;  4RN5 A;  3A23 A;  3BGA A;  2Y6J A;  2VMF A;  2WO3 A;  1SHW B;  4XUT A;  3SKV A;  2JKX A;  4OYU A;  1W8N A;  3CZJ A;  5HPO A;  2VQU A;  4P00 B;  4QB6 A;  4ZXE A;  4CU9 A;  3I3E A;  4P02 B;  4A41 A;  4E8D A;  3T0B A;  1US2 A;  5JR2 A;  2WDB A;  1UYX A;  3I2G A;  5FUI A;  1CZT A;  2WO1 A;  3ETP A;  1W9W A;  2J1T A;  2W1W A;  1NKG A;  4UI9 L;  3IB3 A;  3C7F A;  1K12 A;  4BJ0 A;  2V72 A;  4YPJ A;  1JYX A;  4MOA A;  1MPX A;  2DCK A;  2C26 A;  2VZS A;  1UXZ A;  4OZO A;  3UET A;  4CU7 A;  2VQT A;  4QAW A;  2WAB A;  3WSO A;  2BER A;  2J1A A;  2ZEY A;  3HNB M;  4OUE A;  4QB1 A;  5JXH A;  1R64 A;  2EIB A;  5JXJ A;  3T09 A;  2E32 A;  2X10 A;  4LPL A;  3GDB A;  2HLE A;  1D7P M;  4W50 A;  3T2O A;  3DEC A;  1ULP A;  3I2I A;  2VZO A;  2W95 A;  2R7E B;  5B4N A;  1XNT A;  2W91 A;  1OF3 A;  1UWW A;  4A45 A;  2QQK A;  1K42 A;  3I97 A;  4MGQ A;  2BGP A;  3MUY 1;  2WQ8 A;  2WAO A;  3NJV A;  4ET7 A;  2J1V A;  1UMH A;  1UY2 A;  1UYY A;  3T2Q A;  1TVG A;  3WF0 A;  3K75 B;  3IAQ A;  3I3B A;  4QDS A;  3W5N A;  3LPG A;  1GNY A;  5LA2 A;  1WKY A;  1TG7 A;  1I5P A;  3WF3 A;  4XUO A;  4KI5 M;  2RVA A;  3GM8 A;  2QQM A;  2ZEX A;  3FN9 A;  3WQB A;  1GQP A;  2YC4 A;  4CU6 A;  2VMD A;  4BXS V;  4DXS A;  2W1U A;  3WNL A;  3SEE A;  2VMC A;  3III A;  2V5D A;  2XOM A;  4PF1 A;  2ZXQ A;  5B4X A;  2ZEZ A;  4E8C A;  4A4A A;  4A6O A;  4HG6 B;  5IFT A;  2W94 A;  2QQO A;  3BN6 A;  2QQI A;  2C4X A;  1RYY A;  1W99 A;  1UY1 A;  2ORZ A;  2CDP A;  2ORX A;  1JU3 A;  2Y8K A;  1CX1 A;  1OT5 A;  2JDA A;  3IDA A;  3P1I A;  2WZE A;  3F2Z A;  3GXU A;  1YQ2 A;  3FHA A;  1JZ5 A;  2V4V A;  4XUR A;  3VDC A;  2EID A;  1H6Y A;  2QBX A;  4JKL A;  1PX4 A;  2WBK A;  2VZT A;  3MO4 A;  2W47 A;  1XNA A;  4DEQ A;  3WF4 A;  2VZV A;  1GU3 A;  4CVU A;  3FHQ A;  2VZP A;  1KGY A;  2J7M A;  1EUT A;  3OG2 A;  3OGR A;  2VO5 A;  1L7R A;  3K4D A;  3I2J A;  5HXM A;  1CZS A;  2L9L A;  5G05 L;  3HNY M;  4QX0 A;  3WNP A;  2X09 A;  3E1F 1;  4W4Z A;  1CIY A;  5DQ0 A;  4MO3 M;  1LNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...