1XNAA

Nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
151
structure length
151
Chain Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DNA-REPAIR PROTEIN XRCC1)
publication title Solution structure of the single-strand break repair protein XRCC1 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xnaA00
3WEZA 4CU8A 2VMDA 1SHWB 1NKGA 2VJXA 3DECA 2J1VA 1GQPA 2W94A 4OZOA 4KI5M 1O59A 1KGYA 3VD4A 4OUEA 4LPLA 1F4HA 3CKHA 3K75B 3T0BA 3LEGA 3WNPA 3I3BA 4AAXA 1EUTA 3LPGA 2X05A 3WF0A 1CZSA 3T09A 1NUKA 1RYYA 1UY4A 3C7FA 2JE8A 3C7HA 3PUIA 1JZ8A 3IAQA 2WN3A 1UY2A 3C7OA 3CIHA 1JHJA 2ZEXA 3ACIA 3F2ZA 4JX0A 5C70A 5A1AA 2BGPA 2E33A 4CUCA 4W4ZA 3SKVA 4CU9A 2C4XA 3FL7A 2VZRA 4AG4A 2Y6HA 2WYSA 3I2FA 4E8DA 2W5FA 5IJRA 3FHQA 4A44A 1F4AA 1K3IA 3OBAA 5JR2A 2R7EB 4P02B 2YG0A 1JU3A 1GOHA 1OD3A 4DXTA 4ZZ5A 5HPOA 4OMDA 2VZ3A 1GOGA 3U37A 2J22A 3WNMA 3I2HA 2J1UA 3WNNA 2Y8KA 3J7HA 1UXXX 4DUWA 2QQKA 4QAWA 2EICA 2VCAA 2V4VA 4ARXA 3I3EA 4Z2AA 2QQNA 3THDA 2W3JA 1SDDB 3AC0A 1PX4A 3WSOA 1JYNA 2VR4A 2VZVA 1L7QA 2JDAA 1W9TA 2BZDA 1OF3A 4OMCA 2W47A 2VMEA 1KEXA 2VZPA 1J83A 1OH4A 5DQ0A 1UY1A 2J1AA 2RJ2A 1US2A 4W8JA 4ET7A 4UAPA 3HN3A 2W1SA 4GZ9A 1O8SA 2QBXA 3HNBM 3MBWA 5B4NA 3CMGA 4IUGA 4DEVA 1XC6A 3VDCA 2DCKA 4XVHA 2HLEA 2VZSA 2J1RA 3VD9A 3HJRA 4QB2A 3IAPA 4JKMA 3MV11 4QPWA 1J84A 3I2IA 5JXJA 2J1TA 4E8CA 4XUPA 1K45A 2BGOA 2WO1A 2J1SA 3EB7A 3OGRA 1US3A 5JXIA 1CIYA 3I2JA 4QB6A 3DYOA 4A41A 1OF4A 4QDSA 2Y6LA 2OKXA 1EUUA 4XUOA 4A6OA 2VZQA 3A7QA 3T0AA 5JMOA 3NRUA 1W8OA 4LHSA 5G04L 2X09A 2YC2A 4GWIA 4LKSA 1IQDC 2XOMA 4KMQA 4XUNA 5EIYB 1NAEA 4MGQA 3LEKA 5DMYA 3IB3A 3WQBA 4XURA 1W9WA 1WKYA 3VD5A 2WBKA 3MUZ1 2XHNA 3HEIA 1JZ4A 1DP0A 2VM9A 3HNYM 5LA0A 5LA2A 1W0NA 3OB8A 1UY0A 3WF3A 3A21A 3NQHA 2PQSA 5HXMA 3LPFA 4D0QA 1GOFA 2L9LA 3C7EA 4CVUA 1UY3A 3WNKA 3VD3A 5IFPA 1YQ2A 3FHAA 4XUQA 3P6BA 3WF2A 3ABZA 3K4DA 4DUXA 2WAOA 4A45A 3CZUA 1MPXA 1SG3A 2VO5A 4CU7A 3LEIA 1XPWA 3WF1A 1W8NA 1UWWA 3OGVA 2DCJA 2VQTA 1GUIA 4OYUA 4QX0A 3MV01 1PMHX 3NJVA 2RVAA 4GWJA 4UOJA 4DUVA 2Y6KA 1XNAA 3GGLA 3UESA 1NX9A 3T2OA 2B9VA 3NNGA 2HYXA 3ACFA 2W92A 1TG7A 2Y64A 2ZXQA 3DYPA 3BGAA 2V72A 2W91A 3DYMA 3K4ZA 1UXZA 4QX1A 3UETA 1GU3A 2QQIA 1JYXA 1WCQA 4RN5A 2VMCA 5IHRA 1ULOA 2LW8A 2E32A 1CZVA 2B4KA 4BXSV 4UI9L 5C71A 3A23A 3ACHA 4BJ0A 5IYYA 3FN9A 5J1XA 4RYDA 2CDOA 2Y6JA 3CZJA 1GMMA 4QDQA 2Z4FA 3T0DA 2WDBA 5DPNA 2YFUA 2ORZA 5CYYA 2VMFA 1PMJX 2VCCA 4HG6B 3T08A 2JKXA 1JZ2A 1CZTA 4BK5A 3WNLA 4PQQA 4P5YA 5B4XA 3C8XA 2VCBA 3MUY1 3SEEA 2EIEA 1UZ0A 2WZ8A 3WF4A 1UX7A 4ZZ8A 3W5MA 2C26A 2BBAA 2WABA 3K77A 2QQJA 3LE0A 2VZ1A 4QB1A 5CZKA 3GDBA 1HN1A 3OEAA 3OGSA 4P00B 3W5NA 2ZEZA 4ARYA 2Y6GA 4TXWA 2WAAA 3EYPA 5IFTA 2ZEYA 3MO4A 3ECQA 3ETPA 1UYYA 3VDAA 2VC9A 2VZTA 4A42A 2W87A 3I2KA 1BHGA 4L0PA 4A4AA 2QQMA 4QX3A 2E31A 5EJZB 2RV9A 3LQCA 4PT6A 4XZUG 5JXHA 3HPNA 4BDVB 2VQUA 2BERA 5FUIA 1JU4A 3ZM8A 3K46A 2WO2A 2YB7A 1JYWA 2KD7A 1I5PA 3I3DA 3I2GA 4KWUA 4CU6A 4XUTA 1DLCA 3BN6A 3T2PA 1T2XA 3K4AA 2ORXA 2J1EA 2EIDA 1H6YA 1K12A 2CDPA 2W1QA 2X10A 4M4PA 4W50A 3WNOA 1UMIA 1W9SA 1JYVA 2W1WA 4JKLA 1P8JA 2WQ8A 2ZEWA 3PUHA 2LS6A 4MADA 1JZ7A 2WN2A 4FI9A 3SEPA 4DXRA 2JD9A 2W1UA 1LNSA 1JI6A 1UYXA 2VZOA 4YPJA 3THCA 5JUVA 2W9XA 2E26A 2VZUA 3E1F1 4TTGA 3OEBA 1O8PA 2VOTA 3SKJE 1W99A 5G05L 2XQXA 4JHZA 1K42A 3CDZB 3D3AA 1JZ6A 4A3ZA 1L7RA 2ID4A 3GXUA 4P08A 5LCWL 5F7UA 4LQRA 2EIBA 3P1IA 2C9KA 1GNYA 3VDBA 1R64A 1OT5A 5EJ1B 2VL4A 4MO3M 3VD7A 2QQLA 1TVGA 2W46A 3C7GA 4QDRA 3UNPA 1UMHA 1JZ3A 4MOAA 1JZ5A 5C7GA 3OG2A 3T2QA 2WO3A 1XNTA 3IIIA 5DN2A 2XONA 5LA1A 3NJXA 4ZY9A 2WUHA 4BK4A 3IDAA 2J7MA 5JXGA 1ULPA 2VTFA 4MGSA 2WZEA 4D8MA 4QX2A 1D7PM 2YFZA 2V5DA 3JXSA 5I0DA 1DYOA 1H6XA 4DXSA 3HNMA 2W95A 4ZXEA 2YC4A 3HOBA 3I97A 1PX3A 2QQOA 4JKKA 3CQOA 2DDUA 3GM8A 4CUBA 4DEQA 4CUAA 4M4RA 1CX1A 3A22A 3ACGA 4PF1A 1UYZA
chains in the Genus database with same CATH superfamily
1URXA 4IV1A 5IAVA 2SLIA 1QXPA 1BKZA 1K5MC 3RZKA 2JIGA 2ZMKA 4DOUA 3VBUA 2DUOA 3DECA 1RUC2 4P9GA 1AR72 2W94A 1E5SA 2A3YA 4KU8A 4JRAA 4OZOA 5JIAA 1KGYA 3GCWA 1U12A 4LPLA 1Z78A 1LHOA 2IFRA 4XDOA 3CKHA 5FYYA 1RUC1 3U1XA 3JD73 1AR71 1WGPA 4K8FA 4MSVA 5FXWA 1G86A 3VHPA 1C3HA 1AX2A 5JLVA 1AL23 5FXZA 3IM0A 5GZGA 1NOVA 4Y26A 3ILNA 2X05A 1CAXA 3AYEA 4I01A 4AGRA 5C8CA 4XFCA 1VBB2 3CJIA 1G9DA 3C7FA 2JE8A 2B9UA 2R071 3E5QA 3POGA 5D21A 3MW4A 2R061 4I30A 3VGIA 3VBOB 3RJ2X 4YM0A 4XBLA 4XQWA 3JU9A 5A32B 4URAA 1O4YA 2ZEXA 4JX0A 2GZWA 5LK5A 5HV0A 4JCKA 5L9RA 3WDYA 2EAAA 1CPMA 1HX6A 1W2UA 4K3UA 4CEYA 3H1YA 5IK8A 5EP9A 2WYFA 4EZ4A 5FYVA 2HWE3 5JZGB 1AR62 1JN2P 2Y26A 4YW5A 5JR7B 1W06A 2OXBA 5FLJA 3Q8BA 1RB8G 5DZEA 3RZHA 3M70A 1AR61 2AH2A 3ZPOA 2RJKA 4JDMA 4Y1ZA 5JOZA 5FOBB 4P02B 3ZN4A 3VDDA 1S0EA 1JU3A 3ZXDA 1GOHA 3O12A 4DPNA 5C3RA 5C3QA 2SBAA 5EQUA 5SV8A 2OZ6A 2R6QA 1JOPA 2GP5A 2VNRA 3GNEA 2VE1A 3WNMA 4JGYC 2UYAA 3PMSA 3C3VA 3OPWA 2XMLA 4XW3A 1HRI2 3B5LB 3LIHA 3PIGA 2GDFA 2NM1A 4JQRA 4FTBA 4QAWA 2VCAA 2P1BA 2UWCA 4QKNA 4CDXA 2A71A 2P37A 4MXWB 1Z0HA 3ZIXA 3AMQA 3D6EA 4IEWA 2WIIB 2PHRA 5CNAA 4JDOA 2VQAA 3OOXA 1UOJA 4NE9A 4CDUA 1I6XA 4COWA 4CPBA 4WM7C 4YW6A 3WSOA 4WM8B 2VZVA 1W9TA 1OF3A 1HXS2 4PJYA 2RR12 4MHRA 1QNYA 2LROA 2VMEA 4NRPA 1GKBA 5FP7A 4TYSA 4XE9A 4HK8A 2VZPA 5CIRA 1AJOA 3GZUC 3HT2A 3PJYA 5F37A 2J1AA 1EV13 1HXS1 2P6CA 3PIJA 4AXOA 2RR11 2ZGPA 2RDSA 4ASMB 1UYPA 3GZAA 5JSOA 3H7YA 4UAPA 5F2SA 5L7OB 4QGLA 2IXIA 2YGMA 3HN3A 3BTAA 3H3UA 1HB4A 3M3EA 3O14A 2VPVA 1PK6A 1O8SA 3VZKA 2PQQA 4YM3A 5I0RA 4Q4V2 4DEVA 3VDCA 2JECA 3O0WA 4ITCA 3L2HA 3VUOA 1LAJA 5ISLA 3N3HA 5LK7B 3VD9A 4QB2A 3QBQA 3ZN5A 4Q4V1 5A7WA 4XOGA 2LRPA 4XXAA 4TZDA 1IS5A 2QUOA 3IPVA 4LLOA 1DBNA 2TEPA 1OQEA 2A75A 1Y9GA 4HXCA 1ENSA 1ASJ3 5JXJA 5T52A 1PM4A 3L2YA 2JDNA 3RMYA 2BW8A 5M0TA 3N9OA 2BGOA 1IPKA 2J1SA 3ZYJB 1LENA 3JUUA 3T3YA 3I2JA 4QB6A 5H9SA 3DYOA 2ZOEB 4A41A 1JH5A 1V6JA 2Y6LA 3ZMOA 4CZSA 2JG8B 3J8F2 4QD2A 2OKXA 4BQ4A 1FMD3 3EHKA 1U0AA 2PLV2 2VTXA 5A6YA 1WA6X 1W8OA 2YMZA 3LGRA 5CAZA 5GZDA 1FPN2 1PGL2 4LTAA 4LORA 1AXZA 4GWIA 4HL0A 3P5BA 3ZFFC 4QXHA 2XPJA 5GALA 2ARBA 4N7IA 4OI2A 4QHZA 3O1UA 2DBNA 3GZEA 3PURA 4OI1A 1COV2 1AR91 1ZRRA 4GALA 4NN0A 5FBZA 3D4KA 3OBRA 4IEZA 3ZPYA 2WBKA 1X9PA 3LFMA 1LB2A 5FFOC 2FDHA 1JZ4A 5LBEA 2PTMA 1GWMA 2VM9A 3I7DA 3OB8A 2IWGB 2ZZJA 2FQPA 3LKJA 3A21A 5FYSA 2PQSA 5HXMA 3LPFA 3KZ4C 4GH4B 4CVUA 1GOFA 1OLME 3RGBA 5FK7A 4CSWA 3U78A 4E4ZA 5KR7A 3OSDA 3HR9A 5F1RA 4PDWB 5C4WB 3LIGA 1YQ2A 3UK9A 2FCVA 5F3IA 3ZSLA 2DFBA 2WJSA 1FXZA 1WW5A 1W8TA 1QDOA 1LESA 1J1TA 3O0XA 4CP2A 3J7LA 5T55A 4RR3B 5IW0A 1HW5A 3QACA 1NZIA 2JDUA 3S6PA 1JYIA 1R1ZA 3RQ0A 1Q3EA 1PNFA 4Y1YA 5FYIA 5T5JA 1D0HA 4IEXA 4XABA 1C8M3 3O1OA 1O4ZA 3VBOA 3RYRA 5LEJA 3WF1A 2WS91 4LBJA 1NCRB 1W8NA 1UWWA 1ZBA1 3GZTB 4FFGA 5FCCA 4Y3OA 1BCXA 5FKBA 4DB5A 5DG2A 2XLGA 1MS4A 4LBNA 5A80A 1M4WA 1IKQA 1LECA 1VBA3 3H8UA 5L9BA 2RVAA 4N9IA 1RITA 1XBFA 4UOJA 4CCNA 5JZGA 3WZ1A 3ON7A 2E6VA 5K0UB 3UESA 3AKRA 1VMJA 1OSGA 3NNGA 2JDZA 2W92A 1TG7A 1R091 3LAGA 1JOJA 2WNEA 3DYPA 2ZGUA 3RMXA 3RZMA 1B35C 1QOTA 1UXZA 1YHFA 1MEC2 3HAGA 4R8HA 2RJLA 4XDQA 3VL8A 4B7KA 2QDNA 1S0FA 1GU3A 2WFF1 3IWZA 3IZOA 5DUUA 4XFFA 3WY6A 2VMCA 3VZMA 5FJKA 5IHRA 3SLIA 4EN9B 2VVFA 2HWF2 4YG6A 2LW8A 1FX5A 2E32A 3VZLA 4YZ5A 5JVVA 1DDLA 2GMMA 1CPNA 1GP4A 3KT7A 5DDJ3 1IPJA 1J3QA 1KFUL 5KHJA 3KGZA 1O3RA 2HWF1 3FWEA 5KC6A 1J58A 4BJ0A 5IYYA 1ONAA 3AK0A 4XEZA 1FV3A 4UFHA 5EZWA 4YVSB 1H2NA 2JJ6A 3POYA 4MUVA 4QPIC 1X8EA 4EV0A 2ZTNA 1KS4A 1YRZA 5A1FA 3R4DB 4RYDA 3RPQA 3CL1A 4W65A 2VAUA 2Y6JA 2XJUA 3DPRC 1JUIA 4I0WB 1ZRFA 3OBTA 1AL22 5FR3A 4NIDA 1VRBA 3PVOA 1RMU3 3T0DA 2WDBA 3WCSA 3A0NA 5F3GA 2CL2A 2VNGA 2YFUA 2ORZA 3ZN6B 3THTA 5GLVA 1PMJX 3ZR5A 5D8AB 3SC7X 4H14A 1W0PA 2X8KA 1TMF1 1J1LA 4LK7A 2JKXA 1PNGA 5L7OA 5FZ7A 1D4VB 1TEIA 4BISA 3I4IA 1QJX2 1FOD2 4BK5A 4Q0UA 3H42B 5JDBA 2ZCWA 1O5LA 2HBTA 2JE7A 1Q8VA 1C28A 3C8XA 4N43B 1C57A 1XNKA 2HWE2 1QJX1 1FOD1 1V0AA 1W6NB 1LU2A 1IG0A 3U4XA 5BNNB 1YJLA 2ZGLA 1YEWA 2VULA 1YFYA 3FBMA 1WCSA 1FNYA 1RUH1 1O3SA 3WF4A 4IV3C 4E2QA 2BU9A 2BGCA 1W3XA 4JGZC 4EN0A 1TQ5A 5IATA 5J98B 4CDQB 4HSLA 1YFWA 3IT8A 3ZFEC 5HBAA 5J37A 1ULGA 4FFHA 1WD3A 3W5NA 3UKVA 2WRAA 1E5IA 1SBDA 2CAVA 2R043 1MZ6A 2VW0A 3BB6A 2WL1A 3B69A 3S7IA 2K46A 3ECQA 1WD4A 1R081 2CGNA 3CF6E 3ETPA 3OY8B 4AEDC 2XVKA 2EA7A 4BPZA 4CTEA 4JDNA 2W87A 4B29A 4K8RB 1U5YA 4H55A 4IEVA 4RL7A 2JG8A 1OKQA 1Y4WA 3BALA 5EJZB 2RV9A 4GKYA 2FBEA 3SHRA 3O1RA 3GHMA 3N36A 4NAOA 2DUQA 1GZ9A 4DFSA 2MHFA 3MF9A 3MIDA 4BHPA 3LF7A 2D5HA 3PVBB 3ZM8A 1TNRA 2V5YA 3AMPA 3B93A 5ACA3 2JG9C 1VBE3 2KD7A 3HT1A 5HCAA 3RZJA 1KRIA 1KFXL 2ZX1A 1I5PA 3S5QA 3I3DA 3JQWA 1CIWA 2O14A 4YW7A 1PO13 2NLRA 2Q5TA 3LEMA 4NOTA 1UL9A 1EV12 2NMOA 5A6XA 1VBC3 3Q8CA 4CU6A 1CX4A 1MS1A 4XUTA 5FK8A 4YARA 5IVJA 1W8HA 4OUSA 2DWRA 4GMP3 1PM7A 4QKDA 4ZXKA 5KHGA 5KXDA 4CE8A 3ASIA 2XVLA 3IDCB 4URTA 3MLLA 4IE0A 2CDPA 4UW3A 1OBNA 1OXCA 5EXOA 3URFA 3OGJA 5F6KA 4FPLA 5CFDB 1NG0A 1V9U1 4IE5A 1JYVA 2P3YA 2W1WA 4COZA 1DLLA 4PDWA 5C4WA 5F9TA 1RC6A 2ATFA 5E1RA 4BIOA 4BZ4A 4K6BA 5FZ8A 1BEV3 2Y6FA 5CISA 1S0CA 1ND2C 2OS2A 2ZEWA 4MADA 1SMVA 4DXRA 1W39A 4QPYA 4I3GA 1G7YA 3D0JA 3E5UA 2WLQA 4RR3A 3K48A 3PMEA 4RSUA 5GLZA 1OI6A 2O8QA 5C33A 5GJ6A 1ASJ2 1RXFA 1RUD2 1PVC3 1PGW1 2NMNA 5GZFA 2BBVA 3V0BB 5AFBA 3RZLA 2VVEA 1YIFA 3QH6A 1TZOA 2F4PA 1DZQA 5A7QA 1RUD1 1NCRA 2PHTA 2BFUS 4MH0E 3S30A 5G05L 5A3OA 4OLLA 4A6SA 4AR2A 2OX0A 3TEYA 2XQXA 3VBRB 2EVXA 2JEMA 2VECA 5CEHA 4V2WA 1NZCA 4MGTA 1FMD2 1HKDA 5A7SA 4M3CF 2EALA 5FO9B 1XQNA 1H1AA 2ID4A 5K0UA 4P08A 1W8ZA 3NKTA 5A3LA 3AM2A 1OVSA 1DGWA 1ZZ9A 3ZFGB 1DZRA 1G9FA 1GNYA 1UMZA 2YY1A 2VGDA 1VRH3 4DQAA 2HWB3 1DQ4A 3ELNA 2OUHA 3B01A 4QXCA 4Q0QA 1R64A 3SMHA 2B5HA 4BQWA 4PQ9A 1OT5A 2RS51 4Q4X1 1EAH1 1NCQA 1MQTB 5EJ1B 3RG0A 4AI9A 3V0AB 4YG0A 1TVGA 3Q8AA 1RUI1 3HMYA 3SCFA 1SACA 4MOAA 1ULDA 5BNOB 2BPA2 2WWJA 5FZ4A 3H3ZA 1V6LA 2NN8A 3AFGA 4HLTA 2DU1A 5FV3A 3IIIA 1RUE2 2X29A 5LA1A 5IUQA 2BP6A 3VBUB 1W3VA 2RS11 4I02A 1H9PA 2WNUC 2RDNA 4YW2A 1AXKA 2VTFA 3ZX7A 2WZEA 1RUE1 2BVVA 2CTVA 1SLTA 2LUWA 5CG8A 3FHIB 2YFZA 4FTSA 2G19A 4Y1XA 4YVSA 1QWRA 4RQPA 2V5DA 3JXSA 4RGGA 2XJPA 3R0RA 4GWNA 3BOWA 2BRTA 1DYOA 3DXUA 3PL0A 2W95A 1OUSA 4ZXEA 2JWPA 5FXXA 1DGRN 2G9GA 1VE0A 4IEYA 5C8CB 4ORFA 2JXAA 2XR4A 4HPKA 1PX3A 3CJIB 4JRLA 2H6CA 3CQOA 2DDUA 2DFCA 3NW4A 4G3YC 1DHKB 3DKWA 5FIXA 3GBGA 4M4RA 4I09A 3KCCA 2P3KA 5D8AA 3N9LA 4DS0A 2MEV1 2FDJA 4RS5A 1K5MB 3BUCA 2FD8A 2NP0A 3WDUA 1JUHA 4O9EA 2PAEA 1JS9A 3PU3A 2FMDA 3AP7A 1RVF3 1O59A 2VMGA 1HB2A 1VBA2 3INAA 4N8MA 3TNPB 4DXZA 5FO8B 1S0DA 3AFKA 4FPFA 3VKNA 1W6NA 4AQTA 3GJBA 4XHBA 5BNNA 1LOBA 3BYWA 1V6NA 2AREA 3DKQA 4RFRB 4X6QB 5FDBA 4U2AA 1SLCA 3WNPA 3TRSB 5CKQA 1HRV3 3ALQA 1AYN1 1EUTA 4QX8A 3PVEA 2KA3A 5FYMA 4NR1A 3WF0A 1V6KA 1UZVA 5D1IA 4IERA 3T09A 2I74A 1NE6A 1RYYA 1O3TA 2QFEA 1POV1 4AHYA 1N1YA 3KCXA 2Q8DA 3G7DA 2DU0A 1BVP1 1BK0A 1W2NA 4R4XA 1UY2A 5CVRA 4XC9A 2WQZC 3CIHA 1XB9A 3F2ZA 1JXNA 4RD7A 3OY8A 5C70A 4Q4W3 5A1AA 2G4IA 1LGNA 1I3HA 3AB0A 5D2AA 4MVTA 5DDJ2 2JIJA 5F39A 4CDXB 2F6BA 4CU9A 3BVCA 4AFAA 4BCUA 3EO6A 4XILA 4NVPA 1VAKA 2NZ9A 2WYSA 3WDTA 3N4MA 4E27A 4E8DA 3KT1A 5LRSA 3HQXA 2F4LA 1W6MB 3FHQA 5EPAA 1QQP2 4A44A 5BNQA 5JR2A 5ABJC 2ZX3A 4ATEA 3KGLA 2R49A 4LBQD 1QQP1 3M3OA 5HPOA 2Y38A 4OMDA 5K7PA 1GOGA 4XF0A 1RMU2 2Y0IA 3I2HA 2DCZA 4FPKA 5E88A 2Y8KA 4TSVA 3VHOA 1XOYA 4UFJA 1UXXX 5DZFA 1CGPA 1CJPA 4DUWA 1NLRA 4QM9A 4CP0A 1D2SA 4S2FA 2EICA 1PK6B 4OFGA 1W05A 2VNOA 4OHZA 3P3NA 4ARXA 4LBOA 5FTTC 2WT0A 2QQNA 4EYUA 2WZR3 4IL7A 4L97A 4P9WA 5T54A 1DGWX 3S7EA 2A3WA 4M3CB 2DCYA 2NYYA 3AC0A 4B8EA 2K2SA 3KV4A 1CAUB 2ETEA 3ZLIA 2D3SA 4L99A 4YZ1A 5F3CA 1QIQA 2BZDA 1XYOA 1X33A 5FWJA 3IPVB 1YFUA 1YQ5A 1PGSA 5HXVA 5A70A 4UT5A 3VZNA 4R9BA 1H8TC 5FBJA 5A7PA 1OH4A 4EWDA 3POJA 1UY1A 4JZRA 2WNOA 1FAYA 4ET7A 5K4LA 1G9BA 4JQTA 2R042 1VBD3 3VBFC 4F8AA 5IVVA 1O6UA 1SPPA 3V0BA 2WWSA 1LTEA 1UZZA 4CCKA 4EN7B 3VZOA 2YU1A 3LOBA 1GP5A 4HK9A 3AZVA 3HNBM 1RUG3 1ST8A 5LBCA 5GZCA 2QTWB 3JCIA 1BBT3 2OPWA 5B4NA 2ADDA 1ZBE2 1AYM1 4IUGA 4XIKA 1F15A 4NHKA 5A3UA 1QJU2 5TSWA 3KMHA 3TAYA 4EE2A 2VMIA 4AGGA 3BTYA 4DRRA 5A3MA 2ZJCA 2MPFA 1ZBE1 1CN1A 3BTZA 3O5SA 1X9TA 3ES1A 5FZIA 5E16A 1QJU1 1XE0A 1W03A 4Y20A 4QPWA 3ZXGA 1J84A 3I2IA 1CVNA 3SITA 1C1FA 2CGPA 3TYJA 4C1XA 5F6LB 1VBE2 1NT0A 4E8CA 4GQ7A 3WQ0A 3EBRA 1WCDJ 1PO12 3T4HB 3V0AA 1D2QA 2GNMA 4LHLA 1PO23 3H8OA 4XXPA 4HKLA 4LO7A 4AFBA 3ZXAC 1VBC2 2I2SA 2XL7A 1WBLA 3UKTA 3L9JT 2O0OA 4NPLA 3AL6A 1QOOA 4XUOA 2QQUA 5A7NA 1ZZCA 3A7QA 4MX3A 5KC5A 3BU0A 1CR7A 2WFF3 1JODA 4PBPA 3W59A 1QU0A 4LKSA 1OLRA 1IQDC 2XOMA 1SDWA 5A33B 3MIGA 4FOWA 3ROUA 3ZFFB 4BA6A 1W9FA 4A2UA 4XUNA 3NAPA 4Y33A 1MS9A 1NAEA 2HWC2 5C3PA 4MGQA 3C2UA 5DMYA 1R1A2 2HEWF 3WQBA 4LO6B 3OGGA 1YQCA 1W9WA 1WKYA 2RS33 3PUSA 1A78A 2EXIA 4LEJA 4AOCA 1WUVA 5LZ6A 3ZYRA 1ENQA 1W8FA 2XHNA 3VBFA 3HEIA 2PAKA 5FZAA 4I0BA 3WHUA 4AK3A 3JZVA 3WW2A 1RJ8A 3HNYM 4Z1VA 1LJ7A 5LA2A 5LA0A 1K5MA 1V6OA 3Q8FA 5GLWA 1UY0A 1VBB1 4GB33 3LA3A 3S57A 3SNMA 2AUYA 5I91A 4D0QA 3DGTA 4LT5A 4EQVA 1IKPA 1IS3A 1YNAA 4H3WA 2QVSB 4HKOA 4Q0VA 4D94A 3APBA 2H6BA 1NA1C 3W58A 1Z7S3 1WCUA 2XH6A 3JBG2 1NXMA 3B94A 3KF5A 3VBSC 2R0FA 4AQ2A 1ZZ7A 5E8AA 4DY3A 1XU1A 1UZWA 4Q26A 2DBIA 4LOTA 2YU2A 5F8PA 3JBG1 5IT6A 5I8TA 3AMNA 4GXLA 4NO4A 4DUXA 3H7JA 5LY1A 1UZYA 1RJ7A 1VRH2 4QT6A 1W90A 5FP3A 4F7ZA 4MLOA 1S0JA 1MPXA 3FLTA 4OZXA 1SG3A 1W28A 3NKGA 4FFIA 1MACA 4OI4A 3WNXA 2PA7A 5IK4A 1S0BA 4HSJA 4M01A 3BPSA 1AXYA 3PHMA 1WLCA 1KDMA 3AKPA 5A3WA 4QX7A 4GMP0 2IFWA 4GIQA 1C4RA 3J7NA 3NJVA 1H1IA 1HRI1 3T4VA 3DXTA 4KWLA 4YW1A 2D6LX 4P9YA 1UPIA 3T2OA 1RL3A 1S2EA 3POFA 3KQRA 3ACFA 1W6MA 5FZ0A 2XHKA 4O61A 3BGAA 2FHRA 1B35B 3K2OA 4F3JA 1H1MA 5FY1A 2BQPA 3DYMA 2D5FA 2PHFA 3SCHA 4LA2A 5FO7B 4JGYA 5AVPA 4CCOA 4DIQA 3MEPA 3POWA 4OHXA 5IK7A 3NV1A 2W0XA 2Q8CA 2WKKA 1ULOA 4PI0A 3POBA 3FUQA 4PIYA 1CZVA 2B4KA 4B1MA 2CWSA 1RUJ3 2D3PA 1LGCA 2WSUA 4E2SA 5K8SA 2AENA 1WMDA 2GN3A 3ZYGA 5C71A 3ZXFA 4WVWA 5IVEA 4AQSA 4CP1A 3HQRA 4LR4A 3M4FA 4QPIB 1E5HA 4M3CA 2VBPA 4WM7A 5FRAA 4AI0A 5BV6A 5J1XA 5FAXA 1IZ3A 1CAUA 3B02A 1DF0A 2D6OX 3DPRB 4HKWA 3WQ7A 2Y34A 2BEOA 3KHBA 1GMMA 2GMEA 4MZUA 2Z42A 1HRV2 2Z4FA 4LLFA 2E9QA 4W6XA 4Z2WA 5FOJB 4MGIE 1EYBA 1YC61 2A73B 2W68A 1LRHA 2YUEA 1UU5A 1XSRA 4YWAA 5LY2A 5FP4A 3VBHC 5DUWA 1F5JA 4XJZA 2XBO2 2VCCA 4HG6B 2AEZA 4LBLA 3T08A 1UIJA 4L9BA 4HVQA 2B7YA 4Y5Z0 1XE8A 4LIUA 2KXLA 3RI8A 5JI9A 1DIWA 2CGOA 4HT1T 2TNFA 4Q4W2 4Y4YA 5H9PA 2XBO1 4BQ5A 4YGBA 2PHLA 3UGFA 3WNLA 4PQQA 2VCMA 4P5YA 1OUXA 4JAAA 1L7LA 3M3CA 2C6SA 3LA2A 4UYBA 4I3PA 4XJAA 3MUY1 3X29B 4IV3B 4ZONA 1HJGA 4JGZB 3H1WA 3J8F1 2VBDA 3IMMA 3MIEA 3ZOIA 2PLV1 5FZLA 1V70A 2XKPA 3ZFEB 2C26A 1AR83 1BJQA 2VOKA 5C3SA 1FPN1 5C6CA 4AF9A 2ENRA 1PGL1 2VZ1A 5CZKA 3GDBA 1HN1A 3A4UA 3OEAA 4D69A 5BNPC 3NV3A 5KWRA 1DQ6A 3M7AA 3SH3A 2ZEZA 1UCXA 4PF5A 2BDRA 1A34A 3U10A 2Y6GA 2RMU3 3EYPA 1EP0A 2E7AA 1V6MA 4UWDA 4ZU4A 4AFCA 2Z79A 3MO4A 2ZA9A 2HEVF 2QZ3A 1UYYA 3VDAA 2VZTA 1UIKA 1COV1 4NMIA 5A7OA 2IXJA 2X5IB 3I2KA 4FT8A 1BHGA 4L0PA 4Q0PA 5FZCA 1O7FA 1SFPA 4QPGB 2DTYA 3EQEA 1OH3A 1GV9A 1JBCA 4Y1VA 4AAPA 2ET1A 2YHJA 2WZR2 4XF1A 1DZTA 2LALA 5IVFA 1RHI3 2LM3A 3ITQA 4ZHNA 3BU7A 5FMBA 5A33A 2VOVA 5LBBA 2YPJA 3ZFFA 3CO2A 3GHNA 4AFMA 4PLOA 4BQ3A 4YVWC 2WO2A 4JTNA 4PIZA 1JYWA 2RS13 5AVAA 4F83A 4OQ8A 1D4M3 1Q5OA 5EV7A 3IDBB 4XFBA 4YFZA 3JQXA 4RHV3 5I93A 2HH9A 5FP8A 1MVEA 4QHBA 2JDMA 3GBFA 3DCQA 4XBNA 5T3NA 5L73A 3MIFA 4BOWA 2WINB 5GLUA 5A6ZA 4LBMA 1DLCA 2B42B 3BN6A 3WG2A 3GF6A 4FPEA 2VUJA 4C8DA 2ZBJA 4Z82A 4LE3A 2IXKA 3N9QA 4OHVA 4TWTA 2ORXA 2QDRA 5JZGC 5EJ3A 1Q56A 4Z07A 3ZSMA 1RUG2 5J3UA 2E51A 1UMIA 1LEDA 4HFSA 2ZX2A 4JKLA 2QKDA 4FQ4A 3AXEA 1SQ4A 2TUNA 4NIIA 1TME2 4ASLA 1MZEA 2XXZA 2LS6A 1N1SA 3T1LA 2AR6A 2XLAA 4FI9A 3SEPA 1BMV2 2WR9A 1WBFA 1V6IA 3LDKA 3TN93 4LBQB 1GNHA 4ONUA 3ZYIB 3MW3A 1QHDA 1TME1 3ACLA 4K1YA 5GZEA 3FZ3A 5I0TA 1UO9A 4CDWC 1KJRA 1UYXA 4Q4Y3 2ZGQA 5FYBA 4YSFA 4N53C 5FLHA 1NCQB 4YPJA 3ATGA 3VHNA 4ES9A 3CHXA 3THCA 4CEWC 5JUVA 3ZMNA 2W9XA 1ACCA 2W52A 3UL2A 1PIV2 2VZUA 3E1F1 1MEC1 1NE4A 4P9LA 3M3IA 2B8MA 4S2HA 4LKEA 1QGLA 5EWSA 1WA4A 2VOWA 4UBGA 2Q4SA 4J25A 4QU1A 2ERFA 4KNCA 1WZXA 1PIV1 4DMIA 4SLIA 4XIOA 2XB6C 4G4FA 3CDZB 3D3AA 4WM8C 1FYUA 5J96B 3MICA 3CU7A 3GXUA 3T2TA 4D7SA 3RI9A 2FDGA 4RQPB 1UOBA 2EIBA 2C9KA 2YDEA 3JD72 3N7KA 2RM23 3MPBA 4YM2A 3TEWA 3VDBA 4QM8A 4CXWA 1HV1A 1B35A 2WNVC 3H8RA 3OTFA 3ILRA 2VL4A 3JD71 4HPKB 3Q8EA 4L8QA 5F5QA 1UKRA 2BNMA 2W46A 5JIUA 3UNPA 4LE4A 1UMHA 4LKDA 1JZ3A 3AZXA 1AL21 1FI2A 1PZ8A 2DVFA 2D6PA 2D6NA 4EWEA 4RS5B 5C7GA 2IXHA 3T2QA 2WO3A 1XNTA 4M3CE 5FPZA 3LZZA 4FVVA 4ZY9A 5BY5A 3AZZA 1QEXA 4PCRA 4BK4A 2EXKA 3IDAA 3WUCA 2XKOA 4IGPA 3RFRA 1Z7S2 2RG4A 1QH7A 3UT0A 4QPIA 3ZSEA 3VN4A 5L9VA 1AF9A 1S55A 1OOPC 1H6XA 3DPRA 1EY2A 3AMHA 3HNMA 3MZHA 3KLSA 4BQYA 5I0SA 2HWE1 4MG2A 3ZKYA 4AI3A 2DF7A 2QQOA 2GNDA 3THPA 2UURA 3CLPA 2HWD3 2Q0AA 3GM8A 4JV4A 4NPMA 1W04A 5T5OA 3WR0A 4DO0A 5DAXA 1IS4A 1I1EA 3ACGA 3SCGA 4MHUA 1UYZA 4D7TA 4CU8A 2VMDA 3RSJA 3F95A 3ZR6A 2XL9A 1A8DA 1SHWB 1NKGA 4LHKA 4X8PA 4GA9A 1BXHA 2EIGA 2J1VA 4C0BA 3OCPA 2VXRA 5IVYA 1JMUB 3FJSA 4H2AA 1TNFA 1MVQA 1U5ZA 4KI5M 5DUXA 3VB9A 1HIXA 2P2KA 3FC0A 4A7YA 3VD4A 5KHIA 3J4UH 3WDWA 3K75B 4KH9A 2WZPP 3T0BA 3E6CC 1PMIA 2KR2A 3GJAA 1YI7A 3LEGA 4FCAA 4IV3A 4NHXA 1J3PA 3FE5A 4FPHA 3RVHA 4AE2A 3I3BA 2BTVC 4JGZA 3MHZA 1UAIA 2ZMLA 3LPGA 1QJFA 4LIVA 4N90A 4IW3A 1X50A 2LTNA 3ZFEA 2PAMA 4H7LA 1XNDA 1OD5A 3W9AA 4XJUA 3PUIA 4FPOB 1GBGA 1JZ8A 5EFUA 3OF1A 1GP6A 2WN3A 4UFLA 3NSTA 4Y24A 2OT7A 4KQ7A 3ACIA 3I49A 4AEDA 4HN1A 5AC93 4B7EA 4GH4C 1WMFA 3D0SA 2BGPA 5FY0A 4XACA 4CUCA 1RUJ2 1XNCA 3AYCA 4W4ZA 2X5IA 4EZHA 2GAUA 1EV11 4QPGA 3FL7A 1KD7A 1VPHA 2VZRA 4AG4A 4PDWC 3O1SA 1BZWA 1RUF3 2O1QA 1F2NA 1ND3C 1WW4A 3I2FA 3N7MA 4KL1A 1QJY3 2H0VA 4NRMA 4XJ9A 4IGOA 3POEA 2QJVA 5IJRA 3IKWA 2OZJA 3WP5A 1SLAA 3W21A 4IEUA 3MGUA 1K3IA 1PZ9A 1KDKA 3OBAA 2R7EB 1RTVA 3N35A 4HVRA 5FMCA 5FY4A 5IAXA 2DUPA 5FZ6A 4AHWA 3B3QE 1ZREA 2VZ3A 3U37A 2J22A 2CWMA 4AVCA 3OPZA 1HLCA 2J1UA 1N3OA 2QCSB 2AGSA 3J7HA 5C5UA 5EYYA 3CEWA 5FMOS 1XSQA 1RUC3 4M0HA 1LOFC 1AR73 1C5IA 1N47A 1F9KA 1UNBA 2BFUL 4G9SB 4LO5B 1SPPB 4COYA 4BQXA 2QQKA 4E4DX 3AP5A 1JYCA 2QZ2A 5FZ1A 2V4VA 5F5IA 1GICA 2D44A 3VKOA 1ASJ1 5J48A 2ARCA 4Z2AA 4YZ3A 3ZYBA 3O1TA 4R9DA 4IGQA 4OCTA 3THDA 2W3JA 4AHZA 4O9GA 4QU2A 2R073 3KF3A 3A0KA 5F5AA 1M06G 2R063 2VR4A 5H9QA 2VOXA 3DF0A 3USSA 1ND2A 4QQOA 4B4RA 2XVGA 4OMCA 3TWIA 3LWCA 4OHWA 2W47A 2WFPA 1FMD1 2YV8A 3O0VA 4JHTA 4OUMA 4BH9A 4Y20B 1H8TB 3WW1A 2Q1ZB 4LBQA 3WT3A 5DQ0A 5JSPA 2R16A 3PU8A 3K51A 4XCBA 3NJYA 5FZEA 3LB9A 1UW8A 1US2A 4W8JA 4A7KA 3I3MA 3WG4A 3QH7A 1UN1A 3KV5A 4OQ9A 2XJSA 1AX1A 1AR63 2W1SA 2VNVA 1W2TA 1OPOA 2VU9A 4Z92B 2QBXA 3ETQA 3O1PA 3U11A 2GMPA 3ZYFA 4XAAA 4WVZA 2CYFA 2VD7A 5FPUA 4FPJA 2BV4A 2G9ZA 4UF0B 4XVHA 2VZSA 3NV4A 2J1RA 3I54A 3HJRA 4YYOA 1KS5A 3RDIA 1RHI2 1QY4A 1OLQA 2XJTA 2ZAHA 4UFIA 3IAPA 4HOOA 2HBUA 3NAPB 4JKMA 4LO8A 1RINA 1MZFA 2PFWA 1D0GA 3MV11 5JWPA 4IE4A 1NLSA 1OA4A 1IPSA 2AC1A 1GYKA 1POQA 2DCTA 3LA7A 2J1TA 1D4M2 4XUPA 2CY6A 4P5HA 1UU6A 2ZGRA 3AKTA 3D5OA 4RHV2 3T30A 1MS5A 4LJHA 3VBFB 1W2OA 1CESA 2V09A 1YLLA 3V65A 1C8M2 2ZACA 3R4SA 3AX4A 1GNZA 4QDSA 2QNKA 1QNWA 3NNJA 1EUUA 4A6OA 1QH6A 1O4TA 2VUCA 4A7ZA 1VALA 4N43C 4TN7A 3T0AA 3NRUA 2WNUA 1ZRDA 3WDXA 1C8M1 2X09A 3CBNA 2YC2A 4QMAA 4YFWA 1HXS3 2RR13 4S2DA 5C9AC 1MS0A 2VTXJ 2B46X 1XNBA 1GR3A 4XZPA 4CDQC 3AJYA 1SBEA 3SISA 5C5TA 2ZS6B 1VBA1 4HMZA 3LEKA 2KM2A 3TN92 3MW2A 1W8WA 4FOVA 4XURA 3VD5A 2YGLA 1UQXA 4WVMA 2ZMNA 5IVCA 1YJKA 4ES8A 3KS7A 1FV2A 1LCLA 4K20A 3E6DA 2BOJA 5E89A 4LMFA 4Q4V3 1YIPA 4L92A 3ZYHA 1W0NA 3WF3A 1XYNA 2EXHA 1O3QA 2ARAA 2JDKA 2R1BA 4NRQA 3C7EA 5CKNA 1S0GA 3NV2A 3ME2A 1NA1B 1REEA 4QQHA 3CNAA 2ZZQA 5ERLA 5GLTA 2C24A 3VD3A 5JOXA 1I9RA 2VBBA 4QKBA 5KXCA 3P6BA 4AVBA 5DDJ1 4O65A 3WW4A 1JW6A 3WQ1A 1LU1A 1G8WA 4COVA 1JHNA 2AEYA 2RM22 3NJZA 4A45A 3CZUA 3RRDA 3B9IA 3LDRA 1A3KA 3IBMA 4JGYB 4C1WA 4CU7A 1UKGA 2DVDA 5CFCC 5HI0A 3LEIA 4N9HA 3HIFA 2JX9A 2DCJA 4FBFA 1GUIA 1RMU1 4OYUA 4Q1RA 4Q8LA 4QX0A 1QXJA 3MV01 5CFDC 1PMHX 2D40A 1N1TA 4GAZA 4CCMA 1AR93 4GWJA 5FUPA 4DUVA 1VJ2A 2P3IA 1XNAA 1NX9A 2QQWA 3AZWA 4WM7B 4IXLA 2HYXA 4AYUA 4NHMA 2ZGKA 3H0OA 2Y64A 1HB1A 1SFNA 1WMEA 4META 5BUVA 5FKCA 1KQRA 3SH4A 5I8YA 3KVBA 2P6HA 2QQPA 4QX1A 5FZGA 2AZ5A 3FFQA 1BYHA 4M00A 3UETA 2ZX4A 3ES4A 2QQIA 3B7MA 5T50A 3PTYA 1W6OB 1STMA 4RN5A 4AFDA 2W39A 3OUJA 3W20A 3I59B 3EMRA 1MS3A 3N9NA 4B4QA 4LNVA 2ES3A 1C5HA 4FXGB 4L11A 4LHNA 4Y5SA 2WT1A 3VBRC 1Y7BA 2UY8A 4IEQA 3MLKA 4BXSV 2YROA 3KSCA 4UI9L 3TOJA 2R041 3A23A 3ACHA 4AWDA 3RZZA 4QGMA 4LA3A 5GM0A 4K1ZA 1H2LA 4IETA 5FQ0B 3OPTA 4J6GA 2E53A 3ZFGC 4ZU7A 3BCWA 2G9FA 1W9YA 2E7TA 1W6PB 2WS93 3CZJA 1ZBA3 2ZAAA 3WINE 4C0HA 2PHUA 3V64A 3ZDVA 5FZKA 1AUYA 2XWBB 4LO4B 4FO9A 1H8TA 1MQTC 3OYWB 3U4SA 3VBHB 5CYYA 5ACA2 4E2GA 1QMJA 5BNOC 4YNIA 4FAGA 2BOIA 4J1XA 3MYXA 4IV1C 3IN9A 4K40A 3NWKA 5FPVA 2UWAA 4GKXA 1JZ2A 1L3JA 5ANQA 5ACA1 1R093 1VBE1 3VBUC 1CZTA 1ODMA 5AC92 4D7YA 3EXUA 1PO11 4QWNA 4Y4RA 1BQPA 2B45X 5B4XA 4XCAA 3MFAA 4TLFA 3O7OA 3HWJA 1VBC1 4NIAA 1RUF2 2GALA 1QOSA 1YQ8A 4UF0A 5JAXA 3WW3A 2FDIA 5DABA 1QJY2 2EIEA 3GYDA 1UX7A 5CBLA 2R0HA 3AVSA 4Q0SA 3RWNA 4AW7A 4GMP1 2W08A 4NWWA 4HN0A 1Y9MA 4ZZ8A 1APNA 1LKNA 5C8CC 4FOYA 2BBAA 2WABA 3LE0A 1BEV2 4HETA 5FLIA 4QB1A 5BNPB 1HB3A 3CJIC 3OUHA 2XJRA 5A6QA 3OGSA 2HWF3 4WVVA 2ZHNA 3KV6A 1WW6A 2HWC1 1Q43A 2WAAA 1BEV1 3AL5A 2ZEYA 1H4GA 1R1A1 5DAQA 3T1MA 4BIFA 1PVC2 1WCKA 1YQ6A 4FPGA 3MIBA 4CEYC 2VQ0A 4XAEA 3U0ZA 3LSEA 5FJHA 3OJBA 1ENRA 4FPYA 1PVC1 2JB8A 1GZWB 1VMHA 2WSVA 1OLMA 2EAKA 5FMDA 1WMXA 3AKSA 4CCDA 1ZRCA 4PT6A 5JXHA 2R072 4BDVB 2R062 2BERA 2FCUA 1TMF3 4QQPA 1JU4A 2D3RA 4YVWB 1LHNA 2HEYF 3QOPA 4XBQA 3VDDC 3ZXEA 3LDBA 3KWVA 2A7AA 2PN5A 4YZ4A 1JYTA 4OVEA 4P9XA 1OQDA 4N7UA 1XXNA 3GALA 1VIWB 2HWB2 3I2OA 2D43A 5DAVA 1I5ZA 1W0OA 4NIGA 1QJX3 1FNZA 1FOD3 3I2GA 3UKNA 2XG3A 5HV4A 1Y9QA 2WT2A 3FUOA 2A6ZA 4YW4A 5F5CA 4XF4A 1RUH3 1YWKA 1VRH1 3T2PA 3ZVXA 2HWB1 3BODA 1SLIA 4CDXC 2O8OA 2J1EA 2EIDA 2GH2A 5FUNA 1H6YA 2P4EA 1YO8A 1K12A 2W1QA 1HJFA 2X10A 1Q8QA 1NA1A 2YYOA 2ZGMA 4M4PA 3VBSA 3WNOA 5FZMA 4CDUC 1W9SA 3RS6A 3LD8A 2BYVE 1P8JA 2PHWA 4BQ1A 2WQ8A 4XFAA 2P34A 2C1FA 3PUHA 2A5ZA 4QX5A 4I2OA 1R083 4FPCA 1VAMA 3LSDA 4BM8A 4AEKA 3IIAA 2ZGTA 1U5IA 5DZGA 4CDWB 1LNSA 1JI6A 1J3RA 2PYTA 4N53B 4PIXA 2RDQA 1H4HA 4TLGA 2RHPA 2VZOA 3N7LA 2A1XA 1BVVA 1GZCA 4AI1A 4CEWB 5LW9A 2Q8OA 1JOBA 3WP6A 1IG3A 2E26A 1CAWA 1LEMA 4MGKE 1FT9A 1PK6C 3M2MA 4TTGA 2FDFA 3H1MA 1O8PA 2VOTA 2YC0A 3OEBA 3PJQA 4GJYA 4AEJA 2ZGSA 3J7MA 2DVBA 1IHMA 4CP9A 3OD4A 2P3JA 3I8TA 4JHZA 1H2KA 1K42A 2RE9A 2IUWA 4R4ZA 2VW2A 1DCSA 1RVF2 1JZ6A 4DY5A 5KXEA 4CXXA 2BVBA 1UPSA 5KXBA 3WD5A 1V00A 2ILMA 4GWMA 4LQRA 1ZNPA 3P1IA 5FP9A 5F3EA 1RVF1 3V56A 4BLJA 1SLLA 1A8MA 2WNVB 3G6JB 4NHLA 5T5LA 4Y22B 3ST7A 2FZ1A 1XYPA 2IXCA 3BIWE 3U75A 1OFNA 1X7NA 2VXJA 4AI8A 4MO3M 4D3WA 5AFEA 4YZ2A 4GD4A 4QXBA 1OA3A 3C7GA 3PLQA 4QDRA 1W6OA 1V9U3 4XJ8A 2C5DA 1HRV1 2HJIA 2GU9A 3AMMA 5DG1A 1F8VA 5FZFA 5LA9A 2DTWA 2JDYA 3FX3A 1VB2A 2VUDA 4MV2A 5DN2A 5T5PA 2J42A 3UJOA 3WG1A 2WUHA 5F2WA 5H9RA 5A3NA 3AYDA 5APAA 5B2GB 2J7MA 5JXGA 4BMEA 1ULPA 2E7QA 5FZ9A 4MGSA 5FZBA 4D8MA 2CU5A 4AI2A 4FTEA 1AHSA 1Y43B 1NQDA 4W6YA 5SV5A 4E4HA 4Q4W1 4AGVA 5FQ0A 4HANA 3Q9OA 1OOPB 1LOEA 2XWJB 5I0DA 4DXSA 1Y3TA 3B00A 5FPBA 1W6PA 2D97A 1RUD3 2GC3A 3POSA 2YC4A 5DXDA 5FYZA 5E6HA 3HOBA 1B09A 3MDPA 4NAMA 3OYWA 2PMWB 3MFCA 4DEQA 3ENRA 3VBHA 4IE7A 4X6RB 1CX1A 3J26N 1O91A 1G6NA 4UXAA 2OYZA 1NY72 4RGKA 2XJVA 3RWKX 3VKMA 3WEZA 2I45A 2IVJA 4H7MA 4XDPA 4IQPA 4AEDB 4DRVA 4U36A 2VJXA 1VMFA 2NQYA 2WC2A 4XFGA 1CAVB 1GQPA 2ARXA 3FFZA 5FXVA 2OA2A 4P14A 1NY71 1AL0G 1ZZ8A 3AP4A 1BK1A 2V4AA 4OUEA 4Q4X3 1X82A 1F4HA 2RS53 2W2IA 4QGNA 1AR92 1EAH3 1GWLA 1LGBA 2ZHMA 2ZKNA 3HQUA 3TBDA 2XUMA 3IMNA 5CB7A 1RUI3 2ZHLA 2JICA 2Q1FA 4RFT0 2Y60A 4AAXA 3BTXA 2WA3A 2WLPA 1IQAA 2TBVA 2WZR1 1ZVFA 1CZSA 3HN1A 3ZKUA 2Q1MA 1NUKA 1UY4A 2DURA 2JG9B 3TEXA 5BNPA 1SCSA 3C7HA 2VMHA 1PHMA 3IAQA 4V2VA 3WX5A 3VBOC 4AVAA 1RUE3 3C7OA 1E5RA 4KGGA 1JHJA 1GQHA 1SLBA 4IEPA 2OUJA 4YM1A 3GBWA 4M0NA 3ZSKA 2E33A 3PUAA 1VBD2 4AQ6A 2OW4A 4CRQA 3LFIA 5C8WA 2GP3A 1Q8SA 4AZZA 5A1LA 2X53S 4GULA 5CA6A 3SKVA 2C4XA 4WV8A 1ND3B 2A6WA 3FMGA 3ZSJA 4CPBD 2Y6HA 3E5XA 1GZWA 1BBT2 1VBD1 3D82A 4MXVA 4V1PA 2W5FA 4D6QA 5L19A 4AL9A 1F4AA 1AZDA 4Z8BA 4GJZA 4W6WA 1OFSA 4NPRA 1LOCA 2MEV3 4EN6B 1ND2B 1RUG1 2YG0A 1BBT1 1PVXA 4YRDA 4YVWA 2GC1A 4B3NA 1OD3A 1ZA7A 2D98A 1HQWA 1ZBA2 2WS92 4XETA 3WP3A 4BU2A 4DXTA 1LHWA 1EPZA 5FYTA 4ZZ5A 5JPNB 5C3OA 2VUAA 4P9JA 2OIIA 5K9YA 3WNNA 1ZM1A 1CONA 3O1VA 1BMV1 4KBZA 5A32A 5JSRA 2CSGA 3DUIA 4JTOA 2IC1A 4RA0A 3AYAA 3WHTA 3BIEA 2VW1A 2Q8EA 1N3PA 2D7FA 1PO22 1AYN3 1SBFA 5IVBA 1R092 3I3EA 4Y1UA 4PI2A 4ZS3A 5FY8A 3N9MA 4EJRA 4C90A 1NLQA 3I59A 1POV3 1PO21 1SDDB 4K21A 1PX4A 1JYNA 1WLTA 3N7JA 4Q29A 5DAPA 2WFF2 1L7QA 2JDAA 4HZFA 4FP2A 1VAVA 3JB8A 1F35A 2GC0A 1KEXA 2YPDA 3TB0A 1ZZ6A 1HQNA 2JE9A 1J83A 3MF6A 1OA2A 2OVUA 1E57A 4CDWA 4XHXA 3PTRB 4N53A 1UD1A 2OQ6A 2RJ2A 4CA9A 4FP3A 1OURA 3E97A 1DYPA 4CCCA 4CEWA 5L7OC 2RS32 3WV6A 2C0ZA 4XTMA 3RYPA 4YGDA 1HDKA 1ZRIA 5HCFA 4GZ9A 3AKQA 4MXWA 3R4UA 5LEKA 3M8LA 1QDCA 3MBWA 2A6XA 2RS31 3CMGA 1X8MA 4XMIA 4YW3A 5FYCA 1QQP3 1XC6A 4GB32 3USUB 4UW5A 5CKMA 2WNUB 3ZIWA 5EYXA 2DCKA 2HLEA 3NNMA 4WM8A 5EHDA 1X36A 4KWJA 3SXWA 2FCTA 3OUIA 3H8XA 4GB31 3JB4C 3WCRA 4BQ2A 1SFYA 1TMF2 2JKBA 2H0BA 2GH8A 2WNVA 4DINB 1Z7S1 1DG6A 4Y22A 2FDKA 1K45A 4B4PA 4WVMB 3EB7A 2WO1A 5FPAA 4P9IA 1ZZBA 3OGRA 4Q8KA 1OHFA 1HN0A 1US3A 2BWAA 5FZHA 5JXIA 1DQ1A 3WXPA 5F32A 1RUOA 3ZYPA 3ZXLA 1DGLA 1CIYA 4OI0A 1MR5A 4MYEA 1S0IA 1ZX5A 2A6VA 2OQ7A 2IZWA 1J59A 1VB4A 1OF4A 1RUH2 2VG9A 4XTPA 5FZOB 2CV6A 1Q8PA 2VZQA 5KHHA 1H30A 2JG8C 1QKQA 3VKFC 4E4SA 5IWFA 3S5AA 3WOGA 5FY9A 1DYKA 4LHSA 4FXKB 4UW4A 5G04L 5LBFA 3WP4A 1ZA4A 5JMOA 2C9AA 2EXJA 4AVSA 1JTZX 1REFA 2G1MA 5C9AB 5CADA 2HYKA 2ET7A 4KMQA 4JC1A 1AVBA 5EIYB 2ZHKA 1CD3G 3LCPA 1Q8OA 1OOPA 4X8NA 1SZBA 1S2KA 1R082 3IB3A 4NWVA 1U5XA 2JD4A 1NYWA 3QLQA 1AYM3 5JMCA 3MUZ1 1XJAA 4IESA 1LULA 2Y33A 2JDHA 4KU7A 4ZKTB 2Y0OA 2XUEA 1DP0A 2CNAA 1K5JA 2HKXA 1ZBE3 5LATA 3FLPA 2X5IC 4COUA 3VV1A 1SCRA 1HQLA 1ODNA 1QJU3 3NQHA 4QPGC 3VZJA 4FQZA 1H9WA 2L9LA 3DEMA 4K9SA 4XF9A 3U07A 3UYJA 4BXFA 1S1AA 5I0UA 3NNFA 1CAVA 1UY3A 3RNSA 4OHYA 1G9AA 4MGYE 5KHKA 2Z5WA 3WNKA 5IFPA 3FHAA 4UW6A 5C4WC 1UOGA 1YYNA 4XQDA 3I3QA 1GANA 2YZ4A 4XUQA 1RUJ1 1DQ5A 3UJQA 2FMYA 3FBYA 3WF2A 3ABZA 4SBVA 3K4DA 4K7JA 5ABJB 2E63A 4WZCA 3AP6A 5JCTA 1LOAA 3POIA 2PXJA 4PLNA 4RR3C 1GQGA 2WAOA 1S4CA 4BYYA 1KJLA 2JG9A 4LITA 3BKZA 5FMOL 2A3XA 5JOWA 5CFCB 2VO5A 4R9CA 1NXD1 2R30A 5IK5A 4L2NA 2P5BA 3H9AA 1XPWA 1YUDA 5ANNA 1V9U2 4UBHA 3SQOA 1NCRC 1C8NA 1F31A 4GH4A 3OGVA 4KBBA 2VQTA 3KT4A 2BNOA 3NL1A 3NNLA 1XU2A 4QHOA 3RYKA 3UGHA 1DFQA 1MS8A 3HBZA 5FY7A 4LKFA 1DGRA 3PVNA 1YXWA 1ZYBA 1ND3A 2HWC3 1BLZA 2Y6KA 3MIHA 3GGLA 1XRUA 5J09A 2B9VA 2DYCA 5HCBA 5K0UC 1R1A3 1YI9A 3AP9A 4AVVA 1PGW2 2UU8A 2DVAA 2UYBA 2VH9A 4BLIA 2ZXQA 5FPXA 4DNYA 2AACA 4E9KA 5FREA 1W6QB 2V72A 1VBB3 2W91A 3K4ZA 3MLJA 5BXXA 3I2DA 2PHDA 3NMBA 2R32A 1O5UA 3OD0A 3S0MA 1NCQC 1REDA 4KWKA 3O1MA 1AR82 2ZGNA 1JYXA 1GZTA 1WCQA 2GNTA 3J9SA 4XF3A 4PBOA 4BMBA 2WO7A 4FSJA 4QQ2A 4Q27A 3KD4A 1LOFA 3AZYA 4EWAA 3E6BA 4QXKA 1AR81 2RMU2 3JBG3 3WUDA 4ASKA 5FYUA 4A3XA 3RJRA 1VR3A 3K3NA 4HVOA 2A6YA 4LK6A 1OQ1A 4ZS2A 4Y5TA 1ULFA 1GLHA 2RMU1 3EJKA 1UX6A 3FN9A 3KVAA 4CCEA 4Q4X2 2QQVA 2RS52 4YVSC 1LHVA 1EAH2 4RQPC 5KBFA 3HVDA 3KCYA 3PUQA 2PHXA 1ALYA 3M1HA 4XJWA 5CU1A 2CDOA 1RUI2 3LOIA 5FYHA 3AJZA 1GSLA 2YBPA 3ILFA 4QDQA 1DQ2A 1QXRA 1TE1B 2BNNA 2I07B 4BWOA 5DPNA 1HV0A 4NJ4A 1N1VA 2VMFA 4ATFA 2CAUA 4Q1PA 1RHI1 1HRI3 2RS12 5D8AC 2PELA 4S2GA 3ZXKA 4IV1B 1G9CA 4RS5C 2RDRA 3GCXA 2AYHA 3OBZA 2XGXA 4UFKA 3VL9A 1D4M1 4RHV1 4CCLA 4OULA 1CWPA 3N9PA 5FPLA 2VCBA 1C1LA 3USUA 1GFF2 4LUKA 4IE6A 3DV8A 5BNNC 3SEEA 4ISQA 1H8VA 1UZ0A 2WZ8A 1RGSA 1AJKA 3PNAA 4LOSA 2VVDA 4XMAA 1QF3A 2Z2SB 1CAXB 4EROA 3W5MA 2VY0A 2MEV2 1WLWA 1YCIA 3K77A 4NHYA 1A6CA 1N3QA 2GSYA 2QQJA 4LBKA 1YFXA 4NROA 4Q5OA 2EF6A 3FLRA 4YG3A 3ZN6A 2IXLA 3P3PA 4P00B 3UV9A 3ZO0B 1RXGA 3KM5A 4ARYA 3VLBB 4MGZE 4D6RA 2YBSA 4TXWA 3BPZA 5IFTA 1NQJA 3K3OA 4Q4Y2 5BPXA 4FFFA 3H50A 2GNBA 2Q30A 2VC9A 4A42A 5LRRA 1QJZA 1UU4A 4KG8A 4NUBA 5DAWA 3TN91 4CEYB 5BYNA 2Z69A 4LXLA 4A4AA 5FZOA 2QQMA 4AVTA 4QX3A 4Q4Y1 2XLFA 1AYN2 2UWBA 3NVCA 2E31A 4N43A 4WZFA 5DUVA 5J36A 3LQCA 4IDZA 3VBSB 1VP6A 4R9AA 3DL3A 5C9AA 4XZUG 4J1WA 3HPNA 1F5FA 2VQUA 1LHUA 4LULA 3KV9A 4O7XA 2ZPXA 4CDQA 5FUIA 3VDDB 4XPVA 1W8UA 2QE3A 4CUGA 3K46A 2YB7A 2BWCA 2JENA 2ZX0A 4RGAA 2XBO3 1LODA 2A70A 4HBNA 4WBBA 3RZGA 1IS6A 2WQ4A 4BE3A 5LWBA 1MZ5A 2P17A 4BB3A 4KWUA 1RUNA 2B39A 2RM21 1CAWB 1T2XA 2GC2A 3IDEA 3J8F3 3QCWA 4CCJA 1ULCA 3AVRA 3K4AA 5JI7A 3WG3A 2PLV3 1H2MA 5GKAC 3QD6A 2FZ2A 2BJSA 1FPN3 1GWKA 4YLZA 2ADEA 4CP9B 3TEZA 4CDUB 4W50A 3KB5A 4ZU5A 4QKFA 3HBKA 5J7MA 4HONA 4YGCA 4XQ4A 5FZDA 1RIRA 3BI3A 4XYXA 1JZ7A 2BUKA 2WN2A 1KITA 3PDQA 3UGGA 2JD9A 3AXDA 1T6GC 4R52A 4UFMA 1COV3 1WWYA 5FWEA 1OVPA 5ABJA 2K0GA 1CQ9A 2W1UA 1AX0A 1UF2C 4ISRA 3DN7A 4JVAA 3D8CA 1KXGA 1WW7A 2D93A 4C91A 1OKOA 2DV9A 4KGQA 5CFCA 1UOFA 5FZ3A 2NPIA 4B1LA 4PHZA 2HWD2 3U14A 2K9ZA 2MNGA 3ORJA 3SKJE 1W2AX 1W99A 2XQRA 2ZGOA 2YBKA 2YXSA 3R6SA 5CFDA 4KG0A 2HWD1 1LOGA 3BOPA 5HCHA 2DVGA 4I0AA 4YGEA 5I8SA 1OC1A 3WLUA 5LASA 2D6KA 2JB4A 3H3LA 1POV0 4A3ZA 1L7RA 5CG9A 5A7WB 3HD8B 1ENXA 5LCWL 3NO8A 4XFIA 4PLMA 3ZXJA 5F7UA 3KHCA 5L36A 4XFHA 3WVJA 1DQ0A 2XDVA 5A3TA 2CHHA 5JPMB 1W6QA 3B9CA 4IEOA 2V73A 4DZGA 1S2BA 2JDPA 3R05A 1QJEA 1CJDA 3VD7A 1OPMA 2XJQA 2QQLA 1AYM2 1DU3D 4ZPIA 1WLDA 3VHRA 1VLNA 4NIHA 1JZ5A 5LB6A 3KQ4B 2UY9A 3OG2A 4INDA 4EN8B 4FOQA 1PZ7A 2XONA 3TNQA 3VBRA 3VKLA 2ZABA 3NJXA 2D6MA 3CJXA 2IVIB 1T6BX 1TME3 3M3QA 2OPKA 2F17A 1H0BA 4D6SA 4AEMA 1IGOA 4QX2A 4CYDA 1D7PM 1EPWA 3MPPG 5JOYA 3ZFGA 5AC91 2N7GA 3NAPC 3SH5A 1FATA 1LR5A 2ZKLA 1MEC3 1XE7A 4CXYA 4QQLA 1ULEA 4AHXA 1IOAA 1RUF1 3I97A 4Q2FA 5FY5A 1SEFA 1MQTA 3WDVA 4LUMA 5A3PA 2WA4A 1QJY1 4JKKA 1PIV3 4CUBA 1OMIA 2WWUA 4CUAA 2R1DA 3ZDSA 5BNOA 2GN7A 3A22A 4FAHA 4PF1A 3MI8A
chains in the Genus database with same CATH topology
3WEZA 4CU8A 2VMDA 1SHWB 1NKGA 2VJXA 3DECA 2J1VA 1GQPA 2W94A 4OZOA 4KI5M 1O59A 1KGYA 3VD4A 4OUEA 4LPLA 1F4HA 3CKHA 3K75B 3T0BA 3LEGA 3WNPA 3I3BA 4AAXA 1EUTA 3LPGA 2X05A 3WF0A 1CZSA 3T09A 1NUKA 1RYYA 1UY4A 3C7FA 2JE8A 3C7HA 3PUIA 1JZ8A 3IAQA 2WN3A 1UY2A 3C7OA 3CIHA 1JHJA 2ZEXA 3ACIA 3F2ZA 4JX0A 5C70A 5A1AA 2BGPA 2E33A 4CUCA 4W4ZA 3SKVA 4CU9A 2C4XA 3FL7A 2VZRA 4AG4A 2Y6HA 2WYSA 3I2FA 4E8DA 2W5FA 5IJRA 3FHQA 4A44A 1F4AA 1K3IA 3OBAA 5JR2A 2R7EB 4P02B 2YG0A 1JU3A 1GOHA 1OD3A 4DXTA 4ZZ5A 5HPOA 4OMDA 2VZ3A 1GOGA 3U37A 2J22A 3WNMA 3I2HA 2J1UA 3WNNA 2Y8KA 3J7HA 1UXXX 4DUWA 2QQKA 4QAWA 2EICA 2VCAA 2V4VA 4ARXA 3I3EA 4Z2AA 2QQNA 3THDA 2W3JA 1SDDB 3AC0A 1PX4A 3WSOA 1JYNA 2VR4A 2VZVA 1L7QA 2JDAA 1W9TA 2BZDA 1OF3A 4OMCA 2W47A 2VMEA 1KEXA 2VZPA 1J83A 1OH4A 5DQ0A 1UY1A 2J1AA 2RJ2A 1US2A 4W8JA 4ET7A 4UAPA 3HN3A 2W1SA 4GZ9A 1O8SA 2QBXA 3HNBM 3MBWA 5B4NA 3CMGA 4IUGA 4DEVA 1XC6A 3VDCA 2DCKA 4XVHA 2HLEA 2VZSA 2J1RA 3VD9A 3HJRA 4QB2A 3IAPA 4JKMA 3MV11 4QPWA 1J84A 3I2IA 5JXJA 2J1TA 4E8CA 4XUPA 1K45A 2BGOA 2WO1A 2J1SA 3EB7A 3OGRA 1US3A 5JXIA 1CIYA 3I2JA 4QB6A 3DYOA 4A41A 1OF4A 4QDSA 2Y6LA 2OKXA 1EUUA 4XUOA 4A6OA 2VZQA 3A7QA 3T0AA 5JMOA 3NRUA 1W8OA 4LHSA 5G04L 2X09A 2YC2A 4GWIA 4LKSA 1IQDC 2XOMA 4KMQA 4XUNA 5EIYB 1NAEA 4MGQA 3LEKA 5DMYA 3IB3A 3WQBA 4XURA 1W9WA 1WKYA 3VD5A 2WBKA 3MUZ1 2XHNA 3HEIA 1JZ4A 1DP0A 2VM9A 3HNYM 5LA0A 5LA2A 1W0NA 3OB8A 1UY0A 3WF3A 3A21A 3NQHA 2PQSA 5HXMA 3LPFA 4D0QA 1GOFA 2L9LA 3C7EA 4CVUA 1UY3A 3WNKA 3VD3A 5IFPA 1YQ2A 3FHAA 4XUQA 3P6BA 3WF2A 3ABZA 3K4DA 4DUXA 2WAOA 4A45A 3CZUA 1MPXA 1SG3A 2VO5A 4CU7A 3LEIA 1XPWA 3WF1A 1W8NA 1UWWA 3OGVA 2DCJA 2VQTA 1GUIA 4OYUA 4QX0A 3MV01 1PMHX 3NJVA 2RVAA 4GWJA 4UOJA 4DUVA 2Y6KA 1XNAA 3GGLA 3UESA 1NX9A 3T2OA 2B9VA 3NNGA 2HYXA 3ACFA 2W92A 1TG7A 2Y64A 2ZXQA 3DYPA 3BGAA 2V72A 2W91A 3DYMA 3K4ZA 1UXZA 4QX1A 3UETA 1GU3A 2QQIA 1JYXA 1WCQA 4RN5A 2VMCA 5IHRA 1ULOA 2LW8A 2E32A 1CZVA 2B4KA 4BXSV 4UI9L 5C71A 3A23A 3ACHA 4BJ0A 5IYYA 3FN9A 5J1XA 4RYDA 2CDOA 2Y6JA 3CZJA 1GMMA 4QDQA 2Z4FA 3T0DA 2WDBA 5DPNA 2YFUA 2ORZA 5CYYA 2VMFA 1PMJX 2VCCA 4HG6B 3T08A 2JKXA 1JZ2A 1CZTA 4BK5A 3WNLA 4PQQA 4P5YA 5B4XA 3C8XA 2VCBA 3MUY1 3SEEA 2EIEA 1UZ0A 2WZ8A 3WF4A 1UX7A 4ZZ8A 3W5MA 2C26A 2BBAA 2WABA 3K77A 2QQJA 3LE0A 2VZ1A 4QB1A 5CZKA 3GDBA 1HN1A 3OEAA 3OGSA 4P00B 3W5NA 2ZEZA 4ARYA 2Y6GA 4TXWA 2WAAA 3EYPA 5IFTA 2ZEYA 3MO4A 3ECQA 3ETPA 1UYYA 3VDAA 2VC9A 2VZTA 4A42A 2W87A 3I2KA 1BHGA 4L0PA 4A4AA 2QQMA 4QX3A 2E31A 5EJZB 2RV9A 3LQCA 4PT6A 4XZUG 5JXHA 3HPNA 4BDVB 2VQUA 2BERA 5FUIA 1JU4A 3ZM8A 3K46A 2WO2A 2YB7A 1JYWA 2KD7A 1I5PA 3I3DA 3I2GA 4KWUA 4CU6A 4XUTA 1DLCA 3BN6A 3T2PA 1T2XA 3K4AA 2ORXA 2J1EA 2EIDA 1H6YA 1K12A 2CDPA 2W1QA 2X10A 4M4PA 4W50A 3WNOA 1UMIA 1W9SA 1JYVA 2W1WA 4JKLA 1P8JA 2WQ8A 2ZEWA 3PUHA 2LS6A 4MADA 1JZ7A 2WN2A 4FI9A 3SEPA 4DXRA 2JD9A 2W1UA 1LNSA 1JI6A 1UYXA 2VZOA 4YPJA 3THCA 5JUVA 2W9XA 2E26A 2VZUA 3E1F1 4TTGA 3OEBA 1O8PA 2VOTA 3SKJE 1W99A 5G05L 2XQXA 4JHZA 1K42A 3CDZB 3D3AA 1JZ6A 4A3ZA 1L7RA 2ID4A 3GXUA 4P08A 5LCWL 5F7UA 4LQRA 2EIBA 3P1IA 2C9KA 1GNYA 3VDBA 1R64A 1OT5A 5EJ1B 2VL4A 4MO3M 3VD7A 2QQLA 1TVGA 2W46A 3C7GA 4QDRA 3UNPA 1UMHA 1JZ3A 4MOAA 1JZ5A 5C7GA 3OG2A 3T2QA 2WO3A 1XNTA 3IIIA 5DN2A 2XONA 5LA1A 3NJXA 4ZY9A 2WUHA 4BK4A 3IDAA 2J7MA 5JXGA 1ULPA 2VTFA 4MGSA 2WZEA 4D8MA 4QX2A 1D7PM 2YFZA 2V5DA 3JXSA 5I0DA 1DYOA 1H6XA 4DXSA 3HNMA 2W95A 4ZXEA 2YC4A 3HOBA 3I97A 1PX3A 2QQOA 4JKKA 3CQOA 2DDUA 3GM8A 4CUBA 4DEQA 4CUAA 4M4RA 1CX1A 3A22A 3ACGA 4PF1A 1UYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WEZ A;  4CU8 A;  2VMD A;  1SHW B;  1NKG A;  2VJX A;  3DEC A;  2J1V A;  1GQP A;  2W94 A;  4OZO A;  4KI5 M;  1O59 A;  1KGY A;  3VD4 A;  4OUE A;  4LPL A;  1F4H A;  3CKH A;  3K75 B;  3T0B A;  3LEG A;  3WNP A;  3I3B A;  4AAX A;  1EUT A;  3LPG A;  2X05 A;  3WF0 A;  1CZS A;  3T09 A;  1NUK A;  1RYY A;  1UY4 A;  3C7F A;  2JE8 A;  3C7H A;  3PUI A;  1JZ8 A;  3IAQ A;  2WN3 A;  1UY2 A;  3C7O A;  3CIH A;  1JHJ A;  2ZEX A;  3ACI A;  3F2Z A;  4JX0 A;  5C70 A;  5A1A A;  2BGP A;  2E33 A;  4CUC A;  4W4Z A;  3SKV A;  4CU9 A;  2C4X A;  3FL7 A;  2VZR A;  4AG4 A;  2Y6H A;  2WYS A;  3I2F A;  4E8D A;  2W5F A;  5IJR A;  3FHQ A;  4A44 A;  1F4A A;  1K3I A;  3OBA A;  5JR2 A;  2R7E B;  4P02 B;  2YG0 A;  1JU3 A;  1GOH A;  1OD3 A;  4DXT A;  4ZZ5 A;  5HPO A;  4OMD A;  2VZ3 A;  1GOG A;  3U37 A;  2J22 A;  3WNM A;  3I2H A;  2J1U A;  3WNN A;  2Y8K A;  3J7H A;  1UXX X;  4DUW A;  2QQK A;  4QAW A;  2EIC A;  2VCA A;  2V4V A;  4ARX A;  3I3E A;  4Z2A A;  2QQN A;  3THD A;  2W3J A;  1SDD B;  3AC0 A;  1PX4 A;  3WSO A;  1JYN A;  2VR4 A;  2VZV A;  1L7Q A;  2JDA A;  1W9T A;  2BZD A;  1OF3 A;  4OMC A;  2W47 A;  2VME A;  1KEX A;  2VZP A;  1J83 A;  1OH4 A;  5DQ0 A;  1UY1 A;  2J1A A;  2RJ2 A;  1US2 A;  4W8J A;  4ET7 A;  4UAP A;  3HN3 A;  2W1S A;  4GZ9 A;  1O8S A;  2QBX A;  3HNB M;  3MBW A;  5B4N A;  3CMG A;  4IUG A;  4DEV A;  1XC6 A;  3VDC A;  2DCK A;  4XVH A;  2HLE A;  2VZS A;  2J1R A;  3VD9 A;  3HJR A;  4QB2 A;  3IAP A;  4JKM A;  3MV1 1;  4QPW A;  1J84 A;  3I2I A;  5JXJ A;  2J1T A;  4E8C A;  4XUP A;  1K45 A;  2BGO A;  2WO1 A;  2J1S A;  3EB7 A;  3OGR A;  1US3 A;  5JXI A;  1CIY A;  3I2J A;  4QB6 A;  3DYO A;  4A41 A;  1OF4 A;  4QDS A;  2Y6L A;  2OKX A;  1EUU A;  4XUO A;  4A6O A;  2VZQ A;  3A7Q A;  3T0A A;  5JMO A;  3NRU A;  1W8O A;  4LHS A;  5G04 L;  2X09 A;  2YC2 A;  4GWI A;  4LKS A;  1IQD C;  2XOM A;  4KMQ A;  4XUN A;  5EIY B;  1NAE A;  4MGQ A;  3LEK A;  5DMY A;  3IB3 A;  3WQB A;  4XUR A;  1W9W A;  1WKY A;  3VD5 A;  2WBK A;  3MUZ 1;  2XHN A;  3HEI A;  1JZ4 A;  1DP0 A;  2VM9 A;  3HNY M;  5LA0 A;  5LA2 A;  1W0N A;  3OB8 A;  1UY0 A;  3WF3 A;  3A21 A;  3NQH A;  2PQS A;  5HXM A;  3LPF A;  4D0Q A;  1GOF A;  2L9L A;  3C7E A;  4CVU A;  1UY3 A;  3WNK A;  3VD3 A;  5IFP A;  1YQ2 A;  3FHA A;  4XUQ A;  3P6B A;  3WF2 A;  3ABZ A;  3K4D A;  4DUX A;  2WAO A;  4A45 A;  3CZU A;  1MPX A;  1SG3 A;  2VO5 A;  4CU7 A;  3LEI A;  1XPW A;  3WF1 A;  1W8N A;  1UWW A;  3OGV A;  2DCJ A;  2VQT A;  1GUI A;  4OYU A;  4QX0 A;  3MV0 1;  1PMH X;  3NJV A;  2RVA A;  4GWJ A;  4UOJ A;  4DUV A;  2Y6K A;  1XNA A;  3GGL A;  3UES A;  1NX9 A;  3T2O A;  2B9V A;  3NNG A;  2HYX A;  3ACF A;  2W92 A;  1TG7 A;  2Y64 A;  2ZXQ A;  3DYP A;  3BGA A;  2V72 A;  2W91 A;  3DYM A;  3K4Z A;  1UXZ A;  4QX1 A;  3UET A;  1GU3 A;  2QQI A;  1JYX A;  1WCQ A;  4RN5 A;  2VMC A;  5IHR A;  1ULO A;  2LW8 A;  2E32 A;  1CZV A;  2B4K A;  4BXS V;  4UI9 L;  5C71 A;  3A23 A;  3ACH A;  4BJ0 A;  5IYY A;  3FN9 A;  5J1X A;  4RYD A;  2CDO A;  2Y6J A;  3CZJ A;  1GMM A;  4QDQ A;  2Z4F A;  3T0D A;  2WDB A;  5DPN A;  2YFU A;  2ORZ A;  5CYY A;  2VMF A;  1PMJ X;  2VCC A;  4HG6 B;  3T08 A;  2JKX A;  1JZ2 A;  1CZT A;  4BK5 A;  3WNL A;  4PQQ A;  4P5Y A;  5B4X A;  3C8X A;  2VCB A;  3MUY 1;  3SEE A;  2EIE A;  1UZ0 A;  2WZ8 A;  3WF4 A;  1UX7 A;  4ZZ8 A;  3W5M A;  2C26 A;  2BBA A;  2WAB A;  3K77 A;  2QQJ A;  3LE0 A;  2VZ1 A;  4QB1 A;  5CZK A;  3GDB A;  1HN1 A;  3OEA A;  3OGS A;  4P00 B;  3W5N A;  2ZEZ A;  4ARY A;  2Y6G A;  4TXW A;  2WAA A;  3EYP A;  5IFT A;  2ZEY A;  3MO4 A;  3ECQ A;  3ETP A;  1UYY A;  3VDA A;  2VC9 A;  2VZT A;  4A42 A;  2W87 A;  3I2K A;  1BHG A;  4L0P A;  4A4A A;  2QQM A;  4QX3 A;  2E31 A;  5EJZ B;  2RV9 A;  3LQC A;  4PT6 A;  4XZU G;  5JXH A;  3HPN A;  4BDV B;  2VQU A;  2BER A;  5FUI A;  1JU4 A;  3ZM8 A;  3K46 A;  2WO2 A;  2YB7 A;  1JYW A;  2KD7 A;  1I5P A;  3I3D A;  3I2G A;  4KWU A;  4CU6 A;  4XUT A;  1DLC A;  3BN6 A;  3T2P A;  1T2X A;  3K4A A;  2ORX A;  2J1E A;  2EID A;  1H6Y A;  1K12 A;  2CDP A;  2W1Q A;  2X10 A;  4M4P A;  4W50 A;  3WNO A;  1UMI A;  1W9S A;  1JYV A;  2W1W A;  4JKL A;  1P8J A;  2WQ8 A;  2ZEW A;  3PUH A;  2LS6 A;  4MAD A;  1JZ7 A;  2WN2 A;  4FI9 A;  3SEP A;  4DXR A;  2JD9 A;  2W1U A;  1LNS A;  1JI6 A;  1UYX A;  2VZO A;  4YPJ A;  3THC A;  5JUV A;  2W9X A;  2E26 A;  2VZU A;  3E1F 1;  4TTG A;  3OEB A;  1O8P A;  2VOT A;  3SKJ E;  1W99 A;  5G05 L;  2XQX A;  4JHZ A;  1K42 A;  3CDZ B;  3D3A A;  1JZ6 A;  4A3Z A;  1L7R A;  2ID4 A;  3GXU A;  4P08 A;  5LCW L;  5F7U A;  4LQR A;  2EIB A;  3P1I A;  2C9K A;  1GNY A;  3VDB A;  1R64 A;  1OT5 A;  5EJ1 B;  2VL4 A;  4MO3 M;  3VD7 A;  2QQL A;  1TVG A;  2W46 A;  3C7G A;  4QDR A;  3UNP A;  1UMH A;  1JZ3 A;  4MOA A;  1JZ5 A;  5C7G A;  3OG2 A;  3T2Q A;  2WO3 A;  1XNT A;  3III A;  5DN2 A;  2XON A;  5LA1 A;  3NJX A;  4ZY9 A;  2WUH A;  4BK4 A;  3IDA A;  2J7M A;  5JXG A;  1ULP A;  2VTF A;  4MGS A;  2WZE A;  4D8M A;  4QX2 A;  1D7P M;  2YFZ A;  2V5D A;  3JXS A;  5I0D A;  1DYO A;  1H6X A;  4DXS A;  3HNM A;  2W95 A;  4ZXE A;  2YC4 A;  3HOB A;  3I97 A;  1PX3 A;  2QQO A;  4JKK A;  3CQO A;  2DDU A;  3GM8 A;  4CUB A;  4DEQ A;  4CUA A;  4M4R A;  1CX1 A;  3A22 A;  3ACG A;  4PF1 A;  1UYZ A; 
#chains in the Genus database with same CATH topology
 1URX A;  4IV1 A;  5IAV A;  2SLI A;  1QXP A;  1BKZ A;  1K5M C;  3RZK A;  2JIG A;  2ZMK A;  4DOU A;  3VBU A;  2DUO A;  3DEC A;  1RUC 2;  4P9G A;  1AR7 2;  2W94 A;  1E5S A;  2A3Y A;  4KU8 A;  4JRA A;  4OZO A;  5JIA A;  1KGY A;  3GCW A;  1U12 A;  4LPL A;  1Z78 A;  1LHO A;  2IFR A;  4XDO A;  3CKH A;  5FYY A;  1RUC 1;  3U1X A;  3JD7 3;  1AR7 1;  1WGP A;  4K8F A;  4MSV A;  5FXW A;  1G86 A;  3VHP A;  1C3H A;  1AX2 A;  5JLV A;  1AL2 3;  5FXZ A;  3IM0 A;  5GZG A;  1NOV A;  4Y26 A;  3ILN A;  2X05 A;  1CAX A;  3AYE A;  4I01 A;  4AGR A;  5C8C A;  4XFC A;  1VBB 2;  3CJI A;  1G9D A;  3C7F A;  2JE8 A;  2B9U A;  2R07 1;  3E5Q A;  3POG A;  5D21 A;  3MW4 A;  2R06 1;  4I30 A;  3VGI A;  3VBO B;  3RJ2 X;  4YM0 A;  4XBL A;  4XQW A;  3JU9 A;  5A32 B;  4URA A;  1O4Y A;  2ZEX A;  4JX0 A;  2GZW A;  5LK5 A;  5HV0 A;  4JCK A;  5L9R A;  3WDY A;  2EAA A;  1CPM A;  1HX6 A;  1W2U A;  4K3U A;  4CEY A;  3H1Y A;  5IK8 A;  5EP9 A;  2WYF A;  4EZ4 A;  5FYV A;  2HWE 3;  5JZG B;  1AR6 2;  1JN2 P;  2Y26 A;  4YW5 A;  5JR7 B;  1W06 A;  2OXB A;  5FLJ A;  3Q8B A;  1RB8 G;  5DZE A;  3RZH A;  3M70 A;  1AR6 1;  2AH2 A;  3ZPO A;  2RJK A;  4JDM A;  4Y1Z A;  5JOZ A;  5FOB B;  4P02 B;  3ZN4 A;  3VDD A;  1S0E A;  1JU3 A;  3ZXD A;  1GOH A;  3O12 A;  4DPN A;  5C3R A;  5C3Q A;  2SBA A;  5EQU A;  5SV8 A;  2OZ6 A;  2R6Q A;  1JOP A;  2GP5 A;  2VNR A;  3GNE A;  2VE1 A;  3WNM A;  4JGY C;  2UYA A;  3PMS A;  3C3V A;  3OPW A;  2XML A;  4XW3 A;  1HRI 2;  3B5L B;  3LIH A;  3PIG A;  2GDF A;  2NM1 A;  4JQR A;  4FTB A;  4QAW A;  2VCA A;  2P1B A;  2UWC A;  4QKN A;  4CDX A;  2A71 A;  2P37 A;  4MXW B;  1Z0H A;  3ZIX A;  3AMQ A;  3D6E A;  4IEW A;  2WII B;  2PHR A;  5CNA A;  4JDO A;  2VQA A;  3OOX A;  1UOJ A;  4NE9 A;  4CDU A;  1I6X A;  4COW A;  4CPB A;  4WM7 C;  4YW6 A;  3WSO A;  4WM8 B;  2VZV A;  1W9T A;  1OF3 A;  1HXS 2;  4PJY A;  2RR1 2;  4MHR A;  1QNY A;  2LRO A;  2VME A;  4NRP A;  1GKB A;  5FP7 A;  4TYS A;  4XE9 A;  4HK8 A;  2VZP A;  5CIR A;  1AJO A;  3GZU C;  3HT2 A;  3PJY A;  5F37 A;  2J1A A;  1EV1 3;  1HXS 1;  2P6C A;  3PIJ A;  4AXO A;  2RR1 1;  2ZGP A;  2RDS A;  4ASM B;  1UYP A;  3GZA A;  5JSO A;  3H7Y A;  4UAP A;  5F2S A;  5L7O B;  4QGL A;  2IXI A;  2YGM A;  3HN3 A;  3BTA A;  3H3U A;  1HB4 A;  3M3E A;  3O14 A;  2VPV A;  1PK6 A;  1O8S A;  3VZK A;  2PQQ A;  4YM3 A;  5I0R A;  4Q4V 2;  4DEV A;  3VDC A;  2JEC A;  3O0W A;  4ITC A;  3L2H A;  3VUO A;  1LAJ A;  5ISL A;  3N3H A;  5LK7 B;  3VD9 A;  4QB2 A;  3QBQ A;  3ZN5 A;  4Q4V 1;  5A7W A;  4XOG A;  2LRP A;  4XXA A;  4TZD A;  1IS5 A;  2QUO A;  3IPV A;  4LLO A;  1DBN A;  2TEP A;  1OQE A;  2A75 A;  1Y9G A;  4HXC A;  1ENS A;  1ASJ 3;  5JXJ A;  5T52 A;  1PM4 A;  3L2Y A;  2JDN A;  3RMY A;  2BW8 A;  5M0T A;  3N9O A;  2BGO A;  1IPK A;  2J1S A;  3ZYJ B;  1LEN A;  3JUU A;  3T3Y A;  3I2J A;  4QB6 A;  5H9S A;  3DYO A;  2ZOE B;  4A41 A;  1JH5 A;  1V6J A;  2Y6L A;  3ZMO A;  4CZS A;  2JG8 B;  3J8F 2;  4QD2 A;  2OKX A;  4BQ4 A;  1FMD 3;  3EHK A;  1U0A A;  2PLV 2;  2VTX A;  5A6Y A;  1WA6 X;  1W8O A;  2YMZ A;  3LGR A;  5CAZ A;  5GZD A;  1FPN 2;  1PGL 2;  4LTA A;  4LOR A;  1AXZ A;  4GWI A;  4HL0 A;  3P5B A;  3ZFF C;  4QXH A;  2XPJ A;  5GAL A;  2ARB A;  4N7I A;  4OI2 A;  4QHZ A;  3O1U A;  2DBN A;  3GZE A;  3PUR A;  4OI1 A;  1COV 2;  1AR9 1;  1ZRR A;  4GAL A;  4NN0 A;  5FBZ A;  3D4K A;  3OBR A;  4IEZ A;  3ZPY A;  2WBK A;  1X9P A;  3LFM A;  1LB2 A;  5FFO C;  2FDH A;  1JZ4 A;  5LBE A;  2PTM A;  1GWM A;  2VM9 A;  3I7D A;  3OB8 A;  2IWG B;  2ZZJ A;  2FQP A;  3LKJ A;  3A21 A;  5FYS A;  2PQS A;  5HXM A;  3LPF A;  3KZ4 C;  4GH4 B;  4CVU A;  1GOF A;  1OLM E;  3RGB A;  5FK7 A;  4CSW A;  3U78 A;  4E4Z A;  5KR7 A;  3OSD A;  3HR9 A;  5F1R A;  4PDW B;  5C4W B;  3LIG A;  1YQ2 A;  3UK9 A;  2FCV A;  5F3I A;  3ZSL A;  2DFB A;  2WJS A;  1FXZ A;  1WW5 A;  1W8T A;  1QDO A;  1LES A;  1J1T A;  3O0X A;  4CP2 A;  3J7L A;  5T55 A;  4RR3 B;  5IW0 A;  1HW5 A;  3QAC A;  1NZI A;  2JDU A;  3S6P A;  1JYI A;  1R1Z A;  3RQ0 A;  1Q3E A;  1PNF A;  4Y1Y A;  5FYI A;  5T5J A;  1D0H A;  4IEX A;  4XAB A;  1C8M 3;  3O1O A;  1O4Z A;  3VBO A;  3RYR A;  5LEJ A;  3WF1 A;  2WS9 1;  4LBJ A;  1NCR B;  1W8N A;  1UWW A;  1ZBA 1;  3GZT B;  4FFG A;  5FCC A;  4Y3O A;  1BCX A;  5FKB A;  4DB5 A;  5DG2 A;  2XLG A;  1MS4 A;  4LBN A;  5A80 A;  1M4W A;  1IKQ A;  1LEC A;  1VBA 3;  3H8U A;  5L9B A;  2RVA A;  4N9I A;  1RIT A;  1XBF A;  4UOJ A;  4CCN A;  5JZG A;  3WZ1 A;  3ON7 A;  2E6V A;  5K0U B;  3UES A;  3AKR A;  1VMJ A;  1OSG A;  3NNG A;  2JDZ A;  2W92 A;  1TG7 A;  1R09 1;  3LAG A;  1JOJ A;  2WNE A;  3DYP A;  2ZGU A;  3RMX A;  3RZM A;  1B35 C;  1QOT A;  1UXZ A;  1YHF A;  1MEC 2;  3HAG A;  4R8H A;  2RJL A;  4XDQ A;  3VL8 A;  4B7K A;  2QDN A;  1S0F A;  1GU3 A;  2WFF 1;  3IWZ A;  3IZO A;  5DUU A;  4XFF A;  3WY6 A;  2VMC A;  3VZM A;  5FJK A;  5IHR A;  3SLI A;  4EN9 B;  2VVF A;  2HWF 2;  4YG6 A;  2LW8 A;  1FX5 A;  2E32 A;  3VZL A;  4YZ5 A;  5JVV A;  1DDL A;  2GMM A;  1CPN A;  1GP4 A;  3KT7 A;  5DDJ 3;  1IPJ A;  1J3Q A;  1KFU L;  5KHJ A;  3KGZ A;  1O3R A;  2HWF 1;  3FWE A;  5KC6 A;  1J58 A;  4BJ0 A;  5IYY A;  1ONA A;  3AK0 A;  4XEZ A;  1FV3 A;  4UFH A;  5EZW A;  4YVS B;  1H2N A;  2JJ6 A;  3POY A;  4MUV A;  4QPI C;  1X8E A;  4EV0 A;  2ZTN A;  1KS4 A;  1YRZ A;  5A1F A;  3R4D B;  4RYD A;  3RPQ A;  3CL1 A;  4W65 A;  2VAU A;  2Y6J A;  2XJU A;  3DPR C;  1JUI A;  4I0W B;  1ZRF A;  3OBT A;  1AL2 2;  5FR3 A;  4NID A;  1VRB A;  3PVO A;  1RMU 3;  3T0D A;  2WDB A;  3WCS A;  3A0N A;  5F3G A;  2CL2 A;  2VNG A;  2YFU A;  2ORZ A;  3ZN6 B;  3THT A;  5GLV A;  1PMJ X;  3ZR5 A;  5D8A B;  3SC7 X;  4H14 A;  1W0P A;  2X8K A;  1TMF 1;  1J1L A;  4LK7 A;  2JKX A;  1PNG A;  5L7O A;  5FZ7 A;  1D4V B;  1TEI A;  4BIS A;  3I4I A;  1QJX 2;  1FOD 2;  4BK5 A;  4Q0U A;  3H42 B;  5JDB A;  2ZCW A;  1O5L A;  2HBT A;  2JE7 A;  1Q8V A;  1C28 A;  3C8X A;  4N43 B;  1C57 A;  1XNK A;  2HWE 2;  1QJX 1;  1FOD 1;  1V0A A;  1W6N B;  1LU2 A;  1IG0 A;  3U4X A;  5BNN B;  1YJL A;  2ZGL A;  1YEW A;  2VUL A;  1YFY A;  3FBM A;  1WCS A;  1FNY A;  1RUH 1;  1O3S A;  3WF4 A;  4IV3 C;  4E2Q A;  2BU9 A;  2BGC A;  1W3X A;  4JGZ C;  4EN0 A;  1TQ5 A;  5IAT A;  5J98 B;  4CDQ B;  4HSL A;  1YFW A;  3IT8 A;  3ZFE C;  5HBA A;  5J37 A;  1ULG A;  4FFH A;  1WD3 A;  3W5N A;  3UKV A;  2WRA A;  1E5I A;  1SBD A;  2CAV A;  2R04 3;  1MZ6 A;  2VW0 A;  3BB6 A;  2WL1 A;  3B69 A;  3S7I A;  2K46 A;  3ECQ A;  1WD4 A;  1R08 1;  2CGN A;  3CF6 E;  3ETP A;  3OY8 B;  4AED C;  2XVK A;  2EA7 A;  4BPZ A;  4CTE A;  4JDN A;  2W87 A;  4B29 A;  4K8R B;  1U5Y A;  4H55 A;  4IEV A;  4RL7 A;  2JG8 A;  1OKQ A;  1Y4W A;  3BAL A;  5EJZ B;  2RV9 A;  4GKY A;  2FBE A;  3SHR A;  3O1R A;  3GHM A;  3N36 A;  4NAO A;  2DUQ A;  1GZ9 A;  4DFS A;  2MHF A;  3MF9 A;  3MID A;  4BHP A;  3LF7 A;  2D5H A;  3PVB B;  3ZM8 A;  1TNR A;  2V5Y A;  3AMP A;  3B93 A;  5ACA 3;  2JG9 C;  1VBE 3;  2KD7 A;  3HT1 A;  5HCA A;  3RZJ A;  1KRI A;  1KFX L;  2ZX1 A;  1I5P A;  3S5Q A;  3I3D A;  3JQW A;  1CIW A;  2O14 A;  4YW7 A;  1PO1 3;  2NLR A;  2Q5T A;  3LEM A;  4NOT A;  1UL9 A;  1EV1 2;  2NMO A;  5A6X A;  1VBC 3;  3Q8C A;  4CU6 A;  1CX4 A;  1MS1 A;  4XUT A;  5FK8 A;  4YAR A;  5IVJ A;  1W8H A;  4OUS A;  2DWR A;  4GMP 3;  1PM7 A;  4QKD A;  4ZXK A;  5KHG A;  5KXD A;  4CE8 A;  3ASI A;  2XVL A;  3IDC B;  4URT A;  3MLL A;  4IE0 A;  2CDP A;  4UW3 A;  1OBN A;  1OXC A;  5EXO A;  3URF A;  3OGJ A;  5F6K A;  4FPL A;  5CFD B;  1NG0 A;  1V9U 1;  4IE5 A;  1JYV A;  2P3Y A;  2W1W A;  4COZ A;  1DLL A;  4PDW A;  5C4W A;  5F9T A;  1RC6 A;  2ATF A;  5E1R A;  4BIO A;  4BZ4 A;  4K6B A;  5FZ8 A;  1BEV 3;  2Y6F A;  5CIS A;  1S0C A;  1ND2 C;  2OS2 A;  2ZEW A;  4MAD A;  1SMV A;  4DXR A;  1W39 A;  4QPY A;  4I3G A;  1G7Y A;  3D0J A;  3E5U A;  2WLQ A;  4RR3 A;  3K48 A;  3PME A;  4RSU A;  5GLZ A;  1OI6 A;  2O8Q A;  5C33 A;  5GJ6 A;  1ASJ 2;  1RXF A;  1RUD 2;  1PVC 3;  1PGW 1;  2NMN A;  5GZF A;  2BBV A;  3V0B B;  5AFB A;  3RZL A;  2VVE A;  1YIF A;  3QH6 A;  1TZO A;  2F4P A;  1DZQ A;  5A7Q A;  1RUD 1;  1NCR A;  2PHT A;  2BFU S;  4MH0 E;  3S30 A;  5G05 L;  5A3O A;  4OLL A;  4A6S A;  4AR2 A;  2OX0 A;  3TEY A;  2XQX A;  3VBR B;  2EVX A;  2JEM A;  2VEC A;  5CEH A;  4V2W A;  1NZC A;  4MGT A;  1FMD 2;  1HKD A;  5A7S A;  4M3C F;  2EAL A;  5FO9 B;  1XQN A;  1H1A A;  2ID4 A;  5K0U A;  4P08 A;  1W8Z A;  3NKT A;  5A3L A;  3AM2 A;  1OVS A;  1DGW A;  1ZZ9 A;  3ZFG B;  1DZR A;  1G9F A;  1GNY A;  1UMZ A;  2YY1 A;  2VGD A;  1VRH 3;  4DQA A;  2HWB 3;  1DQ4 A;  3ELN A;  2OUH A;  3B01 A;  4QXC A;  4Q0Q A;  1R64 A;  3SMH A;  2B5H A;  4BQW A;  4PQ9 A;  1OT5 A;  2RS5 1;  4Q4X 1;  1EAH 1;  1NCQ A;  1MQT B;  5EJ1 B;  3RG0 A;  4AI9 A;  3V0A B;  4YG0 A;  1TVG A;  3Q8A A;  1RUI 1;  3HMY A;  3SCF A;  1SAC A;  4MOA A;  1ULD A;  5BNO B;  2BPA 2;  2WWJ A;  5FZ4 A;  3H3Z A;  1V6L A;  2NN8 A;  3AFG A;  4HLT A;  2DU1 A;  5FV3 A;  3III A;  1RUE 2;  2X29 A;  5LA1 A;  5IUQ A;  2BP6 A;  3VBU B;  1W3V A;  2RS1 1;  4I02 A;  1H9P A;  2WNU C;  2RDN A;  4YW2 A;  1AXK A;  2VTF A;  3ZX7 A;  2WZE A;  1RUE 1;  2BVV A;  2CTV A;  1SLT A;  2LUW A;  5CG8 A;  3FHI B;  2YFZ A;  4FTS A;  2G19 A;  4Y1X A;  4YVS A;  1QWR A;  4RQP A;  2V5D A;  3JXS A;  4RGG A;  2XJP A;  3R0R A;  4GWN A;  3BOW A;  2BRT A;  1DYO A;  3DXU A;  3PL0 A;  2W95 A;  1OUS A;  4ZXE A;  2JWP A;  5FXX A;  1DGR N;  2G9G A;  1VE0 A;  4IEY A;  5C8C B;  4ORF A;  2JXA A;  2XR4 A;  4HPK A;  1PX3 A;  3CJI B;  4JRL A;  2H6C A;  3CQO A;  2DDU A;  2DFC A;  3NW4 A;  4G3Y C;  1DHK B;  3DKW A;  5FIX A;  3GBG A;  4M4R A;  4I09 A;  3KCC A;  2P3K A;  5D8A A;  3N9L A;  4DS0 A;  2MEV 1;  2FDJ A;  4RS5 A;  1K5M B;  3BUC A;  2FD8 A;  2NP0 A;  3WDU A;  1JUH A;  4O9E A;  2PAE A;  1JS9 A;  3PU3 A;  2FMD A;  3AP7 A;  1RVF 3;  1O59 A;  2VMG A;  1HB2 A;  1VBA 2;  3INA A;  4N8M A;  3TNP B;  4DXZ A;  5FO8 B;  1S0D A;  3AFK A;  4FPF A;  3VKN A;  1W6N A;  4AQT A;  3GJB A;  4XHB A;  5BNN A;  1LOB A;  3BYW A;  1V6N A;  2ARE A;  3DKQ A;  4RFR B;  4X6Q B;  5FDB A;  4U2A A;  1SLC A;  3WNP A;  3TRS B;  5CKQ A;  1HRV 3;  3ALQ A;  1AYN 1;  1EUT A;  4QX8 A;  3PVE A;  2KA3 A;  5FYM A;  4NR1 A;  3WF0 A;  1V6K A;  1UZV A;  5D1I A;  4IER A;  3T09 A;  2I74 A;  1NE6 A;  1RYY A;  1O3T A;  2QFE A;  1POV 1;  4AHY A;  1N1Y A;  3KCX A;  2Q8D A;  3G7D A;  2DU0 A;  1BVP 1;  1BK0 A;  1W2N A;  4R4X A;  1UY2 A;  5CVR A;  4XC9 A;  2WQZ C;  3CIH A;  1XB9 A;  3F2Z A;  1JXN A;  4RD7 A;  3OY8 A;  5C70 A;  4Q4W 3;  5A1A A;  2G4I A;  1LGN A;  1I3H A;  3AB0 A;  5D2A A;  4MVT A;  5DDJ 2;  2JIJ A;  5F39 A;  4CDX B;  2F6B A;  4CU9 A;  3BVC A;  4AFA A;  4BCU A;  3EO6 A;  4XIL A;  4NVP A;  1VAK A;  2NZ9 A;  2WYS A;  3WDT A;  3N4M A;  4E27 A;  4E8D A;  3KT1 A;  5LRS A;  3HQX A;  2F4L A;  1W6M B;  3FHQ A;  5EPA A;  1QQP 2;  4A44 A;  5BNQ A;  5JR2 A;  5ABJ C;  2ZX3 A;  4ATE A;  3KGL A;  2R49 A;  4LBQ D;  1QQP 1;  3M3O A;  5HPO A;  2Y38 A;  4OMD A;  5K7P A;  1GOG A;  4XF0 A;  1RMU 2;  2Y0I A;  3I2H A;  2DCZ A;  4FPK A;  5E88 A;  2Y8K A;  4TSV A;  3VHO A;  1XOY A;  4UFJ A;  1UXX X;  5DZF A;  1CGP A;  1CJP A;  4DUW A;  1NLR A;  4QM9 A;  4CP0 A;  1D2S A;  4S2F A;  2EIC A;  1PK6 B;  4OFG A;  1W05 A;  2VNO A;  4OHZ A;  3P3N A;  4ARX A;  4LBO A;  5FTT C;  2WT0 A;  2QQN A;  4EYU A;  2WZR 3;  4IL7 A;  4L97 A;  4P9W A;  5T54 A;  1DGW X;  3S7E A;  2A3W A;  4M3C B;  2DCY A;  2NYY A;  3AC0 A;  4B8E A;  2K2S A;  3KV4 A;  1CAU B;  2ETE A;  3ZLI A;  2D3S A;  4L99 A;  4YZ1 A;  5F3C A;  1QIQ A;  2BZD A;  1XYO A;  1X33 A;  5FWJ A;  3IPV B;  1YFU A;  1YQ5 A;  1PGS A;  5HXV A;  5A70 A;  4UT5 A;  3VZN A;  4R9B A;  1H8T C;  5FBJ A;  5A7P A;  1OH4 A;  4EWD A;  3POJ A;  1UY1 A;  4JZR A;  2WNO A;  1FAY A;  4ET7 A;  5K4L A;  1G9B A;  4JQT A;  2R04 2;  1VBD 3;  3VBF C;  4F8A A;  5IVV A;  1O6U A;  1SPP A;  3V0B A;  2WWS A;  1LTE A;  1UZZ A;  4CCK A;  4EN7 B;  3VZO A;  2YU1 A;  3LOB A;  1GP5 A;  4HK9 A;  3AZV A;  3HNB M;  1RUG 3;  1ST8 A;  5LBC A;  5GZC A;  2QTW B;  3JCI A;  1BBT 3;  2OPW A;  5B4N A;  2ADD A;  1ZBE 2;  1AYM 1;  4IUG A;  4XIK A;  1F15 A;  4NHK A;  5A3U A;  1QJU 2;  5TSW A;  3KMH A;  3TAY A;  4EE2 A;  2VMI A;  4AGG A;  3BTY A;  4DRR A;  5A3M A;  2ZJC A;  2MPF A;  1ZBE 1;  1CN1 A;  3BTZ A;  3O5S A;  1X9T A;  3ES1 A;  5FZI A;  5E16 A;  1QJU 1;  1XE0 A;  1W03 A;  4Y20 A;  4QPW A;  3ZXG A;  1J84 A;  3I2I A;  1CVN A;  3SIT A;  1C1F A;  2CGP A;  3TYJ A;  4C1X A;  5F6L B;  1VBE 2;  1NT0 A;  4E8C A;  4GQ7 A;  3WQ0 A;  3EBR A;  1WCD J;  1PO1 2;  3T4H B;  3V0A A;  1D2Q A;  2GNM A;  4LHL A;  1PO2 3;  3H8O A;  4XXP A;  4HKL A;  4LO7 A;  4AFB A;  3ZXA C;  1VBC 2;  2I2S A;  2XL7 A;  1WBL A;  3UKT A;  3L9J T;  2O0O A;  4NPL A;  3AL6 A;  1QOO A;  4XUO A;  2QQU A;  5A7N A;  1ZZC A;  3A7Q A;  4MX3 A;  5KC5 A;  3BU0 A;  1CR7 A;  2WFF 3;  1JOD A;  4PBP A;  3W59 A;  1QU0 A;  4LKS A;  1OLR A;  1IQD C;  2XOM A;  1SDW A;  5A33 B;  3MIG A;  4FOW A;  3ROU A;  3ZFF B;  4BA6 A;  1W9F A;  4A2U A;  4XUN A;  3NAP A;  4Y33 A;  1MS9 A;  1NAE A;  2HWC 2;  5C3P A;  4MGQ A;  3C2U A;  5DMY A;  1R1A 2;  2HEW F;  3WQB A;  4LO6 B;  3OGG A;  1YQC A;  1W9W A;  1WKY A;  2RS3 3;  3PUS A;  1A78 A;  2EXI A;  4LEJ A;  4AOC A;  1WUV A;  5LZ6 A;  3ZYR A;  1ENQ A;  1W8F A;  2XHN A;  3VBF A;  3HEI A;  2PAK A;  5FZA A;  4I0B A;  3WHU A;  4AK3 A;  3JZV A;  3WW2 A;  1RJ8 A;  3HNY M;  4Z1V A;  1LJ7 A;  5LA2 A;  5LA0 A;  1K5M A;  1V6O A;  3Q8F A;  5GLW A;  1UY0 A;  1VBB 1;  4GB3 3;  3LA3 A;  3S57 A;  3SNM A;  2AUY A;  5I91 A;  4D0Q A;  3DGT A;  4LT5 A;  4EQV A;  1IKP A;  1IS3 A;  1YNA A;  4H3W A;  2QVS B;  4HKO A;  4Q0V A;  4D94 A;  3APB A;  2H6B A;  1NA1 C;  3W58 A;  1Z7S 3;  1WCU A;  2XH6 A;  3JBG 2;  1NXM A;  3B94 A;  3KF5 A;  3VBS C;  2R0F A;  4AQ2 A;  1ZZ7 A;  5E8A A;  4DY3 A;  1XU1 A;  1UZW A;  4Q26 A;  2DBI A;  4LOT A;  2YU2 A;  5F8P A;  3JBG 1;  5IT6 A;  5I8T A;  3AMN A;  4GXL A;  4NO4 A;  4DUX A;  3H7J A;  5LY1 A;  1UZY A;  1RJ7 A;  1VRH 2;  4QT6 A;  1W90 A;  5FP3 A;  4F7Z A;  4MLO A;  1S0J A;  1MPX A;  3FLT A;  4OZX A;  1SG3 A;  1W28 A;  3NKG A;  4FFI A;  1MAC A;  4OI4 A;  3WNX A;  2PA7 A;  5IK4 A;  1S0B A;  4HSJ A;  4M01 A;  3BPS A;  1AXY A;  3PHM A;  1WLC A;  1KDM A;  3AKP A;  5A3W A;  4QX7 A;  4GMP 0;  2IFW A;  4GIQ A;  1C4R A;  3J7N A;  3NJV A;  1H1I A;  1HRI 1;  3T4V A;  3DXT A;  4KWL A;  4YW1 A;  2D6L X;  4P9Y A;  1UPI A;  3T2O A;  1RL3 A;  1S2E A;  3POF A;  3KQR A;  3ACF A;  1W6M A;  5FZ0 A;  2XHK A;  4O61 A;  3BGA A;  2FHR A;  1B35 B;  3K2O A;  4F3J A;  1H1M A;  5FY1 A;  2BQP A;  3DYM A;  2D5F A;  2PHF A;  3SCH A;  4LA2 A;  5FO7 B;  4JGY A;  5AVP A;  4CCO A;  4DIQ A;  3MEP A;  3POW A;  4OHX A;  5IK7 A;  3NV1 A;  2W0X A;  2Q8C A;  2WKK A;  1ULO A;  4PI0 A;  3POB A;  3FUQ A;  4PIY A;  1CZV A;  2B4K A;  4B1M A;  2CWS A;  1RUJ 3;  2D3P A;  1LGC A;  2WSU A;  4E2S A;  5K8S A;  2AEN A;  1WMD A;  2GN3 A;  3ZYG A;  5C71 A;  3ZXF A;  4WVW A;  5IVE A;  4AQS A;  4CP1 A;  3HQR A;  4LR4 A;  3M4F A;  4QPI B;  1E5H A;  4M3C A;  2VBP A;  4WM7 A;  5FRA A;  4AI0 A;  5BV6 A;  5J1X A;  5FAX A;  1IZ3 A;  1CAU A;  3B02 A;  1DF0 A;  2D6O X;  3DPR B;  4HKW A;  3WQ7 A;  2Y34 A;  2BEO A;  3KHB A;  1GMM A;  2GME A;  4MZU A;  2Z42 A;  1HRV 2;  2Z4F A;  4LLF A;  2E9Q A;  4W6X A;  4Z2W A;  5FOJ B;  4MGI E;  1EYB A;  1YC6 1;  2A73 B;  2W68 A;  1LRH A;  2YUE A;  1UU5 A;  1XSR A;  4YWA A;  5LY2 A;  5FP4 A;  3VBH C;  5DUW A;  1F5J A;  4XJZ A;  2XBO 2;  2VCC A;  4HG6 B;  2AEZ A;  4LBL A;  3T08 A;  1UIJ A;  4L9B A;  4HVQ A;  2B7Y A;  4Y5Z 0;  1XE8 A;  4LIU A;  2KXL A;  3RI8 A;  5JI9 A;  1DIW A;  2CGO A;  4HT1 T;  2TNF A;  4Q4W 2;  4Y4Y A;  5H9P A;  2XBO 1;  4BQ5 A;  4YGB A;  2PHL A;  3UGF A;  3WNL A;  4PQQ A;  2VCM A;  4P5Y A;  1OUX A;  4JAA A;  1L7L A;  3M3C A;  2C6S A;  3LA2 A;  4UYB A;  4I3P A;  4XJA A;  3MUY 1;  3X29 B;  4IV3 B;  4ZON A;  1HJG A;  4JGZ B;  3H1W A;  3J8F 1;  2VBD A;  3IMM A;  3MIE A;  3ZOI A;  2PLV 1;  5FZL A;  1V70 A;  2XKP A;  3ZFE B;  2C26 A;  1AR8 3;  1BJQ A;  2VOK A;  5C3S A;  1FPN 1;  5C6C A;  4AF9 A;  2ENR A;  1PGL 1;  2VZ1 A;  5CZK A;  3GDB A;  1HN1 A;  3A4U A;  3OEA A;  4D69 A;  5BNP C;  3NV3 A;  5KWR A;  1DQ6 A;  3M7A A;  3SH3 A;  2ZEZ A;  1UCX A;  4PF5 A;  2BDR A;  1A34 A;  3U10 A;  2Y6G A;  2RMU 3;  3EYP A;  1EP0 A;  2E7A A;  1V6M A;  4UWD A;  4ZU4 A;  4AFC A;  2Z79 A;  3MO4 A;  2ZA9 A;  2HEV F;  2QZ3 A;  1UYY A;  3VDA A;  2VZT A;  1UIK A;  1COV 1;  4NMI A;  5A7O A;  2IXJ A;  2X5I B;  3I2K A;  4FT8 A;  1BHG A;  4L0P A;  4Q0P A;  5FZC A;  1O7F A;  1SFP A;  4QPG B;  2DTY A;  3EQE A;  1OH3 A;  1GV9 A;  1JBC A;  4Y1V A;  4AAP A;  2ET1 A;  2YHJ A;  2WZR 2;  4XF1 A;  1DZT A;  2LAL A;  5IVF A;  1RHI 3;  2LM3 A;  3ITQ A;  4ZHN A;  3BU7 A;  5FMB A;  5A33 A;  2VOV A;  5LBB A;  2YPJ A;  3ZFF A;  3CO2 A;  3GHN A;  4AFM A;  4PLO A;  4BQ3 A;  4YVW C;  2WO2 A;  4JTN A;  4PIZ A;  1JYW A;  2RS1 3;  5AVA A;  4F83 A;  4OQ8 A;  1D4M 3;  1Q5O A;  5EV7 A;  3IDB B;  4XFB A;  4YFZ A;  3JQX A;  4RHV 3;  5I93 A;  2HH9 A;  5FP8 A;  1MVE A;  4QHB A;  2JDM A;  3GBF A;  3DCQ A;  4XBN A;  5T3N A;  5L73 A;  3MIF A;  4BOW A;  2WIN B;  5GLU A;  5A6Z A;  4LBM A;  1DLC A;  2B42 B;  3BN6 A;  3WG2 A;  3GF6 A;  4FPE A;  2VUJ A;  4C8D A;  2ZBJ A;  4Z82 A;  4LE3 A;  2IXK A;  3N9Q A;  4OHV A;  4TWT A;  2ORX A;  2QDR A;  5JZG C;  5EJ3 A;  1Q56 A;  4Z07 A;  3ZSM A;  1RUG 2;  5J3U A;  2E51 A;  1UMI A;  1LED A;  4HFS A;  2ZX2 A;  4JKL A;  2QKD A;  4FQ4 A;  3AXE A;  1SQ4 A;  2TUN A;  4NII A;  1TME 2;  4ASL A;  1MZE A;  2XXZ A;  2LS6 A;  1N1S A;  3T1L A;  2AR6 A;  2XLA A;  4FI9 A;  3SEP A;  1BMV 2;  2WR9 A;  1WBF A;  1V6I A;  3LDK A;  3TN9 3;  4LBQ B;  1GNH A;  4ONU A;  3ZYI B;  3MW3 A;  1QHD A;  1TME 1;  3ACL A;  4K1Y A;  5GZE A;  3FZ3 A;  5I0T A;  1UO9 A;  4CDW C;  1KJR A;  1UYX A;  4Q4Y 3;  2ZGQ A;  5FYB A;  4YSF A;  4N53 C;  5FLH A;  1NCQ B;  4YPJ A;  3ATG A;  3VHN A;  4ES9 A;  3CHX A;  3THC A;  4CEW C;  5JUV A;  3ZMN A;  2W9X A;  1ACC A;  2W52 A;  3UL2 A;  1PIV 2;  2VZU A;  3E1F 1;  1MEC 1;  1NE4 A;  4P9L A;  3M3I A;  2B8M A;  4S2H A;  4LKE A;  1QGL A;  5EWS A;  1WA4 A;  2VOW A;  4UBG A;  2Q4S A;  4J25 A;  4QU1 A;  2ERF A;  4KNC A;  1WZX A;  1PIV 1;  4DMI A;  4SLI A;  4XIO A;  2XB6 C;  4G4F A;  3CDZ B;  3D3A A;  4WM8 C;  1FYU A;  5J96 B;  3MIC A;  3CU7 A;  3GXU A;  3T2T A;  4D7S A;  3RI9 A;  2FDG A;  4RQP B;  1UOB A;  2EIB A;  2C9K A;  2YDE A;  3JD7 2;  3N7K A;  2RM2 3;  3MPB A;  4YM2 A;  3TEW A;  3VDB A;  4QM8 A;  4CXW A;  1HV1 A;  1B35 A;  2WNV C;  3H8R A;  3OTF A;  3ILR A;  2VL4 A;  3JD7 1;  4HPK B;  3Q8E A;  4L8Q A;  5F5Q A;  1UKR A;  2BNM A;  2W46 A;  5JIU A;  3UNP A;  4LE4 A;  1UMH A;  4LKD A;  1JZ3 A;  3AZX A;  1AL2 1;  1FI2 A;  1PZ8 A;  2DVF A;  2D6P A;  2D6N A;  4EWE A;  4RS5 B;  5C7G A;  2IXH A;  3T2Q A;  2WO3 A;  1XNT A;  4M3C E;  5FPZ A;  3LZZ A;  4FVV A;  4ZY9 A;  5BY5 A;  3AZZ A;  1QEX A;  4PCR A;  4BK4 A;  2EXK A;  3IDA A;  3WUC A;  2XKO A;  4IGP A;  3RFR A;  1Z7S 2;  2RG4 A;  1QH7 A;  3UT0 A;  4QPI A;  3ZSE A;  3VN4 A;  5L9V A;  1AF9 A;  1S55 A;  1OOP C;  1H6X A;  3DPR A;  1EY2 A;  3AMH A;  3HNM A;  3MZH A;  3KLS A;  4BQY A;  5I0S A;  2HWE 1;  4MG2 A;  3ZKY A;  4AI3 A;  2DF7 A;  2QQO A;  2GND A;  3THP A;  2UUR A;  3CLP A;  2HWD 3;  2Q0A A;  3GM8 A;  4JV4 A;  4NPM A;  1W04 A;  5T5O A;  3WR0 A;  4DO0 A;  5DAX A;  1IS4 A;  1I1E A;  3ACG A;  3SCG A;  4MHU A;  1UYZ A;  4D7T A;  4CU8 A;  2VMD A;  3RSJ A;  3F95 A;  3ZR6 A;  2XL9 A;  1A8D A;  1SHW B;  1NKG A;  4LHK A;  4X8P A;  4GA9 A;  1BXH A;  2EIG A;  2J1V A;  4C0B A;  3OCP A;  2VXR A;  5IVY A;  1JMU B;  3FJS A;  4H2A A;  1TNF A;  1MVQ A;  1U5Z A;  4KI5 M;  5DUX A;  3VB9 A;  1HIX A;  2P2K A;  3FC0 A;  4A7Y A;  3VD4 A;  5KHI A;  3J4U H;  3WDW A;  3K75 B;  4KH9 A;  2WZP P;  3T0B A;  3E6C C;  1PMI A;  2KR2 A;  3GJA A;  1YI7 A;  3LEG A;  4FCA A;  4IV3 A;  4NHX A;  1J3P A;  3FE5 A;  4FPH A;  3RVH A;  4AE2 A;  3I3B A;  2BTV C;  4JGZ A;  3MHZ A;  1UAI A;  2ZML A;  3LPG A;  1QJF A;  4LIV A;  4N90 A;  4IW3 A;  1X50 A;  2LTN A;  3ZFE A;  2PAM A;  4H7L A;  1XND A;  1OD5 A;  3W9A A;  4XJU A;  3PUI A;  4FPO B;  1GBG A;  1JZ8 A;  5EFU A;  3OF1 A;  1GP6 A;  2WN3 A;  4UFL A;  3NST A;  4Y24 A;  2OT7 A;  4KQ7 A;  3ACI A;  3I49 A;  4AED A;  4HN1 A;  5AC9 3;  4B7E A;  4GH4 C;  1WMF A;  3D0S A;  2BGP A;  5FY0 A;  4XAC A;  4CUC A;  1RUJ 2;  1XNC A;  3AYC A;  4W4Z A;  2X5I A;  4EZH A;  2GAU A;  1EV1 1;  4QPG A;  3FL7 A;  1KD7 A;  1VPH A;  2VZR A;  4AG4 A;  4PDW C;  3O1S A;  1BZW A;  1RUF 3;  2O1Q A;  1F2N A;  1ND3 C;  1WW4 A;  3I2F A;  3N7M A;  4KL1 A;  1QJY 3;  2H0V A;  4NRM A;  4XJ9 A;  4IGO A;  3POE A;  2QJV A;  5IJR A;  3IKW A;  2OZJ A;  3WP5 A;  1SLA A;  3W21 A;  4IEU A;  3MGU A;  1K3I A;  1PZ9 A;  1KDK A;  3OBA A;  2R7E B;  1RTV A;  3N35 A;  4HVR A;  5FMC A;  5FY4 A;  5IAX A;  2DUP A;  5FZ6 A;  4AHW A;  3B3Q E;  1ZRE A;  2VZ3 A;  3U37 A;  2J22 A;  2CWM A;  4AVC A;  3OPZ A;  1HLC A;  2J1U A;  1N3O A;  2QCS B;  2AGS A;  3J7H A;  5C5U A;  5EYY A;  3CEW A;  5FMO S;  1XSQ A;  1RUC 3;  4M0H A;  1LOF C;  1AR7 3;  1C5I A;  1N47 A;  1F9K A;  1UNB A;  2BFU L;  4G9S B;  4LO5 B;  1SPP B;  4COY A;  4BQX A;  2QQK A;  4E4D X;  3AP5 A;  1JYC A;  2QZ2 A;  5FZ1 A;  2V4V A;  5F5I A;  1GIC A;  2D44 A;  3VKO A;  1ASJ 1;  5J48 A;  2ARC A;  4Z2A A;  4YZ3 A;  3ZYB A;  3O1T A;  4R9D A;  4IGQ A;  4OCT A;  3THD A;  2W3J A;  4AHZ A;  4O9G A;  4QU2 A;  2R07 3;  3KF3 A;  3A0K A;  5F5A A;  1M06 G;  2R06 3;  2VR4 A;  5H9Q A;  2VOX A;  3DF0 A;  3USS A;  1ND2 A;  4QQO A;  4B4R A;  2XVG A;  4OMC A;  3TWI A;  3LWC A;  4OHW A;  2W47 A;  2WFP A;  1FMD 1;  2YV8 A;  3O0V A;  4JHT A;  4OUM A;  4BH9 A;  4Y20 B;  1H8T B;  3WW1 A;  2Q1Z B;  4LBQ A;  3WT3 A;  5DQ0 A;  5JSP A;  2R16 A;  3PU8 A;  3K51 A;  4XCB A;  3NJY A;  5FZE A;  3LB9 A;  1UW8 A;  1US2 A;  4W8J A;  4A7K A;  3I3M A;  3WG4 A;  3QH7 A;  1UN1 A;  3KV5 A;  4OQ9 A;  2XJS A;  1AX1 A;  1AR6 3;  2W1S A;  2VNV A;  1W2T A;  1OPO A;  2VU9 A;  4Z92 B;  2QBX A;  3ETQ A;  3O1P A;  3U11 A;  2GMP A;  3ZYF A;  4XAA A;  4WVZ A;  2CYF A;  2VD7 A;  5FPU A;  4FPJ A;  2BV4 A;  2G9Z A;  4UF0 B;  4XVH A;  2VZS A;  3NV4 A;  2J1R A;  3I54 A;  3HJR A;  4YYO A;  1KS5 A;  3RDI A;  1RHI 2;  1QY4 A;  1OLQ A;  2XJT A;  2ZAH A;  4UFI A;  3IAP A;  4HOO A;  2HBU A;  3NAP B;  4JKM A;  4LO8 A;  1RIN A;  1MZF A;  2PFW A;  1D0G A;  3MV1 1;  5JWP A;  4IE4 A;  1NLS A;  1OA4 A;  1IPS A;  2AC1 A;  1GYK A;  1POQ A;  2DCT A;  3LA7 A;  2J1T A;  1D4M 2;  4XUP A;  2CY6 A;  4P5H A;  1UU6 A;  2ZGR A;  3AKT A;  3D5O A;  4RHV 2;  3T30 A;  1MS5 A;  4LJH A;  3VBF B;  1W2O A;  1CES A;  2V09 A;  1YLL A;  3V65 A;  1C8M 2;  2ZAC A;  3R4S A;  3AX4 A;  1GNZ A;  4QDS A;  2QNK A;  1QNW A;  3NNJ A;  1EUU A;  4A6O A;  1QH6 A;  1O4T A;  2VUC A;  4A7Z A;  1VAL A;  4N43 C;  4TN7 A;  3T0A A;  3NRU A;  2WNU A;  1ZRD A;  3WDX A;  1C8M 1;  2X09 A;  3CBN A;  2YC2 A;  4QMA A;  4YFW A;  1HXS 3;  2RR1 3;  4S2D A;  5C9A C;  1MS0 A;  2VTX J;  2B46 X;  1XNB A;  1GR3 A;  4XZP A;  4CDQ C;  3AJY A;  1SBE A;  3SIS A;  5C5T A;  2ZS6 B;  1VBA 1;  4HMZ A;  3LEK A;  2KM2 A;  3TN9 2;  3MW2 A;  1W8W A;  4FOV A;  4XUR A;  3VD5 A;  2YGL A;  1UQX A;  4WVM A;  2ZMN A;  5IVC A;  1YJK A;  4ES8 A;  3KS7 A;  1FV2 A;  1LCL A;  4K20 A;  3E6D A;  2BOJ A;  5E89 A;  4LMF A;  4Q4V 3;  1YIP A;  4L92 A;  3ZYH A;  1W0N A;  3WF3 A;  1XYN A;  2EXH A;  1O3Q A;  2ARA A;  2JDK A;  2R1B A;  4NRQ A;  3C7E A;  5CKN A;  1S0G A;  3NV2 A;  3ME2 A;  1NA1 B;  1REE A;  4QQH A;  3CNA A;  2ZZQ A;  5ERL A;  5GLT A;  2C24 A;  3VD3 A;  5JOX A;  1I9R A;  2VBB A;  4QKB A;  5KXC A;  3P6B A;  4AVB A;  5DDJ 1;  4O65 A;  3WW4 A;  1JW6 A;  3WQ1 A;  1LU1 A;  1G8W A;  4COV A;  1JHN A;  2AEY A;  2RM2 2;  3NJZ A;  4A45 A;  3CZU A;  3RRD A;  3B9I A;  3LDR A;  1A3K A;  3IBM A;  4JGY B;  4C1W A;  4CU7 A;  1UKG A;  2DVD A;  5CFC C;  5HI0 A;  3LEI A;  4N9H A;  3HIF A;  2JX9 A;  2DCJ A;  4FBF A;  1GUI A;  1RMU 1;  4OYU A;  4Q1R A;  4Q8L A;  4QX0 A;  1QXJ A;  3MV0 1;  5CFD C;  1PMH X;  2D40 A;  1N1T A;  4GAZ A;  4CCM A;  1AR9 3;  4GWJ A;  5FUP A;  4DUV A;  1VJ2 A;  2P3I A;  1XNA A;  1NX9 A;  2QQW A;  3AZW A;  4WM7 B;  4IXL A;  2HYX A;  4AYU A;  4NHM A;  2ZGK A;  3H0O A;  2Y64 A;  1HB1 A;  1SFN A;  1WME A;  4MET A;  5BUV A;  5FKC A;  1KQR A;  3SH4 A;  5I8Y A;  3KVB A;  2P6H A;  2QQP A;  4QX1 A;  5FZG A;  2AZ5 A;  3FFQ A;  1BYH A;  4M00 A;  3UET A;  2ZX4 A;  3ES4 A;  2QQI A;  3B7M A;  5T50 A;  3PTY A;  1W6O B;  1STM A;  4RN5 A;  4AFD A;  2W39 A;  3OUJ A;  3W20 A;  3I59 B;  3EMR A;  1MS3 A;  3N9N A;  4B4Q A;  4LNV A;  2ES3 A;  1C5H A;  4FXG B;  4L11 A;  4LHN A;  4Y5S A;  2WT1 A;  3VBR C;  1Y7B A;  2UY8 A;  4IEQ A;  3MLK A;  4BXS V;  2YRO A;  3KSC A;  4UI9 L;  3TOJ A;  2R04 1;  3A23 A;  3ACH A;  4AWD A;  3RZZ A;  4QGM A;  4LA3 A;  5GM0 A;  4K1Z A;  1H2L A;  4IET A;  5FQ0 B;  3OPT A;  4J6G A;  2E53 A;  3ZFG C;  4ZU7 A;  3BCW A;  2G9F A;  1W9Y A;  2E7T A;  1W6P B;  2WS9 3;  3CZJ A;  1ZBA 3;  2ZAA A;  3WIN E;  4C0H A;  2PHU A;  3V64 A;  3ZDV A;  5FZK A;  1AUY A;  2XWB B;  4LO4 B;  4FO9 A;  1H8T A;  1MQT C;  3OYW B;  3U4S A;  3VBH B;  5CYY A;  5ACA 2;  4E2G A;  1QMJ A;  5BNO C;  4YNI A;  4FAG A;  2BOI A;  4J1X A;  3MYX A;  4IV1 C;  3IN9 A;  4K40 A;  3NWK A;  5FPV A;  2UWA A;  4GKX A;  1JZ2 A;  1L3J A;  5ANQ A;  5ACA 1;  1R09 3;  1VBE 1;  3VBU C;  1CZT A;  1ODM A;  5AC9 2;  4D7Y A;  3EXU A;  1PO1 1;  4QWN A;  4Y4R A;  1BQP A;  2B45 X;  5B4X A;  4XCA A;  3MFA A;  4TLF A;  3O7O A;  3HWJ A;  1VBC 1;  4NIA A;  1RUF 2;  2GAL A;  1QOS A;  1YQ8 A;  4UF0 A;  5JAX A;  3WW3 A;  2FDI A;  5DAB A;  1QJY 2;  2EIE A;  3GYD A;  1UX7 A;  5CBL A;  2R0H A;  3AVS A;  4Q0S A;  3RWN A;  4AW7 A;  4GMP 1;  2W08 A;  4NWW A;  4HN0 A;  1Y9M A;  4ZZ8 A;  1APN A;  1LKN A;  5C8C C;  4FOY A;  2BBA A;  2WAB A;  3LE0 A;  1BEV 2;  4HET A;  5FLI A;  4QB1 A;  5BNP B;  1HB3 A;  3CJI C;  3OUH A;  2XJR A;  5A6Q A;  3OGS A;  2HWF 3;  4WVV A;  2ZHN A;  3KV6 A;  1WW6 A;  2HWC 1;  1Q43 A;  2WAA A;  1BEV 1;  3AL5 A;  2ZEY A;  1H4G A;  1R1A 1;  5DAQ A;  3T1M A;  4BIF A;  1PVC 2;  1WCK A;  1YQ6 A;  4FPG A;  3MIB A;  4CEY C;  2VQ0 A;  4XAE A;  3U0Z A;  3LSE A;  5FJH A;  3OJB A;  1ENR A;  4FPY A;  1PVC 1;  2JB8 A;  1GZW B;  1VMH A;  2WSV A;  1OLM A;  2EAK A;  5FMD A;  1WMX A;  3AKS A;  4CCD A;  1ZRC A;  4PT6 A;  5JXH A;  2R07 2;  4BDV B;  2R06 2;  2BER A;  2FCU A;  1TMF 3;  4QQP A;  1JU4 A;  2D3R A;  4YVW B;  1LHN A;  2HEY F;  3QOP A;  4XBQ A;  3VDD C;  3ZXE A;  3LDB A;  3KWV A;  2A7A A;  2PN5 A;  4YZ4 A;  1JYT A;  4OVE A;  4P9X A;  1OQD A;  4N7U A;  1XXN A;  3GAL A;  1VIW B;  2HWB 2;  3I2O A;  2D43 A;  5DAV A;  1I5Z A;  1W0O A;  4NIG A;  1QJX 3;  1FNZ A;  1FOD 3;  3I2G A;  3UKN A;  2XG3 A;  5HV4 A;  1Y9Q A;  2WT2 A;  3FUO A;  2A6Z A;  4YW4 A;  5F5C A;  4XF4 A;  1RUH 3;  1YWK A;  1VRH 1;  3T2P A;  3ZVX A;  2HWB 1;  3BOD A;  1SLI A;  4CDX C;  2O8O A;  2J1E A;  2EID A;  2GH2 A;  5FUN A;  1H6Y A;  2P4E A;  1YO8 A;  1K12 A;  2W1Q A;  1HJF A;  2X10 A;  1Q8Q A;  1NA1 A;  2YYO A;  2ZGM A;  4M4P A;  3VBS A;  3WNO A;  5FZM A;  4CDU C;  1W9S A;  3RS6 A;  3LD8 A;  2BYV E;  1P8J A;  2PHW A;  4BQ1 A;  2WQ8 A;  4XFA A;  2P34 A;  2C1F A;  3PUH A;  2A5Z A;  4QX5 A;  4I2O A;  1R08 3;  4FPC A;  1VAM A;  3LSD A;  4BM8 A;  4AEK A;  3IIA A;  2ZGT A;  1U5I A;  5DZG A;  4CDW B;  1LNS A;  1JI6 A;  1J3R A;  2PYT A;  4N53 B;  4PIX A;  2RDQ A;  1H4H A;  4TLG A;  2RHP A;  2VZO A;  3N7L A;  2A1X A;  1BVV A;  1GZC A;  4AI1 A;  4CEW B;  5LW9 A;  2Q8O A;  1JOB A;  3WP6 A;  1IG3 A;  2E26 A;  1CAW A;  1LEM A;  4MGK E;  1FT9 A;  1PK6 C;  3M2M A;  4TTG A;  2FDF A;  3H1M A;  1O8P A;  2VOT A;  2YC0 A;  3OEB A;  3PJQ A;  4GJY A;  4AEJ A;  2ZGS A;  3J7M A;  2DVB A;  1IHM A;  4CP9 A;  3OD4 A;  2P3J A;  3I8T A;  4JHZ A;  1H2K A;  1K42 A;  2RE9 A;  2IUW A;  4R4Z A;  2VW2 A;  1DCS A;  1RVF 2;  1JZ6 A;  4DY5 A;  5KXE A;  4CXX A;  2BVB A;  1UPS A;  5KXB A;  3WD5 A;  1V00 A;  2ILM A;  4GWM A;  4LQR A;  1ZNP A;  3P1I A;  5FP9 A;  5F3E A;  1RVF 1;  3V56 A;  4BLJ A;  1SLL A;  1A8M A;  2WNV B;  3G6J B;  4NHL A;  5T5L A;  4Y22 B;  3ST7 A;  2FZ1 A;  1XYP A;  2IXC A;  3BIW E;  3U75 A;  1OFN A;  1X7N A;  2VXJ A;  4AI8 A;  4MO3 M;  4D3W A;  5AFE A;  4YZ2 A;  4GD4 A;  4QXB A;  1OA3 A;  3C7G A;  3PLQ A;  4QDR A;  1W6O A;  1V9U 3;  4XJ8 A;  2C5D A;  1HRV 1;  2HJI A;  2GU9 A;  3AMM A;  5DG1 A;  1F8V A;  5FZF A;  5LA9 A;  2DTW A;  2JDY A;  3FX3 A;  1VB2 A;  2VUD A;  4MV2 A;  5DN2 A;  5T5P A;  2J42 A;  3UJO A;  3WG1 A;  2WUH A;  5F2W A;  5H9R A;  5A3N A;  3AYD A;  5APA A;  5B2G B;  2J7M A;  5JXG A;  4BME A;  1ULP A;  2E7Q A;  5FZ9 A;  4MGS A;  5FZB A;  4D8M A;  2CU5 A;  4AI2 A;  4FTE A;  1AHS A;  1Y43 B;  1NQD A;  4W6Y A;  5SV5 A;  4E4H A;  4Q4W 1;  4AGV A;  5FQ0 A;  4HAN A;  3Q9O A;  1OOP B;  1LOE A;  2XWJ B;  5I0D A;  4DXS A;  1Y3T A;  3B00 A;  5FPB A;  1W6P A;  2D97 A;  1RUD 3;  2GC3 A;  3POS A;  2YC4 A;  5DXD A;  5FYZ A;  5E6H A;  3HOB A;  1B09 A;  3MDP A;  4NAM A;  3OYW A;  2PMW B;  3MFC A;  4DEQ A;  3ENR A;  3VBH A;  4IE7 A;  4X6R B;  1CX1 A;  3J26 N;  1O91 A;  1G6N A;  4UXA A;  2OYZ A;  1NY7 2;  4RGK A;  2XJV A;  3RWK X;  3VKM A;  3WEZ A;  2I45 A;  2IVJ A;  4H7M A;  4XDP A;  4IQP A;  4AED B;  4DRV A;  4U36 A;  2VJX A;  1VMF A;  2NQY A;  2WC2 A;  4XFG A;  1CAV B;  1GQP A;  2ARX A;  3FFZ A;  5FXV A;  2OA2 A;  4P14 A;  1NY7 1;  1AL0 G;  1ZZ8 A;  3AP4 A;  1BK1 A;  2V4A A;  4OUE A;  4Q4X 3;  1X82 A;  1F4H A;  2RS5 3;  2W2I A;  4QGN A;  1AR9 2;  1EAH 3;  1GWL A;  1LGB A;  2ZHM A;  2ZKN A;  3HQU A;  3TBD A;  2XUM A;  3IMN A;  5CB7 A;  1RUI 3;  2ZHL A;  2JIC A;  2Q1F A;  4RFT 0;  2Y60 A;  4AAX A;  3BTX A;  2WA3 A;  2WLP A;  1IQA A;  2TBV A;  2WZR 1;  1ZVF A;  1CZS A;  3HN1 A;  3ZKU A;  2Q1M A;  1NUK A;  1UY4 A;  2DUR A;  2JG9 B;  3TEX A;  5BNP A;  1SCS A;  3C7H A;  2VMH A;  1PHM A;  3IAQ A;  4V2V A;  3WX5 A;  3VBO C;  4AVA A;  1RUE 3;  3C7O A;  1E5R A;  4KGG A;  1JHJ A;  1GQH A;  1SLB A;  4IEP A;  2OUJ A;  4YM1 A;  3GBW A;  4M0N A;  3ZSK A;  2E33 A;  3PUA A;  1VBD 2;  4AQ6 A;  2OW4 A;  4CRQ A;  3LFI A;  5C8W A;  2GP3 A;  1Q8S A;  4AZZ A;  5A1L A;  2X53 S;  4GUL A;  5CA6 A;  3SKV A;  2C4X A;  4WV8 A;  1ND3 B;  2A6W A;  3FMG A;  3ZSJ A;  4CPB D;  2Y6H A;  3E5X A;  1GZW A;  1BBT 2;  1VBD 1;  3D82 A;  4MXV A;  4V1P A;  2W5F A;  4D6Q A;  5L19 A;  4AL9 A;  1F4A A;  1AZD A;  4Z8B A;  4GJZ A;  4W6W A;  1OFS A;  4NPR A;  1LOC A;  2MEV 3;  4EN6 B;  1ND2 B;  1RUG 1;  2YG0 A;  1BBT 1;  1PVX A;  4YRD A;  4YVW A;  2GC1 A;  4B3N A;  1OD3 A;  1ZA7 A;  2D98 A;  1HQW A;  1ZBA 2;  2WS9 2;  4XET A;  3WP3 A;  4BU2 A;  4DXT A;  1LHW A;  1EPZ A;  5FYT A;  4ZZ5 A;  5JPN B;  5C3O A;  2VUA A;  4P9J A;  2OII A;  5K9Y A;  3WNN A;  1ZM1 A;  1CON A;  3O1V A;  1BMV 1;  4KBZ A;  5A32 A;  5JSR A;  2CSG A;  3DUI A;  4JTO A;  2IC1 A;  4RA0 A;  3AYA A;  3WHT A;  3BIE A;  2VW1 A;  2Q8E A;  1N3P A;  2D7F A;  1PO2 2;  1AYN 3;  1SBF A;  5IVB A;  1R09 2;  3I3E A;  4Y1U A;  4PI2 A;  4ZS3 A;  5FY8 A;  3N9M A;  4EJR A;  4C90 A;  1NLQ A;  3I59 A;  1POV 3;  1PO2 1;  1SDD B;  4K21 A;  1PX4 A;  1JYN A;  1WLT A;  3N7J A;  4Q29 A;  5DAP A;  2WFF 2;  1L7Q A;  2JDA A;  4HZF A;  4FP2 A;  1VAV A;  3JB8 A;  1F35 A;  2GC0 A;  1KEX A;  2YPD A;  3TB0 A;  1ZZ6 A;  1HQN A;  2JE9 A;  1J83 A;  3MF6 A;  1OA2 A;  2OVU A;  1E57 A;  4CDW A;  4XHX A;  3PTR B;  4N53 A;  1UD1 A;  2OQ6 A;  2RJ2 A;  4CA9 A;  4FP3 A;  1OUR A;  3E97 A;  1DYP A;  4CCC A;  4CEW A;  5L7O C;  2RS3 2;  3WV6 A;  2C0Z A;  4XTM A;  3RYP A;  4YGD A;  1HDK A;  1ZRI A;  5HCF A;  4GZ9 A;  3AKQ A;  4MXW A;  3R4U A;  5LEK A;  3M8L A;  1QDC A;  3MBW A;  2A6X A;  2RS3 1;  3CMG A;  1X8M A;  4XMI A;  4YW3 A;  5FYC A;  1QQP 3;  1XC6 A;  4GB3 2;  3USU B;  4UW5 A;  5CKM A;  2WNU B;  3ZIW A;  5EYX A;  2DCK A;  2HLE A;  3NNM A;  4WM8 A;  5EHD A;  1X36 A;  4KWJ A;  3SXW A;  2FCT A;  3OUI A;  3H8X A;  4GB3 1;  3JB4 C;  3WCR A;  4BQ2 A;  1SFY A;  1TMF 2;  2JKB A;  2H0B A;  2GH8 A;  2WNV A;  4DIN B;  1Z7S 1;  1DG6 A;  4Y22 A;  2FDK A;  1K45 A;  4B4P A;  4WVM B;  3EB7 A;  2WO1 A;  5FPA A;  4P9I A;  1ZZB A;  3OGR A;  4Q8K A;  1OHF A;  1HN0 A;  1US3 A;  2BWA A;  5FZH A;  5JXI A;  1DQ1 A;  3WXP A;  5F32 A;  1RUO A;  3ZYP A;  3ZXL A;  1DGL A;  1CIY A;  4OI0 A;  1MR5 A;  4MYE A;  1S0I A;  1ZX5 A;  2A6V A;  2OQ7 A;  2IZW A;  1J59 A;  1VB4 A;  1OF4 A;  1RUH 2;  2VG9 A;  4XTP A;  5FZO B;  2CV6 A;  1Q8P A;  2VZQ A;  5KHH A;  1H30 A;  2JG8 C;  1QKQ A;  3VKF C;  4E4S A;  5IWF A;  3S5A A;  3WOG A;  5FY9 A;  1DYK A;  4LHS A;  4FXK B;  4UW4 A;  5G04 L;  5LBF A;  3WP4 A;  1ZA4 A;  5JMO A;  2C9A A;  2EXJ A;  4AVS A;  1JTZ X;  1REF A;  2G1M A;  5C9A B;  5CAD A;  2HYK A;  2ET7 A;  4KMQ A;  4JC1 A;  1AVB A;  5EIY B;  2ZHK A;  1CD3 G;  3LCP A;  1Q8O A;  1OOP A;  4X8N A;  1SZB A;  1S2K A;  1R08 2;  3IB3 A;  4NWV A;  1U5X A;  2JD4 A;  1NYW A;  3QLQ A;  1AYM 3;  5JMC A;  3MUZ 1;  1XJA A;  4IES A;  1LUL A;  2Y33 A;  2JDH A;  4KU7 A;  4ZKT B;  2Y0O A;  2XUE A;  1DP0 A;  2CNA A;  1K5J A;  2HKX A;  1ZBE 3;  5LAT A;  3FLP A;  2X5I C;  4COU A;  3VV1 A;  1SCR A;  1HQL A;  1ODN A;  1QJU 3;  3NQH A;  4QPG C;  3VZJ A;  4FQZ A;  1H9W A;  2L9L A;  3DEM A;  4K9S A;  4XF9 A;  3U07 A;  3UYJ A;  4BXF A;  1S1A A;  5I0U A;  3NNF A;  1CAV A;  1UY3 A;  3RNS A;  4OHY A;  1G9A A;  4MGY E;  5KHK A;  2Z5W A;  3WNK A;  5IFP A;  3FHA A;  4UW6 A;  5C4W C;  1UOG A;  1YYN A;  4XQD A;  3I3Q A;  1GAN A;  2YZ4 A;  4XUQ A;  1RUJ 1;  1DQ5 A;  3UJQ A;  2FMY A;  3FBY A;  3WF2 A;  3ABZ A;  4SBV A;  3K4D A;  4K7J A;  5ABJ B;  2E63 A;  4WZC A;  3AP6 A;  5JCT A;  1LOA A;  3POI A;  2PXJ A;  4PLN A;  4RR3 C;  1GQG A;  2WAO A;  1S4C A;  4BYY A;  1KJL A;  2JG9 A;  4LIT A;  3BKZ A;  5FMO L;  2A3X A;  5JOW A;  5CFC B;  2VO5 A;  4R9C A;  1NXD 1;  2R30 A;  5IK5 A;  4L2N A;  2P5B A;  3H9A A;  1XPW A;  1YUD A;  5ANN A;  1V9U 2;  4UBH A;  3SQO A;  1NCR C;  1C8N A;  1F31 A;  4GH4 A;  3OGV A;  4KBB A;  2VQT A;  3KT4 A;  2BNO A;  3NL1 A;  3NNL A;  1XU2 A;  4QHO A;  3RYK A;  3UGH A;  1DFQ A;  1MS8 A;  3HBZ A;  5FY7 A;  4LKF A;  1DGR A;  3PVN A;  1YXW A;  1ZYB A;  1ND3 A;  2HWC 3;  1BLZ A;  2Y6K A;  3MIH A;  3GGL A;  1XRU A;  5J09 A;  2B9V A;  2DYC A;  5HCB A;  5K0U C;  1R1A 3;  1YI9 A;  3AP9 A;  4AVV A;  1PGW 2;  2UU8 A;  2DVA A;  2UYB A;  2VH9 A;  4BLI A;  2ZXQ A;  5FPX A;  4DNY A;  2AAC A;  4E9K A;  5FRE A;  1W6Q B;  2V72 A;  1VBB 3;  2W91 A;  3K4Z A;  3MLJ A;  5BXX A;  3I2D A;  2PHD A;  3NMB A;  2R32 A;  1O5U A;  3OD0 A;  3S0M A;  1NCQ C;  1RED A;  4KWK A;  3O1M A;  1AR8 2;  2ZGN A;  1JYX A;  1GZT A;  1WCQ A;  2GNT A;  3J9S A;  4XF3 A;  4PBO A;  4BMB A;  2WO7 A;  4FSJ A;  4QQ2 A;  4Q27 A;  3KD4 A;  1LOF A;  3AZY A;  4EWA A;  3E6B A;  4QXK A;  1AR8 1;  2RMU 2;  3JBG 3;  3WUD A;  4ASK A;  5FYU A;  4A3X A;  3RJR A;  1VR3 A;  3K3N A;  4HVO A;  2A6Y A;  4LK6 A;  1OQ1 A;  4ZS2 A;  4Y5T A;  1ULF A;  1GLH A;  2RMU 1;  3EJK A;  1UX6 A;  3FN9 A;  3KVA A;  4CCE A;  4Q4X 2;  2QQV A;  2RS5 2;  4YVS C;  1LHV A;  1EAH 2;  4RQP C;  5KBF A;  3HVD A;  3KCY A;  3PUQ A;  2PHX A;  1ALY A;  3M1H A;  4XJW A;  5CU1 A;  2CDO A;  1RUI 2;  3LOI A;  5FYH A;  3AJZ A;  1GSL A;  2YBP A;  3ILF A;  4QDQ A;  1DQ2 A;  1QXR A;  1TE1 B;  2BNN A;  2I07 B;  4BWO A;  5DPN A;  1HV0 A;  4NJ4 A;  1N1V A;  2VMF A;  4ATF A;  2CAU A;  4Q1P A;  1RHI 1;  1HRI 3;  2RS1 2;  5D8A C;  2PEL A;  4S2G A;  3ZXK A;  4IV1 B;  1G9C A;  4RS5 C;  2RDR A;  3GCX A;  2AYH A;  3OBZ A;  2XGX A;  4UFK A;  3VL9 A;  1D4M 1;  4RHV 1;  4CCL A;  4OUL A;  1CWP A;  3N9P A;  5FPL A;  2VCB A;  1C1L A;  3USU A;  1GFF 2;  4LUK A;  4IE6 A;  3DV8 A;  5BNN C;  3SEE A;  4ISQ A;  1H8V A;  1UZ0 A;  2WZ8 A;  1RGS A;  1AJK A;  3PNA A;  4LOS A;  2VVD A;  4XMA A;  1QF3 A;  2Z2S B;  1CAX B;  4ERO A;  3W5M A;  2VY0 A;  2MEV 2;  1WLW A;  1YCI A;  3K77 A;  4NHY A;  1A6C A;  1N3Q A;  2GSY A;  2QQJ A;  4LBK A;  1YFX A;  4NRO A;  4Q5O A;  2EF6 A;  3FLR A;  4YG3 A;  3ZN6 A;  2IXL A;  3P3P A;  4P00 B;  3UV9 A;  3ZO0 B;  1RXG A;  3KM5 A;  4ARY A;  3VLB B;  4MGZ E;  4D6R A;  2YBS A;  4TXW A;  3BPZ A;  5IFT A;  1NQJ A;  3K3O A;  4Q4Y 2;  5BPX A;  4FFF A;  3H50 A;  2GNB A;  2Q30 A;  2VC9 A;  4A42 A;  5LRR A;  1QJZ A;  1UU4 A;  4KG8 A;  4NUB A;  5DAW A;  3TN9 1;  4CEY B;  5BYN A;  2Z69 A;  4LXL A;  4A4A A;  5FZO A;  2QQM A;  4AVT A;  4QX3 A;  4Q4Y 1;  2XLF A;  1AYN 2;  2UWB A;  3NVC A;  2E31 A;  4N43 A;  4WZF A;  5DUV A;  5J36 A;  3LQC A;  4IDZ A;  3VBS B;  1VP6 A;  4R9A A;  3DL3 A;  5C9A A;  4XZU G;  4J1W A;  3HPN A;  1F5F A;  2VQU A;  1LHU A;  4LUL A;  3KV9 A;  4O7X A;  2ZPX A;  4CDQ A;  5FUI A;  3VDD B;  4XPV A;  1W8U A;  2QE3 A;  4CUG A;  3K46 A;  2YB7 A;  2BWC A;  2JEN A;  2ZX0 A;  4RGA A;  2XBO 3;  1LOD A;  2A70 A;  4HBN A;  4WBB A;  3RZG A;  1IS6 A;  2WQ4 A;  4BE3 A;  5LWB A;  1MZ5 A;  2P17 A;  4BB3 A;  4KWU A;  1RUN A;  2B39 A;  2RM2 1;  1CAW B;  1T2X A;  2GC2 A;  3IDE A;  3J8F 3;  3QCW A;  4CCJ A;  1ULC A;  3AVR A;  3K4A A;  5JI7 A;  3WG3 A;  2PLV 3;  1H2M A;  5GKA C;  3QD6 A;  2FZ2 A;  2BJS A;  1FPN 3;  1GWK A;  4YLZ A;  2ADE A;  4CP9 B;  3TEZ A;  4CDU B;  4W50 A;  3KB5 A;  4ZU5 A;  4QKF A;  3HBK A;  5J7M A;  4HON A;  4YGC A;  4XQ4 A;  5FZD A;  1RIR A;  3BI3 A;  4XYX A;  1JZ7 A;  2BUK A;  2WN2 A;  1KIT A;  3PDQ A;  3UGG A;  2JD9 A;  3AXD A;  1T6G C;  4R52 A;  4UFM A;  1COV 3;  1WWY A;  5FWE A;  1OVP A;  5ABJ A;  2K0G A;  1CQ9 A;  2W1U A;  1AX0 A;  1UF2 C;  4ISR A;  3DN7 A;  4JVA A;  3D8C A;  1KXG A;  1WW7 A;  2D93 A;  4C91 A;  1OKO A;  2DV9 A;  4KGQ A;  5CFC A;  1UOF A;  5FZ3 A;  2NPI A;  4B1L A;  4PHZ A;  2HWD 2;  3U14 A;  2K9Z A;  2MNG A;  3ORJ A;  3SKJ E;  1W2A X;  1W99 A;  2XQR A;  2ZGO A;  2YBK A;  2YXS A;  3R6S A;  5CFD A;  4KG0 A;  2HWD 1;  1LOG A;  3BOP A;  5HCH A;  2DVG A;  4I0A A;  4YGE A;  5I8S A;  1OC1 A;  3WLU A;  5LAS A;  2D6K A;  2JB4 A;  3H3L A;  1POV 0;  4A3Z A;  1L7R A;  5CG9 A;  5A7W B;  3HD8 B;  1ENX A;  5LCW L;  3NO8 A;  4XFI A;  4PLM A;  3ZXJ A;  5F7U A;  3KHC A;  5L36 A;  4XFH A;  3WVJ A;  1DQ0 A;  2XDV A;  5A3T A;  2CHH A;  5JPM B;  1W6Q A;  3B9C A;  4IEO A;  2V73 A;  4DZG A;  1S2B A;  2JDP A;  3R05 A;  1QJE A;  1CJD A;  3VD7 A;  1OPM A;  2XJQ A;  2QQL A;  1AYM 2;  1DU3 D;  4ZPI A;  1WLD A;  3VHR A;  1VLN A;  4NIH A;  1JZ5 A;  5LB6 A;  3KQ4 B;  2UY9 A;  3OG2 A;  4IND A;  4EN8 B;  4FOQ A;  1PZ7 A;  2XON A;  3TNQ A;  3VBR A;  3VKL A;  2ZAB A;  3NJX A;  2D6M A;  3CJX A;  2IVI B;  1T6B X;  1TME 3;  3M3Q A;  2OPK A;  2F17 A;  1H0B A;  4D6S A;  4AEM A;  1IGO A;  4QX2 A;  4CYD A;  1D7P M;  1EPW A;  3MPP G;  5JOY A;  3ZFG A;  5AC9 1;  2N7G A;  3NAP C;  3SH5 A;  1FAT A;  1LR5 A;  2ZKL A;  1MEC 3;  1XE7 A;  4CXY A;  4QQL A;  1ULE A;  4AHX A;  1IOA A;  1RUF 1;  3I97 A;  4Q2F A;  5FY5 A;  1SEF A;  1MQT A;  3WDV A;  4LUM A;  5A3P A;  2WA4 A;  1QJY 1;  4JKK A;  1PIV 3;  4CUB A;  1OMI A;  2WWU A;  4CUA A;  2R1D A;  3ZDS A;  5BNO A;  2GN7 A;  3A22 A;  4FAH A;  4PF1 A;  3MI8 A; 
#chains in the Genus database with same CATH homology
 3WEZ A;  4CU8 A;  2VMD A;  1SHW B;  1NKG A;  2VJX A;  3DEC A;  2J1V A;  1GQP A;  2W94 A;  4OZO A;  4KI5 M;  1O59 A;  1KGY A;  3VD4 A;  4OUE A;  4LPL A;  1F4H A;  3CKH A;  3K75 B;  3T0B A;  3LEG A;  3WNP A;  3I3B A;  4AAX A;  1EUT A;  3LPG A;  2X05 A;  3WF0 A;  1CZS A;  3T09 A;  1NUK A;  1RYY A;  1UY4 A;  3C7F A;  2JE8 A;  3C7H A;  3PUI A;  1JZ8 A;  3IAQ A;  2WN3 A;  1UY2 A;  3C7O A;  3CIH A;  1JHJ A;  2ZEX A;  3ACI A;  3F2Z A;  4JX0 A;  5C70 A;  5A1A A;  2BGP A;  2E33 A;  4CUC A;  4W4Z A;  3SKV A;  4CU9 A;  2C4X A;  3FL7 A;  2VZR A;  4AG4 A;  2Y6H A;  2WYS A;  3I2F A;  4E8D A;  2W5F A;  5IJR A;  3FHQ A;  4A44 A;  1F4A A;  1K3I A;  3OBA A;  5JR2 A;  2R7E B;  4P02 B;  2YG0 A;  1JU3 A;  1GOH A;  1OD3 A;  4DXT A;  4ZZ5 A;  5HPO A;  4OMD A;  2VZ3 A;  1GOG A;  3U37 A;  2J22 A;  3WNM A;  3I2H A;  2J1U A;  3WNN A;  2Y8K A;  3J7H A;  1UXX X;  4DUW A;  2QQK A;  4QAW A;  2EIC A;  2VCA A;  2V4V A;  4ARX A;  3I3E A;  4Z2A A;  2QQN A;  3THD A;  2W3J A;  1SDD B;  3AC0 A;  1PX4 A;  3WSO A;  1JYN A;  2VR4 A;  2VZV A;  1L7Q A;  2JDA A;  1W9T A;  2BZD A;  1OF3 A;  4OMC A;  2W47 A;  2VME A;  1KEX A;  2VZP A;  1J83 A;  1OH4 A;  5DQ0 A;  1UY1 A;  2J1A A;  2RJ2 A;  1US2 A;  4W8J A;  4ET7 A;  4UAP A;  3HN3 A;  2W1S A;  4GZ9 A;  1O8S A;  2QBX A;  3HNB M;  3MBW A;  5B4N A;  3CMG A;  4IUG A;  4DEV A;  1XC6 A;  3VDC A;  2DCK A;  4XVH A;  2HLE A;  2VZS A;  2J1R A;  3VD9 A;  3HJR A;  4QB2 A;  3IAP A;  4JKM A;  3MV1 1;  4QPW A;  1J84 A;  3I2I A;  5JXJ A;  2J1T A;  4E8C A;  4XUP A;  1K45 A;  2BGO A;  2WO1 A;  2J1S A;  3EB7 A;  3OGR A;  1US3 A;  5JXI A;  1CIY A;  3I2J A;  4QB6 A;  3DYO A;  4A41 A;  1OF4 A;  4QDS A;  2Y6L A;  2OKX A;  1EUU A;  4XUO A;  4A6O A;  2VZQ A;  3A7Q A;  3T0A A;  5JMO A;  3NRU A;  1W8O A;  4LHS A;  5G04 L;  2X09 A;  2YC2 A;  4GWI A;  4LKS A;  1IQD C;  2XOM A;  4KMQ A;  4XUN A;  5EIY B;  1NAE A;  4MGQ A;  3LEK A;  5DMY A;  3IB3 A;  3WQB A;  4XUR A;  1W9W A;  1WKY A;  3VD5 A;  2WBK A;  3MUZ 1;  2XHN A;  3HEI A;  1JZ4 A;  1DP0 A;  2VM9 A;  3HNY M;  5LA0 A;  5LA2 A;  1W0N A;  3OB8 A;  1UY0 A;  3WF3 A;  3A21 A;  3NQH A;  2PQS A;  5HXM A;  3LPF A;  4D0Q A;  1GOF A;  2L9L A;  3C7E A;  4CVU A;  1UY3 A;  3WNK A;  3VD3 A;  5IFP A;  1YQ2 A;  3FHA A;  4XUQ A;  3P6B A;  3WF2 A;  3ABZ A;  3K4D A;  4DUX A;  2WAO A;  4A45 A;  3CZU A;  1MPX A;  1SG3 A;  2VO5 A;  4CU7 A;  3LEI A;  1XPW A;  3WF1 A;  1W8N A;  1UWW A;  3OGV A;  2DCJ A;  2VQT A;  1GUI A;  4OYU A;  4QX0 A;  3MV0 1;  1PMH X;  3NJV A;  2RVA A;  4GWJ A;  4UOJ A;  4DUV A;  2Y6K A;  1XNA A;  3GGL A;  3UES A;  1NX9 A;  3T2O A;  2B9V A;  3NNG A;  2HYX A;  3ACF A;  2W92 A;  1TG7 A;  2Y64 A;  2ZXQ A;  3DYP A;  3BGA A;  2V72 A;  2W91 A;  3DYM A;  3K4Z A;  1UXZ A;  4QX1 A;  3UET A;  1GU3 A;  2QQI A;  1JYX A;  1WCQ A;  4RN5 A;  2VMC A;  5IHR A;  1ULO A;  2LW8 A;  2E32 A;  1CZV A;  2B4K A;  4BXS V;  4UI9 L;  5C71 A;  3A23 A;  3ACH A;  4BJ0 A;  5IYY A;  3FN9 A;  5J1X A;  4RYD A;  2CDO A;  2Y6J A;  3CZJ A;  1GMM A;  4QDQ A;  2Z4F A;  3T0D A;  2WDB A;  5DPN A;  2YFU A;  2ORZ A;  5CYY A;  2VMF A;  1PMJ X;  2VCC A;  4HG6 B;  3T08 A;  2JKX A;  1JZ2 A;  1CZT A;  4BK5 A;  3WNL A;  4PQQ A;  4P5Y A;  5B4X A;  3C8X A;  2VCB A;  3MUY 1;  3SEE A;  2EIE A;  1UZ0 A;  2WZ8 A;  3WF4 A;  1UX7 A;  4ZZ8 A;  3W5M A;  2C26 A;  2BBA A;  2WAB A;  3K77 A;  2QQJ A;  3LE0 A;  2VZ1 A;  4QB1 A;  5CZK A;  3GDB A;  1HN1 A;  3OEA A;  3OGS A;  4P00 B;  3W5N A;  2ZEZ A;  4ARY A;  2Y6G A;  4TXW A;  2WAA A;  3EYP A;  5IFT A;  2ZEY A;  3MO4 A;  3ECQ A;  3ETP A;  1UYY A;  3VDA A;  2VC9 A;  2VZT A;  4A42 A;  2W87 A;  3I2K A;  1BHG A;  4L0P A;  4A4A A;  2QQM A;  4QX3 A;  2E31 A;  5EJZ B;  2RV9 A;  3LQC A;  4PT6 A;  4XZU G;  5JXH A;  3HPN A;  4BDV B;  2VQU A;  2BER A;  5FUI A;  1JU4 A;  3ZM8 A;  3K46 A;  2WO2 A;  2YB7 A;  1JYW A;  2KD7 A;  1I5P A;  3I3D A;  3I2G A;  4KWU A;  4CU6 A;  4XUT A;  1DLC A;  3BN6 A;  3T2P A;  1T2X A;  3K4A A;  2ORX A;  2J1E A;  2EID A;  1H6Y A;  1K12 A;  2CDP A;  2W1Q A;  2X10 A;  4M4P A;  4W50 A;  3WNO A;  1UMI A;  1W9S A;  1JYV A;  2W1W A;  4JKL A;  1P8J A;  2WQ8 A;  2ZEW A;  3PUH A;  2LS6 A;  4MAD A;  1JZ7 A;  2WN2 A;  4FI9 A;  3SEP A;  4DXR A;  2JD9 A;  2W1U A;  1LNS A;  1JI6 A;  1UYX A;  2VZO A;  4YPJ A;  3THC A;  5JUV A;  2W9X A;  2E26 A;  2VZU A;  3E1F 1;  4TTG A;  3OEB A;  1O8P A;  2VOT A;  3SKJ E;  1W99 A;  5G05 L;  2XQX A;  4JHZ A;  1K42 A;  3CDZ B;  3D3A A;  1JZ6 A;  4A3Z A;  1L7R A;  2ID4 A;  3GXU A;  4P08 A;  5LCW L;  5F7U A;  4LQR A;  2EIB A;  3P1I A;  2C9K A;  1GNY A;  3VDB A;  1R64 A;  1OT5 A;  5EJ1 B;  2VL4 A;  4MO3 M;  3VD7 A;  2QQL A;  1TVG A;  2W46 A;  3C7G A;  4QDR A;  3UNP A;  1UMH A;  1JZ3 A;  4MOA A;  1JZ5 A;  5C7G A;  3OG2 A;  3T2Q A;  2WO3 A;  1XNT A;  3III A;  5DN2 A;  2XON A;  5LA1 A;  3NJX A;  4ZY9 A;  2WUH A;  4BK4 A;  3IDA A;  2J7M A;  5JXG A;  1ULP A;  2VTF A;  4MGS A;  2WZE A;  4D8M A;  4QX2 A;  1D7P M;  2YFZ A;  2V5D A;  3JXS A;  5I0D A;  1DYO A;  1H6X A;  4DXS A;  3HNM A;  2W95 A;  4ZXE A;  2YC4 A;  3HOB A;  3I97 A;  1PX3 A;  2QQO A;  4JKK A;  3CQO A;  2DDU A;  3GM8 A;  4CUB A;  4DEQ A;  4CUA A;  4M4R A;  1CX1 A;  3A22 A;  3ACG A;  4PF1 A;  1UYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...