1XNAA

Nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
151
structure length
151
Chain Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the single-strand break repair protein XRCC1 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords PROTEIN (DNA-REPAIR PROTEIN XRCC1)
total genus 19
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01834 XRCC1_N XRCC1 N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xnaA00
2ZEZA 4QDSA 2WBKA 5F7UA 2QQMA 5IJRA 4XURA 4E8CA 1JYVA 3LEKA 1UYZA 2QQKA 5EJ1B 2YFUA 2HLEA 3MO4A 5JUVA 3ACFA 2V5DA 3IB3A 1JZ6A 2YG0A 3NJVA 2VJXA 1H6XA 4KWUA 2EICA 2X09A 4OUEA 1JZ8A 4GWIA 4FI9A 4RYDA 2JE8A 4DUWA 1PMHX 2QQLA 2BZDA 3LPFA 1K45A 2YFZA 2WAAA 3VD3A 4QDQA 3ZM8A 3CMGA 1R64A 1ULOA 4CU7A 4ZXEA 5LA2A 1KGYA 2VL4A 3PUIA 5CZKA 3IIIA 4CUCA 3HJRA 3FN9A 4JX0A 4ARXA 3NNGA 4CU8A 1BHGA 2J1AA 3SEPA 2E33A 2E26A 3LEIA 5B4NA 5LA0A 3OBAA 4KMQA 3ACHA 5IYYA 1OF4A 2XHNA 4XUPA 3IAPA 2VMEA 3K4AA 2X10A 1US2A 4A3ZA 3T0BA 3I3BA 2WDBA 1EUTA 2WN3A 3UNPA 2W9XA 2PQSA 5JXJA 3WF3A 2Y64A 4DXRA 1D7PM 2QQOA 1PX3A 1PX4A 4DUVA 2W46A 4XZUG 3WF2A 2VZUA 4P02B 2YC4A 2Y6JA 5C7GA 2B4KA 1GNYA 2J1SA 1OH4A 2WZ8A 1SHWB 3T08A 4DUXA 3VDCA 3I2KA 3CIHA 2ZEWA 4YPJA 2VCCA 2W1UA 3OG2A 1GQPA 2VMDA 3CZJA 4MADA 3ABZA 1OD3A 2VQTA 4P5YA 3NJXA 3WNKA 1GU3A 2W95A 4W8JA 1JZ2A 3LEGA 2DDUA 2W5FA 4A42A 2E31A 4BDVB 3A21A 5DPNA 2VZ3A 2QQIA 4Z2AA 1DYOA 2EIBA 3CZUA 4CVUA 2BGPA 3C7HA 4UAPA 5IHRA 1W99A 3K46A 2ORZA 3UETA 1GOFA 1WKYA 3E1F1 2X05A 4A6OA 4M4RA 5A1AA 1CIYA 5DQ0A 1W9TA 3MV01 2VZPA 3HPNA 4KI5M 4P00B 2WUHA 1NKGA 2VMCA 3HNMA 4QX0A 3K4ZA 5HXMA 2HYXA 2VZ1A 3A23A 4CUAA 2Y6LA 3D3AA 4A41A 3OGSA 2W91A 2WO1A 2VZSA 3WEZA 1DP0A 1XNTA 2VZVA 5B4XA 1XC6A 2W1WA 1SDDB 2XONA 5JXGA 1T2XA 2J1VA 3SKVA 1J83A 2VR4A 2EIDA 1UYYA 3T0DA 4A4AA 4TTGA 1W9SA 4DEVA 4DXSA 3BN6A 1EUUA 4QPWA 1TG7A 1K12A 3VDBA 2J1UA 1UZ0A 4LPLA 4IUGA 3I97A 2Y6KA 1GOGA 1K3IA 3P1IA 4P08A 2J1RA 4M4PA 2R7EB 1UMIA 2BGOA 3HN3A 3F2ZA 3VD5A 4A45A 2ZEYA 2XQXA 3LPGA 1YQ2A 1W8OA 1JU3A 2ID4A 2WO3A 4W4ZA 2ORXA 1UXXX 3HEIA 3VD4A 2LW8A 1GOHA 3C7EA 3C7GA 3FL7A 4XUQA 3VDAA 4DXTA 1CX1A 3SKJE 4TXWA 2KD7A 3WNLA 2V4VA 3WNPA 4XUNA 2DCKA 2W92A 3WNMA 3ETPA 4ET7A 1KEXA 2VO5A 2E32A 4MGQA 1JZ3A 1UY4A 2VCAA 5DN2A 3CQOA 1O59A 3OGRA 2VZTA 1W9WA 2YC2A 3DECA 3K4DA 3GDBA 3J7HA 1JZ5A 3OGVA 1OT5A 2W47A 3GGLA 3T09A 3WF1A 1UY1A 1JU4A 3THCA 1UY3A 4ZY9A 1OF3A 1NUKA 3MBWA 2QQJA 3I2HA 1SG3A 4QB6A 3FHQA 2VC9A 3IAQA 5G04L 1H6YA 1US3A 1UY2A 1JYNA 3MUZ1 2C9KA 1DLCA 1JZ7A 1HN1A 3LE0A 4DEQA 4OMDA 3CKHA 4PF1A 1ULPA 2VCBA 3EYPA 4UI9L 2VTFA 3I2IA 2EIEA 4XUTA 4JKKA 2JDAA 4BJ0A 2JD9A 2ZEXA 4JKMA 4D0QA 4AAXA 1XNAA 3DYMA 1GUIA 3CDZB 4LKSA 1O8SA 4ZZ8A 3I2FA 3OB8A 3WF4A 2DCJA 4JKLA 2W94A 1UX7A 4LQRA 5JXIA 2Z4FA 4CU6A 2OKXA 1UY0A 2CDPA 3C7OA 2VOTA 3C7FA 2BERA 1CZTA 1L7QA 4QX2A 1P8JA 4D8MA 4MO3M 4QDRA 1PMJX 3I2GA 4OMCA 4L0PA 1RYYA 2W1QA 4QX1A 2WABA 3PUHA 1JYWA 1WCQA 2WO2A 1JZ4A 1UYXA 3WF0A 3FHAA 2YB7A 3U37A 4GWJA 3IDAA 2WN2A 4UOJA 4PQQA 1CZVA 5HPOA 3A7QA 3EB7A 4E8DA 5FUIA 1CZSA 3WNNA 5IFTA 2W87A 3JXSA 3A22A 4ARYA 4PT6A 4HG6B 3LQCA 3MUY1 3GM8A 1NAEA 1MPXA 2VMFA 3I3DA 2J22A 3SEEA 1F4AA 4BK5A 2J7MA 3C8XA 1I5PA 2Y6GA 1J84A 3DYOA 3OEBA 4QB1A 5C70A 4MGSA 3T2QA 3T0AA 4BK4A 2L9LA 4GZ9A 1XPWA 4QX3A 1UMHA 5DMYA 5G05L 3WSOA 1NX9A 3WNOA 2XOMA 3I2JA 2VZOA 4MOAA 3HNYM 4QAWA 4ZZ5A 3HOBA 4OYUA 2W3JA 2W1SA 4BXSV 5IFPA 2VZQA 3W5MA 3ACGA 5LCWL 2ZXQA 5JXHA 2VZRA 3T2PA 1JYXA 3P6BA 2WYSA 4CU9A 2VQUA 3MV11 4W50A 2RJ2A 2WAOA 1TVGA 3BGAA 1LNSA 2C26A 2Y8KA 4XVHA 3OEAA 3THDA 5J1XA 5EIYB 2V72A 3HNBM 2B9VA 2WZEA 3ACIA 5I0DA 2RV9A 4OZOA 3I3EA 5JR2A 1W0NA 3NRUA 2C4XA 2WQ8A 3WQBA 3K75B 5C71A 1O8PA 5CYYA 2Y6HA 2CDOA 3W5NA 2QQNA 4CUBA 4LHSA 3GXUA 1K42A 4AG4A 2VM9A 3AC0A 3VD9A 4JHZA 3ECQA 3DYPA 1IQDC 4QB2A 2BBAA 1W8NA 1GMMA 2QBXA 2LS6A 2JKXA 3T2OA 5EJZB 5JMOA 4XUOA 3VD7A 5LA1A 3UESA 1L7RA 3K77A 1JHJA 1JI6A 2J1TA 2RVAA 1UXZA 1UWWA 4A44A 1F4HA 2J1EA 3NQHA 4RN5A
chains in the Genus database with same CATH superfamily
2D6PA 1XNBA 1WUVA 1V6IA 1DLLA 2H6BA 2QQMA 1OKOA 4CPBA 1JYVA 3LEKA 5GLUA 4AHWA 3VL9A 1HRI3 1KD7A 1D0GA 1ZZCA 2P6HA 4IEXA 1UO9A 1UMZA 5E88A 4GJYA 2A70A 5I0SA 1MEC1 2XG3A 2HLEA 4K7JA 5FQ0A 1URXA 3B00A 1O3SA 4LBOA 3FLPA 1NZIA 3ACFA 3FE5A 1J3PA 1GV9A 2V5DA 4XAEA 3ZXAC 1NQDA 1H6XA 5FZ1A 2EICA 2X09A 4Z82A 3ZPYA 4A7ZA 1LHNA 4CDXC 5J37A 1Y9GA 1AJOA 1ND2B 3O0VA 4LBQA 1PMHX 1DQ2A 4XJ9A 5FK8A 3ILFA 4QKBA 5FREA 4N90A 4NIDA 2D3RA 1HRI2 5IAXA 1ZRCA 1QXPA 1AVBA 1WW4A 2ZX0A 2F17A 4R9AA 1RUI2 3DV8A 4KGGA 3TOJA 1LOEA 2D44A 4IXLA 4C0BA 1R64A 2D93A 3WP5A 2ETEA 2AEZA 1NXMA 1V9U1 2VL4A 2RHPA 4J1XA 4LBLA 2GSYA 5GZFA 4CDUA 3POWA 1EP0A 1TZOA 4EZ4A 2X5IC 4QQ2A 3ZSLA 4E4DX 3FN9A 2WINB 4ARXA 4BM8A 4CU8A 3WDVA 1BEV3 1VBE2 4MVTA 1GWMA 4YNIA 4FPEA 1WW6A 3CHXA 3GYDA 2E7AA 3HMYA 2E26A 1HX6A 3M1HA 3B02A 3OBAA 5CNAA 3KV4A 5IVEA 4NWVA 2VVEA 4AVVA 2VTXJ 2DFCA 3IAPA 1I5ZA 2Z5WA 5E1RA 2NM1A 4A6SA 4A3ZA 4COUA 1BK0A 3R4UA 4Y24A 3I3BA 2IXKA 2ZHMA 1OA4A 3BTZA 3H8UA 2W9XA 4V2WA 3VHPA 2PQSA 5JXJA 1YC61 1BEV2 1QJX1 5CG8A 2IXCA 1VBE3 1G8WA 5CG9A 2WNVB 2C0ZA 3J9SA 1ST8A 2Y34A 4NJ4A 1FOD3 4NHXA 2AENA 2D6KA 3M70A 1H30A 3ZN4A 1O4TA 2R063 1PX4A 1R1A3 2W46A 1HRV2 5A70A 1J1TA 4P02B 2YC4A 1MS0A 5C7GA 2ZZQA 1GNYA 1OH4A 5A1LA 2FDFA 1BMV2 2RM22 1ULFA 3USUA 2WFF2 2W1UA 3ST7A 5KHKA 1GQPA 3H8RA 2E63A 2O14A 2XB6C 4FFHA 2VMDA 5FBZA 5KC6A 4LKEA 4XFBA 5JI7A 2H0VA 4QQOA 1A3KA 4KWLA 4P5YA 1KFUL 2CWMA 3CJXA 3NJXA 1H8TC 1HRV3 1BZWA 2KR2A 4M3CF 2X5IA 2I07B 4NIIA 1LGCA 2A6YA 4KGQA 1XNDA 2HEWF 3LEGA 3MIHA 2W5FA 4UW5A 4A42A 2JDYA 4FQ4A 4BDVB 5DPNA 4E4SA 1QJU2 3WG1A 3VGIA 5KHGA 2F4LA 3WG4A 1QY4A 3AYEA 2VG9A 1GZ9A 2AZ5A 5FDBA 1UIJA 2EALA 4V2VA 4C1WA 4AEDC 2P1BA 2A73B 1DYOA 1XU1A 2EIBA 2QVSB 3RJ2X 4ONUA 2ZGKA 1NZCA 4FPLA 2B8MA 1A6CA 2B39A 3VL8A 5FUPA 2BYVE 2RR11 2B7YA 2IXHA 3K46A 3UETA 4FBFA 2WSUA 3INAA 1A34A 5FXXA 1JOJA 4R52A 2V73A 5CKQA 4KU7A 1R082 1J3RA 3CF6E 4HPKB 2OZJA 2IVJA 4MGZE 3TAYA 4NPRA 1RTVA 4CCJA 5A33A 1C5IA 3O12A 4FAHA 4YW5A 3Q8CA 1JHNA 3I2DA 1QJEA 3LIGA 5C3SA 1EAH2 2VZPA 4BXFA 1J3QA 3LSEA 5HXMA 1HB1A 3PNAA 4INDA 5D8AC 2VH9A 4RSUA 3D3AA 3OGSA 2W91A 2BV4A 1OXCA 3IWZA 4YZ3A 1Z7S2 2UY9A 1DG6A 4PQ9A 2JDPA 2D3SA 5FZDA 2Y6FA 2XONA 5K0UC 3AYAA 3AYCA 4CXYA 1N1VA 3SKVA 1J83A 2O0OA 1X7NA 4GULA 4N53A 2BWAA 3FJSA 4XETA 4HN0A 5FZKA 4HKOA 1YHFA 1ZBE2 4JDOA 3JB4C 3NV3A 3PVOA 1H9WA 2ARXA 2WFPA 4N53B 5JAXA 4CCMA 1AR62 3BN6A 4TYSA 2ADDA 1GP6A 2GC0A 1S0EA 2TBVA 4J6GA 1RITA 3V0AA 1RGSA 3MIBA 2XWJB 1NE4A 1RMU2 1C1LA 1G9AA 1SBDA 5IK4A 5K8SA 2JDHA 2DCYA 2Q1FA 1W8TA 3S6PA 3SCGA 4WV8A 3OGGA 1W8WA 4YW6A 2D43A 4MGYE 1Z78A 4P08A 2R7EB 3WUCA 1BJQA 2BGOA 4IE0A 5KBFA 4BPZA 1AYN3 3VD5A 4LBQD 3E5UA 3LWCA 1AR63 2VULA 1GZCA 2NPIA 1JODA 3B7MA 3KWVA 1JU3A 2ID4A 4LOTA 2SBAA 4AVBA 1NYWA 1RUH2 3WCRA 5A3MA 1W9FA 2AR6A 2RE9A 2GAUA 1UXXX 3J4UH 3WNXA 3VD4A 2VUAA 2WS91 1O91A 4W6YA 3PHMA 4XUQA 3VDAA 1CX1A 4WM7B 3UL2A 2D7FA 4NIHA 1RUE1 1X8MA 3U75A 3AP7A 1GANA 4MX3A 2KD7A 5FY7A 1OLME 2JWPA 2RMU2 1ULDA 2V4VA 4XUNA 2DCKA 1S2BA 3I59B 5H9SA 5C9AC 1C5HA 1AYN2 1CAVB 1SFNA 5IUQA 2W92A 2OQ6A 3ETPA 1PZ8A 5A6XA 2CAUA 1IHMA 1KEXA 1QJZA 4CCNA 4DS0A 3V56A 5FKCA 5EWSA 4OHZA 5K7PA 5DAQA 3D8CA 2PLV3 2QKDA 1R081 4JHTA 1KXGA 2EXHA 1U0AA 2VQ0A 3VHRA 4WM8A 4XXAA 3PIGA 2Q8CA 4CXXA 3N9PA 3JQXA 4NAOA 3NAPC 3ZR6A 2IUWA 4K8FA 4CCOA 5CA6A 3J7HA 4YARA 3O0XA 3OGVA 4XOGA 1XE8A 3GGLA 1S2EA 1UY1A 4CDWB 3MFAA 3BI3A 1JOPA 3THCA 4LTAA 3ACLA 3F95A 4QPGA 1ZRIA 2LM3A 1RHI3 5CAZA 5FPAA 4EZHA 4BQYA 4HKLA 2PLV2 1Q43A 5CKNA 4PIYA 2QQJA 3GBFA 3VLBB 1XE7A 2JXAA 1PNFA 1SG3A 5LK5A 1D4M3 1ZZ9A 3FHQA 3IAQA 3P3NA 5BNPA 1LHVA 2WJSA 4LO8A 1UY2A 1W06A 3KV6A 2PLV1 1MQTC 1SLBA 4YVSA 1YUDA 1NCQC 5BNPB 3EMRA 5FZCA 2D5FA 4GKXA 4OMDA 5DZGA 1OLRA 3ROUA 2VD7A 4DEQA 1ULPA 3AZYA 2VXJA 4WVMA 2ZMNA 4UI9L 1K5MA 2VTFA 2Y60A 4QD2A 1CONA 1HV0A 2A7AA 5FR3A 1NCRB 4GWMA 5L7OB 4NO4A 4PBOA 1QOTA 4AE2A 4EE2A 3KZ4C 3BOWA 1K5MB 3VV1A 1D4M2 1OUSA 1S0IA 1SMVA 1SPPB 3MI8A 4L99A 2ZX3A 2A71A 2QZ2A 3J8F3 2ZEXA 4JKMA 4FVVA 3T1LA 1MS8A 4D0QA 1EAH3 2JG9A 1XNAA 3DYMA 1D4M1 1VAVA 4LKSA 1O8SA 3U07A 4IEOA 4LE4A 3OB8A 4JTOA 3WF4A 5JPMB 4MHUA 2PHUA 2VE1A 2DCJA 3DL3A 5JXIA 1YEWA 3VKOA 1CJPA 4GA9A 2JICA 2R043 2Z4FA 3CLPA 1Z7S3 2WR9A 4FXGB 2OKXA 1UY0A 2CDPA 4C90A 4CU6A 1EPZA 4SBVA 4H7MA 5C70A 1W6MB 4QQPA 5A3OA 5KXEA 1L7QA 1SLCA 4N9HA 1WBFA 3VZJA 4F83A 1FAYA 4IEUA 5I0RA 1V6NA 4P9GA 1UIKA 2D6MA 1DQ1A 1PMJX 1BEV1 1QJX2 2LRPA 1PO22 3ES1A 3FFZA 4LUMA 4YZ4A 5GLTA 5K4LA 1GZWB 3ZFEC 4ES9A 1EYBA 1JYWA 1RUJ1 3DPRB 1PIV2 2QTWB 2GZWA 4KH9A 2W2IA 3FHAA 4WVWA 4YVWA 2XHKA 4DIQA 1J59A 4UOJA 2WN2A 5FMOL 4AI0A 4G4FA 4Q0PA 5C8CA 1X50A 4MV2A 4CCCA 1CZVA 2GMMA 2HWB1 1HKDA 1W39A 4AF9A 5LBFA 3WNNA 1DF0A 3JXSA 1GWLA 1RUD3 4ARYA 4LO7A 3WG2A 2ZBJA 1CAWB 5EYXA 2BDRA 4COVA 4K21A 2JDNA 1EPWA 5IW0A 3N7MA 2E51A 1EV12 1F31A 3PLQA 4MSVA 5FMOS 3VBSB 2GH8A 4XE9A 5L9VA 1W3XA 3LGRA 2HWC1 3ZXFA 1XYOA 2J22A 2BQPA 3SEEA 3TN92 4QT6A 2LALA 1RIRA 3KHBA 4BQ4A 1ZRDA 2ARCA 4GH4C 1WD3A 1PZ7A 3OEBA 2JE7A 4Q26A 4MGSA 1POQA 4S2HA 4Q4Y1 3RMYA 3T0AA 4LK6A 3WQ1A 4Z8BA 5JZGB 2HYKA 1PK6C 4QGNA 3JB8A 4AFMA 1RUD2 4ZS2A 3RGBA 3S30A 4XHBA 3TB0A 1YQ8A 2XOMA 4RL7A 2VZOA 3AP4A 3POEA 3PVNA 4MOAA 3VKFC 1G7YA 1N47A 4XJ8A 1ZBA1 1BK1A 2Z69A 4KL1A 1EV13 1V0AA 1PGW1 4YM1A 1HB4A 4OYUA 3RZJA 3DF0A 1VRH2 3TN93 5LCWL 3SHRA 5JXHA 2VZRA 3T2PA 3ZDSA 3BOPA 1H4HA 1JUIA 2BU9A 3MYXA 4Q4X3 4W6WA 5F1RA 1BYHA 2WYSA 2VQUA 4X6QB 3WY6A 4PCRA 4YLZA 5FP3A 1J58A 3UT0A 4F7ZA 1BBT2 3UK9A 1TVGA 4BQ5A 3BGAA 4TZDA 1LNSA 1VE0A 1ZA4A 3SLIA 4X8NA 3PTYA 4Y1YA 4H7LA 2V72A 4UXAA 4RHV1 4AR2A 3WW1A 3I54A 1IKPA 1AR71 1N3QA 2E6VA 5C8CC 4HPKA 4AXOA 1UW8A 1VBA2 4GAZA 4XF0A 1FV2A 1RHI2 2AEYA 2C4XA 5LRSA 4N43C 5GZEA 3H1MA 4NE9A 1QU0A 5C71A 3PUAA 4RR3B 3ILNA 4GB31 4XW3A 3WHUA 2XL9A 1ZZ7A 5L9BA 2R1DA 2LROA 2Y6HA 4LO6B 4MG2A 2CHHA 4LJHA 4I0AA 1BBT3 5CU1A 1LU2A 5DAWA 5EFUA 4XFFA 2DCTA 3AP6A 1WW7A 4AG4A 5KWRA 4CEYC 5T50A 3AFGA 3R4SA 4I09A 3ZFFA 4DY3A 3ZN5A 5T5OA 1VAMA 3I8TA 4XF9A 1IQDC 4JCKA 2BBAA 2Z2SB 5C3RA 1ODNA 1W8NA 3SC7X 4Q4V2 2WA3A 4XMIA 1COV3 4B4PA 5LA1A 3JD71 1XYPA 3R05A 1YI9A 3K77A 5F3EA 3WV6A 4JGYC 5AVAA 2QQPA 2YC0A 1GNZA 1VB2A 1UXZA 1UWWA 2ENRA 3C2UA 1F4HA 1UOFA 3NQHA 2AACA 3UKTA 4RN5A 3FHIB 1STMA 4XURA 4E8CA 4LIUA 1W28A 1UYZA 1H1MA 5EJ1B 1LJ7A 3RVHA 1LGBA 4QHBA 5JWPA 3HT1A 2ZMLA 3AMNA 3N35A 4FPJA 4LLFA 1COV2 3E6CC 1Q56A 2UU8A 5JUVA 4OULA 4QX5A 5FPUA 2H6CA 3AYDA 3VZMA 3IB3A 4QKDA 3U11A 2YG0A 3BPZA 1JZ6A 5EP9A 2VJXA 4GXLA 4KWUA 3OBTA 4OUEA 5EV7A 4AI1A 3ZFFC 3AP9A 4COZA 1PGL1 1V9U3 2CU5A 4K9SA 3KS7A 2QQLA 3LFMA 4GH4B 3WQ0A 3D4KA 5BNQA 2BZDA 2R32A 4P9XA 3LPFA 2JD4A 3O1VA 3WINE 2XJTA 3NJYA 3LA3A 5F39A 5GLZA 5A6ZA 1HQNA 2ZX4A 5M0TA 3OBZA 1MZ6A 3CMGA 3K48A 4NR1A 1ULOA 4LKDA 4B29A 2PFWA 5GM0A 5A1FA 3I59A 4ZXEA 2QCSB 1KGYA 1AYM3 1SZBA 3NNLA 2FQPA 3FBYA 3KT7A 1CAXB 1XOYA 3JBG3 4FPHA 5CZKA 4IV1C 3ILRA 5FZ6A 5D1IA 5LY1A 3GNEA 5FQ0B 4BYYA 1POV0 5ANNA 4JX0A 3Q8AA 3BTYA 3OPWA 3OCPA 4JVAA 4P5HA 5FYHA 3B93A 1KDMA 4EYUA 1IPJA 1PVXA 4P9LA 2A6WA 4Q0SA 3AZWA 1UOJA 4PIXA 2UY8A 4BMBA 2E33A 2TEPA 4AVSA 1GKBA 1H8VA 5LA0A 1N3OA 5HV4A 3LB9A 5TSWA 2BUKA 2FBEA 2W68A 4KMQA 2ATFA 4YFZA 4I2OA 2D6NA 4XUPA 2VMEA 1AYM2 3OD4A 4Q1PA 1H2LA 2CGNA 4AYUA 5CFCC 2W08A 4H3WA 1IGOA 3VBOB 4XDPA 3UNPA 2WNUA 2VW2A 3E5XA 1QWRA 1S0FA 2HWF1 2QQUA 1AZDA 1MQTB 2X29A 3IMNA 5CKMA 2D3PA 5FXWA 1UF2C 3UV9A 3WF3A 2WSVA 4UF0B 4AQ6A 2DUPA 1Y9MA 1OKQA 4OHVA 3VBSA 1CIWA 3WDTA 1X82A 4W65A 2R30A 1DZQA 4D3WA 4P9JA 4H2AA 2QQOA 4XCAA 2DU0A 4CP9B 1ONAA 1HXS3 3WF2A 4Q8LA 5GZDA 3JCIA 5JOXA 4IV1A 1FNZA 1ULCA 3E6BA 2B4KA 2J1SA 2WZ8A 3NAPA 2ZAHA 2BVBA 5A3UA 4BU2A 4FCAA 1NLSA 3VDCA 4EQVA 1QHDA 1T6BX 1IS5A 4MLOA 4BIOA 3DCQA 5H9RA 4CP1A 2CV6A 1W8FA 1WA6X 1I6XA 3ZR5A 2RS11 1W2NA 3VBFC 1XNKA 3CZJA 5EQUA 1ZYBA 5JDBA 3ABZA 3NV4A 3TNPB 3H8XA 2ARBA 3MDPA 3KB5A 2GMEA 1WMXA 2DUQA 3AMQA 1JN2P 4ZU5A 2Y38A 3MLLA 1SCRA 5FTTC 5A7OA 2WNUC 5F9TA 1Y43B 1OURA 3B01A 3KHCA 4U2AA 4DZGA 1VMHA 2KXLA 1PGL2 3K3OA 4QKFA 2QQIA 2HBTA 3OSDA 3VHNA 4LEJA 4AAPA 5C4WA 5A3LA 4QMAA 4YW3A 4AEKA 4MGIE 3PUQA 4IEWA 4O65A 3ZLIA 4KWJA 3TNQA 4CVUA 1OMIA 4ASLA 3OBRA 3GZUC 2D6LX 4LORA 2BGPA 3FMGA 4HLTA 4Q0VA 4XC9A 3IIAA 5IHRA 1ND3A 5LBBA 2ORZA 1JH5A 2EXKA 2DTWA 3QBQA 4HONA 5KHHA 3E1F1 3VKNA 3H3UA 5AC93 5C9AA 1KDKA 1AL23 1OPMA 4YM0A 3CO2A 4QM9A 2ZTNA 4WVMB 1NA1B 2VMIA 5A1AA 1RMU1 3ZSEA 4UFLA 5C9AB 1RUF1 4LR4A 2PHRA 3AKTA 4V1PA 1AX2A 3MHZA 5GLWA 3MV01 4KI5M 1XRUA 1HIXA 4JGYB 4QX0A 1RUF2 4LO5B 1TE1B 3RRDA 5A3PA 1NQJA 4UW3A 4AQSA 4C91A 1W6PB 5ABJC 2HWB3 4PLOA 4A41A 3SITA 3TEWA 3ZYIB 2P6CA 2WO1A 4FPFA 1LEDA 1LECA 1O5UA 4JDMA 3WCSA 1DP0A 3WEZA 2WQ4A 4K6BA 1V70A 4E4ZA 1XYNA 5FMDA 2PMWB 3SXWA 1XC6A 1ZZBA 2HEVF 4QPYA 1SDDB 2C1FA 1T2XA 3KCCA 5J36A 2BOIA 1I1EA 4OQ8A 1UYYA 1PNGA 3J26N 4META 3T0DA 2PHXA 4XFIA 4YW1A 4A4AA 4TTGA 1U5IA 2BVVA 3B3QE 4CA9A 4Y20A 4ZU4A 4EN9B 3NMBA 3D5OA 2ZHLA 1CD3G 1RUF3 1RUC2 4E9KA 2RMU1 1UYPA 4Z07A 1H2NA 2BEOA 3JBG2 1V6LA 4MUVA 2NMNA 3VDDB 4AK3A 1WMDA 3IPVB 4BH9A 1W03A 3KT4A 2XUMA 2XMLA 2B42B 3GZEA 4FPCA 4K1YA 2XJSA 4RS5B 1TQ5A 5C6CA 4LPLA 4PJYA 3VBRA 5HV0A 1UQXA 4AZZA 3H9AA 3PVBB 3MICA 4BMEA 3OPZA 2ZZJA 3V0BA 5FPVA 1REDA 3EQEA 1AX0A 5FZ7A 1WCDJ 3ZX7A 5JIUA 3R4DB 4NRMA 4AI2A 4GH4A 1ZBA3 3LDBA 4FPKA 1UMIA 4NVPA 4QQHA 4Y26A 3VBRB 2WKKA 3WT3A 2JX9A 3WW3A 2O1QA 4P9WA 2Q1ZB 1GBGA 1RUC3 1YQCA 2XQXA 3DN7A 3I4IA 3LPGA 1CJDA 2R0FA 5BUVA 3FUOA 2WLQA 1YQ2A 2JG9C 1W8OA 4R4XA 4RR3C 3AMHA 3BU7A 4I0BA 5D21A 5CB7A 4YG0A 3O1OA 2WO3A 4CCLA 3BPSA 1K5JA 3OJBA 4FOWA 2Q1MA 3K51A 2ORXA 1REEA 1JYTA 1FV3A 5JSRA 4B1MA 2LW8A 4UBHA 3C7GA 1S0CA 2RM21 5BYNA 2C5DA 1V6MA 3P5BA 4XPVA 2E7QA 5FPZA 2CWSA 5BPXA 1JYCA 5IAVA 3WNLA 4LUKA 4YVSC 3WNPA 4CPBD 1W0PA 4IERA 4FFIA 2ZGNA 1TNRA 5LEJA 2CNAA 2ZACA 2DBNA 1Q8VA 2E32A 1V6OA 4XBQA 5DXDA 3VBOC 3POIA 4O61A 3VBHB 3W21A 1JZ3A 1U12A 1ZRRA 5CFCB 1UY4A 1VIWB 5FO9B 4FSJA 3J7MA 1HN0A 2QE3A 4O9EA 3OGRA 1Y3TA 2V5YA 3DXTA 2JENA 3GDBA 3V64A 1VPHA 3WW2A 4AFBA 5J09A 5LBEA 2R6QA 3KF3A 1JZ5A 1OT5A 2W47A 2IFWA 3NWKA 1YIPA 5FZGA 4WBBA 1F2NA 5E89A 4KG0A 2PN5A 3T09A 1PGSA 3WF1A 1RUI3 2JDMA 3ES4A 1JTZX 2JKBA 4OVEA 1UY3A 3EO6A 3IZOA 3PIJA 4I02A 1N1YA 4ZY9A 1OF3A 1NUKA 5FYYA 4LA2A 5FRAA 1FMD1 1PVC1 4YGEA 4TN7A 3CNAA 1VBD3 3MBWA 3I2HA 5FXVA 2DVDA 2WWSA 4FPOB 2VC9A 1CGPA 1VBC2 3B9IA 4ISQA 1WLWA 2OXBA 5FJKA 4ZHNA 1GLHA 1US3A 3UJQA 3MUZ1 1DLCA 1W90A 2DYCA 2P34A 3MW2A 5JOWA 3I2OA 5DAXA 1RUG1 2AGSA 1GZWA 1NY71 3OUIA 4PF5A 4PF1A 2JG8C 4FAGA 2VCBA 1EAH1 1WGPA 2DFBA 1ZZ8A 1LKNA 3EYPA 3OYWB 4YVWB 2H0BA 3E6DA 1LEMA 1S1AA 4CDWC 1POV1 2QUOA 1DGLA 1VBD2 4AGRA 3SQOA 1LB2A 4JKKA 1HQLA 2JD9A 1XBFA 3H1WA 5JVVA 3BTAA 2MHFA 1UZZA 2XJPA 3QH7A 3FWEA 3RI9A 1UKRA 1FATA 5F37A 3RI8A 3AKQA 1O3RA 1GUIA 1HDKA 4YM2A 1WW5A 5DG2A 1DQ5A 3VBOA 5K9YA 3WDXA 3I2FA 1YRZA 5GALA 2WT1A 3BKZA 1MR5A 5B2GB 4NHMA 4QKNA 1DDLA 4WVVA 4XTMA 4YVSB 3NVCA 1UX7A 4D6SA 4PBPA 4FT8A 1OI6A 3ZIWA 2VNRA 5DUXA 4K1ZA 1RVF1 3UGGA 5J7MA 3KVBA 3BIWE 4XDQA 2B45X 4IGPA 3BALA 1I3HA 2XJUA 5C3PA 4HKWA 2PAMA 1RUOA 4COYA 1POV3 1RVF2 3V0AB 4PIZA 2WS93 4CDQA 1IS6A 4I3GA 3I2GA 4OMCA 1RUD1 3C3VA 3NJZA 4XFAA 1RYYA 4QX1A 1Z0HA 1R093 2WABA 4FFFA 1DFQA 5E6HA 3OF1A 2OYZA 2WO2A 2K2SA 2NYYA 4MH0E 1W6NA 4LXLA 5FY5A 3WF0A 3FLTA 4FP3A 4XAAA 1IOAA 4IEPA 4GWJA 4XHXA 5BV6A 3IDAA 3MLKA 5FO8B 4YWAA 3AP5A 2OPWA 2VOWA 3LFIA 1GWKA 2ZKNA 1W04A 1CQ9A 1VBB3 2HWF2 3JUUA 5FUIA 4DY5A 1VRH1 1CZSA 3RZZA 4FTEA 2VVDA 1QJU3 1QQP3 1GFF2 5IFTA 1XB9A 2WZR3 4J25A 4PT6A 3ASIA 3LQCA 3MUY1 3A0KA 1JW6A 3LEMA 4NOTA 1RB8G 2GC1A 2OUHA 2PHDA 5HCFA 3AM2A 2DWRA 4X8PA 2CTVA 4XF1A 4AHZA 1YXWA 3GM8A 1LENA 1NAEA 3TEYA 2WNVA 1GICA 3ZN6A 1MPXA 2WWUA 5T55A 4IE6A 2PTMA 4CDUC 3QCWA 3H8OA 4CEYA 1TEIA 2DVBA 2VBDA 1YQ6A 3H7YA 4D7YA 1AR72 4XFHA 2J7MA 4BK5A 1PO11 1Q3EA 2R49A 3N9OA 3Q8EA 4XF3A 3T30A 4LHLA 2FZ2A 1U5ZA 2FCUA 1EY2A 4DMIA 4P14A 4GJZA 1R083 4QB1A 1LOAA 5F2SA 4Y22B 1AR81 1UD1A 4LO4B 5IK5A 3IMMA 1NCRC 4QX3A 2DTYA 5DMYA 5G05L 1BKZA 2YPDA 2GU9A 4GMP0 2RR12 5C8WA 1LHUA 3PMEA 3ZFGB 3I2JA 1ALYA 1QJU1 1PMIA 2RS13 3ZIXA 3G7DA 4N43B 4MXWB 4X6RB 5DDJ2 3KF5A 3ZVXA 1L7LA 5GZGA 1AR73 3ACGA 2ZGMA 2OPKA 2ZXQA 4CP2A 3O1RA 1RHI1 1YJLA 1W2TA 2DF7A 5AC91 1JYXA 2JIJA 2ZHKA 3P6BA 4Q27A 2QQVA 4CU9A 2LTNA 1JMUB 3N9MA 4W50A 5FZ3A 2Q8EA 2G9ZA 3LSDA 3KM5A 3KV5A 2VOVA 2WAOA 3WDYA 4B4RA 5FWEA 1DYKA 3CL1A 4LK7A 3JU9A 5H9QA 1X9TA 4BHPA 4XVHA 1WA4A 3JD72 2RR13 1QOSA 3AJZA 3NV1A 1QXRA 1W6OA 3GCXA 4HETA 4QM8A 4XACA 3W20A 5F32A 4S2DA 5J1XA 4XFGA 2VOKA 2NLRA 5FY8A 1QKQA 4N7IA 2R0HA 3M4FA 3QOPA 1MS1A 2RS51 2RV9A 4AVTA 1OLQA 2RJLA 2OQ7A 3I3EA 4QXKA 4XTPA 2XVGA 1W0NA 3EJKA 2WQ8A 3HQXA 5EHDA 1GR3A 1QJY2 3N7JA 3K75B 1YFXA 3PMSA 3KSCA 1B09A 2UYBA 2CDOA 3W5NA 5L36A 3WVJA 1BQPA 1UU6A 3J8F1 4Q8KA 5T5LA 3UKVA 3AMMA 1NLRA 5L7OA 4KU8A 1QH7A 3VD9A 3KLSA 4JHZA 5E16A 2BTVC 4WM8C 5BNOB 2NN8A 4NN0A 4L8QA 3ECQA 4PI0A 4XJAA 3DYPA 1DBNA 5L73A 3RWKX 4AOCA 1HB3A 1SLTA 2ZOEB 1ZA7A 4TWTA 1ENXA 1W8ZA 5FPLA 1HB2A 1N3PA 5EJZB 2JECA 4XUOA 4CCDA 4U36A 1IS3A 4UBGA 1L7RA 4Z2WA 1OSGA 3ZXDA 4BLJA 1H4GA 2QNKA 1BVVA 1DGRA 4RQPB 2TNFA 3K2OA 1APNA 5SV5A 1RJ7A 4ZU7A 2J1EA 5JMCA 4LBJA 5FY0A 3ZYBA 5FOBB 5FZOA 1RUH1 1CAVA 2EXIA 4LULA 3VZLA 4QDSA 2WA4A 4EJRA 3S7EA 3H3ZA 3MIEA 5IJRA 3LIHA 2DU1A 3NO8A 3UGHA 3HBZA 1CVNA 4QHZA 1XJAA 5FWJA 1F5FA 5IK8A 1VRBA 2YFUA 1CR7A 3WD5A 1OVPA 3IDCB 4EWEA 4Q2FA 5A32A 2WIIB 4MXVA 3R0RA 4AEDB 3VHOA 5K0UA 5F3CA 1AYN1 1YYNA 4S2FA 3N7KA 3KGLA 4Q4W2 3FLRA 2WS92 3S5QA 3BU0A 4PLMA 5ANQA 5FZEA 1FOD2 5CFCA 4OCTA 4GWIA 2N7GA 4FI9A 1R092 4PI2A 5HXVA 1AYM1 2JE8A 2R062 5DUWA 4DUWA 4Z92B 1IS4A 2RDRA 2XLFA 3AKPA 1OBNA 5A7WA 5DABA 1PIV1 3WDUA 1RJ8A 4H55A 2FDHA 1QIQA 1K45A 2NMOA 1CESA 4K8RB 2YFZA 1RUE3 4Y3OA 4PDWB 3MZHA 3VD3A 4CP9A 4CXWA 4QDQA 4LNVA 3ZM8A 1MEC2 1QQP2 2JEMA 1A8MA 2WFF3 3VBRC 2JG9B 4DB5A 1ACCA 1FYUA 4Q4W3 4UF0A 2YU2A 5FP4A 3LOIA 3ORJA 5CFDC 4I0WB 3IIIA 4QHOA 4YGBA 5I0UA 3HJRA 5D8AB 4CUCA 2XDVA 5ABJB 5KXBA 1V6KA 3ZXGA 5AFBA 3NNGA 4I01A 5T5PA 5JZGC 5FYMA 2GNBA 5KXDA 3SEPA 5IK7A 5A6QA 4CRQA 3LOBA 5B4NA 4ES8A 1BLZA 5FYZA 2JDUA 3GF6A 4A2UA 1HQWA 2CL2A 4FTBA 1ASJ1 2XLGA 3D0JA 4E2QA 3ZKUA 3ACHA 2XVKA 5IYYA 4UFJA 5JI9A 5EZWA 1OF4A 1B35B 4DPNA 1AHSA 2XHNA 3CBNA 2IXLA 3MPPG 1L3JA 5IATA 3IKWA 4HBNA 4CP0A 3OUJA 4GB33 3RZKA 1ZNPA 3K4AA 4GMP1 4NIGA 1US2A 2FMYA 3AB0A 3DPRA 3PJQA 1EUTA 2WN3A 2RS12 3DGTA 4B7EA 1LHWA 2PHFA 2VMGA 2BW8A 4RQPC 2BOJA 5FZLA 2DVAA 4AQ2A 4CTEA 2Y64A 3NNMA 2A6ZA 3ZSJA 4RD7A 5FYBA 1DHKB 4Y1UA 5FKBA 3MPBA 2BFUS 1C4RA 1D7PM 3IBMA 1LU1A 2R042 4OI4A 3BYWA 5L9RA 4EN0A 2QFEA 4XZUG 2YBPA 3PU8A 4DUVA 2VZUA 1VBC1 3ZFGC 4KNCA 2Y6JA 5CFDA 1PK6B 2XBO2 4PHZA 3OYWA 1SHWB 1FNYA 1B35C 3T08A 3RWNA 2AH2A 3RSJA 4DUXA 1S4CA 3I2KA 4OI2A 2ZEWA 1A8DA 3ME2A 1PK6A 3W9AA 3H3LA 4YPJA 1X8EA 5FOJB 2VCCA 3MF9A 3AX4A 2UURA 2VQAA 1O6UA 5J98B 4N7UA 1CAUB 1QJY3 3VBSC 3HR9A 3VB9A 1FI2A 1XE0A 3EHKA 2EAKA 2EIGA 1G86A 2VQTA 1TMF2 3BCWA 5EXOA 3QH6A 2AC1A 3ZFFB 2CGOA 5DUVA 2E9QA 1WCUA 3ATGA 4QX7A 2OT7A 4XBNA 3WUDA 1NA1A 2WWJA 4W8JA 3O1SA 4L9BA 1JZ2A 1U5XA 2W39A 3A21A 3AXEA 1Z7S1 3LF7A 1W3VA 2VZ3A 3ON7A 1OQ1A 3PTRB 1K5MC 2ERFA 2VW1A 4M00A 4OI1A 4Z2AA 3U0ZA 3MW3A 1TME1 5FO7B 4NRQA 2YMZA 1JXNA 3CZUA 1VBB1 5FIXA 5F5IA 3MF6A 1QQP1 5LB6A 3C7HA 5JZGA 1OA2A 2ZGPA 4UAPA 5LRRA 5I91A 2KA3A 1W99A 3AKRA 1AXKA 1RUJ3 3LA7A 3I3MA 5BNNB 4NAMA 4YZ1A 5HI0A 5ISLA 3MIDA 3S7IA 1WKYA 2GALA 3WP3A 4DRVA 5CIRA 1R1A2 1LODA 1OQEA 2OUJA 5FZHA 4A6OA 4AHYA 1M4WA 4Y20B 2NP0A 4QWNA 4E8DA 1GQGA 1ULGA 1SLIA 3J7NA 1W6QB 4CCKA 5HBAA 1SDWA 3A4UA 3O5SA 3POBA 5F8PA 2WUHA 5E8AA 4BLIA 1DCSA 1NKGA 2FCVA 2VMCA 3HNMA 2ZA9A 1C28A 1R1ZA 3M8LA 5FBJA 2BNNA 4N43A 2B9UA 1XSRA 3U14A 2PA7A 4XQ4A 2IWGB 5JOYA 2HYXA 4GQ7A 3OPTA 3A23A 3ZO0B 1H2KA 3JBG1 2PXJA 3QLQA 2VZSA 3KV9A 5FK7A 2WT2A 3TWIA 3MGUA 1XNTA 1RUNA 3VBUB 2VZVA 4DINB 2HJIA 2W1WA 4ITCA 3THPA 1NXD1 3W58A 4Q4Y3 1KJLA 2J1VA 4TLFA 1UOGA 5EYYA 2VR4A 4Y22A 2FMDA 5IVYA 2EAAA 1DQ6A 3FBMA 1NA1C 4LITA 3RNSA 3ZYJB 1JYIA 2XLAA 1W9SA 2B46X 4O7XA 1PO13 1EUUA 4NPMA 3N9NA 5SV8A 5IVFA 1NCQA 2ZCWA 4JZRA 4MXWA 3POYA 3VDBA 4IEZA 4AFAA 1V00A 1CPNA 1OQDA 1OUXA 1GSLA 2J1UA 4E2GA 4Q0UA 3SH5A 2R072 4RHV2 1QDCA 1N1TA 1OPOA 1UZ0A 1W0OA 2VUDA 3UGFA 2HWE3 4Q0QA 3I97A 2QDNA 3V65A 1BVP1 4M3CB 4PDWC 5I0TA 1GYKA 4BQ3A 1K3IA 2MNGA 1ND2A 3P1IA 3E97A 1WLTA 4I3PA 5ERLA 4M4PA 2HWD2 1BXHA 4K20A 4Q4V3 3ENRA 4OI0A 2GC2A 2IVIB 3F2ZA 3HN3A 2E7TA 4HXCA 4A45A 5ACA1 4L11A 4QQLA 2CY6A 2DV9A 2ZEYA 4GB32 5T3NA 3ZDVA 3PVEA 2K0GA 1QF3A 2YPJA 4BOWA 2QQWA 2WQZC 4NROA 3LDRA 3HEIA 3ZN6B 3VDDC 4IV3A 1NOVA 4D6QA 2RDQA 2HWE2 1VLNA 4OZXA 4CUGA 3FX3A 3APBA 3MIFA 3HWJA 5APAA 2ADEA 1Q8SA 1UPSA 2ZGOA 4L92A 2XKOA 1OC1A 1T6GC 2Y26A 4IW3A 2BRTA 2RDSA 5IWFA 4D7TA 1REFA 1FXZA 2GN3A 1SBEA 4GKYA 4LBKA 3MFCA 1XQNA 3EXUA 1AF9A 1MZEA 3J8F2 4MGQA 4ORFA 1SFYA 2XXZA 4RR3A 4B3NA 1HV1A 3PU3A 5LASA 4XJWA 5LZ6A 2P3YA 1ZBE3 1KFXL 2YHJA 5DN2A 3O1PA 1O59A 3T2TA 4EN6B 4RS5A 1FMD3 1PVC3 3HT2A 4IEVA 2ZHNA 4FOVA 1VBD1 1IG3A 1O4YA 4WZCA 3L2HA 1OOPC 1RMU3 1TMF3 5AVPA 3RDIA 2XPJA 4XCBA 2A3WA 2DCZA 2OS2A 2QJVA 2FHRA 3AMPA 4MYEA 4H14A 4MZUA 5JLVA 2YYOA 3WR0A 3VN4A 2CGPA 2BGCA 2I74A 2OA2A 2VVFA 2WO7A 1F5JA 1ZZ6A 2IXIA 5A7PA 1O3TA 1SLAA 4FPGA 2FD8A 2W52A 4BB3A 1YJKA 4N53C 5LK7B 1D2SA 4PDWA 1QJX3 1PO23 1TNFA 4C1XA 4YZ5A 4CSWA 3TBDA 4IE5A 4AVAA 3WXPA 1PIV3 3H7JA 1RXGA 4CDXA 5IVJA 3VBHA 1ENQA 4IE4A 1UN1A 1HLCA 4Y33A 3ETQA 1FX5A 2C9KA 1RUH3 3SMHA 1JZ7A 1HN1A 5KXCA 3LE0A 4JGZC 2OZ6A 3CKHA 3RPQA 2P17A 1NCRA 5DG1A 1WMFA 1H8TB 4Q4W1 4BE3A 2ZGRA 5LW9A 1HJFA 4RFT0 2RMU3 2G1MA 3DUIA 4COWA 5A3WA 3T1MA 5CBLA 5T52A 1H8TA 2WNUB 1BMV1 4XUTA 1JUHA 1ZREA 1I9RA 3HVDA 2JDAA 3GJBA 4RGAA 4Y5SA 1O3QA 2ZAAA 3EBRA 3NKGA 4KBZA 1OOPA 3VKLA 4AAXA 1ASJ3 1AR92 1DU3D 3PUSA 4UWDA 3MIGA 4AHXA 4CE8A 4ZZ8A 5FZ9A 4OHXA 1MS9A 5FZIA 2JG8A 2UWAA 4W6XA 3WQ7A 4XZPA 4M3CE 1D2QA 2JB4A 1AXYA 1OVSA 2VCMA 2WT0A 3USSA 4BQ1A 5FPBA 3H50A 1JOBA 1C57A 1IQAA 2A6VA 4XJZA 4E27A 1BCXA 3LZZA 2BERA 2JB8A 4URAA 1UKGA 3OD0A 1CZTA 4IGOA 5KHJA 5FYUA 5LBCA 1MACA 2K46A 1VAKA 3UKNA 2ZX2A 4QX2A 5FFOC 5CFDB 5D2AA 1P8JA 4YW7A 4D8MA 2RM23 2VNOA 4MO3M 4QDRA 1GNHA 1AUYA 1ASJ2 1AR93 2IFRA 2VOXA 4L0PA 5A32B 4Q4X2 3ZXJA 5JPNB 2W1QA 3OGJA 4SLIA 4LHNA 4CYDA 2GP3A 3AVRA 3ZMOA 1NE6A 1PO12 1WCQA 3BIEA 3QD6A 2YB7A 4QX8A 2D40A 4R4ZA 1SEFA 2VNVA 3M3CA 3ZPOA 4WM8B 5BNOC 5CISA 2ET1A 3M3QA 4D7SA 5HPOA 4GD4A 2R073 3KD4A 1F15A 4UFMA 1NT0A 2W87A 3A22A 1WZXA 4D94A 1ZRFA 1W6OB 4NUBA 2VMHA 2PHWA 5HCAA 2YBKA 3I7DA 4CCEA 1GZTA 4QPGB 4GIQA 1VBA1 1NY72 1YIFA 2ZMKA 1F4AA 5F5QA 1RUI1 3C8XA 3GALA 4CDQB 5C3QA 2Y6GA 2WYFA 2RJKA 3H42B 3TEXA 3DPRC 1E5IA 3PDQA 2VGDA 5F6LB 5AC92 5FAXA 2CYFA 5I8SA 2L9LA 4GZ9A 3OY8A 1LOBA 4RA0A 1UMHA 5DZFA 3T3YA 1UPIA 2R16A 5F5CA 3FC0A 2PQQA 3WSOA 3WNOA 3VBFA 5C5UA 4M3CA 5FV3A 3HNYM 3HIFA 3KQ4B 1YCIA 1YO8A 2ET7A 3QACA 1LULA 4QAWA 3ZOIA 3IPVA 4ZZ5A 1M06G 5CADA 3HOBA 1TME2 2YROA 3VBFB 1Q8QA 5FZFA 4BXSV 1O7FA 4PLNA 2VZQA 3A0NA 3NNJA 3AXDA 5A7SA 3X29B 4YZ2A 2HWB2 4AQTA 1WD4A 3B5LB 2D97A 1CWPA 1FMD2 1PVC2 2UYAA 4CEYB 3KQRA 4LKFA 5FMCA 4NPLA 3RMXA 2Y8KA 4AL9A 1KITA 3THDA 4L97A 1IKQA 4FXKB 1IPKA 5EIYB 5T5JA 3SCFA 3SH4A 3HNBM 5BNNA 4JTNA 2WZEA 1CAXA 5JSOA 5I0DA 2XUEA 1DGWX 2YGMA 1TME3 3AKSA 3NRUA 3WQBA 4BIFA 2PAKA 4XMAA 5CYYA 1V9U2 1C8NA 4NHLA 3GHNA 2G9GA 2MPFA 2D98A 2OIIA 2WZPP 4A3XA 3V0BB 4LHSA 3GXUA 1LGNA 3LAGA 4UYBA 1K42A 4KG8A 2V4AA 3Q9OA 3MEPA 2VM9A 3AC0A 2GDFA 5BNNC 1RC6A 1ZBA2 3FZ3A 3IDEA 4R9DA 3Q8FA 3PURA 1F9KA 2VAUA 2R061 3GZTB 2XQRA 3S57A 1LOGA 1MQTA 4WVZA 3S5AA 4DFSA 3UYJA 3U4XA 2LS6A 1QXJA 4XF4A 5FYIA 3U10A 5JMOA 3HN1A 3GCWA 3AL5A 3UESA 5DAVA 3ALQA 4BCUA 2XJVA 2RDNA 4JRLA 4DO0A 2PHLA 5C5TA 1VRH3 2J1TA 4S2GA 2RVAA 4IDZA 2I45A 4OLLA 3SNMA 2Z79A 2WLPA 5F6KA 1V6JA 4A44A 2WZR1 1W05A 4Y1ZA 5FY1A 1QNWA 1NCQB 5BNPC 4P9YA 2ZEZA 2JDZA 3NAPB 2WBKA 5F7UA 4Q5OA 1S55A 2QQKA 1G9CA 4LLOA 2FCTA 4EV0A 1F35A 3MO4A 1MS4A 2XJQA 4FOQA 1E5RA 4CEWA 4URTA 3NJVA 4DQAA 4LA3A 4YGCA 1WMEA 2VXRA 1OLMA 3PL0A 2ZPXA 4Y1VA 1JZ8A 4AGVA 5JR7B 4RYDA 4AGGA 4UT5A 5GKAC 1O4ZA 1GP4A 2HWE1 2OX0A 2VBPA 5LY2A 1MZ5A 1B35A 1UZWA 4M0NA 4OUSA 1ULEA 1IPSA 2YGLA 2JG8B 4NHYA 2WAAA 1ZBE1 2J42A 3GBGA 3Q8BA 2HH9A 2VU9A 2VUCA 2XL7A 2YU1A 3AK0A 4FQZA 4LMFA 2RS32 4KBBA 3NV2A 4Y5TA 4EWAA 2ARAA 2GP5A 4XILA 4CDWA 3ZKYA 4CU7A 1LAJA 1SACA 4NMIA 1F8VA 5LA2A 4LBMA 5F5AA 5C3OA 2AREA 3PUIA 1Q5OA 2HKXA 2MEV2 3LCPA 4LBNA 3KGZA 3ITQA 2A3YA 2D5HA 4YW2A 4YG6A 5J48A 3ZSKA 1VR3A 2JE9A 2FDJA 1CPMA 3T4HB 3WP6A 2V09A 1ND3C 5FP7A 1KJRA 3ZMNA 3H0OA 4WM7C 1BHGA 3AZZA 3WHTA 1GP5A 2J1AA 1CAUA 4ISRA 3RYRA 1XNCA 3LEIA 3RZMA 4YYOA 2BBVA 1YFYA 2VUJA 3POGA 2A75A 1OFNA 2RS33 2R1BA 1RINA 1WLCA 5A7WB 1PZ9A 3AFKA 1FPN3 5T54A 5GZCA 2X10A 2MEV3 4MGTA 3T0BA 3FFQA 4BQ2A 1QDOA 1SCSA 5F3GA 2WDBA 1W6PA 3B69A 5DUUA 3RZLA 3ZYFA 1W8UA 1XU2A 3E5QA 4NRPA 2DURA 4CDQC 2ZGTA 4HL0A 1YQ5A 1ZVFA 4LE3A 4CDUB 2SLIA 2G9FA 4QXCA 4JC1A 1TMF1 3ZFEB 4HVQA 1IZ3A 4OHYA 4ZKTB 1WCKA 2ZX1A 3ZYHA 4DXRA 3N9QA 4YVWC 3MLJA 4Y5Z0 1PX3A 4UW4A 2ZABA 2IC1A 3WLUA 3IT8A 3ELNA 2PYTA 1ENRA 1LCLA 2ZGSA 4FOYA 1QJY1 4IV3B 1RUG3 1E5HA 4YRDA 2X53S 1LESA 3D6EA 1Q8OA 3T4VA 3ZSMA 1FPN2 1H9PA 1D4VB 1QMJA 1X9PA 4IESA 5FYCA 3THTA 4XFCA 4JAAA 3WZ1A 1RL3A 2VW0A 1W2UA 2VECA 2XJRA 3CIHA 4AFDA 3G6JB 3IN9A 1FPN1 2QZ3A 2GNDA 2CSGA 1OD5A 3OG2A 5EJ3A 3KCXA 1G9FA 4TSVA 2C24A 3BUCA 4MADA 5JSPA 2DBIA 1OD3A 3POFA 4EWDA 2WRAA 2FDGA 3DEMA 1UZVA 3D0SA 3WNKA 4IE7A 2JIGA 4JGZB 4QPIC 3ZYPA 4CZSA 2D6OX 1GU3A 2W95A 4DOUA 2CAVA 4XIKA 2DDUA 2FDKA 2BP6A 5FYTA 1H1IA 2DVGA 2E31A 3RQ0A 4JGZA 5FZAA 4ATFA 2PHTA 5LWBA 3N7LA 1UU5A 3IDBB 3L2YA 2Q5TA 2A1XA 4AFCA 2Q0AA 5FCCA 4YM3A 2A3XA 4J1WA 4EN8B 1W6MA 4EROA 4XXPA 4NIAA 3W59A 4I30A 1C1FA 1HRV1 4TLGA 3VZNA 4D69A 5IVBA 3RS6A 1ND3B 1KS5A 1SQ4A 1UOBA 3CJIB 3OOXA 3SCHA 1HXS1 3N9LA 2A6XA 2EVXA 2BPA2 1QEXA 1LOFC 1GOFA 3R6SA 4Y4YA 5JIAA 1LTEA 4XYXA 1IG0A 2F4PA 3M3OA 4OHWA 5FZBA 2X05A 4Z1VA 1HXS2 1QOOA 2UWCA 1YFWA 4M4RA 3WW4A 3AJYA 5FZ4A 4LOSA 2X8KA 1W2OA 4RGKA 3PJYA 1CIYA 4HVRA 2Y0OA 5DQ0A 4A7KA 2GH2A 2XH6A 1QH6A 1W9TA 5FP8A 3HPNA 3DXUA 4P00B 3O1UA 1RUC1 3J7LA 5FP9A 4YG3A 1BBT1 1YLLA 3K4ZA 1WBLA 2B5HA 3O7OA 2Q8DA 1MVQA 2VZ1A 4CUAA 2Y6LA 2ZKLA 4BZ4A 4Y1XA 2GN7A 4G3YC 1H1AA 2G19A 1OFSA 1NLQA 2PAEA 3BB6A 2FZ1A 5B4XA 3URFA 4E4HA 1AXZA 5JXGA 1CX4A 1LHOA 2NQYA 4IV3C 3N36A 4JQTA 3M3IA 3I3QA 5A7NA 4AWDA 2EIDA 4OFGA 3OY8B 4BQWA 4GWNA 4AI3A 2YBSA 4AW7A 2HWD1 1VBA3 2YUEA 2ZGQA 2WC2A 4DEVA 4DXSA 4BA6A 3M3EA 1LOFA 1YNAA 4QPWA 1TG7A 2IXJA 5ACA2 4HSLA 1LR5A 5JCTA 4L2NA 5FZOB 4JV4A 1K12A 3M7AA 4QGMA 4XDOA 4LT5A 1Y7BA 1WWYA 4GALA 1LOCA 2ZGUA 1AL21 4IUGA 1C3HA 4NWWA 2Y6KA 4IQPA 4C0HA 5IVCA 1GOGA 1E5SA 1S0JA 4FFGA 3FUQA 2J1RA 2QDRA 5C8CB 4A7YA 1J1LA 1AL22 1VP6A 4M0HA 4QGLA 3HD8B 5GJ6A 3VBHC 4DNYA 3JQWA 5A3NA 5IT6A 5EPAA 4DXZA 5KR7A 5C33A 1VB4A 2BNOA 1VBC3 4AVCA 3RYKA 2RS53 5DAPA 1S0BA 3NNFA 1HRI1 5F3IA 3P3PA 2YDEA 4QU2A 4W4ZA 1C8M1 1JS9A 1DZTA 3S0MA 4MGKE 1GOHA 3C7EA 3IM0A 4OUMA 3FL7A 1WLDA 1ENSA 4HK9A 4DXTA 3SKJE 4B7KA 1OHFA 2NZ9A 1ND2C 2VTXA 4TXWA 1AR61 2O8OA 3HBKA 1RUG2 1PGW2 3WNMA 1SFPA 5FY9A 5A6YA 4ET7A 2VO5A 3CU7A 2ZJCA 4QPGC 3RFRA 3U1XA 5KC5A 2GNMA 4QXHA 3BVCA 4RFRB 2VCAA 1W6NB 2GNTA 4CEWC 2OW4A 5FUNA 3CQOA 4IEQA 3O0WA 1GQHA 1FT9A 1SPPA 2VZTA 2Y0IA 1UAIA 5FLHA 1W9WA 1D0HA 4CEWB 2YC2A 3DECA 4BWOA 3K4DA 1KRIA 1OOPB 4HOOA 5BNOA 1VBE1 3LKJA 1C8M3 5L19A 5FYVA 5FJHA 1FOD1 1YFUA 3JZVA 2HWC3 2VNGA 5FYSA 3TRSB 4HANA 4Q29A 2UWBA 3LD8A 3MW4A 1JU4A 2GC3A 1S0GA 1ZX5A 2IZWA 2TUNA 1QNYA 1G6NA 1QJFA 1RVF3 3L9JT 3U4SA 1W8HA 2VBBA 4IETA 1DGWA 4QB6A 4ATEA 4D6RA 3I49A 1UZYA 3NKTA 4IL7A 4UFKA 1MVEA 4XBLA 4UFIA 2YV8A 5G04L 1H6YA 3HQRA 1JYNA 3RZHA 1R091 4Y4RA 1DQ0A 3ZXLA 4B8EA 3TEZA 2HWC2 2Q8OA 1UU4A 1VBB2 1DIWA 4HN1A 1VMJA 3B94A 4R9CA 1XSQA 3U78A 1G9DA 3VUOA 5L7OC 4Q4X1 4XQDA 4QXBA 1O5LA 3I2IA 3N3HA 1H0BA 4AEDA 3H1YA 3GZAA 1W9YA 2DVFA 2EIEA 5FZMA 4AI8A 5I93A 4IGQA 1UNBA 5K0UB 2XGXA 1R1A1 3AZVA 4BJ0A 1UCXA 3KCYA 4G9SB 1CN1A 3WG3A 1N1SA 2XWBB 2WFF1 3DKWA 4OQ9A 4FTSA 3CDZB 2C6SA 4HVOA 4K40A 4ZONA 5JOZA 1MS5A 2P2KA 2RS31 3RG0A 3AVSA 1DZRA 1QGLA 4Q4V1 5C4WC 4HFSA 4CDXB 5F2WA 5BY5A 4JKLA 2W0XA 2W94A 1DGRN 4LQRA 2MEV1 3NW4A 3KMHA 4M01A 3SH3A 2ZS6B 4MHRA 3VZOA 3WP4A 2XBO3 4QPIB 1X36A 1COV1 3C7OA 2VOTA 4P9IA 3C7FA 4HSJA 5H9PA 1AR83 3BODA 1Y9QA 4B4QA 4F8AA 2A5ZA 3POJA 2WNOA 5D8AA 2Z42A 3GJAA 3WX5A 5ABJA 4IV1B 2EF6A 5DDJ3 2ZGLA 4O9GA 4GMP3 4UW6A 1MS3A 2ILMA 3NSTA 3PUHA 1PHMA 4R8HA 2R041 2X5IB 3VKMA 5ACA3 1UYXA 3O14A 4XABA 1JZ4A 5LATA 1ODMA 1PM4A 3SISA 2HEYF 1HJGA 3TYJA 3RYPA 3U37A 5J3UA 3JD73 4PQQA 4IEYA 1SBFA 5A80A 4EN7B 3CEWA 3A7QA 3EB7A 5CEHA 1AR82 4C8DA 4F3JA 2C9AA 2JJ6A 2YY1A 2YZ4A 2Y33A 5IVVA 1KS4A 2XBO1 1AX1A 4HG6B 4ZS3A 2Q30A 2PELA 1AL0G 4XIOA 2P3KA 2VMFA 4FPYA 4XQWA 3I3DA 2YXSA 3NL1A 5DDJ1 2RS52 3AL6A 1H2MA 2P4EA 1YI7A 4YGDA 4AEMA 1I5PA 1RUJ2 3ZXKA 2F6BA 1J84A 3DYOA 2BWCA 1YWKA 3LDKA 2P3JA 1XXNA 3T2QA 4BK4A 1LRHA 1OA3A 3CJIA 1A78A 3LA2A 5FZ0A 2EXJA 1XPWA 3UJOA 4ASMB 1PO21 2VPVA 1Y4WA 2XKPA 2WL1A 2XVLA 2VY0A 5FZ8A 5LA9A 5FXZA 3ZYRA 3USUB 1NX9A 4HZFA 4ZPIA 1W2AX 3POSA 2AYHA 4DRRA 4N8MA 1DQ4A 3KVAA 5FLIA 3ZFGA 2Q4SA 2W3JA 2W1SA 1OH3A 1DYPA 3OUHA 5IFPA 4XEZA 3W5MA 4LHKA 3AZXA 4LBQB 5FLJA 4WZFA 2K9ZA 5C4WB 2P5BA 5FY4A 4BQXA 5I8TA 2BJSA 4RGGA 5HCBA 5CVRA 3M2MA 2XR4A 3MV11 4BISA 1JBCA 2RJ2A 3WDWA 3HAGA 1E57A 2RG4A 4E2SA 5GLVA 1C8M2 2E53A 2C26A 3K3NA 1VALA 2GMPA 3OTFA 1EV11 3OEAA 4JDNA 4Q4Y2 3ZFEA 3ZYGA 1CAWA 4YFWA 3RZGA 5DZEA 1HW5A 4B1LA 1UX6A 2B9VA 2HWF3 5A7QA 4UFHA 3TN91 4ASKA 3ACIA 2ES3A 2P37A 2WZR2 4LIVA 1RXFA 4OZOA 4QPIA 4N9IA 5JR2A 4ZXKA 4K3UA 1NG0A 5AFEA 2WNEA 1UL9A 1O8PA 2LUWA 3CJIC 2HBUA 4WM7A 4HK8A 3GBWA 3DKQA 2OVUA 3HQUA 4RHV3 4AI9A 4JGYA 2QQNA 3WOGA 4AEJA 4CUBA 1MZFA 2I2SA 4QU1A 3VBUC 3VDDA 3GHMA 4YSFA 1S2KA 1U5YA 2KM2A 2G4IA 1RUE2 5A33B 2HWD3 1X33A 5HCHA 3B9CA 3O1MA 5J96B 1MEC3 3BTXA 2EA7A 1W6QA 3VZKA 1VMFA 3O1TA 1Q8PA 4QB2A 1ZM1A 3N4MA 1VJ2A 1SLLA 3D82A 4KWKA 1GMMA 2O8QA 2QBXA 2BFUL 3RJRA 2JKXA 5A3TA 3T2OA 1G9BA 4KQ7A 4XJUA 2FDIA 4RQPA 3VD7A 3ZXEA 5FMBA 2AUYA 1JHJA 4FO9A 1JI6A 2WNVC 5BXXA 1AJKA 1PM7A 2DUOA 2R071 1KQRA 4JRAA 4Q1RA 4R9BA 5KHIA 1S0DA 3KT1A 2BNMA 2P3IA 5I8YA 5LEKA 4FP2A 3VBUA 4JQRA 4RS5C 4NHKA 4HMZA 4YW4A 4HT1T 1WCSA 5FPXA 2JDKA 1AR91
chains in the Genus database with same CATH topology
2ZEZA 4QDSA 2WBKA 5F7UA 2QQMA 5IJRA 4XURA 4E8CA 1JYVA 3LEKA 1UYZA 2QQKA 5EJ1B 2YFUA 2HLEA 3MO4A 5JUVA 3ACFA 2V5DA 3IB3A 1JZ6A 2YG0A 3NJVA 2VJXA 1H6XA 4KWUA 2EICA 2X09A 4OUEA 1JZ8A 4GWIA 4FI9A 4RYDA 2JE8A 4DUWA 1PMHX 2QQLA 2BZDA 3LPFA 1K45A 2YFZA 2WAAA 3VD3A 4QDQA 3ZM8A 3CMGA 1R64A 1ULOA 4CU7A 4ZXEA 5LA2A 1KGYA 2VL4A 3PUIA 5CZKA 3IIIA 4CUCA 3HJRA 3FN9A 4JX0A 4ARXA 3NNGA 4CU8A 1BHGA 2J1AA 3SEPA 2E33A 2E26A 3LEIA 5B4NA 5LA0A 3OBAA 4KMQA 3ACHA 5IYYA 1OF4A 2XHNA 4XUPA 3IAPA 2VMEA 3K4AA 2X10A 1US2A 4A3ZA 3T0BA 3I3BA 2WDBA 1EUTA 2WN3A 3UNPA 2W9XA 2PQSA 5JXJA 3WF3A 2Y64A 4DXRA 1D7PM 2QQOA 1PX3A 1PX4A 4DUVA 2W46A 4XZUG 3WF2A 2VZUA 4P02B 2YC4A 2Y6JA 5C7GA 2B4KA 1GNYA 2J1SA 1OH4A 2WZ8A 1SHWB 3T08A 4DUXA 3VDCA 3I2KA 3CIHA 2ZEWA 4YPJA 2VCCA 2W1UA 3OG2A 1GQPA 2VMDA 3CZJA 4MADA 3ABZA 1OD3A 2VQTA 4P5YA 3NJXA 3WNKA 1GU3A 2W95A 4W8JA 1JZ2A 3LEGA 2DDUA 2W5FA 4A42A 2E31A 4BDVB 3A21A 5DPNA 2VZ3A 2QQIA 4Z2AA 1DYOA 2EIBA 3CZUA 4CVUA 2BGPA 3C7HA 4UAPA 5IHRA 1W99A 3K46A 2ORZA 3UETA 1GOFA 1WKYA 3E1F1 2X05A 4A6OA 4M4RA 5A1AA 1CIYA 5DQ0A 1W9TA 3MV01 2VZPA 3HPNA 4KI5M 4P00B 2WUHA 1NKGA 2VMCA 3HNMA 4QX0A 3K4ZA 5HXMA 2HYXA 2VZ1A 3A23A 4CUAA 2Y6LA 3D3AA 4A41A 3OGSA 2W91A 2WO1A 2VZSA 3WEZA 1DP0A 1XNTA 2VZVA 5B4XA 1XC6A 2W1WA 1SDDB 2XONA 5JXGA 1T2XA 2J1VA 3SKVA 1J83A 2VR4A 2EIDA 1UYYA 3T0DA 4A4AA 4TTGA 1W9SA 4DEVA 4DXSA 3BN6A 1EUUA 4QPWA 1TG7A 1K12A 3VDBA 2J1UA 1UZ0A 4LPLA 4IUGA 3I97A 2Y6KA 1GOGA 1K3IA 3P1IA 4P08A 2J1RA 4M4PA 2R7EB 1UMIA 2BGOA 3HN3A 3F2ZA 3VD5A 4A45A 2ZEYA 2XQXA 3LPGA 1YQ2A 1W8OA 1JU3A 2ID4A 2WO3A 4W4ZA 2ORXA 1UXXX 3HEIA 3VD4A 2LW8A 1GOHA 3C7EA 3C7GA 3FL7A 4XUQA 3VDAA 4DXTA 1CX1A 3SKJE 4TXWA 2KD7A 3WNLA 2V4VA 3WNPA 4XUNA 2DCKA 2W92A 3WNMA 3ETPA 4ET7A 1KEXA 2VO5A 2E32A 4MGQA 1JZ3A 1UY4A 2VCAA 5DN2A 3CQOA 1O59A 3OGRA 2VZTA 1W9WA 2YC2A 3DECA 3K4DA 3GDBA 3J7HA 1JZ5A 3OGVA 1OT5A 2W47A 3GGLA 3T09A 3WF1A 1UY1A 1JU4A 3THCA 1UY3A 4ZY9A 1OF3A 1NUKA 3MBWA 2QQJA 3I2HA 1SG3A 4QB6A 3FHQA 2VC9A 3IAQA 5G04L 1H6YA 1US3A 1UY2A 1JYNA 3MUZ1 2C9KA 1DLCA 1JZ7A 1HN1A 3LE0A 4DEQA 4OMDA 3CKHA 4PF1A 1ULPA 2VCBA 3EYPA 4UI9L 2VTFA 3I2IA 2EIEA 4XUTA 4JKKA 2JDAA 4BJ0A 2JD9A 2ZEXA 4JKMA 4D0QA 4AAXA 1XNAA 3DYMA 1GUIA 3CDZB 4LKSA 1O8SA 4ZZ8A 3I2FA 3OB8A 3WF4A 2DCJA 4JKLA 2W94A 1UX7A 4LQRA 5JXIA 2Z4FA 4CU6A 2OKXA 1UY0A 2CDPA 3C7OA 2VOTA 3C7FA 2BERA 1CZTA 1L7QA 4QX2A 1P8JA 4D8MA 4MO3M 4QDRA 1PMJX 3I2GA 4OMCA 4L0PA 1RYYA 2W1QA 4QX1A 2WABA 3PUHA 1JYWA 1WCQA 2WO2A 1JZ4A 1UYXA 3WF0A 3FHAA 2YB7A 3U37A 4GWJA 3IDAA 2WN2A 4UOJA 4PQQA 1CZVA 5HPOA 3A7QA 3EB7A 4E8DA 5FUIA 1CZSA 3WNNA 5IFTA 2W87A 3JXSA 3A22A 4ARYA 4PT6A 4HG6B 3LQCA 3MUY1 3GM8A 1NAEA 1MPXA 2VMFA 3I3DA 2J22A 3SEEA 1F4AA 4BK5A 2J7MA 3C8XA 1I5PA 2Y6GA 1J84A 3DYOA 3OEBA 4QB1A 5C70A 4MGSA 3T2QA 3T0AA 4BK4A 2L9LA 4GZ9A 1XPWA 4QX3A 1UMHA 5DMYA 5G05L 3WSOA 1NX9A 3WNOA 2XOMA 3I2JA 2VZOA 4MOAA 3HNYM 4QAWA 4ZZ5A 3HOBA 4OYUA 2W3JA 2W1SA 4BXSV 5IFPA 2VZQA 3W5MA 3ACGA 5LCWL 2ZXQA 5JXHA 2VZRA 3T2PA 1JYXA 3P6BA 2WYSA 4CU9A 2VQUA 3MV11 4W50A 2RJ2A 2WAOA 1TVGA 3BGAA 1LNSA 2C26A 2Y8KA 4XVHA 3OEAA 3THDA 5J1XA 5EIYB 2V72A 3HNBM 2B9VA 2WZEA 3ACIA 5I0DA 2RV9A 4OZOA 3I3EA 5JR2A 1W0NA 3NRUA 2C4XA 2WQ8A 3WQBA 3K75B 5C71A 1O8PA 5CYYA 2Y6HA 2CDOA 3W5NA 2QQNA 4CUBA 4LHSA 3GXUA 1K42A 4AG4A 2VM9A 3AC0A 3VD9A 4JHZA 3ECQA 3DYPA 1IQDC 4QB2A 2BBAA 1W8NA 1GMMA 2QBXA 2LS6A 2JKXA 3T2OA 5EJZB 5JMOA 4XUOA 3VD7A 5LA1A 3UESA 1L7RA 3K77A 1JHJA 1JI6A 2J1TA 2RVAA 1UXZA 1UWWA 4A44A 1F4HA 2J1EA 3NQHA 4RN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEZ A;  4QDS A;  2WBK A;  5F7U A;  2QQM A;  5IJR A;  4XUR A;  4E8C A;  1JYV A;  3LEK A;  1UYZ A;  2QQK A;  5EJ1 B;  2YFU A;  2HLE A;  3MO4 A;  5JUV A;  3ACF A;  2V5D A;  3IB3 A;  1JZ6 A;  2YG0 A;  3NJV A;  2VJX A;  1H6X A;  4KWU A;  2EIC A;  2X09 A;  4OUE A;  1JZ8 A;  4GWI A;  4FI9 A;  4RYD A;  2JE8 A;  4DUW A;  1PMH X;  2QQL A;  2BZD A;  3LPF A;  1K45 A;  2YFZ A;  2WAA A;  3VD3 A;  4QDQ A;  3ZM8 A;  3CMG A;  1R64 A;  1ULO A;  4CU7 A;  4ZXE A;  5LA2 A;  1KGY A;  2VL4 A;  3PUI A;  5CZK A;  3III A;  4CUC A;  3HJR A;  3FN9 A;  4JX0 A;  4ARX A;  3NNG A;  4CU8 A;  1BHG A;  2J1A A;  3SEP A;  2E33 A;  2E26 A;  3LEI A;  5B4N A;  5LA0 A;  3OBA A;  4KMQ A;  3ACH A;  5IYY A;  1OF4 A;  2XHN A;  4XUP A;  3IAP A;  2VME A;  3K4A A;  2X10 A;  1US2 A;  4A3Z A;  3T0B A;  3I3B A;  2WDB A;  1EUT A;  2WN3 A;  3UNP A;  2W9X A;  2PQS A;  5JXJ A;  3WF3 A;  2Y64 A;  4DXR A;  1D7P M;  2QQO A;  1PX3 A;  1PX4 A;  4DUV A;  2W46 A;  4XZU G;  3WF2 A;  2VZU A;  4P02 B;  2YC4 A;  2Y6J A;  5C7G A;  2B4K A;  1GNY A;  2J1S A;  1OH4 A;  2WZ8 A;  1SHW B;  3T08 A;  4DUX A;  3VDC A;  3I2K A;  3CIH A;  2ZEW A;  4YPJ A;  2VCC A;  2W1U A;  3OG2 A;  1GQP A;  2VMD A;  3CZJ A;  4MAD A;  3ABZ A;  1OD3 A;  2VQT A;  4P5Y A;  3NJX A;  3WNK A;  1GU3 A;  2W95 A;  4W8J A;  1JZ2 A;  3LEG A;  2DDU A;  2W5F A;  4A42 A;  2E31 A;  4BDV B;  3A21 A;  5DPN A;  2VZ3 A;  2QQI A;  4Z2A A;  1DYO A;  2EIB A;  3CZU A;  4CVU A;  2BGP A;  3C7H A;  4UAP A;  5IHR A;  1W99 A;  3K46 A;  2ORZ A;  3UET A;  1GOF A;  1WKY A;  3E1F 1;  2X05 A;  4A6O A;  4M4R A;  5A1A A;  1CIY A;  5DQ0 A;  1W9T A;  3MV0 1;  2VZP A;  3HPN A;  4KI5 M;  4P00 B;  2WUH A;  1NKG A;  2VMC A;  3HNM A;  4QX0 A;  3K4Z A;  5HXM A;  2HYX A;  2VZ1 A;  3A23 A;  4CUA A;  2Y6L A;  3D3A A;  4A41 A;  3OGS A;  2W91 A;  2WO1 A;  2VZS A;  3WEZ A;  1DP0 A;  1XNT A;  2VZV A;  5B4X A;  1XC6 A;  2W1W A;  1SDD B;  2XON A;  5JXG A;  1T2X A;  2J1V A;  3SKV A;  1J83 A;  2VR4 A;  2EID A;  1UYY A;  3T0D A;  4A4A A;  4TTG A;  1W9S A;  4DEV A;  4DXS A;  3BN6 A;  1EUU A;  4QPW A;  1TG7 A;  1K12 A;  3VDB A;  2J1U A;  1UZ0 A;  4LPL A;  4IUG A;  3I97 A;  2Y6K A;  1GOG A;  1K3I A;  3P1I A;  4P08 A;  2J1R A;  4M4P A;  2R7E B;  1UMI A;  2BGO A;  3HN3 A;  3F2Z A;  3VD5 A;  4A45 A;  2ZEY A;  2XQX A;  3LPG A;  1YQ2 A;  1W8O A;  1JU3 A;  2ID4 A;  2WO3 A;  4W4Z A;  2ORX A;  1UXX X;  3HEI A;  3VD4 A;  2LW8 A;  1GOH A;  3C7E A;  3C7G A;  3FL7 A;  4XUQ A;  3VDA A;  4DXT A;  1CX1 A;  3SKJ E;  4TXW A;  2KD7 A;  3WNL A;  2V4V A;  3WNP A;  4XUN A;  2DCK A;  2W92 A;  3WNM A;  3ETP A;  4ET7 A;  1KEX A;  2VO5 A;  2E32 A;  4MGQ A;  1JZ3 A;  1UY4 A;  2VCA A;  5DN2 A;  3CQO A;  1O59 A;  3OGR A;  2VZT A;  1W9W A;  2YC2 A;  3DEC A;  3K4D A;  3GDB A;  3J7H A;  1JZ5 A;  3OGV A;  1OT5 A;  2W47 A;  3GGL A;  3T09 A;  3WF1 A;  1UY1 A;  1JU4 A;  3THC A;  1UY3 A;  4ZY9 A;  1OF3 A;  1NUK A;  3MBW A;  2QQJ A;  3I2H A;  1SG3 A;  4QB6 A;  3FHQ A;  2VC9 A;  3IAQ A;  5G04 L;  1H6Y A;  1US3 A;  1UY2 A;  1JYN A;  3MUZ 1;  2C9K A;  1DLC A;  1JZ7 A;  1HN1 A;  3LE0 A;  4DEQ A;  4OMD A;  3CKH A;  4PF1 A;  1ULP A;  2VCB A;  3EYP A;  4UI9 L;  2VTF A;  3I2I A;  2EIE A;  4XUT A;  4JKK A;  2JDA A;  4BJ0 A;  2JD9 A;  2ZEX A;  4JKM A;  4D0Q A;  4AAX A;  1XNA A;  3DYM A;  1GUI A;  3CDZ B;  4LKS A;  1O8S A;  4ZZ8 A;  3I2F A;  3OB8 A;  3WF4 A;  2DCJ A;  4JKL A;  2W94 A;  1UX7 A;  4LQR A;  5JXI A;  2Z4F A;  4CU6 A;  2OKX A;  1UY0 A;  2CDP A;  3C7O A;  2VOT A;  3C7F A;  2BER A;  1CZT A;  1L7Q A;  4QX2 A;  1P8J A;  4D8M A;  4MO3 M;  4QDR A;  1PMJ X;  3I2G A;  4OMC A;  4L0P A;  1RYY A;  2W1Q A;  4QX1 A;  2WAB A;  3PUH A;  1JYW A;  1WCQ A;  2WO2 A;  1JZ4 A;  1UYX A;  3WF0 A;  3FHA A;  2YB7 A;  3U37 A;  4GWJ A;  3IDA A;  2WN2 A;  4UOJ A;  4PQQ A;  1CZV A;  5HPO A;  3A7Q A;  3EB7 A;  4E8D A;  5FUI A;  1CZS A;  3WNN A;  5IFT A;  2W87 A;  3JXS A;  3A22 A;  4ARY A;  4PT6 A;  4HG6 B;  3LQC A;  3MUY 1;  3GM8 A;  1NAE A;  1MPX A;  2VMF A;  3I3D A;  2J22 A;  3SEE A;  1F4A A;  4BK5 A;  2J7M A;  3C8X A;  1I5P A;  2Y6G A;  1J84 A;  3DYO A;  3OEB A;  4QB1 A;  5C70 A;  4MGS A;  3T2Q A;  3T0A A;  4BK4 A;  2L9L A;  4GZ9 A;  1XPW A;  4QX3 A;  1UMH A;  5DMY A;  5G05 L;  3WSO A;  1NX9 A;  3WNO A;  2XOM A;  3I2J A;  2VZO A;  4MOA A;  3HNY M;  4QAW A;  4ZZ5 A;  3HOB A;  4OYU A;  2W3J A;  2W1S A;  4BXS V;  5IFP A;  2VZQ A;  3W5M A;  3ACG A;  5LCW L;  2ZXQ A;  5JXH A;  2VZR A;  3T2P A;  1JYX A;  3P6B A;  2WYS A;  4CU9 A;  2VQU A;  3MV1 1;  4W50 A;  2RJ2 A;  2WAO A;  1TVG A;  3BGA A;  1LNS A;  2C26 A;  2Y8K A;  4XVH A;  3OEA A;  3THD A;  5J1X A;  5EIY B;  2V72 A;  3HNB M;  2B9V A;  2WZE A;  3ACI A;  5I0D A;  2RV9 A;  4OZO A;  3I3E A;  5JR2 A;  1W0N A;  3NRU A;  2C4X A;  2WQ8 A;  3WQB A;  3K75 B;  5C71 A;  1O8P A;  5CYY A;  2Y6H A;  2CDO A;  3W5N A;  2QQN A;  4CUB A;  4LHS A;  3GXU A;  1K42 A;  4AG4 A;  2VM9 A;  3AC0 A;  3VD9 A;  4JHZ A;  3ECQ A;  3DYP A;  1IQD C;  4QB2 A;  2BBA A;  1W8N A;  1GMM A;  2QBX A;  2LS6 A;  2JKX A;  3T2O A;  5EJZ B;  5JMO A;  4XUO A;  3VD7 A;  5LA1 A;  3UES A;  1L7R A;  3K77 A;  1JHJ A;  1JI6 A;  2J1T A;  2RVA A;  1UXZ A;  1UWW A;  4A44 A;  1F4H A;  2J1E A;  3NQH A;  4RN5 A; 
#chains in the Genus database with same CATH topology
 2D6P A;  1XNB A;  1WUV A;  1V6I A;  1DLL A;  2H6B A;  2QQM A;  1OKO A;  4CPB A;  1JYV A;  3LEK A;  5GLU A;  4AHW A;  3VL9 A;  1HRI 3;  1KD7 A;  1D0G A;  1ZZC A;  2P6H A;  4IEX A;  1UO9 A;  1UMZ A;  5E88 A;  4GJY A;  2A70 A;  5I0S A;  1MEC 1;  2XG3 A;  2HLE A;  4K7J A;  5FQ0 A;  1URX A;  3B00 A;  1O3S A;  4LBO A;  3FLP A;  1NZI A;  3ACF A;  3FE5 A;  1J3P A;  1GV9 A;  2V5D A;  4XAE A;  3ZXA C;  1NQD A;  1H6X A;  5FZ1 A;  2EIC A;  2X09 A;  4Z82 A;  3ZPY A;  4A7Z A;  1LHN A;  4CDX C;  5J37 A;  1Y9G A;  1AJO A;  1ND2 B;  3O0V A;  4LBQ A;  1PMH X;  1DQ2 A;  4XJ9 A;  5FK8 A;  3ILF A;  4QKB A;  5FRE A;  4N90 A;  4NID A;  2D3R A;  1HRI 2;  5IAX A;  1ZRC A;  1QXP A;  1AVB A;  1WW4 A;  2ZX0 A;  2F17 A;  4R9A A;  1RUI 2;  3DV8 A;  4KGG A;  3TOJ A;  1LOE A;  2D44 A;  4IXL A;  4C0B A;  1R64 A;  2D93 A;  3WP5 A;  2ETE A;  2AEZ A;  1NXM A;  1V9U 1;  2VL4 A;  2RHP A;  4J1X A;  4LBL A;  2GSY A;  5GZF A;  4CDU A;  3POW A;  1EP0 A;  1TZO A;  4EZ4 A;  2X5I C;  4QQ2 A;  3ZSL A;  4E4D X;  3FN9 A;  2WIN B;  4ARX A;  4BM8 A;  4CU8 A;  3WDV A;  1BEV 3;  1VBE 2;  4MVT A;  1GWM A;  4YNI A;  4FPE A;  1WW6 A;  3CHX A;  3GYD A;  2E7A A;  3HMY A;  2E26 A;  1HX6 A;  3M1H A;  3B02 A;  3OBA A;  5CNA A;  3KV4 A;  5IVE A;  4NWV A;  2VVE A;  4AVV A;  2VTX J;  2DFC A;  3IAP A;  1I5Z A;  2Z5W A;  5E1R A;  2NM1 A;  4A6S A;  4A3Z A;  4COU A;  1BK0 A;  3R4U A;  4Y24 A;  3I3B A;  2IXK A;  2ZHM A;  1OA4 A;  3BTZ A;  3H8U A;  2W9X A;  4V2W A;  3VHP A;  2PQS A;  5JXJ A;  1YC6 1;  1BEV 2;  1QJX 1;  5CG8 A;  2IXC A;  1VBE 3;  1G8W A;  5CG9 A;  2WNV B;  2C0Z A;  3J9S A;  1ST8 A;  2Y34 A;  4NJ4 A;  1FOD 3;  4NHX A;  2AEN A;  2D6K A;  3M70 A;  1H30 A;  3ZN4 A;  1O4T A;  2R06 3;  1PX4 A;  1R1A 3;  2W46 A;  1HRV 2;  5A70 A;  1J1T A;  4P02 B;  2YC4 A;  1MS0 A;  5C7G A;  2ZZQ A;  1GNY A;  1OH4 A;  5A1L A;  2FDF A;  1BMV 2;  2RM2 2;  1ULF A;  3USU A;  2WFF 2;  2W1U A;  3ST7 A;  5KHK A;  1GQP A;  3H8R A;  2E63 A;  2O14 A;  2XB6 C;  4FFH A;  2VMD A;  5FBZ A;  5KC6 A;  4LKE A;  4XFB A;  5JI7 A;  2H0V A;  4QQO A;  1A3K A;  4KWL A;  4P5Y A;  1KFU L;  2CWM A;  3CJX A;  3NJX A;  1H8T C;  1HRV 3;  1BZW A;  2KR2 A;  4M3C F;  2X5I A;  2I07 B;  4NII A;  1LGC A;  2A6Y A;  4KGQ A;  1XND A;  2HEW F;  3LEG A;  3MIH A;  2W5F A;  4UW5 A;  4A42 A;  2JDY A;  4FQ4 A;  4BDV B;  5DPN A;  4E4S A;  1QJU 2;  3WG1 A;  3VGI A;  5KHG A;  2F4L A;  3WG4 A;  1QY4 A;  3AYE A;  2VG9 A;  1GZ9 A;  2AZ5 A;  5FDB A;  1UIJ A;  2EAL A;  4V2V A;  4C1W A;  4AED C;  2P1B A;  2A73 B;  1DYO A;  1XU1 A;  2EIB A;  2QVS B;  3RJ2 X;  4ONU A;  2ZGK A;  1NZC A;  4FPL A;  2B8M A;  1A6C A;  2B39 A;  3VL8 A;  5FUP A;  2BYV E;  2RR1 1;  2B7Y A;  2IXH A;  3K46 A;  3UET A;  4FBF A;  2WSU A;  3INA A;  1A34 A;  5FXX A;  1JOJ A;  4R52 A;  2V73 A;  5CKQ A;  4KU7 A;  1R08 2;  1J3R A;  3CF6 E;  4HPK B;  2OZJ A;  2IVJ A;  4MGZ E;  3TAY A;  4NPR A;  1RTV A;  4CCJ A;  5A33 A;  1C5I A;  3O12 A;  4FAH A;  4YW5 A;  3Q8C A;  1JHN A;  3I2D A;  1QJE A;  3LIG A;  5C3S A;  1EAH 2;  2VZP A;  4BXF A;  1J3Q A;  3LSE A;  5HXM A;  1HB1 A;  3PNA A;  4IND A;  5D8A C;  2VH9 A;  4RSU A;  3D3A A;  3OGS A;  2W91 A;  2BV4 A;  1OXC A;  3IWZ A;  4YZ3 A;  1Z7S 2;  2UY9 A;  1DG6 A;  4PQ9 A;  2JDP A;  2D3S A;  5FZD A;  2Y6F A;  2XON A;  5K0U C;  3AYA A;  3AYC A;  4CXY A;  1N1V A;  3SKV A;  1J83 A;  2O0O A;  1X7N A;  4GUL A;  4N53 A;  2BWA A;  3FJS A;  4XET A;  4HN0 A;  5FZK A;  4HKO A;  1YHF A;  1ZBE 2;  4JDO A;  3JB4 C;  3NV3 A;  3PVO A;  1H9W A;  2ARX A;  2WFP A;  4N53 B;  5JAX A;  4CCM A;  1AR6 2;  3BN6 A;  4TYS A;  2ADD A;  1GP6 A;  2GC0 A;  1S0E A;  2TBV A;  4J6G A;  1RIT A;  3V0A A;  1RGS A;  3MIB A;  2XWJ B;  1NE4 A;  1RMU 2;  1C1L A;  1G9A A;  1SBD A;  5IK4 A;  5K8S A;  2JDH A;  2DCY A;  2Q1F A;  1W8T A;  3S6P A;  3SCG A;  4WV8 A;  3OGG A;  1W8W A;  4YW6 A;  2D43 A;  4MGY E;  1Z78 A;  4P08 A;  2R7E B;  3WUC A;  1BJQ A;  2BGO A;  4IE0 A;  5KBF A;  4BPZ A;  1AYN 3;  3VD5 A;  4LBQ D;  3E5U A;  3LWC A;  1AR6 3;  2VUL A;  1GZC A;  2NPI A;  1JOD A;  3B7M A;  3KWV A;  1JU3 A;  2ID4 A;  4LOT A;  2SBA A;  4AVB A;  1NYW A;  1RUH 2;  3WCR A;  5A3M A;  1W9F A;  2AR6 A;  2RE9 A;  2GAU A;  1UXX X;  3J4U H;  3WNX A;  3VD4 A;  2VUA A;  2WS9 1;  1O91 A;  4W6Y A;  3PHM A;  4XUQ A;  3VDA A;  1CX1 A;  4WM7 B;  3UL2 A;  2D7F A;  4NIH A;  1RUE 1;  1X8M A;  3U75 A;  3AP7 A;  1GAN A;  4MX3 A;  2KD7 A;  5FY7 A;  1OLM E;  2JWP A;  2RMU 2;  1ULD A;  2V4V A;  4XUN A;  2DCK A;  1S2B A;  3I59 B;  5H9S A;  5C9A C;  1C5H A;  1AYN 2;  1CAV B;  1SFN A;  5IUQ A;  2W92 A;  2OQ6 A;  3ETP A;  1PZ8 A;  5A6X A;  2CAU A;  1IHM A;  1KEX A;  1QJZ A;  4CCN A;  4DS0 A;  3V56 A;  5FKC A;  5EWS A;  4OHZ A;  5K7P A;  5DAQ A;  3D8C A;  2PLV 3;  2QKD A;  1R08 1;  4JHT A;  1KXG A;  2EXH A;  1U0A A;  2VQ0 A;  3VHR A;  4WM8 A;  4XXA A;  3PIG A;  2Q8C A;  4CXX A;  3N9P A;  3JQX A;  4NAO A;  3NAP C;  3ZR6 A;  2IUW A;  4K8F A;  4CCO A;  5CA6 A;  3J7H A;  4YAR A;  3O0X A;  3OGV A;  4XOG A;  1XE8 A;  3GGL A;  1S2E A;  1UY1 A;  4CDW B;  3MFA A;  3BI3 A;  1JOP A;  3THC A;  4LTA A;  3ACL A;  3F95 A;  4QPG A;  1ZRI A;  2LM3 A;  1RHI 3;  5CAZ A;  5FPA A;  4EZH A;  4BQY A;  4HKL A;  2PLV 2;  1Q43 A;  5CKN A;  4PIY A;  2QQJ A;  3GBF A;  3VLB B;  1XE7 A;  2JXA A;  1PNF A;  1SG3 A;  5LK5 A;  1D4M 3;  1ZZ9 A;  3FHQ A;  3IAQ A;  3P3N A;  5BNP A;  1LHV A;  2WJS A;  4LO8 A;  1UY2 A;  1W06 A;  3KV6 A;  2PLV 1;  1MQT C;  1SLB A;  4YVS A;  1YUD A;  1NCQ C;  5BNP B;  3EMR A;  5FZC A;  2D5F A;  4GKX A;  4OMD A;  5DZG A;  1OLR A;  3ROU A;  2VD7 A;  4DEQ A;  1ULP A;  3AZY A;  2VXJ A;  4WVM A;  2ZMN A;  4UI9 L;  1K5M A;  2VTF A;  2Y60 A;  4QD2 A;  1CON A;  1HV0 A;  2A7A A;  5FR3 A;  1NCR B;  4GWM A;  5L7O B;  4NO4 A;  4PBO A;  1QOT A;  4AE2 A;  4EE2 A;  3KZ4 C;  3BOW A;  1K5M B;  3VV1 A;  1D4M 2;  1OUS A;  1S0I A;  1SMV A;  1SPP B;  3MI8 A;  4L99 A;  2ZX3 A;  2A71 A;  2QZ2 A;  3J8F 3;  2ZEX A;  4JKM A;  4FVV A;  3T1L A;  1MS8 A;  4D0Q A;  1EAH 3;  2JG9 A;  1XNA A;  3DYM A;  1D4M 1;  1VAV A;  4LKS A;  1O8S A;  3U07 A;  4IEO A;  4LE4 A;  3OB8 A;  4JTO A;  3WF4 A;  5JPM B;  4MHU A;  2PHU A;  2VE1 A;  2DCJ A;  3DL3 A;  5JXI A;  1YEW A;  3VKO A;  1CJP A;  4GA9 A;  2JIC A;  2R04 3;  2Z4F A;  3CLP A;  1Z7S 3;  2WR9 A;  4FXG B;  2OKX A;  1UY0 A;  2CDP A;  4C90 A;  4CU6 A;  1EPZ A;  4SBV A;  4H7M A;  5C70 A;  1W6M B;  4QQP A;  5A3O A;  5KXE A;  1L7Q A;  1SLC A;  4N9H A;  1WBF A;  3VZJ A;  4F83 A;  1FAY A;  4IEU A;  5I0R A;  1V6N A;  4P9G A;  1UIK A;  2D6M A;  1DQ1 A;  1PMJ X;  1BEV 1;  1QJX 2;  2LRP A;  1PO2 2;  3ES1 A;  3FFZ A;  4LUM A;  4YZ4 A;  5GLT A;  5K4L A;  1GZW B;  3ZFE C;  4ES9 A;  1EYB A;  1JYW A;  1RUJ 1;  3DPR B;  1PIV 2;  2QTW B;  2GZW A;  4KH9 A;  2W2I A;  3FHA A;  4WVW A;  4YVW A;  2XHK A;  4DIQ A;  1J59 A;  4UOJ A;  2WN2 A;  5FMO L;  4AI0 A;  4G4F A;  4Q0P A;  5C8C A;  1X50 A;  4MV2 A;  4CCC A;  1CZV A;  2GMM A;  2HWB 1;  1HKD A;  1W39 A;  4AF9 A;  5LBF A;  3WNN A;  1DF0 A;  3JXS A;  1GWL A;  1RUD 3;  4ARY A;  4LO7 A;  3WG2 A;  2ZBJ A;  1CAW B;  5EYX A;  2BDR A;  4COV A;  4K21 A;  2JDN A;  1EPW A;  5IW0 A;  3N7M A;  2E51 A;  1EV1 2;  1F31 A;  3PLQ A;  4MSV A;  5FMO S;  3VBS B;  2GH8 A;  4XE9 A;  5L9V A;  1W3X A;  3LGR A;  2HWC 1;  3ZXF A;  1XYO A;  2J22 A;  2BQP A;  3SEE A;  3TN9 2;  4QT6 A;  2LAL A;  1RIR A;  3KHB A;  4BQ4 A;  1ZRD A;  2ARC A;  4GH4 C;  1WD3 A;  1PZ7 A;  3OEB A;  2JE7 A;  4Q26 A;  4MGS A;  1POQ A;  4S2H A;  4Q4Y 1;  3RMY A;  3T0A A;  4LK6 A;  3WQ1 A;  4Z8B A;  5JZG B;  2HYK A;  1PK6 C;  4QGN A;  3JB8 A;  4AFM A;  1RUD 2;  4ZS2 A;  3RGB A;  3S30 A;  4XHB A;  3TB0 A;  1YQ8 A;  2XOM A;  4RL7 A;  2VZO A;  3AP4 A;  3POE A;  3PVN A;  4MOA A;  3VKF C;  1G7Y A;  1N47 A;  4XJ8 A;  1ZBA 1;  1BK1 A;  2Z69 A;  4KL1 A;  1EV1 3;  1V0A A;  1PGW 1;  4YM1 A;  1HB4 A;  4OYU A;  3RZJ A;  3DF0 A;  1VRH 2;  3TN9 3;  5LCW L;  3SHR A;  5JXH A;  2VZR A;  3T2P A;  3ZDS A;  3BOP A;  1H4H A;  1JUI A;  2BU9 A;  3MYX A;  4Q4X 3;  4W6W A;  5F1R A;  1BYH A;  2WYS A;  2VQU A;  4X6Q B;  3WY6 A;  4PCR A;  4YLZ A;  5FP3 A;  1J58 A;  3UT0 A;  4F7Z A;  1BBT 2;  3UK9 A;  1TVG A;  4BQ5 A;  3BGA A;  4TZD A;  1LNS A;  1VE0 A;  1ZA4 A;  3SLI A;  4X8N A;  3PTY A;  4Y1Y A;  4H7L A;  2V72 A;  4UXA A;  4RHV 1;  4AR2 A;  3WW1 A;  3I54 A;  1IKP A;  1AR7 1;  1N3Q A;  2E6V A;  5C8C C;  4HPK A;  4AXO A;  1UW8 A;  1VBA 2;  4GAZ A;  4XF0 A;  1FV2 A;  1RHI 2;  2AEY A;  2C4X A;  5LRS A;  4N43 C;  5GZE A;  3H1M A;  4NE9 A;  1QU0 A;  5C71 A;  3PUA A;  4RR3 B;  3ILN A;  4GB3 1;  4XW3 A;  3WHU A;  2XL9 A;  1ZZ7 A;  5L9B A;  2R1D A;  2LRO A;  2Y6H A;  4LO6 B;  4MG2 A;  2CHH A;  4LJH A;  4I0A A;  1BBT 3;  5CU1 A;  1LU2 A;  5DAW A;  5EFU A;  4XFF A;  2DCT A;  3AP6 A;  1WW7 A;  4AG4 A;  5KWR A;  4CEY C;  5T50 A;  3AFG A;  3R4S A;  4I09 A;  3ZFF A;  4DY3 A;  3ZN5 A;  5T5O A;  1VAM A;  3I8T A;  4XF9 A;  1IQD C;  4JCK A;  2BBA A;  2Z2S B;  5C3R A;  1ODN A;  1W8N A;  3SC7 X;  4Q4V 2;  2WA3 A;  4XMI A;  1COV 3;  4B4P A;  5LA1 A;  3JD7 1;  1XYP A;  3R05 A;  1YI9 A;  3K77 A;  5F3E A;  3WV6 A;  4JGY C;  5AVA A;  2QQP A;  2YC0 A;  1GNZ A;  1VB2 A;  1UXZ A;  1UWW A;  2ENR A;  3C2U A;  1F4H A;  1UOF A;  3NQH A;  2AAC A;  3UKT A;  4RN5 A;  3FHI B;  1STM A;  4XUR A;  4E8C A;  4LIU A;  1W28 A;  1UYZ A;  1H1M A;  5EJ1 B;  1LJ7 A;  3RVH A;  1LGB A;  4QHB A;  5JWP A;  3HT1 A;  2ZML A;  3AMN A;  3N35 A;  4FPJ A;  4LLF A;  1COV 2;  3E6C C;  1Q56 A;  2UU8 A;  5JUV A;  4OUL A;  4QX5 A;  5FPU A;  2H6C A;  3AYD A;  3VZM A;  3IB3 A;  4QKD A;  3U11 A;  2YG0 A;  3BPZ A;  1JZ6 A;  5EP9 A;  2VJX A;  4GXL A;  4KWU A;  3OBT A;  4OUE A;  5EV7 A;  4AI1 A;  3ZFF C;  3AP9 A;  4COZ A;  1PGL 1;  1V9U 3;  2CU5 A;  4K9S A;  3KS7 A;  2QQL A;  3LFM A;  4GH4 B;  3WQ0 A;  3D4K A;  5BNQ A;  2BZD A;  2R32 A;  4P9X A;  3LPF A;  2JD4 A;  3O1V A;  3WIN E;  2XJT A;  3NJY A;  3LA3 A;  5F39 A;  5GLZ A;  5A6Z A;  1HQN A;  2ZX4 A;  5M0T A;  3OBZ A;  1MZ6 A;  3CMG A;  3K48 A;  4NR1 A;  1ULO A;  4LKD A;  4B29 A;  2PFW A;  5GM0 A;  5A1F A;  3I59 A;  4ZXE A;  2QCS B;  1KGY A;  1AYM 3;  1SZB A;  3NNL A;  2FQP A;  3FBY A;  3KT7 A;  1CAX B;  1XOY A;  3JBG 3;  4FPH A;  5CZK A;  4IV1 C;  3ILR A;  5FZ6 A;  5D1I A;  5LY1 A;  3GNE A;  5FQ0 B;  4BYY A;  1POV 0;  5ANN A;  4JX0 A;  3Q8A A;  3BTY A;  3OPW A;  3OCP A;  4JVA A;  4P5H A;  5FYH A;  3B93 A;  1KDM A;  4EYU A;  1IPJ A;  1PVX A;  4P9L A;  2A6W A;  4Q0S A;  3AZW A;  1UOJ A;  4PIX A;  2UY8 A;  4BMB A;  2E33 A;  2TEP A;  4AVS A;  1GKB A;  1H8V A;  5LA0 A;  1N3O A;  5HV4 A;  3LB9 A;  5TSW A;  2BUK A;  2FBE A;  2W68 A;  4KMQ A;  2ATF A;  4YFZ A;  4I2O A;  2D6N A;  4XUP A;  2VME A;  1AYM 2;  3OD4 A;  4Q1P A;  1H2L A;  2CGN A;  4AYU A;  5CFC C;  2W08 A;  4H3W A;  1IGO A;  3VBO B;  4XDP A;  3UNP A;  2WNU A;  2VW2 A;  3E5X A;  1QWR A;  1S0F A;  2HWF 1;  2QQU A;  1AZD A;  1MQT B;  2X29 A;  3IMN A;  5CKM A;  2D3P A;  5FXW A;  1UF2 C;  3UV9 A;  3WF3 A;  2WSV A;  4UF0 B;  4AQ6 A;  2DUP A;  1Y9M A;  1OKQ A;  4OHV A;  3VBS A;  1CIW A;  3WDT A;  1X82 A;  4W65 A;  2R30 A;  1DZQ A;  4D3W A;  4P9J A;  4H2A A;  2QQO A;  4XCA A;  2DU0 A;  4CP9 B;  1ONA A;  1HXS 3;  3WF2 A;  4Q8L A;  5GZD A;  3JCI A;  5JOX A;  4IV1 A;  1FNZ A;  1ULC A;  3E6B A;  2B4K A;  2J1S A;  2WZ8 A;  3NAP A;  2ZAH A;  2BVB A;  5A3U A;  4BU2 A;  4FCA A;  1NLS A;  3VDC A;  4EQV A;  1QHD A;  1T6B X;  1IS5 A;  4MLO A;  4BIO A;  3DCQ A;  5H9R A;  4CP1 A;  2CV6 A;  1W8F A;  1WA6 X;  1I6X A;  3ZR5 A;  2RS1 1;  1W2N A;  3VBF C;  1XNK A;  3CZJ A;  5EQU A;  1ZYB A;  5JDB A;  3ABZ A;  3NV4 A;  3TNP B;  3H8X A;  2ARB A;  3MDP A;  3KB5 A;  2GME A;  1WMX A;  2DUQ A;  3AMQ A;  1JN2 P;  4ZU5 A;  2Y38 A;  3MLL A;  1SCR A;  5FTT C;  5A7O A;  2WNU C;  5F9T A;  1Y43 B;  1OUR A;  3B01 A;  3KHC A;  4U2A A;  4DZG A;  1VMH A;  2KXL A;  1PGL 2;  3K3O A;  4QKF A;  2QQI A;  2HBT A;  3OSD A;  3VHN A;  4LEJ A;  4AAP A;  5C4W A;  5A3L A;  4QMA A;  4YW3 A;  4AEK A;  4MGI E;  3PUQ A;  4IEW A;  4O65 A;  3ZLI A;  4KWJ A;  3TNQ A;  4CVU A;  1OMI A;  4ASL A;  3OBR A;  3GZU C;  2D6L X;  4LOR A;  2BGP A;  3FMG A;  4HLT A;  4Q0V A;  4XC9 A;  3IIA A;  5IHR A;  1ND3 A;  5LBB A;  2ORZ A;  1JH5 A;  2EXK A;  2DTW A;  3QBQ A;  4HON A;  5KHH A;  3E1F 1;  3VKN A;  3H3U A;  5AC9 3;  5C9A A;  1KDK A;  1AL2 3;  1OPM A;  4YM0 A;  3CO2 A;  4QM9 A;  2ZTN A;  4WVM B;  1NA1 B;  2VMI A;  5A1A A;  1RMU 1;  3ZSE A;  4UFL A;  5C9A B;  1RUF 1;  4LR4 A;  2PHR A;  3AKT A;  4V1P A;  1AX2 A;  3MHZ A;  5GLW A;  3MV0 1;  4KI5 M;  1XRU A;  1HIX A;  4JGY B;  4QX0 A;  1RUF 2;  4LO5 B;  1TE1 B;  3RRD A;  5A3P A;  1NQJ A;  4UW3 A;  4AQS A;  4C91 A;  1W6P B;  5ABJ C;  2HWB 3;  4PLO A;  4A41 A;  3SIT A;  3TEW A;  3ZYI B;  2P6C A;  2WO1 A;  4FPF A;  1LED A;  1LEC A;  1O5U A;  4JDM A;  3WCS A;  1DP0 A;  3WEZ A;  2WQ4 A;  4K6B A;  1V70 A;  4E4Z A;  1XYN A;  5FMD A;  2PMW B;  3SXW A;  1XC6 A;  1ZZB A;  2HEV F;  4QPY A;  1SDD B;  2C1F A;  1T2X A;  3KCC A;  5J36 A;  2BOI A;  1I1E A;  4OQ8 A;  1UYY A;  1PNG A;  3J26 N;  4MET A;  3T0D A;  2PHX A;  4XFI A;  4YW1 A;  4A4A A;  4TTG A;  1U5I A;  2BVV A;  3B3Q E;  4CA9 A;  4Y20 A;  4ZU4 A;  4EN9 B;  3NMB A;  3D5O A;  2ZHL A;  1CD3 G;  1RUF 3;  1RUC 2;  4E9K A;  2RMU 1;  1UYP A;  4Z07 A;  1H2N A;  2BEO A;  3JBG 2;  1V6L A;  4MUV A;  2NMN A;  3VDD B;  4AK3 A;  1WMD A;  3IPV B;  4BH9 A;  1W03 A;  3KT4 A;  2XUM A;  2XML A;  2B42 B;  3GZE A;  4FPC A;  4K1Y A;  2XJS A;  4RS5 B;  1TQ5 A;  5C6C A;  4LPL A;  4PJY A;  3VBR A;  5HV0 A;  1UQX A;  4AZZ A;  3H9A A;  3PVB B;  3MIC A;  4BME A;  3OPZ A;  2ZZJ A;  3V0B A;  5FPV A;  1RED A;  3EQE A;  1AX0 A;  5FZ7 A;  1WCD J;  3ZX7 A;  5JIU A;  3R4D B;  4NRM A;  4AI2 A;  4GH4 A;  1ZBA 3;  3LDB A;  4FPK A;  1UMI A;  4NVP A;  4QQH A;  4Y26 A;  3VBR B;  2WKK A;  3WT3 A;  2JX9 A;  3WW3 A;  2O1Q A;  4P9W A;  2Q1Z B;  1GBG A;  1RUC 3;  1YQC A;  2XQX A;  3DN7 A;  3I4I A;  3LPG A;  1CJD A;  2R0F A;  5BUV A;  3FUO A;  2WLQ A;  1YQ2 A;  2JG9 C;  1W8O A;  4R4X A;  4RR3 C;  3AMH A;  3BU7 A;  4I0B A;  5D21 A;  5CB7 A;  4YG0 A;  3O1O A;  2WO3 A;  4CCL A;  3BPS A;  1K5J A;  3OJB A;  4FOW A;  2Q1M A;  3K51 A;  2ORX A;  1REE A;  1JYT A;  1FV3 A;  5JSR A;  4B1M A;  2LW8 A;  4UBH A;  3C7G A;  1S0C A;  2RM2 1;  5BYN A;  2C5D A;  1V6M A;  3P5B A;  4XPV A;  2E7Q A;  5FPZ A;  2CWS A;  5BPX A;  1JYC A;  5IAV A;  3WNL A;  4LUK A;  4YVS C;  3WNP A;  4CPB D;  1W0P A;  4IER A;  4FFI A;  2ZGN A;  1TNR A;  5LEJ A;  2CNA A;  2ZAC A;  2DBN A;  1Q8V A;  2E32 A;  1V6O A;  4XBQ A;  5DXD A;  3VBO C;  3POI A;  4O61 A;  3VBH B;  3W21 A;  1JZ3 A;  1U12 A;  1ZRR A;  5CFC B;  1UY4 A;  1VIW B;  5FO9 B;  4FSJ A;  3J7M A;  1HN0 A;  2QE3 A;  4O9E A;  3OGR A;  1Y3T A;  2V5Y A;  3DXT A;  2JEN A;  3GDB A;  3V64 A;  1VPH A;  3WW2 A;  4AFB A;  5J09 A;  5LBE A;  2R6Q A;  3KF3 A;  1JZ5 A;  1OT5 A;  2W47 A;  2IFW A;  3NWK A;  1YIP A;  5FZG A;  4WBB A;  1F2N A;  5E89 A;  4KG0 A;  2PN5 A;  3T09 A;  1PGS A;  3WF1 A;  1RUI 3;  2JDM A;  3ES4 A;  1JTZ X;  2JKB A;  4OVE A;  1UY3 A;  3EO6 A;  3IZO A;  3PIJ A;  4I02 A;  1N1Y A;  4ZY9 A;  1OF3 A;  1NUK A;  5FYY A;  4LA2 A;  5FRA A;  1FMD 1;  1PVC 1;  4YGE A;  4TN7 A;  3CNA A;  1VBD 3;  3MBW A;  3I2H A;  5FXV A;  2DVD A;  2WWS A;  4FPO B;  2VC9 A;  1CGP A;  1VBC 2;  3B9I A;  4ISQ A;  1WLW A;  2OXB A;  5FJK A;  4ZHN A;  1GLH A;  1US3 A;  3UJQ A;  3MUZ 1;  1DLC A;  1W90 A;  2DYC A;  2P34 A;  3MW2 A;  5JOW A;  3I2O A;  5DAX A;  1RUG 1;  2AGS A;  1GZW A;  1NY7 1;  3OUI A;  4PF5 A;  4PF1 A;  2JG8 C;  4FAG A;  2VCB A;  1EAH 1;  1WGP A;  2DFB A;  1ZZ8 A;  1LKN A;  3EYP A;  3OYW B;  4YVW B;  2H0B A;  3E6D A;  1LEM A;  1S1A A;  4CDW C;  1POV 1;  2QUO A;  1DGL A;  1VBD 2;  4AGR A;  3SQO A;  1LB2 A;  4JKK A;  1HQL A;  2JD9 A;  1XBF A;  3H1W A;  5JVV A;  3BTA A;  2MHF A;  1UZZ A;  2XJP A;  3QH7 A;  3FWE A;  3RI9 A;  1UKR A;  1FAT A;  5F37 A;  3RI8 A;  3AKQ A;  1O3R A;  1GUI A;  1HDK A;  4YM2 A;  1WW5 A;  5DG2 A;  1DQ5 A;  3VBO A;  5K9Y A;  3WDX A;  3I2F A;  1YRZ A;  5GAL A;  2WT1 A;  3BKZ A;  1MR5 A;  5B2G B;  4NHM A;  4QKN A;  1DDL A;  4WVV A;  4XTM A;  4YVS B;  3NVC A;  1UX7 A;  4D6S A;  4PBP A;  4FT8 A;  1OI6 A;  3ZIW A;  2VNR A;  5DUX A;  4K1Z A;  1RVF 1;  3UGG A;  5J7M A;  3KVB A;  3BIW E;  4XDQ A;  2B45 X;  4IGP A;  3BAL A;  1I3H A;  2XJU A;  5C3P A;  4HKW A;  2PAM A;  1RUO A;  4COY A;  1POV 3;  1RVF 2;  3V0A B;  4PIZ A;  2WS9 3;  4CDQ A;  1IS6 A;  4I3G A;  3I2G A;  4OMC A;  1RUD 1;  3C3V A;  3NJZ A;  4XFA A;  1RYY A;  4QX1 A;  1Z0H A;  1R09 3;  2WAB A;  4FFF A;  1DFQ A;  5E6H A;  3OF1 A;  2OYZ A;  2WO2 A;  2K2S A;  2NYY A;  4MH0 E;  1W6N A;  4LXL A;  5FY5 A;  3WF0 A;  3FLT A;  4FP3 A;  4XAA A;  1IOA A;  4IEP A;  4GWJ A;  4XHX A;  5BV6 A;  3IDA A;  3MLK A;  5FO8 B;  4YWA A;  3AP5 A;  2OPW A;  2VOW A;  3LFI A;  1GWK A;  2ZKN A;  1W04 A;  1CQ9 A;  1VBB 3;  2HWF 2;  3JUU A;  5FUI A;  4DY5 A;  1VRH 1;  1CZS A;  3RZZ A;  4FTE A;  2VVD A;  1QJU 3;  1QQP 3;  1GFF 2;  5IFT A;  1XB9 A;  2WZR 3;  4J25 A;  4PT6 A;  3ASI A;  3LQC A;  3MUY 1;  3A0K A;  1JW6 A;  3LEM A;  4NOT A;  1RB8 G;  2GC1 A;  2OUH A;  2PHD A;  5HCF A;  3AM2 A;  2DWR A;  4X8P A;  2CTV A;  4XF1 A;  4AHZ A;  1YXW A;  3GM8 A;  1LEN A;  1NAE A;  3TEY A;  2WNV A;  1GIC A;  3ZN6 A;  1MPX A;  2WWU A;  5T55 A;  4IE6 A;  2PTM A;  4CDU C;  3QCW A;  3H8O A;  4CEY A;  1TEI A;  2DVB A;  2VBD A;  1YQ6 A;  3H7Y A;  4D7Y A;  1AR7 2;  4XFH A;  2J7M A;  4BK5 A;  1PO1 1;  1Q3E A;  2R49 A;  3N9O A;  3Q8E A;  4XF3 A;  3T30 A;  4LHL A;  2FZ2 A;  1U5Z A;  2FCU A;  1EY2 A;  4DMI A;  4P14 A;  4GJZ A;  1R08 3;  4QB1 A;  1LOA A;  5F2S A;  4Y22 B;  1AR8 1;  1UD1 A;  4LO4 B;  5IK5 A;  3IMM A;  1NCR C;  4QX3 A;  2DTY A;  5DMY A;  5G05 L;  1BKZ A;  2YPD A;  2GU9 A;  4GMP 0;  2RR1 2;  5C8W A;  1LHU A;  3PME A;  3ZFG B;  3I2J A;  1ALY A;  1QJU 1;  1PMI A;  2RS1 3;  3ZIX A;  3G7D A;  4N43 B;  4MXW B;  4X6R B;  5DDJ 2;  3KF5 A;  3ZVX A;  1L7L A;  5GZG A;  1AR7 3;  3ACG A;  2ZGM A;  2OPK A;  2ZXQ A;  4CP2 A;  3O1R A;  1RHI 1;  1YJL A;  1W2T A;  2DF7 A;  5AC9 1;  1JYX A;  2JIJ A;  2ZHK A;  3P6B A;  4Q27 A;  2QQV A;  4CU9 A;  2LTN A;  1JMU B;  3N9M A;  4W50 A;  5FZ3 A;  2Q8E A;  2G9Z A;  3LSD A;  3KM5 A;  3KV5 A;  2VOV A;  2WAO A;  3WDY A;  4B4R A;  5FWE A;  1DYK A;  3CL1 A;  4LK7 A;  3JU9 A;  5H9Q A;  1X9T A;  4BHP A;  4XVH A;  1WA4 A;  3JD7 2;  2RR1 3;  1QOS A;  3AJZ A;  3NV1 A;  1QXR A;  1W6O A;  3GCX A;  4HET A;  4QM8 A;  4XAC A;  3W20 A;  5F32 A;  4S2D A;  5J1X A;  4XFG A;  2VOK A;  2NLR A;  5FY8 A;  1QKQ A;  4N7I A;  2R0H A;  3M4F A;  3QOP A;  1MS1 A;  2RS5 1;  2RV9 A;  4AVT A;  1OLQ A;  2RJL A;  2OQ7 A;  3I3E A;  4QXK A;  4XTP A;  2XVG A;  1W0N A;  3EJK A;  2WQ8 A;  3HQX A;  5EHD A;  1GR3 A;  1QJY 2;  3N7J A;  3K75 B;  1YFX A;  3PMS A;  3KSC A;  1B09 A;  2UYB A;  2CDO A;  3W5N A;  5L36 A;  3WVJ A;  1BQP A;  1UU6 A;  3J8F 1;  4Q8K A;  5T5L A;  3UKV A;  3AMM A;  1NLR A;  5L7O A;  4KU8 A;  1QH7 A;  3VD9 A;  3KLS A;  4JHZ A;  5E16 A;  2BTV C;  4WM8 C;  5BNO B;  2NN8 A;  4NN0 A;  4L8Q A;  3ECQ A;  4PI0 A;  4XJA A;  3DYP A;  1DBN A;  5L73 A;  3RWK X;  4AOC A;  1HB3 A;  1SLT A;  2ZOE B;  1ZA7 A;  4TWT A;  1ENX A;  1W8Z A;  5FPL A;  1HB2 A;  1N3P A;  5EJZ B;  2JEC A;  4XUO A;  4CCD A;  4U36 A;  1IS3 A;  4UBG A;  1L7R A;  4Z2W A;  1OSG A;  3ZXD A;  4BLJ A;  1H4G A;  2QNK A;  1BVV A;  1DGR A;  4RQP B;  2TNF A;  3K2O A;  1APN A;  5SV5 A;  1RJ7 A;  4ZU7 A;  2J1E A;  5JMC A;  4LBJ A;  5FY0 A;  3ZYB A;  5FOB B;  5FZO A;  1RUH 1;  1CAV A;  2EXI A;  4LUL A;  3VZL A;  4QDS A;  2WA4 A;  4EJR A;  3S7E A;  3H3Z A;  3MIE A;  5IJR A;  3LIH A;  2DU1 A;  3NO8 A;  3UGH A;  3HBZ A;  1CVN A;  4QHZ A;  1XJA A;  5FWJ A;  1F5F A;  5IK8 A;  1VRB A;  2YFU A;  1CR7 A;  3WD5 A;  1OVP A;  3IDC B;  4EWE A;  4Q2F A;  5A32 A;  2WII B;  4MXV A;  3R0R A;  4AED B;  3VHO A;  5K0U A;  5F3C A;  1AYN 1;  1YYN A;  4S2F A;  3N7K A;  3KGL A;  4Q4W 2;  3FLR A;  2WS9 2;  3S5Q A;  3BU0 A;  4PLM A;  5ANQ A;  5FZE A;  1FOD 2;  5CFC A;  4OCT A;  4GWI A;  2N7G A;  4FI9 A;  1R09 2;  4PI2 A;  5HXV A;  1AYM 1;  2JE8 A;  2R06 2;  5DUW A;  4DUW A;  4Z92 B;  1IS4 A;  2RDR A;  2XLF A;  3AKP A;  1OBN A;  5A7W A;  5DAB A;  1PIV 1;  3WDU A;  1RJ8 A;  4H55 A;  2FDH A;  1QIQ A;  1K45 A;  2NMO A;  1CES A;  4K8R B;  2YFZ A;  1RUE 3;  4Y3O A;  4PDW B;  3MZH A;  3VD3 A;  4CP9 A;  4CXW A;  4QDQ A;  4LNV A;  3ZM8 A;  1MEC 2;  1QQP 2;  2JEM A;  1A8M A;  2WFF 3;  3VBR C;  2JG9 B;  4DB5 A;  1ACC A;  1FYU A;  4Q4W 3;  4UF0 A;  2YU2 A;  5FP4 A;  3LOI A;  3ORJ A;  5CFD C;  4I0W B;  3III A;  4QHO A;  4YGB A;  5I0U A;  3HJR A;  5D8A B;  4CUC A;  2XDV A;  5ABJ B;  5KXB A;  1V6K A;  3ZXG A;  5AFB A;  3NNG A;  4I01 A;  5T5P A;  5JZG C;  5FYM A;  2GNB A;  5KXD A;  3SEP A;  5IK7 A;  5A6Q A;  4CRQ A;  3LOB A;  5B4N A;  4ES8 A;  1BLZ A;  5FYZ A;  2JDU A;  3GF6 A;  4A2U A;  1HQW A;  2CL2 A;  4FTB A;  1ASJ 1;  2XLG A;  3D0J A;  4E2Q A;  3ZKU A;  3ACH A;  2XVK A;  5IYY A;  4UFJ A;  5JI9 A;  5EZW A;  1OF4 A;  1B35 B;  4DPN A;  1AHS A;  2XHN A;  3CBN A;  2IXL A;  3MPP G;  1L3J A;  5IAT A;  3IKW A;  4HBN A;  4CP0 A;  3OUJ A;  4GB3 3;  3RZK A;  1ZNP A;  3K4A A;  4GMP 1;  4NIG A;  1US2 A;  2FMY A;  3AB0 A;  3DPR A;  3PJQ A;  1EUT A;  2WN3 A;  2RS1 2;  3DGT A;  4B7E A;  1LHW A;  2PHF A;  2VMG A;  2BW8 A;  4RQP C;  2BOJ A;  5FZL A;  2DVA A;  4AQ2 A;  4CTE A;  2Y64 A;  3NNM A;  2A6Z A;  3ZSJ A;  4RD7 A;  5FYB A;  1DHK B;  4Y1U A;  5FKB A;  3MPB A;  2BFU S;  1C4R A;  1D7P M;  3IBM A;  1LU1 A;  2R04 2;  4OI4 A;  3BYW A;  5L9R A;  4EN0 A;  2QFE A;  4XZU G;  2YBP A;  3PU8 A;  4DUV A;  2VZU A;  1VBC 1;  3ZFG C;  4KNC A;  2Y6J A;  5CFD A;  1PK6 B;  2XBO 2;  4PHZ A;  3OYW A;  1SHW B;  1FNY A;  1B35 C;  3T08 A;  3RWN A;  2AH2 A;  3RSJ A;  4DUX A;  1S4C A;  3I2K A;  4OI2 A;  2ZEW A;  1A8D A;  3ME2 A;  1PK6 A;  3W9A A;  3H3L A;  4YPJ A;  1X8E A;  5FOJ B;  2VCC A;  3MF9 A;  3AX4 A;  2UUR A;  2VQA A;  1O6U A;  5J98 B;  4N7U A;  1CAU B;  1QJY 3;  3VBS C;  3HR9 A;  3VB9 A;  1FI2 A;  1XE0 A;  3EHK A;  2EAK A;  2EIG A;  1G86 A;  2VQT A;  1TMF 2;  3BCW A;  5EXO A;  3QH6 A;  2AC1 A;  3ZFF B;  2CGO A;  5DUV A;  2E9Q A;  1WCU A;  3ATG A;  4QX7 A;  2OT7 A;  4XBN A;  3WUD A;  1NA1 A;  2WWJ A;  4W8J A;  3O1S A;  4L9B A;  1JZ2 A;  1U5X A;  2W39 A;  3A21 A;  3AXE A;  1Z7S 1;  3LF7 A;  1W3V A;  2VZ3 A;  3ON7 A;  1OQ1 A;  3PTR B;  1K5M C;  2ERF A;  2VW1 A;  4M00 A;  4OI1 A;  4Z2A A;  3U0Z A;  3MW3 A;  1TME 1;  5FO7 B;  4NRQ A;  2YMZ A;  1JXN A;  3CZU A;  1VBB 1;  5FIX A;  5F5I A;  3MF6 A;  1QQP 1;  5LB6 A;  3C7H A;  5JZG A;  1OA2 A;  2ZGP A;  4UAP A;  5LRR A;  5I91 A;  2KA3 A;  1W99 A;  3AKR A;  1AXK A;  1RUJ 3;  3LA7 A;  3I3M A;  5BNN B;  4NAM A;  4YZ1 A;  5HI0 A;  5ISL A;  3MID A;  3S7I A;  1WKY A;  2GAL A;  3WP3 A;  4DRV A;  5CIR A;  1R1A 2;  1LOD A;  1OQE A;  2OUJ A;  5FZH A;  4A6O A;  4AHY A;  1M4W A;  4Y20 B;  2NP0 A;  4QWN A;  4E8D A;  1GQG A;  1ULG A;  1SLI A;  3J7N A;  1W6Q B;  4CCK A;  5HBA A;  1SDW A;  3A4U A;  3O5S A;  3POB A;  5F8P A;  2WUH A;  5E8A A;  4BLI A;  1DCS A;  1NKG A;  2FCV A;  2VMC A;  3HNM A;  2ZA9 A;  1C28 A;  1R1Z A;  3M8L A;  5FBJ A;  2BNN A;  4N43 A;  2B9U A;  1XSR A;  3U14 A;  2PA7 A;  4XQ4 A;  2IWG B;  5JOY A;  2HYX A;  4GQ7 A;  3OPT A;  3A23 A;  3ZO0 B;  1H2K A;  3JBG 1;  2PXJ A;  3QLQ A;  2VZS A;  3KV9 A;  5FK7 A;  2WT2 A;  3TWI A;  3MGU A;  1XNT A;  1RUN A;  3VBU B;  2VZV A;  4DIN B;  2HJI A;  2W1W A;  4ITC A;  3THP A;  1NXD 1;  3W58 A;  4Q4Y 3;  1KJL A;  2J1V A;  4TLF A;  1UOG A;  5EYY A;  2VR4 A;  4Y22 A;  2FMD A;  5IVY A;  2EAA A;  1DQ6 A;  3FBM A;  1NA1 C;  4LIT A;  3RNS A;  3ZYJ B;  1JYI A;  2XLA A;  1W9S A;  2B46 X;  4O7X A;  1PO1 3;  1EUU A;  4NPM A;  3N9N A;  5SV8 A;  5IVF A;  1NCQ A;  2ZCW A;  4JZR A;  4MXW A;  3POY A;  3VDB A;  4IEZ A;  4AFA A;  1V00 A;  1CPN A;  1OQD A;  1OUX A;  1GSL A;  2J1U A;  4E2G A;  4Q0U A;  3SH5 A;  2R07 2;  4RHV 2;  1QDC A;  1N1T A;  1OPO A;  1UZ0 A;  1W0O A;  2VUD A;  3UGF A;  2HWE 3;  4Q0Q A;  3I97 A;  2QDN A;  3V65 A;  1BVP 1;  4M3C B;  4PDW C;  5I0T A;  1GYK A;  4BQ3 A;  1K3I A;  2MNG A;  1ND2 A;  3P1I A;  3E97 A;  1WLT A;  4I3P A;  5ERL A;  4M4P A;  2HWD 2;  1BXH A;  4K20 A;  4Q4V 3;  3ENR A;  4OI0 A;  2GC2 A;  2IVI B;  3F2Z A;  3HN3 A;  2E7T A;  4HXC A;  4A45 A;  5ACA 1;  4L11 A;  4QQL A;  2CY6 A;  2DV9 A;  2ZEY A;  4GB3 2;  5T3N A;  3ZDV A;  3PVE A;  2K0G A;  1QF3 A;  2YPJ A;  4BOW A;  2QQW A;  2WQZ C;  4NRO A;  3LDR A;  3HEI A;  3ZN6 B;  3VDD C;  4IV3 A;  1NOV A;  4D6Q A;  2RDQ A;  2HWE 2;  1VLN A;  4OZX A;  4CUG A;  3FX3 A;  3APB A;  3MIF A;  3HWJ A;  5APA A;  2ADE A;  1Q8S A;  1UPS A;  2ZGO A;  4L92 A;  2XKO A;  1OC1 A;  1T6G C;  2Y26 A;  4IW3 A;  2BRT A;  2RDS A;  5IWF A;  4D7T A;  1REF A;  1FXZ A;  2GN3 A;  1SBE A;  4GKY A;  4LBK A;  3MFC A;  1XQN A;  3EXU A;  1AF9 A;  1MZE A;  3J8F 2;  4MGQ A;  4ORF A;  1SFY A;  2XXZ A;  4RR3 A;  4B3N A;  1HV1 A;  3PU3 A;  5LAS A;  4XJW A;  5LZ6 A;  2P3Y A;  1ZBE 3;  1KFX L;  2YHJ A;  5DN2 A;  3O1P A;  1O59 A;  3T2T A;  4EN6 B;  4RS5 A;  1FMD 3;  1PVC 3;  3HT2 A;  4IEV A;  2ZHN A;  4FOV A;  1VBD 1;  1IG3 A;  1O4Y A;  4WZC A;  3L2H A;  1OOP C;  1RMU 3;  1TMF 3;  5AVP A;  3RDI A;  2XPJ A;  4XCB A;  2A3W A;  2DCZ A;  2OS2 A;  2QJV A;  2FHR A;  3AMP A;  4MYE A;  4H14 A;  4MZU A;  5JLV A;  2YYO A;  3WR0 A;  3VN4 A;  2CGP A;  2BGC A;  2I74 A;  2OA2 A;  2VVF A;  2WO7 A;  1F5J A;  1ZZ6 A;  2IXI A;  5A7P A;  1O3T A;  1SLA A;  4FPG A;  2FD8 A;  2W52 A;  4BB3 A;  1YJK A;  4N53 C;  5LK7 B;  1D2S A;  4PDW A;  1QJX 3;  1PO2 3;  1TNF A;  4C1X A;  4YZ5 A;  4CSW A;  3TBD A;  4IE5 A;  4AVA A;  3WXP A;  1PIV 3;  3H7J A;  1RXG A;  4CDX A;  5IVJ A;  3VBH A;  1ENQ A;  4IE4 A;  1UN1 A;  1HLC A;  4Y33 A;  3ETQ A;  1FX5 A;  2C9K A;  1RUH 3;  3SMH A;  1JZ7 A;  1HN1 A;  5KXC A;  3LE0 A;  4JGZ C;  2OZ6 A;  3CKH A;  3RPQ A;  2P17 A;  1NCR A;  5DG1 A;  1WMF A;  1H8T B;  4Q4W 1;  4BE3 A;  2ZGR A;  5LW9 A;  1HJF A;  4RFT 0;  2RMU 3;  2G1M A;  3DUI A;  4COW A;  5A3W A;  3T1M A;  5CBL A;  5T52 A;  1H8T A;  2WNU B;  1BMV 1;  4XUT A;  1JUH A;  1ZRE A;  1I9R A;  3HVD A;  2JDA A;  3GJB A;  4RGA A;  4Y5S A;  1O3Q A;  2ZAA A;  3EBR A;  3NKG A;  4KBZ A;  1OOP A;  3VKL A;  4AAX A;  1ASJ 3;  1AR9 2;  1DU3 D;  3PUS A;  4UWD A;  3MIG A;  4AHX A;  4CE8 A;  4ZZ8 A;  5FZ9 A;  4OHX A;  1MS9 A;  5FZI A;  2JG8 A;  2UWA A;  4W6X A;  3WQ7 A;  4XZP A;  4M3C E;  1D2Q A;  2JB4 A;  1AXY A;  1OVS A;  2VCM A;  2WT0 A;  3USS A;  4BQ1 A;  5FPB A;  3H50 A;  1JOB A;  1C57 A;  1IQA A;  2A6V A;  4XJZ A;  4E27 A;  1BCX A;  3LZZ A;  2BER A;  2JB8 A;  4URA A;  1UKG A;  3OD0 A;  1CZT A;  4IGO A;  5KHJ A;  5FYU A;  5LBC A;  1MAC A;  2K46 A;  1VAK A;  3UKN A;  2ZX2 A;  4QX2 A;  5FFO C;  5CFD B;  5D2A A;  1P8J A;  4YW7 A;  4D8M A;  2RM2 3;  2VNO A;  4MO3 M;  4QDR A;  1GNH A;  1AUY A;  1ASJ 2;  1AR9 3;  2IFR A;  2VOX A;  4L0P A;  5A32 B;  4Q4X 2;  3ZXJ A;  5JPN B;  2W1Q A;  3OGJ A;  4SLI A;  4LHN A;  4CYD A;  2GP3 A;  3AVR A;  3ZMO A;  1NE6 A;  1PO1 2;  1WCQ A;  3BIE A;  3QD6 A;  2YB7 A;  4QX8 A;  2D40 A;  4R4Z A;  1SEF A;  2VNV A;  3M3C A;  3ZPO A;  4WM8 B;  5BNO C;  5CIS A;  2ET1 A;  3M3Q A;  4D7S A;  5HPO A;  4GD4 A;  2R07 3;  3KD4 A;  1F15 A;  4UFM A;  1NT0 A;  2W87 A;  3A22 A;  1WZX A;  4D94 A;  1ZRF A;  1W6O B;  4NUB A;  2VMH A;  2PHW A;  5HCA A;  2YBK A;  3I7D A;  4CCE A;  1GZT A;  4QPG B;  4GIQ A;  1VBA 1;  1NY7 2;  1YIF A;  2ZMK A;  1F4A A;  5F5Q A;  1RUI 1;  3C8X A;  3GAL A;  4CDQ B;  5C3Q A;  2Y6G A;  2WYF A;  2RJK A;  3H42 B;  3TEX A;  3DPR C;  1E5I A;  3PDQ A;  2VGD A;  5F6L B;  5AC9 2;  5FAX A;  2CYF A;  5I8S A;  2L9L A;  4GZ9 A;  3OY8 A;  1LOB A;  4RA0 A;  1UMH A;  5DZF A;  3T3Y A;  1UPI A;  2R16 A;  5F5C A;  3FC0 A;  2PQQ A;  3WSO A;  3WNO A;  3VBF A;  5C5U A;  4M3C A;  5FV3 A;  3HNY M;  3HIF A;  3KQ4 B;  1YCI A;  1YO8 A;  2ET7 A;  3QAC A;  1LUL A;  4QAW A;  3ZOI A;  3IPV A;  4ZZ5 A;  1M06 G;  5CAD A;  3HOB A;  1TME 2;  2YRO A;  3VBF B;  1Q8Q A;  5FZF A;  4BXS V;  1O7F A;  4PLN A;  2VZQ A;  3A0N A;  3NNJ A;  3AXD A;  5A7S A;  3X29 B;  4YZ2 A;  2HWB 2;  4AQT A;  1WD4 A;  3B5L B;  2D97 A;  1CWP A;  1FMD 2;  1PVC 2;  2UYA A;  4CEY B;  3KQR A;  4LKF A;  5FMC A;  4NPL A;  3RMX A;  2Y8K A;  4AL9 A;  1KIT A;  3THD A;  4L97 A;  1IKQ A;  4FXK B;  1IPK A;  5EIY B;  5T5J A;  3SCF A;  3SH4 A;  3HNB M;  5BNN A;  4JTN A;  2WZE A;  1CAX A;  5JSO A;  5I0D A;  2XUE A;  1DGW X;  2YGM A;  1TME 3;  3AKS A;  3NRU A;  3WQB A;  4BIF A;  2PAK A;  4XMA A;  5CYY A;  1V9U 2;  1C8N A;  4NHL A;  3GHN A;  2G9G A;  2MPF A;  2D98 A;  2OII A;  2WZP P;  4A3X A;  3V0B B;  4LHS A;  3GXU A;  1LGN A;  3LAG A;  4UYB A;  1K42 A;  4KG8 A;  2V4A A;  3Q9O A;  3MEP A;  2VM9 A;  3AC0 A;  2GDF A;  5BNN C;  1RC6 A;  1ZBA 2;  3FZ3 A;  3IDE A;  4R9D A;  3Q8F A;  3PUR A;  1F9K A;  2VAU A;  2R06 1;  3GZT B;  2XQR A;  3S57 A;  1LOG A;  1MQT A;  4WVZ A;  3S5A A;  4DFS A;  3UYJ A;  3U4X A;  2LS6 A;  1QXJ A;  4XF4 A;  5FYI A;  3U10 A;  5JMO A;  3HN1 A;  3GCW A;  3AL5 A;  3UES A;  5DAV A;  3ALQ A;  4BCU A;  2XJV A;  2RDN A;  4JRL A;  4DO0 A;  2PHL A;  5C5T A;  1VRH 3;  2J1T A;  4S2G A;  2RVA A;  4IDZ A;  2I45 A;  4OLL A;  3SNM A;  2Z79 A;  2WLP A;  5F6K A;  1V6J A;  4A44 A;  2WZR 1;  1W05 A;  4Y1Z A;  5FY1 A;  1QNW A;  1NCQ B;  5BNP C;  4P9Y A;  2ZEZ A;  2JDZ A;  3NAP B;  2WBK A;  5F7U A;  4Q5O A;  1S55 A;  2QQK A;  1G9C A;  4LLO A;  2FCT A;  4EV0 A;  1F35 A;  3MO4 A;  1MS4 A;  2XJQ A;  4FOQ A;  1E5R A;  4CEW A;  4URT A;  3NJV A;  4DQA A;  4LA3 A;  4YGC A;  1WME A;  2VXR A;  1OLM A;  3PL0 A;  2ZPX A;  4Y1V A;  1JZ8 A;  4AGV A;  5JR7 B;  4RYD A;  4AGG A;  4UT5 A;  5GKA C;  1O4Z A;  1GP4 A;  2HWE 1;  2OX0 A;  2VBP A;  5LY2 A;  1MZ5 A;  1B35 A;  1UZW A;  4M0N A;  4OUS A;  1ULE A;  1IPS A;  2YGL A;  2JG8 B;  4NHY A;  2WAA A;  1ZBE 1;  2J42 A;  3GBG A;  3Q8B A;  2HH9 A;  2VU9 A;  2VUC A;  2XL7 A;  2YU1 A;  3AK0 A;  4FQZ A;  4LMF A;  2RS3 2;  4KBB A;  3NV2 A;  4Y5T A;  4EWA A;  2ARA A;  2GP5 A;  4XIL A;  4CDW A;  3ZKY A;  4CU7 A;  1LAJ A;  1SAC A;  4NMI A;  1F8V A;  5LA2 A;  4LBM A;  5F5A A;  5C3O A;  2ARE A;  3PUI A;  1Q5O A;  2HKX A;  2MEV 2;  3LCP A;  4LBN A;  3KGZ A;  3ITQ A;  2A3Y A;  2D5H A;  4YW2 A;  4YG6 A;  5J48 A;  3ZSK A;  1VR3 A;  2JE9 A;  2FDJ A;  1CPM A;  3T4H B;  3WP6 A;  2V09 A;  1ND3 C;  5FP7 A;  1KJR A;  3ZMN A;  3H0O A;  4WM7 C;  1BHG A;  3AZZ A;  3WHT A;  1GP5 A;  2J1A A;  1CAU A;  4ISR A;  3RYR A;  1XNC A;  3LEI A;  3RZM A;  4YYO A;  2BBV A;  1YFY A;  2VUJ A;  3POG A;  2A75 A;  1OFN A;  2RS3 3;  2R1B A;  1RIN A;  1WLC A;  5A7W B;  1PZ9 A;  3AFK A;  1FPN 3;  5T54 A;  5GZC A;  2X10 A;  2MEV 3;  4MGT A;  3T0B A;  3FFQ A;  4BQ2 A;  1QDO A;  1SCS A;  5F3G A;  2WDB A;  1W6P A;  3B69 A;  5DUU A;  3RZL A;  3ZYF A;  1W8U A;  1XU2 A;  3E5Q A;  4NRP A;  2DUR A;  4CDQ C;  2ZGT A;  4HL0 A;  1YQ5 A;  1ZVF A;  4LE3 A;  4CDU B;  2SLI A;  2G9F A;  4QXC A;  4JC1 A;  1TMF 1;  3ZFE B;  4HVQ A;  1IZ3 A;  4OHY A;  4ZKT B;  1WCK A;  2ZX1 A;  3ZYH A;  4DXR A;  3N9Q A;  4YVW C;  3MLJ A;  4Y5Z 0;  1PX3 A;  4UW4 A;  2ZAB A;  2IC1 A;  3WLU A;  3IT8 A;  3ELN A;  2PYT A;  1ENR A;  1LCL A;  2ZGS A;  4FOY A;  1QJY 1;  4IV3 B;  1RUG 3;  1E5H A;  4YRD A;  2X53 S;  1LES A;  3D6E A;  1Q8O A;  3T4V A;  3ZSM A;  1FPN 2;  1H9P A;  1D4V B;  1QMJ A;  1X9P A;  4IES A;  5FYC A;  3THT A;  4XFC A;  4JAA A;  3WZ1 A;  1RL3 A;  2VW0 A;  1W2U A;  2VEC A;  2XJR A;  3CIH A;  4AFD A;  3G6J B;  3IN9 A;  1FPN 1;  2QZ3 A;  2GND A;  2CSG A;  1OD5 A;  3OG2 A;  5EJ3 A;  3KCX A;  1G9F A;  4TSV A;  2C24 A;  3BUC A;  4MAD A;  5JSP A;  2DBI A;  1OD3 A;  3POF A;  4EWD A;  2WRA A;  2FDG A;  3DEM A;  1UZV A;  3D0S A;  3WNK A;  4IE7 A;  2JIG A;  4JGZ B;  4QPI C;  3ZYP A;  4CZS A;  2D6O X;  1GU3 A;  2W95 A;  4DOU A;  2CAV A;  4XIK A;  2DDU A;  2FDK A;  2BP6 A;  5FYT A;  1H1I A;  2DVG A;  2E31 A;  3RQ0 A;  4JGZ A;  5FZA A;  4ATF A;  2PHT A;  5LWB A;  3N7L A;  1UU5 A;  3IDB B;  3L2Y A;  2Q5T A;  2A1X A;  4AFC A;  2Q0A A;  5FCC A;  4YM3 A;  2A3X A;  4J1W A;  4EN8 B;  1W6M A;  4ERO A;  4XXP A;  4NIA A;  3W59 A;  4I30 A;  1C1F A;  1HRV 1;  4TLG A;  3VZN A;  4D69 A;  5IVB A;  3RS6 A;  1ND3 B;  1KS5 A;  1SQ4 A;  1UOB A;  3CJI B;  3OOX A;  3SCH A;  1HXS 1;  3N9L A;  2A6X A;  2EVX A;  2BPA 2;  1QEX A;  1LOF C;  1GOF A;  3R6S A;  4Y4Y A;  5JIA A;  1LTE A;  4XYX A;  1IG0 A;  2F4P A;  3M3O A;  4OHW A;  5FZB A;  2X05 A;  4Z1V A;  1HXS 2;  1QOO A;  2UWC A;  1YFW A;  4M4R A;  3WW4 A;  3AJY A;  5FZ4 A;  4LOS A;  2X8K A;  1W2O A;  4RGK A;  3PJY A;  1CIY A;  4HVR A;  2Y0O A;  5DQ0 A;  4A7K A;  2GH2 A;  2XH6 A;  1QH6 A;  1W9T A;  5FP8 A;  3HPN A;  3DXU A;  4P00 B;  3O1U A;  1RUC 1;  3J7L A;  5FP9 A;  4YG3 A;  1BBT 1;  1YLL A;  3K4Z A;  1WBL A;  2B5H A;  3O7O A;  2Q8D A;  1MVQ A;  2VZ1 A;  4CUA A;  2Y6L A;  2ZKL A;  4BZ4 A;  4Y1X A;  2GN7 A;  4G3Y C;  1H1A A;  2G19 A;  1OFS A;  1NLQ A;  2PAE A;  3BB6 A;  2FZ1 A;  5B4X A;  3URF A;  4E4H A;  1AXZ A;  5JXG A;  1CX4 A;  1LHO A;  2NQY A;  4IV3 C;  3N36 A;  4JQT A;  3M3I A;  3I3Q A;  5A7N A;  4AWD A;  2EID A;  4OFG A;  3OY8 B;  4BQW A;  4GWN A;  4AI3 A;  2YBS A;  4AW7 A;  2HWD 1;  1VBA 3;  2YUE A;  2ZGQ A;  2WC2 A;  4DEV A;  4DXS A;  4BA6 A;  3M3E A;  1LOF A;  1YNA A;  4QPW A;  1TG7 A;  2IXJ A;  5ACA 2;  4HSL A;  1LR5 A;  5JCT A;  4L2N A;  5FZO B;  4JV4 A;  1K12 A;  3M7A A;  4QGM A;  4XDO A;  4LT5 A;  1Y7B A;  1WWY A;  4GAL A;  1LOC A;  2ZGU A;  1AL2 1;  4IUG A;  1C3H A;  4NWW A;  2Y6K A;  4IQP A;  4C0H A;  5IVC A;  1GOG A;  1E5S A;  1S0J A;  4FFG A;  3FUQ A;  2J1R A;  2QDR A;  5C8C B;  4A7Y A;  1J1L A;  1AL2 2;  1VP6 A;  4M0H A;  4QGL A;  3HD8 B;  5GJ6 A;  3VBH C;  4DNY A;  3JQW A;  5A3N A;  5IT6 A;  5EPA A;  4DXZ A;  5KR7 A;  5C33 A;  1VB4 A;  2BNO A;  1VBC 3;  4AVC A;  3RYK A;  2RS5 3;  5DAP A;  1S0B A;  3NNF A;  1HRI 1;  5F3I A;  3P3P A;  2YDE A;  4QU2 A;  4W4Z A;  1C8M 1;  1JS9 A;  1DZT A;  3S0M A;  4MGK E;  1GOH A;  3C7E A;  3IM0 A;  4OUM A;  3FL7 A;  1WLD A;  1ENS A;  4HK9 A;  4DXT A;  3SKJ E;  4B7K A;  1OHF A;  2NZ9 A;  1ND2 C;  2VTX A;  4TXW A;  1AR6 1;  2O8O A;  3HBK A;  1RUG 2;  1PGW 2;  3WNM A;  1SFP A;  5FY9 A;  5A6Y A;  4ET7 A;  2VO5 A;  3CU7 A;  2ZJC A;  4QPG C;  3RFR A;  3U1X A;  5KC5 A;  2GNM A;  4QXH A;  3BVC A;  4RFR B;  2VCA A;  1W6N B;  2GNT A;  4CEW C;  2OW4 A;  5FUN A;  3CQO A;  4IEQ A;  3O0W A;  1GQH A;  1FT9 A;  1SPP A;  2VZT A;  2Y0I A;  1UAI A;  5FLH A;  1W9W A;  1D0H A;  4CEW B;  2YC2 A;  3DEC A;  4BWO A;  3K4D A;  1KRI A;  1OOP B;  4HOO A;  5BNO A;  1VBE 1;  3LKJ A;  1C8M 3;  5L19 A;  5FYV A;  5FJH A;  1FOD 1;  1YFU A;  3JZV A;  2HWC 3;  2VNG A;  5FYS A;  3TRS B;  4HAN A;  4Q29 A;  2UWB A;  3LD8 A;  3MW4 A;  1JU4 A;  2GC3 A;  1S0G A;  1ZX5 A;  2IZW A;  2TUN A;  1QNY A;  1G6N A;  1QJF A;  1RVF 3;  3L9J T;  3U4S A;  1W8H A;  2VBB A;  4IET A;  1DGW A;  4QB6 A;  4ATE A;  4D6R A;  3I49 A;  1UZY A;  3NKT A;  4IL7 A;  4UFK A;  1MVE A;  4XBL A;  4UFI A;  2YV8 A;  5G04 L;  1H6Y A;  3HQR A;  1JYN A;  3RZH A;  1R09 1;  4Y4R A;  1DQ0 A;  3ZXL A;  4B8E A;  3TEZ A;  2HWC 2;  2Q8O A;  1UU4 A;  1VBB 2;  1DIW A;  4HN1 A;  1VMJ A;  3B94 A;  4R9C A;  1XSQ A;  3U78 A;  1G9D A;  3VUO A;  5L7O C;  4Q4X 1;  4XQD A;  4QXB A;  1O5L A;  3I2I A;  3N3H A;  1H0B A;  4AED A;  3H1Y A;  3GZA A;  1W9Y A;  2DVF A;  2EIE A;  5FZM A;  4AI8 A;  5I93 A;  4IGQ A;  1UNB A;  5K0U B;  2XGX A;  1R1A 1;  3AZV A;  4BJ0 A;  1UCX A;  3KCY A;  4G9S B;  1CN1 A;  3WG3 A;  1N1S A;  2XWB B;  2WFF 1;  3DKW A;  4OQ9 A;  4FTS A;  3CDZ B;  2C6S A;  4HVO A;  4K40 A;  4ZON A;  5JOZ A;  1MS5 A;  2P2K A;  2RS3 1;  3RG0 A;  3AVS A;  1DZR A;  1QGL A;  4Q4V 1;  5C4W C;  4HFS A;  4CDX B;  5F2W A;  5BY5 A;  4JKL A;  2W0X A;  2W94 A;  1DGR N;  4LQR A;  2MEV 1;  3NW4 A;  3KMH A;  4M01 A;  3SH3 A;  2ZS6 B;  4MHR A;  3VZO A;  3WP4 A;  2XBO 3;  4QPI B;  1X36 A;  1COV 1;  3C7O A;  2VOT A;  4P9I A;  3C7F A;  4HSJ A;  5H9P A;  1AR8 3;  3BOD A;  1Y9Q A;  4B4Q A;  4F8A A;  2A5Z A;  3POJ A;  2WNO A;  5D8A A;  2Z42 A;  3GJA A;  3WX5 A;  5ABJ A;  4IV1 B;  2EF6 A;  5DDJ 3;  2ZGL A;  4O9G A;  4GMP 3;  4UW6 A;  1MS3 A;  2ILM A;  3NST A;  3PUH A;  1PHM A;  4R8H A;  2R04 1;  2X5I B;  3VKM A;  5ACA 3;  1UYX A;  3O14 A;  4XAB A;  1JZ4 A;  5LAT A;  1ODM A;  1PM4 A;  3SIS A;  2HEY F;  1HJG A;  3TYJ A;  3RYP A;  3U37 A;  5J3U A;  3JD7 3;  4PQQ A;  4IEY A;  1SBF A;  5A80 A;  4EN7 B;  3CEW A;  3A7Q A;  3EB7 A;  5CEH A;  1AR8 2;  4C8D A;  4F3J A;  2C9A A;  2JJ6 A;  2YY1 A;  2YZ4 A;  2Y33 A;  5IVV A;  1KS4 A;  2XBO 1;  1AX1 A;  4HG6 B;  4ZS3 A;  2Q30 A;  2PEL A;  1AL0 G;  4XIO A;  2P3K A;  2VMF A;  4FPY A;  4XQW A;  3I3D A;  2YXS A;  3NL1 A;  5DDJ 1;  2RS5 2;  3AL6 A;  1H2M A;  2P4E A;  1YI7 A;  4YGD A;  4AEM A;  1I5P A;  1RUJ 2;  3ZXK A;  2F6B A;  1J84 A;  3DYO A;  2BWC A;  1YWK A;  3LDK A;  2P3J A;  1XXN A;  3T2Q A;  4BK4 A;  1LRH A;  1OA3 A;  3CJI A;  1A78 A;  3LA2 A;  5FZ0 A;  2EXJ A;  1XPW A;  3UJO A;  4ASM B;  1PO2 1;  2VPV A;  1Y4W A;  2XKP A;  2WL1 A;  2XVL A;  2VY0 A;  5FZ8 A;  5LA9 A;  5FXZ A;  3ZYR A;  3USU B;  1NX9 A;  4HZF A;  4ZPI A;  1W2A X;  3POS A;  2AYH A;  4DRR A;  4N8M A;  1DQ4 A;  3KVA A;  5FLI A;  3ZFG A;  2Q4S A;  2W3J A;  2W1S A;  1OH3 A;  1DYP A;  3OUH A;  5IFP A;  4XEZ A;  3W5M A;  4LHK A;  3AZX A;  4LBQ B;  5FLJ A;  4WZF A;  2K9Z A;  5C4W B;  2P5B A;  5FY4 A;  4BQX A;  5I8T A;  2BJS A;  4RGG A;  5HCB A;  5CVR A;  3M2M A;  2XR4 A;  3MV1 1;  4BIS A;  1JBC A;  2RJ2 A;  3WDW A;  3HAG A;  1E57 A;  2RG4 A;  4E2S A;  5GLV A;  1C8M 2;  2E53 A;  2C26 A;  3K3N A;  1VAL A;  2GMP A;  3OTF A;  1EV1 1;  3OEA A;  4JDN A;  4Q4Y 2;  3ZFE A;  3ZYG A;  1CAW A;  4YFW A;  3RZG A;  5DZE A;  1HW5 A;  4B1L A;  1UX6 A;  2B9V A;  2HWF 3;  5A7Q A;  4UFH A;  3TN9 1;  4ASK A;  3ACI A;  2ES3 A;  2P37 A;  2WZR 2;  4LIV A;  1RXF A;  4OZO A;  4QPI A;  4N9I A;  5JR2 A;  4ZXK A;  4K3U A;  1NG0 A;  5AFE A;  2WNE A;  1UL9 A;  1O8P A;  2LUW A;  3CJI C;  2HBU A;  4WM7 A;  4HK8 A;  3GBW A;  3DKQ A;  2OVU A;  3HQU A;  4RHV 3;  4AI9 A;  4JGY A;  2QQN A;  3WOG A;  4AEJ A;  4CUB A;  1MZF A;  2I2S A;  4QU1 A;  3VBU C;  3VDD A;  3GHM A;  4YSF A;  1S2K A;  1U5Y A;  2KM2 A;  2G4I A;  1RUE 2;  5A33 B;  2HWD 3;  1X33 A;  5HCH A;  3B9C A;  3O1M A;  5J96 B;  1MEC 3;  3BTX A;  2EA7 A;  1W6Q A;  3VZK A;  1VMF A;  3O1T A;  1Q8P A;  4QB2 A;  1ZM1 A;  3N4M A;  1VJ2 A;  1SLL A;  3D82 A;  4KWK A;  1GMM A;  2O8Q A;  2QBX A;  2BFU L;  3RJR A;  2JKX A;  5A3T A;  3T2O A;  1G9B A;  4KQ7 A;  4XJU A;  2FDI A;  4RQP A;  3VD7 A;  3ZXE A;  5FMB A;  2AUY A;  1JHJ A;  4FO9 A;  1JI6 A;  2WNV C;  5BXX A;  1AJK A;  1PM7 A;  2DUO A;  2R07 1;  1KQR A;  4JRA A;  4Q1R A;  4R9B A;  5KHI A;  1S0D A;  3KT1 A;  2BNM A;  2P3I A;  5I8Y A;  5LEK A;  4FP2 A;  3VBU A;  4JQR A;  4RS5 C;  4NHK A;  4HMZ A;  4YW4 A;  4HT1 T;  1WCS A;  5FPX A;  2JDK A;  1AR9 1; 
#chains in the Genus database with same CATH homology
 2ZEZ A;  4QDS A;  2WBK A;  5F7U A;  2QQM A;  5IJR A;  4XUR A;  4E8C A;  1JYV A;  3LEK A;  1UYZ A;  2QQK A;  5EJ1 B;  2YFU A;  2HLE A;  3MO4 A;  5JUV A;  3ACF A;  2V5D A;  3IB3 A;  1JZ6 A;  2YG0 A;  3NJV A;  2VJX A;  1H6X A;  4KWU A;  2EIC A;  2X09 A;  4OUE A;  1JZ8 A;  4GWI A;  4FI9 A;  4RYD A;  2JE8 A;  4DUW A;  1PMH X;  2QQL A;  2BZD A;  3LPF A;  1K45 A;  2YFZ A;  2WAA A;  3VD3 A;  4QDQ A;  3ZM8 A;  3CMG A;  1R64 A;  1ULO A;  4CU7 A;  4ZXE A;  5LA2 A;  1KGY A;  2VL4 A;  3PUI A;  5CZK A;  3III A;  4CUC A;  3HJR A;  3FN9 A;  4JX0 A;  4ARX A;  3NNG A;  4CU8 A;  1BHG A;  2J1A A;  3SEP A;  2E33 A;  2E26 A;  3LEI A;  5B4N A;  5LA0 A;  3OBA A;  4KMQ A;  3ACH A;  5IYY A;  1OF4 A;  2XHN A;  4XUP A;  3IAP A;  2VME A;  3K4A A;  2X10 A;  1US2 A;  4A3Z A;  3T0B A;  3I3B A;  2WDB A;  1EUT A;  2WN3 A;  3UNP A;  2W9X A;  2PQS A;  5JXJ A;  3WF3 A;  2Y64 A;  4DXR A;  1D7P M;  2QQO A;  1PX3 A;  1PX4 A;  4DUV A;  2W46 A;  4XZU G;  3WF2 A;  2VZU A;  4P02 B;  2YC4 A;  2Y6J A;  5C7G A;  2B4K A;  1GNY A;  2J1S A;  1OH4 A;  2WZ8 A;  1SHW B;  3T08 A;  4DUX A;  3VDC A;  3I2K A;  3CIH A;  2ZEW A;  4YPJ A;  2VCC A;  2W1U A;  3OG2 A;  1GQP A;  2VMD A;  3CZJ A;  4MAD A;  3ABZ A;  1OD3 A;  2VQT A;  4P5Y A;  3NJX A;  3WNK A;  1GU3 A;  2W95 A;  4W8J A;  1JZ2 A;  3LEG A;  2DDU A;  2W5F A;  4A42 A;  2E31 A;  4BDV B;  3A21 A;  5DPN A;  2VZ3 A;  2QQI A;  4Z2A A;  1DYO A;  2EIB A;  3CZU A;  4CVU A;  2BGP A;  3C7H A;  4UAP A;  5IHR A;  1W99 A;  3K46 A;  2ORZ A;  3UET A;  1GOF A;  1WKY A;  3E1F 1;  2X05 A;  4A6O A;  4M4R A;  5A1A A;  1CIY A;  5DQ0 A;  1W9T A;  3MV0 1;  2VZP A;  3HPN A;  4KI5 M;  4P00 B;  2WUH A;  1NKG A;  2VMC A;  3HNM A;  4QX0 A;  3K4Z A;  5HXM A;  2HYX A;  2VZ1 A;  3A23 A;  4CUA A;  2Y6L A;  3D3A A;  4A41 A;  3OGS A;  2W91 A;  2WO1 A;  2VZS A;  3WEZ A;  1DP0 A;  1XNT A;  2VZV A;  5B4X A;  1XC6 A;  2W1W A;  1SDD B;  2XON A;  5JXG A;  1T2X A;  2J1V A;  3SKV A;  1J83 A;  2VR4 A;  2EID A;  1UYY A;  3T0D A;  4A4A A;  4TTG A;  1W9S A;  4DEV A;  4DXS A;  3BN6 A;  1EUU A;  4QPW A;  1TG7 A;  1K12 A;  3VDB A;  2J1U A;  1UZ0 A;  4LPL A;  4IUG A;  3I97 A;  2Y6K A;  1GOG A;  1K3I A;  3P1I A;  4P08 A;  2J1R A;  4M4P A;  2R7E B;  1UMI A;  2BGO A;  3HN3 A;  3F2Z A;  3VD5 A;  4A45 A;  2ZEY A;  2XQX A;  3LPG A;  1YQ2 A;  1W8O A;  1JU3 A;  2ID4 A;  2WO3 A;  4W4Z A;  2ORX A;  1UXX X;  3HEI A;  3VD4 A;  2LW8 A;  1GOH A;  3C7E A;  3C7G A;  3FL7 A;  4XUQ A;  3VDA A;  4DXT A;  1CX1 A;  3SKJ E;  4TXW A;  2KD7 A;  3WNL A;  2V4V A;  3WNP A;  4XUN A;  2DCK A;  2W92 A;  3WNM A;  3ETP A;  4ET7 A;  1KEX A;  2VO5 A;  2E32 A;  4MGQ A;  1JZ3 A;  1UY4 A;  2VCA A;  5DN2 A;  3CQO A;  1O59 A;  3OGR A;  2VZT A;  1W9W A;  2YC2 A;  3DEC A;  3K4D A;  3GDB A;  3J7H A;  1JZ5 A;  3OGV A;  1OT5 A;  2W47 A;  3GGL A;  3T09 A;  3WF1 A;  1UY1 A;  1JU4 A;  3THC A;  1UY3 A;  4ZY9 A;  1OF3 A;  1NUK A;  3MBW A;  2QQJ A;  3I2H A;  1SG3 A;  4QB6 A;  3FHQ A;  2VC9 A;  3IAQ A;  5G04 L;  1H6Y A;  1US3 A;  1UY2 A;  1JYN A;  3MUZ 1;  2C9K A;  1DLC A;  1JZ7 A;  1HN1 A;  3LE0 A;  4DEQ A;  4OMD A;  3CKH A;  4PF1 A;  1ULP A;  2VCB A;  3EYP A;  4UI9 L;  2VTF A;  3I2I A;  2EIE A;  4XUT A;  4JKK A;  2JDA A;  4BJ0 A;  2JD9 A;  2ZEX A;  4JKM A;  4D0Q A;  4AAX A;  1XNA A;  3DYM A;  1GUI A;  3CDZ B;  4LKS A;  1O8S A;  4ZZ8 A;  3I2F A;  3OB8 A;  3WF4 A;  2DCJ A;  4JKL A;  2W94 A;  1UX7 A;  4LQR A;  5JXI A;  2Z4F A;  4CU6 A;  2OKX A;  1UY0 A;  2CDP A;  3C7O A;  2VOT A;  3C7F A;  2BER A;  1CZT A;  1L7Q A;  4QX2 A;  1P8J A;  4D8M A;  4MO3 M;  4QDR A;  1PMJ X;  3I2G A;  4OMC A;  4L0P A;  1RYY A;  2W1Q A;  4QX1 A;  2WAB A;  3PUH A;  1JYW A;  1WCQ A;  2WO2 A;  1JZ4 A;  1UYX A;  3WF0 A;  3FHA A;  2YB7 A;  3U37 A;  4GWJ A;  3IDA A;  2WN2 A;  4UOJ A;  4PQQ A;  1CZV A;  5HPO A;  3A7Q A;  3EB7 A;  4E8D A;  5FUI A;  1CZS A;  3WNN A;  5IFT A;  2W87 A;  3JXS A;  3A22 A;  4ARY A;  4PT6 A;  4HG6 B;  3LQC A;  3MUY 1;  3GM8 A;  1NAE A;  1MPX A;  2VMF A;  3I3D A;  2J22 A;  3SEE A;  1F4A A;  4BK5 A;  2J7M A;  3C8X A;  1I5P A;  2Y6G A;  1J84 A;  3DYO A;  3OEB A;  4QB1 A;  5C70 A;  4MGS A;  3T2Q A;  3T0A A;  4BK4 A;  2L9L A;  4GZ9 A;  1XPW A;  4QX3 A;  1UMH A;  5DMY A;  5G05 L;  3WSO A;  1NX9 A;  3WNO A;  2XOM A;  3I2J A;  2VZO A;  4MOA A;  3HNY M;  4QAW A;  4ZZ5 A;  3HOB A;  4OYU A;  2W3J A;  2W1S A;  4BXS V;  5IFP A;  2VZQ A;  3W5M A;  3ACG A;  5LCW L;  2ZXQ A;  5JXH A;  2VZR A;  3T2P A;  1JYX A;  3P6B A;  2WYS A;  4CU9 A;  2VQU A;  3MV1 1;  4W50 A;  2RJ2 A;  2WAO A;  1TVG A;  3BGA A;  1LNS A;  2C26 A;  2Y8K A;  4XVH A;  3OEA A;  3THD A;  5J1X A;  5EIY B;  2V72 A;  3HNB M;  2B9V A;  2WZE A;  3ACI A;  5I0D A;  2RV9 A;  4OZO A;  3I3E A;  5JR2 A;  1W0N A;  3NRU A;  2C4X A;  2WQ8 A;  3WQB A;  3K75 B;  5C71 A;  1O8P A;  5CYY A;  2Y6H A;  2CDO A;  3W5N A;  2QQN A;  4CUB A;  4LHS A;  3GXU A;  1K42 A;  4AG4 A;  2VM9 A;  3AC0 A;  3VD9 A;  4JHZ A;  3ECQ A;  3DYP A;  1IQD C;  4QB2 A;  2BBA A;  1W8N A;  1GMM A;  2QBX A;  2LS6 A;  2JKX A;  3T2O A;  5EJZ B;  5JMO A;  4XUO A;  3VD7 A;  5LA1 A;  3UES A;  1L7R A;  3K77 A;  1JHJ A;  1JI6 A;  2J1T A;  2RVA A;  1UXZ A;  1UWW A;  4A44 A;  1F4H A;  2J1E A;  3NQH A;  4RN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...