1XNCA

Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKCDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTCHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermostabilization of the Bacillus circulans xylanase by the introduction of disulfide bonds.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosidase
molecule keywords XYLANASE
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xncA00
2BVVA 2F6BA 3VHNA 4NPRA 4XQDA 1H0BA 4HKLA 1T6GC 2C1FA 3VL9A 1QH7A 1XNBA 3RI9A 3AKSA 1AXKA 3AKTA 2JICA 3MF6A 3RI8A 1REFA 3WP3A 3MFCA 5EJ3A 3EXUA 1XYNA 2B46X 1H4GA 2BWCA 2NQYA 2DFBA 3WP4A 1IGOA 3VZLA 1UU6A 4S2FA 1BVVA 1ENXA 2JENA 2DCYA 3VHPA 2VUJA 1KS4A 1M4WA 1BK1A 2VGDA 1H1AA 1UU5A 3AMHA 1HIXA 3AKPA 4HKOA 1OA2A 4XQWA 2VULA 2Z79A 3VZMA 3WR0A 3M4FA 5HXVA 4HK8A 3MFAA 1OA4A 1PVXA 3AMQA 1C5HA 2BWAA 1YNAA 3VLBB 1XNDA 1XYPA 2DFCA 1HV1A 3LB9A 1KS5A 1UKRA 2VG9A 3WQ7A 3HD8B 4S2HA 3MF9A 1NLRA 1REEA 3VZKA 2DCZA 4XQ4A 1XNKA 1QH6A 1XYOA 4HK9A 3AMNA 3ZSEA 3WX5A 2B45X 3WP6A 4H7MA 3VGIA 2DCJA 3AMMA 1TE1B 1BCXA 2BW8A 3VZNA 2NLRA 4S2DA 2D97A 2B42B 3B7MA 2DCKA 3VL8A 3AMPA 3AKRA 3WQ1A 3VZJA 1W2UA 2QZ2A 1H4HA 3WY6A 5K9YA 1H8VA 5K7PA 3WT3A 1OA3A 3VHOA 1UU4A 3WQ0A 3WXPA 1HV0A 1OLRA 4XPVA 1OLQA 3O7OA 2JEMA 1C5IA 1XXNA 4IXLA 3WP5A 1REDA 3VZOA 1F5JA 2D98A 4S2GA 2QZ3A 4HKWA 3AKQA 3B5LB 1XNCA 3LGRA
chains in the Genus database with same CATH superfamily
3ZIWA 1OURA 2A3WA 2WSVA 2B9VA 1QY4A 1PGW1 4KU7A 4YM2A 5A1FA 4FBFA 3IDAA 2G9ZA 3AKSA 4PLOA 4KWKA 5J96B 5JSOA 4RN5A 2VOVA 1J3PA 4OHXA 5FTTC 3U11A 1GNZA 4EN9B 1MEC3 3QH7A 2A71A 3POJA 3NV1A 1W6PB 2GMMA 1GOFA 2YBKA 4XVHA 2XMLA 1JOPA 3CZJA 4YG3A 3VB9A 1FATA 1I3HA 4LUMA 4BQYA 5LRRA 1AX0A 2HWD2 2JXAA 3PUAA 4NHYA 4LO4B 4HLTA 2AUYA 1P8JA 1WCDJ 4HVQA 1LOFC 4XXPA 1NY72 3RGBA 1SMVA 2QDRA 5FPVA 4CPBD 4ZPIA 1HQNA 1UOGA 3KT7A 2WABA 1S4CA 2FCTA 3I97A 3NQHA 4AFBA 1ENXA 4N8MA 1RGSA 2H0VA 4MYEA 4MGYE 1C8NA 3CEWA 3ZSLA 4Q27A 1H8TA 1MVEA 3OB8A 5CEHA 3NJZA 4RHV2 4Q4W3 5G05L 3FX3A 1ONAA 4PIXA 5FLJA 4D8MA 3MIDA 5ABJC 2PLV2 1TNFA 5JOWA 2X5IB 4B3NA 3VBSB 4HOOA 3GYDA 3RG0A 2GNBA 4FTBA 5H9SA 4YG0A 1WLTA 3DV8A 5KXDA 1X9TA 3MUZ1 3POIA 4QX0A 3UKNA 4GAZA 3ACGA 2RS51 3IMNA 2EIBA 5FBJA 4HPKB 3B94A 4GALA 4AQ2A 2WZR1 2DU0A 2W94A 3LQCA 1QJY2 2FBEA 4DXTA 5I8SA 4YLZA 5FY8A 3KVBA 2HWE3 2XDVA 5AVPA 2D40A 5JXGA 2J1AA 2W39A 3K4AA 4Q0PA 2ZX4A 1ZBE3 4NR1A 4PT6A 1SZBA 4GJYA 1D4M3 2QQWA 1VBD2 2B8MA 2FDHA 4I30A 3VBOB 4LKSA 1SLTA 1FOD1 3D8CA 3NSTA 4FVVA 4DB5A 2IFWA 4KH9A 1RUG2 1ULOA 4AI1A 1YLLA 5FUPA 3WQ1A 3O0XA 3LPFA 3TEZA 4Q4Y1 4QGNA 4G3YC 3ZSKA 1ST8A 1GNYA 5J1XA 1V9U3 2KR2A 4YW3A 2JB4A 4BDVB 4BQ1A 4E4SA 3HPNA 4AXOA 2V4VA 1W04A 1YFYA 3BB6A 1RUD2 4C1WA 5JZGC 1HRV3 3OY8A 1OLRA 1OVSA 3V0AB 2BVBA 3EB7A 3N9OA 4YVWA 5IK7A 4UFJA 1ZNPA 5CZKA 2HYKA 4AL9A 5FZ1A 1GQHA 5CISA 5JLVA 1UOJA 1WLWA 3KGZA 4XF4A 4GWJA 5BNOA 5JMCA 1ZRCA 5DDJ2 4QPGB 5JXHA 1BJQA 1H2KA 4COWA 5L7OC 4HKWA 5FZIA 2XBO3 5JI9A 2HJIA 2GALA 3K46A 1GYKA 5A6ZA 1XNCA 3FHAA 5FO9B 2BVVA 3USUA 5A7QA 4Q4X1 4BMBA 1OVPA 3E97A 2CWMA 3P3NA 1R091 4NAMA 4QQLA 4JGZB 1OPOA 1ND2C 3NJXA 4GH4A 4GJZA 4G9SB 3I3MA 2Q30A 1FPN3 1T6GC 3HBKA 3ENRA 1QH7A 3OOXA 2PXJA 1U0AA 2VNVA 3WSOA 1RMU3 1S0DA 2VD7A 1AX2A 2EXJA 2HWF2 2VM9A 2VR4A 4Y20A 4LE3A 3UGGA 4ATFA 2WIIB 2JE7A 4A7KA 3DCQA 1O4TA 4WV8A 4BK4A 1XJAA 1W8WA 1WW6A 2J1VA 3EXUA 2A3XA 2B46X 2EIGA 4XFIA 5FRAA 3P5BA 3WW2A 2OW4A 3M3QA 3GCXA 2OZJA 1LESA 4NRPA 4WVWA 3MW3A 4NPLA 3RYKA 1S55A 3ZFFB 4QX3A 1H9WA 1AL21 1PIV2 3ZYPA 5D2AA 1VLNA 1MZ6A 2HEYF 3T2TA 5CFDB 3ZDSA 2J22A 2X05A 1T2XA 4IEWA 2YDEA 2ORXA 2Q8CA 4GWMA 1BKZA 5LY2A 1DU3D 2WBKA 3KV4A 4FPHA 1M4WA 2FDFA 2LUWA 3KLSA 3H3ZA 3TOJA 4Q0VA 3SH5A 2RR11 3D82A 4QPGC 2OUJA 5F7UA 2WYFA 1ULEA 5AC91 3MW4A 5AVAA 1RMU1 5FWJA 2DBNA 1PO11 3AYCA 4QX7A 3R05A 4A7ZA 4RHV1 1GWLA 3IPVB 4GIQA 3PU3A 1BYHA 2FDIA 2CWSA 3R6SA 1WCQA 1YNAA 3LIGA 4QKBA 3T4HB 2WJSA 4AI3A 2VG9A 5EYXA 3JXSA 5K0UA 3T2OA 3TB0A 3ZYRA 3MF9A 2PQSA 1UZYA 2V73A 5FO8B 3R0RA 2Y0OA 3C2UA 3MIFA 1ALYA 2ZMKA 3ACLA 4AVVA 2DCTA 4V2VA 2QQIA 5KHHA 2Y26A 5EIYB 1AR91 1FOD3 1RHI3 3LZZA 2DU1A 3S0MA 1N1YA 4UT5A 2PTMA 2GC2A 2LM3A 4IEYA 3VZNA 1SPPA 5GZEA 4Z1VA 1PVC2 2BUKA 3M2MA 5LA2A 5A7SA 4KU8A 1NCQC 2BNNA 4N43C 2MNGA 4EWEA 1COV3 1R092 1E5SA 3ETQA 1KFUL 4ZS3A 1EUTA 3N9MA 4LUKA 3DUIA 3H3UA 4BZ4A 1QEXA 1RUI2 5C4WC 5I0DA 3WQ0A 1HV0A 3MZHA 1KDKA 4XXAA 1UZ0A 1HB3A 5LBFA 3IZOA 3DKQA 3T3YA 1X33A 1ZBE1 2AEZA 1G8WA 1VB2A 4K1ZA 4AWDA 1UF2C 1UZWA 2XUEA 3WF0A 3AVRA 5FYMA 4ZHNA 3PTRB 4PQQA 4IV1A 2EVXA 1OF3A 4XCBA 1X9PA 1F5JA 2YXSA 1AR93 1RHI1 3B69A 5EWSA 1ND2A 3HT2A 4CP0A 1COV2 1R093 4YVSA 2DUPA 2HWB3 2XHKA 4BQ5A 4N53A 3GBGA 3JBG1 3CHXA 5F2SA 4MGZE 5FY7A 1ULPA 3TRSB 5FAXA 3E6CC 2BEOA 2J1UA 1VALA 3EBRA 4I2OA 1N47A 3C7FA 3W5MA 2GU9A 5B4XA 3DN7A 2PHRA 3EO6A 2JICA 2RMU1 2YG0A 3ZKYA 2JDPA 4JGYB 3VN4A 3MFCA 4A7YA 1ZBA3 4K8RB 4ES8A 5F2WA 4CCKA 3H8OA 1UD1A 5IATA 5FWEA 3POFA 5DAPA 3EMRA 1XNTA 4R9CA 1UXXX 1W9WA 3AXEA 2D6MA 5K0UC 3U0ZA 1JH5A 2BFUL 4OLLA 2ZPXA 2XB6C 1VBA1 4XIOA 4YW7A 5FYSA 4QXBA 4CP1A 1HW5A 4PF1A 3ATGA 3MIEA 3LFMA 2OPWA 4YZ3A 3O1UA 3K51A 3UKVA 4FI9A 4X6RB 2WNOA 5FKCA 1AYM2 1C8M1 2EXKA 1UY2A 4LKFA 1VBB1 3HWJA 4KL1A 1BK1A 2ET7A 4GH4B 5KC6A 1ASJ2 1JUIA 3MDPA 5BUVA 5KBFA 1JW6A 4LHKA 5F39A 5HXMA 4C91A 4B1MA 4HT1T 3CJIA 1NCRA 4Q4V1 4XBQA 1LU1A 1UZVA 1F31A 5JI7A 4QQPA 3ZYJB 3S30A 2CDPA 3D3AA 1S2BA 1KD7A 1MZ5A 3A7QA 2DUOA 4K9SA 4TLGA 4DEQA 1OA4A 2R30A 2JDYA 3AMQA 4NIGA 4QB6A 4AHXA 5F1RA 1PO12 2GNTA 4Y33A 4LO5B 1VBC1 3TNQA 5FJHA 1F4HA 1RUJ1 2WFF3 2Y60A 5T55A 2W1SA 2LW8A 5FZAA 4HONA 1XYOA 3HNYM 3K2OA 3U4XA 3TN93 3C7HA 3RJ2X 5T5OA 3UT0A 4FPLA 2VH9A 2NPIA 1PO22 5FZ8A 5DUWA 2AACA 2EA7A 2FCUA 4BQXA 1F8VA 4CSWA 2DCJA 3ASIA 1BCXA 1MS9A 2WFF2 4XTMA 3UK9A 2ORZA 1WZXA 1W2NA 1W39A 3S57A 1HB2A 1DGLA 1QJEA 4GXLA 4QGLA 4ZS2A 5C4WA 1UIKA 2VQ0A 3LKJA 5C3QA 4L0PA 3RZKA 5FP9A 1BMV2 1VRH1 1HRV2 5T54A 3WT3A 1GU3A 1HXS1 1B09A 4L8QA 1PGSA 3BPSA 2BZDA 1Y3TA 2DURA 5F5QA 1FXZA 2W1QA 4FFGA 2ZHKA 1YJLA 5H9QA 4Z2AA 3O1RA 4GMP1 1RXFA 4TN7A 4XIKA 1LTEA 2Y6FA 2ZHLA 3UYJA 1QF3A 1WA4A 2HWC1 1FAYA 1X36A 3J7HA 3KQRA 2ZJCA 5DZFA 1LGCA 1AR72 3VD5A 2K0GA 4Q4X2 3ZXEA 3UETA 1DQ5A 1JU4A 3PJQA 5K4LA 2VZ3A 5ANNA 2DDUA 2P1BA 5CBLA 1YIPA 4MADA 2VUAA 4M00A 2VCBA 5L9RA 1V6OA 1AJOA 1A8DA 2CHHA 1BK0A 4RA0A 5A3MA 5FYZA 1H8TB 4XAEA 1RVF2 4P9WA 1CN1A 4EN8B 3RI9A 5C5UA 2VVFA 2FD8A 5BNQA 4Q4V3 2ZGKA 2X8KA 3CJIC 2HEWF 4D94A 4OUSA 1HXS2 1ZZCA 3AJZA 4Y1ZA 5LEJA 5LA0A 4G4FA 5EFUA 4TZDA 3PUQA 2D44A 4XE9A 1S0GA 3U37A 5ISLA 3BGAA 1GOHA 1OH3A 4MXWB 4QDSA 3RQ0A 1RVF1 3RZZA 4AHZA 1HQLA 4J25A 5I8YA 3M3IA 1ZRDA 4NN0A 4JKKA 3LWCA 2JWPA 1UU6A 1HRI3 2K46A 3PUHA 4DXSA 2VNGA 3WUCA 2HWD1 3FC0A 1QJX1 4RS5A 4Q5OA 2FQPA 4XFHA 5CFCB 3ACIA 3NV2A 1OQ1A 5LATA 2P37A 2PAEA 1O91A 1UYYA 4NMIA 2BOIA 4UOJA 3VHPA 5LY1A 2WQ8A 2VTXJ 3JB4C 1AYN3 4A42A 2J1TA 4P08A 2BBVA 2YC0A 1ZBA1 4OQ8A 2ZGUA 3ZFGB 4Y4YA 3U1XA 2Q8OA 1QDOA 2QQLA 5IVVA 2H0BA 1UMZA 2WS92 3LA3A 4CDUB 1XE7A 1RUD1 1JOBA 1UZZA 1I9RA 2ZXQA 3N36A 3OYWA 2A73B 2ZMLA 4BK5A 2D5FA 3VLBB 1ND3B 1BBT1 2AYHA 5BNPB 1QXRA 2CYFA 2Q0AA 3IAQA 3KCCA 3MICA 5FZ9A 3I2OA 1V9U1 3PNAA 3O12A 5FIXA 5BPXA 3VV1A 3ZXFA 1QXPA 4GB32 3AZWA 4QPGA 1K5JA 3GGLA 1SLIA 3ZFGA 1R1A1 4MXWA 4YZ4A 3QOPA 5BNOC 4O65A 2W68A 3AMMA 1DQ6A 1MQTC 3JU9A 4PQ9A 5C6CA 4OI0A 2WKKA 3I2KA 3Q8FA 1Z78A 2EAAA 4FFHA 5C8CC 2VC9A 3W20A 1LOBA 1UPIA 3B7MA 1LJ7A 2PA7A 5DAXA 1UWWA 3OBZA 3HBZA 4CCNA 4EWAA 2OQ6A 4CVUA 3AZZA 4GH4C 3P1IA 4C0HA 5A32A 2QZ2A 4FOQA 1H4HA 2ZGPA 3O1MA 3HN3A 3OPTA 1LCLA 1U5IA 3ALQA 5FZ0A 2A5ZA 4ZXEA 3O0WA 4COUA 3WXPA 4Y20B 1RUH2 2MHFA 2XVKA 4KG0A 2FDGA 2Y33A 1WW4A 2Z5WA 4FO9A 1QQP1 2ZGQA 3CU7A 4ISQA 2VUDA 1CAWA 4BA6A 4DUXA 3RFRA 3WHUA 3BN6A 1SEFA 2RS11 2UYAA 3ZFFA 2BOJA 3WNMA 1DP0A 1PNFA 4OZXA 5JOXA 1YC61 3BOWA 1MQTA 2WLPA 3CF6E 4AGVA 3WCSA 3AP5A 3T2QA 5A3PA 3INAA 1VMJA 5FZBA 3KV6A 4W50A 1UQXA 1TVGA 5FYYA 4AF9A 4XJUA 3W21A 4URTA 4W8JA 1H6YA 4EQVA 4JDMA 2XG3A 5D8AA 3OBTA 2UWCA 4FXGB 1IOAA 4KGQA 4AVBA 5F5IA 2WN2A 5KHKA 2WO3A 4CU9A 4MLOA 1D0HA 1ENQA 1WMFA 5JUVA 1AUYA 1V6MA 2XBO1 1H9PA 2BNMA 2IXHA 5JR7B 2Q5TA 4DXZA 3JB8A 3WP3A 1OMIA 5CU1A 4WVMA 3ZR6A 4UF0B 1XYNA 2R1BA 3IKWA 3FN9A 2CL2A 1OD3A 3FL7A 4YPJA 3K77A 2SLIA 4AVSA 2EF6A 4XJ8A 3R4UA 4JGYA 1YQ2A 4CEYA 2RS52 2ZACA 1WD3A 3LF7A 1IS3A 3NAPC 4YYOA 3WP4A 4LQRA 3I3BA 4MUVA 2PYTA 4XAAA 1JN2P 4NIIA 2RM21 4IEPA 4BJ0A 1APNA 2ZBJA 3H7YA 4W6WA 1H6XA 3WLUA 3WG4A 2QUOA 5LB6A 3WW1A 2JG8B 5CKQA 2VO5A 3PTYA 3CJIB 1XRUA 3GHNA 4A3XA 4FPEA 5DUXA 1IZ3A 1QWRA 4JVAA 1CAWB 2N7GA 5L36A 3PVOA 3I59A 4ASMB 1RUC1 1HIXA 2DVAA 3JD73 3TN91 5LA9A 1I1EA 4LT5A 4PI2A 2XPJA 2ZEYA 5DDJ1 2VMHA 4DRRA 1YCIA 4MGSA 1RUI1 1LOCA 5IJRA 3WR0A 4YGBA 4NUBA 3CIHA 1GZWB 3MGUA 3GDBA 4HZFA 5FMDA 5C33A 1MPXA 3PU8A 2A6YA 2JIJA 1PVC3 1F15A 1YQ6A 3LDBA 1BVP1 4CEYC 5AC92 1MS0A 4BQ4A 1POV0 3KV9A 2H6BA 2R061 4CA9A 1GZTA 1XNKA 1QH6A 2VU9A 3VD3A 2VJXA 3ACFA 4FPCA 3FUQA 4Q29A 1EUUA 1HJFA 1POQA 4DZGA 1NA1A 2K2SA 4LKDA 4MGTA 1XPWA 3VDAA 4N9IA 1O3QA 5A6YA 3ZFEA 1BHGA 1DLLA 1Q3EA 4N7UA 1Q56A 2IUWA 4XHBA 1A3KA 4UF0A 5FMOS 4NJ4A 1QHDA 1RUF1 2XJTA 4LLOA 5ACA3 1W2UA 4DRVA 3T0DA 5C8CB 2PAMA 5JR2A 1F2NA 1AR92 4MX3A 3G6JB 4QPIA 2RDRA 1VBD1 1YQCA 4WVVA 2BJSA 1N1SA 4FPKA 2X09A 1AR63 1W0OA 4R9BA 4XFAA 1RC6A 2PLV3 3EJKA 4Q0UA 5FJKA 4AEKA 4NIHA 3IIIA 4OQ9A 2FZ1A 2PHFA 3NAPA 2R042 1AYN2 1Z7S1 4QQOA 2JEMA 4FTSA 3MHZA 1H2LA 1GP5A 3H9AA 3V56A 4JKMA 1W3XA 5EPAA 3USSA 3S6PA 1RUE3 1CVNA 1W6NB 3I7DA 3ECQA 4I3PA 3WNPA 1W8ZA 4AQTA 4AFAA 2UU8A 1W8FA 2DVBA 4OCTA 1IPJA 1RITA 1RUF3 2J1RA 2W5FA 2HWB1 2DYCA 5FY9A 2VOKA 1OD5A 4J1WA 4P14A 4Q2FA 1VBB2 2H6CA 4ATEA 1RYYA 1LNSA 1T6BX 4H2AA 5AFBA 3ZN4A 1EAH3 1WLDA 3AM2A 4UW3A 2DVDA 4AFMA 1HDKA 4V2WA 5EJZB 5A80A 3LE0A 4CUCA 1AL0G 1JBCA 4E8DA 2PELA 5DXDA 1EY2A 3U14A 1M06G 1SG3A 2VXJA 3PVNA 2WNVB 3E5QA 4R52A 1J3RA 3BALA 4OZOA 1OI6A 3KB5A 3CBNA 3N7LA 1Z7S3 3P6BA 4UFMA 3FHIB 4OI2A 3VKFC 2E7TA 4JC1A 4O7XA 2JD4A 4CDQB 3IDCB 3LEIA 4UXAA 1TMF2 1VRBA 2UWAA 4IW3A 2FZ2A 3EHKA 2BBAA 2C5DA 5JOYA 1LHVA 1PO21 1L7LA 1DZRA 2RG4A 4CCLA 1MACA 2PAKA 2WO1A 5J7MA 4AEJA 1LHWA 1VBE3 1UOFA 2ZGSA 5FPBA 2BERA 1BLZA 4BHPA 1PGW2 1PZ9A 4YZ1A 4JX0A 1HRI2 2ZGNA 2RS31 1PIV3 3GALA 4XACA 3LDRA 4IV3C 1CIYA 1JTZX 1W9SA 4ARYA 1PMJX 2RJ2A 4KWLA 5APAA 2NN8A 2D3PA 3DXTA 1J3QA 1QJZA 1UU5A 2GZWA 1QMJA 3LEKA 5I8TA 2JG9C 1V9U2 2YPDA 1JYIA 1HJGA 1V6JA 1RHI2 1I6XA 5FY0A 4RR3A 1QNWA 3LSEA 4AFDA 1R081 4WM7B 2VW1A 3TN92 4EZHA 1QJFA 3BCWA 3H7JA 5DUVA 5F3CA 1RUE1 1U5XA 4U2AA 3NNMA 1GMMA 3RMXA 3JQWA 3I59B 1VAVA 3GM8A 5A7NA 3V64A 2R49A 3F2ZA 5FPXA 1J59A 1CWPA 1K3IA 4AYUA 2OA2A 1AX1A 5FYBA 3AK0A 4E4HA 5DG2A 2JDAA 3NO8A 2WT1A 4LO6B 5KXCA 3RWKX 3O5SA 4BIOA 5FXXA 5A32B 4L11A 4DFSA 5BNPC 2ZA9A 3BTZA 3ZYHA 3N9LA 5T3NA 3WG1A 2AREA 2CV6A 2JDNA 3PVBB 2UY9A 4L92A 3VZJA 4XYXA 4NIDA 5DABA 3WDUA 2R1DA 1UX7A 5B2GB 2DBIA 4KBBA 4YZ2A 1OUXA 4Q0SA 2V4AA 5IWFA 1ULCA 1W8UA 2QQJA 2R32A 2ZZQA 4P9LA 4IV1C 3GZTB 4X8PA 1YFXA 4AEDB 5IVBA 4YFWA 3LFIA 2GP3A 2RDSA 5FQ0A 3OTFA 4GD4A 4AI0A 4AE2A 1O3TA 3VDDB 4D7SA 2VZUA 3A0NA 1QU0A 4DNYA 4Z92B 3Q8BA 1Q43A 3RDIA 2YC2A 4LKEA 4CEWB 3PLQA 1L3JA 1OQEA 4M3CE 2LROA 4M0NA 4E9KA 1PO23 4FQZA 5G04L 4AVAA 4BISA 1XBFA 2YFUA 4NPRA 1AR61 1RJ7A 2D3RA 1DQ1A 4LBLA 1H0BA 4AEDA 2E7QA 1AYM1 1W05A 2HWC2 1O3RA 3TBDA 3SHRA 4RR3C 1LOFA 4UI9L 1DG6A 4NHKA 2HWE2 5FZOB 1SHWB 4Y22A 2JJ6A 2E26A 4E27A 2XR4A 4RS5B 5CFCA 3FZ3A 4AFCA 5D8AB 1ZA7A 3TWIA 1VBA2 2A70A 3ZPYA 4BCUA 4OFGA 4P9YA 5EJ3A 3V0AA 4AVTA 3NKTA 3HQUA 1DZQA 1IG0A 1KITA 4YVWB 3KT1A 1VIWB 4DQAA 1PIV1 3DKWA 5FXWA 2XJQA 4AOCA 3M3CA 4Y3OA 1H4GA 1NLQA 2ARBA 4IEOA 5T5JA 5LK7B 3TEWA 3FLRA 2WA3A 2G9GA 1OLMA 1VBC2 1B35B 3H8UA 4YFZA 5A6XA 3Q8EA 3CLPA 5IK8A 4S2FA 1BVVA 1W0PA 3WDTA 3B9CA 4F7ZA 1RUNA 3RVHA 4EE2A 2CDOA 4F3JA 2VMDA 4QX1A 4XOGA 3I2HA 4N53C 4Q4W2 5A7OA 5CG9A 5IK4A 4A44A 4M3CA 2P3IA 2QVSB 2VGDA 5FYVA 1DGRA 1JYCA 4TYSA 3WV6A 2W87A 3UNPA 4LHNA 4LBOA 1JXNA 3AKPA 2Z4FA 4LBJA 1D4VB 4CU6A 4AR2A 4RQPB 4RFRB 3K3NA 1YQ5A 1IQDC 2GC1A 3ST7A 1VBC3 4GQ7A 5HV4A 4XBLA 5FMOL 5JIUA 4HPKA 4IEXA 4LULA 1XB9A 1GQPA 2BWAA 4IGOA 4NRMA 3E1F1 5T50A 3LEMA 5KWRA 4UFHA 3X29B 4LLFA 1W6MA 1ZZ6A 3ES1A 2OX0A 3IWZA 3SKVA 4ZZ5A 1NLRA 1YYNA 3VZKA 4YNIA 5C3OA 5L7OB 3KD4A 1CX4A 4CXXA 4D6SA 4MGQA 1RXGA 3OGSA 4EZ4A 4UFKA 4AW7A 2GDFA 2ENRA 4GULA 1CIWA 1QQP3 4ET7A 4MSVA 2QQUA 3JD71 3CNAA 1LOGA 1JHJA 2Y6HA 4M4RA 5C8WA 2Y0IA 4JGZC 1GZ9A 4B8EA 1GP4A 4GMP0 1RUF2 1OQDA 3RPQA 2VOWA 4I02A 2R063 1O6UA 1TNRA 5FUNA 2CTVA 3J8F1 1RUOA 3RZMA 5JSPA 4PI0A 4IV3B 1NOVA 2FMYA 1LKNA 2MEV2 2R6QA 3N7JA 1OC1A 5D8AC 5FLIA 4BM8A 2DTWA 3O1SA 4IE0A 4QQHA 5C3SA 1CX1A 3VHOA 2VZ1A 3IPVA 2AR6A 1GFF2 3BPZA 1VJ2A 4KNCA 2C9AA 1TME3 3O7OA 4FAHA 3VBFA 1NT0A 5LRSA 1ZVFA 2O8OA 2ZHMA 3WDYA 3I2GA 1UNBA 3EYPA 3OUIA 3AB0A 1XSQA 2UURA 4META 2VVDA 2ZKLA 1YJKA 1CQ9A 3OJBA 2C26A 5CB7A 3IMMA 3VBOC 4A4AA 3OGGA 2ARAA 2KXLA 2ZMNA 1QJX3 1S0JA 2E51A 4QPIC 4XZPA 4LR4A 4OULA 3GF6A 3MV01 4NWWA 2AENA 3VHNA 1JZ7A 5FP4A 1W06A 4XDQA 1EV13 1O4YA 2VNOA 2XL7A 4YGDA 1QIQA 5FP7A 5F6KA 3SEPA 2F17A 3A0KA 2EXHA 3C3VA 1VE0A 4E4DX 4YARA 1CESA 1AXKA 1BXHA 3E6BA 5CA6A 2R7EB 3DPRC 4JCKA 1OHFA 1PZ7A 1PX4A 2YGLA 4IEUA 4CDUC 2VL4A 2JE9A 1AR73 1UY4A 2ARCA 2WNVC 4LHSA 3THCA 2AH2A 1CZTA 1NY71 4IEQA 4L99A 4LMFA 1VAKA 2I2SA 2O1QA 4JTNA 1W9YA 5FYUA 4TLFA 4BPZA 2VCMA 2BFUS 3VD9A 5K8SA 3AL5A 3RZHA 3I2FA 5M0TA 3WQBA 1NE6A 2XBO2 2Q8EA 1JZ4A 1UYZA 1DFQA 2EICA 2Q4SA 3T08A 1W8NA 4Z8BA 5C4WB 5IAVA 4TTGA 4IERA 1WMXA 2WNUC 2IC1A 4RYDA 3RSJA 1KJRA 2BNOA 2FMDA 2YU1A 2ZEWA 3OD4A 5LBCA 5T5PA 4CU7A 1DQ2A 1QJU2 4ES9A 1V70A 3GHMA 4D0QA 4OYUA 5D1IA 1D2SA 2A6WA 4DXRA 1UY1A 2P3YA 5GKAC 3O1VA 1MVQA 2EALA 3VDBA 1RUJ2 3ZYIB 4CDXB 3R4SA 5H9RA 3WG3A 1K5MA 2JG9B 3I49A 3C7OA 3ILNA 1I5ZA 1VRH3 4NWVA 5CVRA 3WZ1A 5KC5A 3AX4A 1K45A 3I54A 4JQTA 1IPSA 2PFWA 3I4IA 4EJRA 4K20A 2WZ8A 4LPLA 4RS5C 1RMU2 4CZSA 2PLV1 1JUHA 3I3QA 3U10A 5FZKA 5J48A 2ZX3A 3MO4A 4RR3B 2WINB 4S2HA 1VBD3 4XTPA 1B35A 1SCSA 3J7NA 1ZZBA 1FMD1 2W52A 4FFIA 5EZWA 1WD4A 2Z69A 3WP6A 1A78A 1AZDA 5A3WA 5FDBA 2Y38A 4Z2WA 1Q8VA 1EAH2 4RL7A 2JG9A 2GSYA 2NLRA 1H8TC 2ZGRA 5IVYA 1Y7BA 5E16A 1QJU1 2CAUA 2B42B 4CEYB 3OUJA 1PGL2 2D6LX 3TAYA 3VL8A 2E63A 5FZEA 4AQ6A 4BB3A 3J7MA 3VD4A 3ILFA 3L2YA 3B02A 3BUCA 1QJX2 1ZYBA 4CEWC 3OGJA 1VMFA 1RUH3 3I3EA 4JV4A 4CP9A 3LDKA 1D0GA 2IVIB 5K7PA 1RUD3 3KF5A 5BNNB 2YV8A 2KA3A 1Q8QA 4K40A 2ZTNA 4CDUA 1KXGA 2JDHA 2WA4A 4QKDA 2ZGLA 1S0CA 3HQXA 4JGZA 1SQ4A 3ILRA 5J09A 1SLCA 1IS4A 4IEZA 4R4ZA 3ZXAC 4EN6B 4ZU7A 1W2OA 5F3GA 3MW2A 3K3OA 5HBAA 1LGNA 5FO7B 5CFDC 3ROUA 4EROA 3I3DA 1Y9QA 4Y5SA 1O3SA 2J42A 2PHTA 2YMZA 2QQNA 1YEWA 4DMIA 4EV0A 1C3HA 1W6OA 5JZGA 4QGMA 1OPMA 1NZIA 4XQDA 1QOTA 2GNDA 1ND2B 3J7LA 2NZ9A 4I3GA 3MLKA 4NIAA 1W9TA 4ASLA 3VBUB 3PMEA 3RNSA 2I45A 1EPWA 2RJLA 4H14A 3FUOA 1I5PA 1PMIA 1W0NA 2D3SA 2JDMA 2Y34A 2X10A 3ZXDA 2HWC3 2P17A 3JQXA 4FPJA 2RMU2 2Y6KA 4WZFA 5AC93 1OOPA 4Y26A 3VBHC 4D7YA 1W6OB 3J8F2 4GMP3 5JZGB 4K8FA 1AF9A 5A3LA 2GC3A 1JZ2A 2VZTA 4QPIB 1IG3A 4CUAA 2ES3A 2ZCWA 3R4DB 5FY1A 5T52A 5L9VA 3WVJA 2XH6A 2R043 1LECA 2VTXA 1GQGA 1VB4A 1J1TA 2XONA 3FMGA 4CDWA 1ENSA 1NX9A 4P02B 3VBUA 2XVGA 1A8MA 3HVDA 1O4ZA 4W6XA 2JENA 2WLQA 1D4M1 3UESA 5A3NA 2TNFA 1JYTA 2W0XA 4ITCA 4ZU5A 2WO7A 2XJVA 1DIWA 3KCYA 2WNEA 3ZIXA 3CZUA 4OHVA 1YI7A 4HG6B 2TEPA 3ETPA 1PK6A 4QXHA 1K12A 1O7FA 3NWKA 4LBKA 2PHDA 5C3RA 3K75B 4XFGA 3J9SA 3UGFA 5FP3A 1SDWA 4CRQA 2RS53 2GMPA 1C4RA 1HX6A 2R072 4GKYA 1MQTB 1HRI1 3BODA 4LA3A 2IFRA 5I93A 2GMEA 1XOYA 1MZFA 1SPPB 1E5RA 2RM23 3MLLA 3WQ7A 4CCEA 5C9AC 2ID4A 3WINE 3WOGA 1REEA 4D69A 4O9GA 2R041 4HK9A 4AK3A 1W9FA 4XCAA 3KVAA 2P5BA 5IAXA 4P9GA 4CDQC 3BU0A 4C0BA 4URAA 4D6RA 4DO0A 3AP6A 3THTA 2A7AA 2WL1A 3O0VA 1FT9A 1XSRA 1TE1B 2W92A 3IT8A 3NKGA 2PMWB 1W99A 2QTWB 2YC4A 1ZRIA 2E32A 4GKXA 3T2PA 3T0BA 1MS8A 2D97A 4XABA 5BNOB 2DCKA 2WFF1 2C6SA 3MYXA 2B39A 1R64A 2G9FA 3VBFB 4HVOA 1K5MB 2YFZA 4Q4X3 2WUHA 3FJSA 2ET1A 1URXA 3JZVA 3JBG3 4DY5A 1BBT2 2CGOA 1W90A 3HN1A 4WM8C 4MGIE 1UMIA 2XXZA 2Q8DA 4CP2A 3OBRA 4K21A 4QPWA 2JB8A 3T4VA 4YW2A 3MEPA 1CJDA 3NNGA 1NZCA 2G19A 3ACHA 3FFQA 1XXNA 4AQSA 1U12A 3HNBM 1NA1C 3S5QA 2VCCA 4BXFA 4JKLA 1AYN1 3POYA 5JOZA 2VQUA 4FQ4A 4QQ2A 3SH3A 5L73A 2E9QA 5FR3A 3KGLA 4NO4A 5FZMA 3ZVXA 3WF4A 1CAVA 4BMEA 5DZEA 4Q8KA 1WKYA 4N43A 4YW5A 2VUCA 1GZCA 2VZSA 1COV1 1XNBA 1O8SA 4ORFA 4FPYA 1G6NA 5J3UA 5FCCA 1TEIA 2VPVA 4HN1A 4MVTA 4P9XA 2P4EA 1UL9A 2V72A 3C7EA 3KSCA 1NQDA 4KG8A 1BEV1 1ZX5A 3LD8A 4RQPA 4BQWA 3NMBA 3B93A 3FE5A 1N3PA 5IVJA 3AYAA 4QWNA 3H8XA 3D0JA 2YBSA 2XLGA 4XFCA 4ZKTB 3A22A 2YPJA 2IXJA 1VR3A 2VW2A 3P3PA 1BEV2 2ADDA 4OMDA 1WCSA 5FZGA 1Q5OA 1BBT3 1VPHA 3MIBA 1OBNA 1YRZA 1R1A2 5CAZA 2VBBA 2XJSA 4H55A 1PK6C 2E33A 5A7WB 1SFNA 1KS4A 5FMBA 2WNVA 2R0HA 5HCBA 3BTYA 3ON7A 4IV1B 5CYYA 2A6ZA 4JDOA 4CTEA 4XZUG 4OHWA 1C8M3 1R082 2XKPA 4RGKA 5FY4A 2QNKA 1MS4A 4X6QB 4MG2A 1QGLA 5IT6A 2RMU3 1W6PA 4RGGA 4L2NA 4LXLA 1MEC2 1AJKA 2OPKA 3VZMA 4PLMA 3E5XA 1ZREA 1DDLA 4BXSV 5JCTA 1X50A 2FDJA 2A75A 4X8NA 4BOWA 3IIAA 1D2QA 1ZRRA 1V6IA 4GB33 3HD8B 4HETA 2WAOA 1W28A 2QE3A 2BPA2 4XQ4A 1NG0A 1AL23 2X5IA 2RE9A 1FOD2 2RM22 4UW5A 4XW3A 3WF2A 3ZSEA 4A6OA 2RS12 3PVEA 1BZWA 4LNVA 1XE0A 1FI2A 1W8HA 3UGHA 3ZKUA 2BU9A 3HNMA 3W58A 3HT1A 2YGMA 1C1LA 4NE9A 2P2KA 4E2GA 5BV6A 3KHCA 5A33A 2HBUA 2CU5A 1SFPA 2RR13 2JE8A 2GAUA 2D6OX 4LK6A 1PM7A 1FV2A 3AL6A 3PURA 5FMCA 2G1MA 3GXUA 3NV4A 5A6QA 4QB1A 3CO2A 1Y43B 3KHBA 1AXYA 1FPN1 2C24A 2ZAAA 4XFBA 5GLTA 1SBDA 1GZWA 1S2EA 1XE8A 3K4ZA 5EJ1B 2JECA 3ELNA 4E2QA 1SDDB 5EYYA 4PJYA 1C28A 2XUMA 4LTAA 1W6QB 5LEKA 1HN1A 4M3CB 4PIZA 4XUNA 1CAUA 4LA2A 4PF5A 3K48A 4SLIA 4I09A 4ARXA 3T0AA 5ACA2 3KWVA 1D7PM 4HN0A 4Y4RA 3SNMA 2YUEA 3JCIA 2EIEA 2QQOA 3N9QA 4AVCA 1REDA 3TYJA 1RTVA 3W5NA 1V6LA 3CJXA 4N90A 2QQKA 1XC6A 5I0UA 3MPPG 3SQOA 2NMOA 1DZTA 2WYSA 3N35A 1CR7A 4FAGA 2IVJA 4XJ9A 3BIEA 2F4PA 2PHWA 2WQZC 2ARXA 1N1TA 2UWBA 4AEMA 5FREA 1HN0A 1F4AA 4TXWA 1FNYA 3GJBA 4LK7A 1ACCA 2BQPA 2ZGOA 4COYA 2ILMA 5C3PA 4Q4V2 1LODA 3GBWA 1E5HA 1E57A 1ULFA 1K5MC 1O5UA 3MF6A 2ZX1A 1DF0A 1LGBA 5FOJB 2GN3A 2X5IC 2YROA 3WF3A 1S1AA 2W47A 3OUHA 1JU3A 3PJYA 4GZ9A 4IE4A 3ZO0B 4CU8A 4WM8B 2GH2A 5IVFA 1LENA 1C8M2 5E1RA 4IGQA 2ATFA 2HWE1 5FXZA 1GP6A 1X8EA 2NQYA 1FMD2 4IL7A 4MHRA 5I0SA 3GBFA 5GALA 3VZLA 4CUGA 4CCCA 2NMNA 4K1YA 4Y5Z0 3USUB 1DGWA 1AR62 4Q0QA 2FCVA 5FPAA 2FDKA 4XMIA 1ASJ3 1CAVB 3RWNA 1LU2A 2BDRA 4B1LA 1MEC1 1KRIA 1AXZA 1CJPA 5JDBA 1H1AA 2XJPA 1V0AA 3AP7A 5EV7A 2CSGA 5T5LA 2JDUA 5JAXA 5JPMB 2KD7A 1BEV3 1NKGA 4C90A 3B01A 4JDNA 2C0ZA 2K9ZA 4PHZA 2XJUA 2WZR2 3WNXA 1UXZA 1WW5A 5A1LA 2JIGA 4QX2A 4V1PA 5GLWA 2WSUA 4XILA 2FHRA 1NYWA 4XFFA 3LAGA 1IS6A 2WAAA 4PIYA 3O1PA 1LHNA 4LBMA 5C9AB 1S0IA 2B5HA 4DIQA 1UOBA 3Q8CA 2DCZA 1W2AX 1DCSA 4FPOB 1HB4A 3SEEA 3ZSJA 1GNHA 1OXCA 3D6EA 3OSDA 2PN5A 3OEBA 4K7JA 3URFA 1K42A 1VAMA 4I0AA 1US3A 2NP0A 5CFDA 2W1UA 3WD5A 3VBOA 1ENRA 2B9UA 1POV3 1FNZA 1GR3A 3DYPA 5H9PA 4AI8A 3DEMA 5IFPA 1RUG1 1CPNA 1LOEA 5FLHA 4J1XA 4WM7A 5A7WA 4Z07A 4YM3A 1S0BA 1EAH1 2XLFA 4FOVA 4R9DA 4A6SA 2P6HA 1TG7A 5F6LB 2AZ5A 2QCSB 1EV11 5FZHA 4OHZA 3AP9A 3ZDVA 5FOBB 4HBNA 1IPKA 2R0FA 2OYZA 3RS6A 1AYM3 5A3UA 3UL2A 5FZ4A 1JYXA 5LK5A 4DS0A 4Y5TA 1GICA 1S0EA 4EWDA 3VKNA 4MV2A 5LBBA 1GANA 5A33B 1OLQA 4BQ3A 2GN7A 2VQAA 2VNRA 3ORJA 5C8CA 4C8DA 1QJY1 3LEGA 4FP2A 1RUG3 3V0BA 4CXYA 1TME1 1FYUA 2GH8A 3I2IA 3M3EA 2GC0A 3WG2A 4M3CF 4CDWB 2CAVA 2DUQA 1RL3A 2VMEA 1PHMA 3W59A 1AR83 2MEV3 3B5LB 2NM1A 3O14A 1HKDA 4HXCA 2OIIA 4XDOA 2HEVF 1GOGA 3VBUC 3H8RA 2RJKA 1LRHA 3J8F3 4XF0A 5C5TA 1YFUA 5CKNA 3J4UH 3DYOA 1GBGA 3HOBA 4PBPA 5FV3A 4UBHA 1R1ZA 1QNYA 2WDBA 3ZFFC 3KT4A 4QXKA 4EYUA 2VMCA 1WCKA 3OGVA 2J1EA 1H2NA 4MO3M 4NOTA 1VP6A 4Y1XA 4ZU4A 1STMA 2JX9A 2BYVE 5F5CA 4XJZA 4EN7B 3H0OA 4N53B 5GLVA 3NVCA 5IVEA 1OKQA 1OUSA 2WNUA 3CQOA 4FPGA 4IQPA 3DGTA 1B35C 1IKPA 3I8TA 5LASA 2XJRA 5DMYA 1AHSA 1DHKB 2WS93 2ZS6B 2WWJA 1J83A 1V6KA 5A1AA 4BYYA 5LA1A 4UYBA 2JD9A 4KQ7A 1N3OA 4QXCA 2LALA 4O9EA 3M3OA 4W6YA 1MS5A 3L9JT 5L9BA 4CCOA 3FBYA 3FHQA 1O59A 5LCWL 4BH9A 4YSFA 3RJRA 2VXRA 5BNNA 1DQ4A 1WWYA 2BGOA 5FZOA 1W03A 3OCPA 1UIJA 4FCAA 4HKOA 5HCAA 2Z79A 4LBNA 5A7PA 1OFNA 2WN3A 4M4PA 1ULGA 2VBDA 5JSRA 1JZ6A 1PM4A 2VTFA 4I01A 1JYVA 3M4FA 3OBAA 4U36A 3UV9A 3WNLA 1WBFA 4QT6A 2C9KA 3N7MA 4WM8A 2BTVC 4F83A 4E2SA 5FYTA 5IHRA 2CNAA 1QKQA 2P6CA 2VQTA 1GWKA 3A4UA 3PIGA 4JHTA 4JTOA 4ZZ8A 1CGPA 4FOWA 4H7MA 2A1XA 1ULDA 1J1LA 2X53S 3POSA 4XUPA 4ZONA 4LOTA 2V5YA 4WVZA 3FFZA 3ZOIA 2WO2A 4LO8A 3TEXA 1JS9A 3CDZB 2HYXA 3AMPA 3Q9OA 2IWGB 4MOAA 3PDQA 1CD3G 3ZN6B 1S2KA 5FZ7A 3WHTA 2WNUB 1OKOA 2VMGA 4NHMA 3VKLA 2WZEA 4N7IA 3S5AA 4QHOA 5DG1A 3ZR5A 1RUC3 4CDXA 2JG8A 1AR71 2YYOA 3B9IA 2UY8A 3FLTA 5FZDA 3M8LA 3RYRA 4O61A 4KWUA 1YQ8A 3ZXJA 3ZFEC 5IVCA 4BLJA 5JMOA 3LCPA 4KWJA 2MPFA 2R16A 3AYEA 1JOJA 1UYXA 2WQ4A 3WNOA 2ZHNA 2DVFA 1NE4A 2AC1A 4GA9A 5GZGA 1XNAA 2CY6A 1UX6A 2XQRA 4PDWA 4P00B 1Z0HA 3KCXA 4M0HA 4SBVA 2QZ3A 3VBRA 3M1HA 5GLZA 4CEWA 1NCQB 2ZGMA 2QKDA 1H30A 4QU1A 2JKXA 1O8PA 1WCUA 4Y22B 3SH4A 4RSUA 5EXOA 2CGPA 2OS2A 4NAOA 1OF4A 4Q4Y3 1SLLA 3N4MA 3NNFA 4LBQD 3VL9A 4FT8A 3GZEA 5F3EA 4AGRA 5J37A 3ZYGA 1UO9A 4NPMA 3LOBA 3AKTA 2PHUA 4XJWA 4TWTA 4BU2A 2P3KA 5FP8A 1AR82 1TMF1 3VBRB 3AVSA 4LO7A 5EHDA 2OKXA 4A2UA 1ZRFA 4LHLA 1A34A 2CGNA 4OMCA 2IZWA 4QAWA 2W1WA 3WUDA 3WDWA 5CNAA 2OZ6A 4OHYA 2YBPA 1W3VA 4Y1VA 5DPNA 2AGSA 2WZR3 3ES4A 3BYWA 3HIFA 3NNJA 3SISA 3L2HA 4OI4A 4MH0E 1VRH2 5TSWA 4JRAA 2VBPA 4PLNA 1WBLA 1PNGA 3PHMA 4IGPA 4AGGA 4HVRA 5FYIA 3HAGA 2D43A 4FPFA 3B00A 3OD0A 5FY5A 4DUWA 1U5ZA 2XKOA 5E6HA 5IYYA 4HSLA 1SLAA 2RVAA 5FPLA 2WWSA 4COVA 3CL1A 1QJU3 1GSLA 3AC0A 1TMF3 5F32A 5L19A 1RINA 2D6PA 4LIUA 3VUOA 3UKTA 4CDXC 1Y9GA 4QPYA 1W2TA 4Q4W1 1CAXA 4GWIA 3SMHA 3ZX7A 1D4M2 3GJAA 2RHPA 5C9AA 3PMSA 1MZEA 2ZOEB 3MLJA 1NCRB 1S0FA 1LAJA 4XC9A 2QFEA 3NL1A 5HXVA 2HWD3 1PVXA 3MPBA 1DGRN 4XEZA 2LRPA 3NV3A 5IW0A 2B4KA 2Q1ZB 1LULA 2Z42A 1V6NA 1KDMA 2RR12 3PUSA 2XLAA 1KS5A 4Q1RA 1W6QA 1Z7S2 3BKZA 5JXIA 4YG6A 4LITA 3KQ4B 1PGL1 4QD2A 2B7YA 3W9AA 4W65A 2BGCA 4LBQB 5KHGA 4L97A 5L7OA 1OSGA 3VGIA 2E31A 1G9CA 4N43B 2BW8A 4JHZA 3O1OA 3AFGA 1G9BA 5GJ6A 3WDXA 1ZZ9A 1QOOA 1RUH1 2D6KA 2GNMA 1KEXA 3A21A 3PIJA 5FQ0B 5FZ3A 2ERFA 2WC2A 3QLQA 4INDA 3KMHA 4OUMA 5F37A 1RJ8A 1O5LA 5K9YA 4YWAA 1YXWA 2WR9A 4QU2A 1F9KA 1H8VA 1VBE2 2ZX2A 4CCJA 1OA3A 1HLCA 1RUI3 1U5YA 5EP9A 1WGPA 1FV3A 1R083 1UU4A 1LR5A 3LA7A 4F8AA 3K4DA 4ONUA 5A3TA 4PDWC 4RHV3 5HV0A 5JXJA 2EXIA 2O8QA 3KF3A 1SFYA 3VBRC 5BNPA 3GZUC 2VCAA 2Q1MA 2R062 3ME2A 2BP6A 3QD6A 1LEDA 2VOTA 4OI1A 1IHMA 2ZEZA 3POGA 5C70A 2EAKA 4EN0A 2VZVA 3BTAA 3C8XA 3AKQA 4B4QA 1HXS3 3HQRA 3OEAA 4RFT0 3DF0A 4KGGA 4P5HA 1CAXB 3RZLA 3LGRA 1GKBA 1PZ8A 1SACA 3AZVA 4MXVA 3VKMA 5LZ6A 4CXWA 1WMEA 1H1IA 1JI6A 4K3UA 4DUVA 2QQMA 1A6CA 4R8HA 4I0WB 4JGYC 1Q8PA 2XL9A 3BTXA 2F4LA 3IAPA 3NJYA 5DAVA 4YW4A 1F5FA 4HANA 5C7GA 3LOIA 1EPZA 1UPSA 3LPGA 3ZXGA 2WFPA 1G9FA 5E8AA 1JMUB 2RS13 3ZMOA 5BYNA 2W46A 1CPMA 4ISRA 1EP0A 2QQPA 4ASKA 1REFA 5A70A 4LIVA 4ZY9A 2W9XA 3JD72 4IE7A 2ZKNA 5FK7A 5FPUA 3VDDC 1UMHA 1YFWA 2D5HA 2JDKA 1LHUA 1US2A 5C71A 4QM9A 5I0RA 4BLIA 2AEYA 1TQ5A 3QACA 4LORA 1PVC1 3ZFEB 5F3IA 4AEDC 2IXLA 4Z82A 5IUQA 1DYPA 2DFBA 2P3JA 3NAPB 4KMQA 5LBEA 4XBNA 3SCGA 4C1XA 3F95A 3VBSC 3B3QE 1V00A 4XURA 3DPRB 3SCFA 1LOAA 1UKGA 3HJRA 1DYKA 5DDJ3 5HI0A 5GM0A 2PHXA 2JDZA 4QDRA 5JWPA 2VMIA 5DQ0A 3ZLIA 2IXCA 4RQPC 3IM0A 3BVCA 3VBHA 2E53A 4Q8LA 3WNKA 4FOYA 1DYOA 1X8MA 1CONA 3SLIA 4B4PA 4Q1PA 2VULA 3D0SA 1NQJA 2DV9A 1OLME 3N3HA 5CFCC 4W4ZA 1L7RA 1DBNA 2VZPA 3DXUA 3KZ4C 5DZGA 1YUDA 4GB31 5CKMA 4CDWC 1HRV1 4QKFA 3T09A 1C5HA 3A23A 3H1WA 1XYPA 1CZSA 1AL22 2DFCA 1OOPB 3WDVA 5J36A 1W8OA 3TEYA 1PMHX 4HSJA 1N1VA 3ZMNA 1C1FA 3GNEA 2HKXA 5ACA1 2C4XA 3WX5A 2HWF3 2B45X 2P34A 2D93A 4XHXA 3ZSMA 4QMAA 5FYCA 4JAAA 4QX5A 1QJY3 2HH9A 1RB8G 4YW6A 1FPN2 3MI8A 3OPZA 3ZYFA 2V09A 2YB7A 2J1SA 3PUIA 2BV4A 1YWKA 4P9JA 3E6DA 1RUJ3 2OQ7A 5HPOA 1TZOA 1H1MA 1XU1A 5DAWA 3S7EA 1KGYA 4MHUA 1NXD1 3OGRA 2R073 1HB1A 4BE3A 4IETA 4M01A 1QOSA 3POEA 4YVSC 1DQ0A 5FZLA 1N3QA 4PCRA 5JIAA 5KHIA 1JZ5A 4QKNA 2R071 2RDNA 4L9BA 4NHLA 1G9AA 4NHXA 3AXDA 2BRTA 2ZZJA 3D4KA 2O0OA 3VKOA 3KS7A 5LWBA 4B7EA 3H1YA 3WNNA 4MZUA 2Q1FA 3IB3A 3ZXLA 4FFFA 3MBWA 1RUC2 4QHBA 5IK5A 1GWMA 1VMHA 4IXLA 3IN9A 3SCHA 3JBG2 5HCFA 3WP5A 3VBHB 3S7IA 3SXWA 3VZOA 3G7DA 2GP5A 4AAXA 5E89A 5EQUA 4D7TA 2KM2A 4JZRA 2WWUA 1FMD3 3WEZA 2YY1A 4IUGA 1JZ3A 4I0BA 2F6BA 3WW3A 3OF1A 4QB2A 3THDA 5ABJB 1NCQA 2MEV1 2ZEXA 2E7AA 3UJQA 4Q4Y2 4QDQA 4UBGA 1E5IA 2DTYA 4HKLA 1ZA4A 4AI9A 2OT7A 4IESA 2C1FA 4RGAA 2VZOA 2Y6JA 5DN2A 1LHOA 3H50A 4J6GA 5I91A 3NRUA 3VDDA 1NCRC 3OY8B 4YM1A 3SC7X 3RI8A 3H3LA 4FXKB 1XQNA 4XUTA 4BQ2A 5GZCA 2OXBA 3PL0A 5FZ6A 3NJVA 2HBTA 3N7KA 3WCRA 1ZM1A 4OVEA 1Y4WA 4IV3A 5D21A 1LEMA 4GWNA 2BWCA 2YZ4A 3U75A 5ANQA 1CZVA 4YRDA 1IGOA 3ITQA 1VBE1 2XHNA 1JYNA 1RUE2 3MIGA 4CYDA 2J7MA 5BY5A 4UW6A 4KI5M 4FTEA 1UN1A 2BGPA 2VY0A 3E5UA 1WW7A 3QH6A 1JODA 2DWRA 1IQAA 1ZZ8A 4NROA 3AFKA 4QM8A 2VUJA 1POV1 4JQRA 4R4XA 5KR7A 1SBFA 2QDNA 2WZPP 4WBBA 2W91A 3D5OA 3BI3A 5SV8A 3ZPOA 3H1MA 1WLCA 3POWA 3Q8AA 1DGWX 4NRQA 2YHJA 1Q8SA 1ZBA2 3DPRA 1X7NA 4Y1UA 1WA6X 4CP9B 1WMDA 3CMGA 3VBSA 1GLHA 4HK8A 3ZXKA 4QHZA 4E4ZA 4XDPA 1YHFA 4YW1A 4LBQA 5FBZA 1HV1A 2JG8C 1RVF3 2XOMA 3DECA 4AG4A 1G7YA 3N9NA 1Q8OA 1Y9MA 1HQWA 3GZAA 4BIFA 4AHYA 1NA1B 1VBA3 3ZYBA 4R9AA 3AMNA 1DLCA 2HLEA 1WUVA 1OFSA 1C57A 4IE5A 2UYBA 5LW9A 2QBXA 3DYMA 3M7AA 5GLUA 3VHRA 5SV5A 1VBB3 1ASJ1 2WRAA 2XGXA 3J26N 4HFSA 4YZ5A 3U4SA 1MR5A 3EQEA 3I2JA 3KM5A 4OUEA 3BIWE 4S2DA 3RMYA 2VOXA 5K0UB 3UJOA 4FP3A 1ZZ7A 5F5AA 3AP4A 3SITA 3AKRA 4A3ZA 1YO8A 1IS5A 3FLPA 5FXVA 3WY6A 4FSJA 4D3WA 2Y8KA 4A45A 1ND3C 5KHJA 2LS6A 5J98B 2TBVA 4XPVA 2WT2A 3VD7A 2TUNA 2Z2SB 4WZCA 1W6NA 2ADEA 4JRLA 1UYPA 2VZQA 4COZA 4MGKE 1MS3A 4WM7C 3FBMA 4D6QA 4DEVA 1J84A 1C5IA 1R1A3 5F8PA 1OT5A 3HMYA 2OUHA 1GV9A 2W3JA 2W95A 2RS33 3H42B 1UCXA 3AJYA 2WS91 3WF1A 3ABZA 1BQPA 5HCHA 1FX5A 5AFEA 4LEJA 2V5DA 2ZABA 4YM0A 2QJVA 3BU7A 5FK8A 2XWBB 1MS1A 4RD7A 4WVMB 2XWJB 1YI9A 1JYWA 3NNLA 5FYHA 1KJLA 1J58A 2Y6GA 2ETEA 4LE4A 2ZX0A 5FFOC 2ZAHA 1BMV1 2VW0A 5FZFA 3WW4A 1G9DA 2VZRA 1UW8A 2RV9A 4A41A 5IFTA 1NUKA 2VVEA 3MV11 2IXKA 1QDCA 4Y24A 2I07B 2W08A 4XUOA 4YGEA 3OPWA 3V0BB 5FUIA 4CUBA 3QBQA 4AHWA 2A6VA 3M70A 1OH4A 3I2DA 3RZJA 3C7GA 3POBA 2X29A 4DOUA 5ABJA 1EV12 1IKQA 2QQVA 2D7FA 2HWF1 4AZZA 3V65A 4XETA 4BWOA 4H3WA 5JPNB 2JKBA 1UY0A 4XMAA 3T1LA 1AR81 5CADA 3DL3A 4CPBA 3T1MA 2PQQA 4TSVA 4P5YA 4Y1YA 5A3OA 3THPA 1JZ8A 4DINB 1NXMA 1PX3A 5E88A 1NLSA 2DCYA 5F9TA 1L7QA 2DF7A 4XJAA 3QCWA 4XUQA 5DAQA 4DPNA 1OOPC 5CG8A 3TNPB 1TME2 4UWDA 5I0TA 4CCDA 3RYPA 4PDWB 2D6NA 3AZYA 4KBZA 3OG2A 5GZFA 2L9LA 4B7KA 4DY3A 1UY3A 5GZDA 2XQXA 3AMHA 2PHLA 3KV5A 4LJHA 5BXXA 1OA2A 4XQWA 4XF3A 1ODNA 1KQRA 4B4RA 4UW4A 4XF9A 2DVGA 2E6VA 3HR9A 3MFAA 1SCRA 2SBAA 4LOSA 4H7LA 3GCWA 5FZCA 3IDBB 5DUUA 4AAPA 2VMFA 1XNDA 3LB9A 1UKRA 2A3YA 3ZN6A 4UAPA 3N9PA 4NVPA 2I74A 2W2IA 3CKHA 2EIDA 1YIFA 5KXBA 2WT0A 1PO13 3RRDA 3FWEA 4B29A 3T30A 1QXJA 2A6XA 4YGCA 3AZXA 4QX8A 3LA2A 4HMZA 3U07A 4AI2A 1SBEA 2RS32 3NW4A 3RZGA 4PBOA 3VBFC 5KXEA 4CE8A 1GUIA 3ZFGC 3HEIA 4HL0A 2Y6LA 1UAIA 3U78A 1ODMA 5BNNC 5FKBA 1ND3A 3LIHA 3APBA 4K6BA 2Y64A 5B4NA 2HWB2 2ZGTA 1W8TA 4P9IA 1CAUB 4IE6A 2XVLA 4IEVA 4ZXKA 4IDZA 3SKJE 2YU2A 3ZM8A 2G4IA 3IBMA 1LB2A 5JVVA 4UFLA 2VAUA 2VE1A 3JUUA 3BOPA 1X82A 2LTNA 4Q26A 3O1TA 5CIRA 4E8CA 2VECA 5FPZA 1PK6B 1RIRA 5ERLA 3ZN5A 2NYYA 1W6MB 2O14A 4CCMA 3VDCA 1AVBA 3OYWB 1H2MA 1G86A 3AYDA 2RDQA 1EYBA 4N9HA 4UFIA 4CDQA 4YVSB 4YVWC 1KFXL 2OVUA 2D98A 4S2GA 1F35A 2IXIA 3MIHA 1ZBE2 3LSDA 1NAEA 3IDEA 1QQP2 3MUY1 1XU2A 1SLBA 1JHNA 4XF1A
chains in the Genus database with same CATH topology
3ZIWA 2A3WA 2WSVA 1QY4A 1PGW1 4KU7A 4YM2A 4FBFA 3AKSA 4PLOA 4KWKA 5J96B 5JSOA 2VOVA 1J3PA 4OHXA 5FTTC 3U11A 1GNZA 4EN9B 1MEC3 3QH7A 2A71A 3NV1A 1W6PB 2GMMA 4YG3A 1FATA 1I3HA 4LUMA 5LRRA 1AX0A 2HWD2 2JXAA 4LO4B 4HLTA 2AUYA 1WCDJ 4HVQA 1LOFC 4XXPA 1NY72 1SMVA 2QDRA 1HQNA 3KT7A 4AFBA 1ENXA 1RGSA 2H0VA 4MYEA 4MGYE 1C8NA 3CEWA 3ZSLA 4Q27A 1H8TA 1MVEA 3NJZA 4RHV2 4Q4W3 3FX3A 1ONAA 4PIXA 5FLJA 5ABJC 3MIDA 2PLV2 1TNFA 5JOWA 2X5IB 4B3NA 3VBSB 3GYDA 3RG0A 2GNBA 4FTBA 5H9SA 4YG0A 1WLTA 3DV8A 5KXDA 3UKNA 2RS51 3IMNA 4HPKB 3B94A 4GALA 4AQ2A 2WZR1 2DU0A 1QJY2 2FBEA 5I8SA 4YLZA 2HWE3 5AVPA 2D40A 2W39A 4Q0PA 2ZX4A 1ZBE3 4NR1A 1D4M3 1VBD2 2B8MA 4I30A 3VBOB 1SLTA 1FOD1 3D8CA 3NSTA 4FVVA 4DB5A 2IFWA 4KH9A 1RUG2 4AI1A 1YLLA 3WQ1A 3O0XA 4Q4Y1 4QGNA 4G3YC 3ZSKA 1V9U3 4YW3A 4BQ1A 4E4SA 4AXOA 3BB6A 1YFYA 4C1WA 1RUD2 5JZGC 1HRV3 3OY8A 1OLRA 3V0AB 2BVBA 4YVWA 5IK7A 1ZNPA 2HYKA 1GQHA 5JLVA 1WLWA 3KGZA 4XF4A 5BNOA 5JMCA 1ZRCA 5DDJ2 4QPGB 1BJQA 1H2KA 4COWA 5L7OC 4HKWA 2XBO3 5JI9A 2HJIA 2GALA 1GYKA 1XNCA 5FO9B 2BVVA 3USUA 4BMBA 4Q4X1 3E97A 2CWMA 3P3NA 1R091 4QQLA 4JGZB 1OPOA 1ND2C 4GH4A 4G9SB 2Q30A 1FPN3 1T6GC 3ENRA 1QH7A 1U0AA 1RMU3 1S0DA 1AX2A 2EXJA 2HWF2 4Y20A 4ATFA 4LE3A 2WIIB 2JE7A 4A7KA 1O4TA 4WV8A 1WW6A 3EXUA 4XFIA 2A3XA 2B46X 2EIGA 5FRAA 3WW2A 2OW4A 3M3QA 2OZJA 1LESA 4WVWA 3MW3A 3RYKA 1S55A 3ZFFB 1H9WA 1AL21 1PIV2 3ZYPA 1VLNA 1MZ6A 2HEYF 3T2TA 5CFDB 3ZDSA 4IEWA 2YDEA 4GWMA 1BKZA 1DU3D 4FPHA 1M4WA 2LUWA 3KLSA 3H3ZA 3TOJA 4Q0VA 3SH5A 2RR11 3D82A 4QPGC 2OUJA 1ULEA 5AC91 3MW4A 5AVAA 1RMU1 1PO11 3AYCA 3R05A 4A7ZA 4RHV1 3IPVB 4GIQA 1BYHA 2CWSA 3R6SA 1YNAA 2WJSA 4AI3A 2VG9A 5EYXA 5K0UA 3TB0A 3ZYRA 3MF9A 1UZYA 2V73A 5FO8B 3R0RA 2Y0OA 3C2UA 3MIFA 1ALYA 2ZMKA 3ACLA 4AVVA 2DCTA 5KHHA 2Y26A 1AR91 1FOD3 1RHI3 3LZZA 2DU1A 3S0MA 1N1YA 2PTMA 2GC2A 2LM3A 4IEYA 3VZNA 5GZEA 4Z1VA 1PVC2 2BUKA 3M2MA 4KU8A 1NCQC 2BNNA 4N43C 2MNGA 4EWEA 1COV3 1R092 3ETQA 1KFUL 4LUKA 3DUIA 3H3UA 4BZ4A 1RUI2 5C4WC 3WQ0A 1HV0A 3MZHA 1KDKA 4XXAA 1X33A 1ZBE1 4K1ZA 1G8WA 1VB2A 4AWDA 1UF2C 4IV1A 2EVXA 1F5JA 2YXSA 1AR93 1RHI1 3B69A 5EWSA 1ND2A 3HT2A 4CP0A 1COV2 1R093 4YVSA 2DUPA 2HWB3 2XHKA 4N53A 3GBGA 3JBG1 4MGZE 3TRSB 5FAXA 3E6CC 2BEOA 1VALA 3EBRA 4I2OA 1N47A 2GU9A 3DN7A 2PHRA 3EO6A 2JICA 2RMU1 4JGYB 3VN4A 3MFCA 4A7YA 1ZBA3 4ES8A 1UD1A 4R9CA 3AXEA 2D6MA 5K0UC 3U0ZA 1JH5A 2BFUL 4OLLA 2ZPXA 2XB6C 1VBA1 4XIOA 4CP1A 1HW5A 3ATGA 3MIEA 4YZ3A 3K51A 3UKVA 4X6RB 1AYM2 1C8M1 2EXKA 1VBB1 3HWJA 4KL1A 1BK1A 2ET7A 4GH4B 5KC6A 1ASJ2 1JUIA 3MDPA 5BUVA 5KBFA 1JW6A 4LHKA 4C91A 4HT1T 3CJIA 1NCRA 4Q4V1 4XBQA 1LU1A 1F31A 5JI7A 4QQPA 3ZYJB 3S30A 1S2BA 1KD7A 1MZ5A 2DUOA 4K9SA 1OA4A 2R30A 3AMQA 4AHXA 5F1RA 1PO12 2GNTA 4LO5B 1VBC1 3TNQA 1RUJ1 2WFF3 5T55A 1XYOA 3U4XA 3TN93 3RJ2X 5T5OA 4FPLA 2VH9A 2NPIA 1PO22 5DUWA 2EA7A 1F8VA 2DCJA 3ASIA 1BCXA 1MS9A 2WFF2 4XTMA 3UK9A 1W39A 1DGLA 4GXLA 4QGLA 5C4WA 1UIKA 2VQ0A 3LKJA 1BMV2 1VRH1 1HRV2 5T54A 3WT3A 1HXS1 1B09A 4L8QA 1PGSA 2DURA 1Y3TA 5F5QA 1FXZA 2ZHKA 1YJLA 5H9QA 4GMP1 4XIKA 1LTEA 2ZHLA 1QF3A 1WA4A 2HWC1 1FAYA 1X36A 5DZFA 3KQRA 2ZJCA 1LGCA 1AR72 2K0GA 4Q4X2 3ZXEA 1DQ5A 3PJQA 5CBLA 1YIPA 2VUAA 4M00A 1V6OA 1AJOA 1A8DA 4RA0A 5A3MA 1H8TB 1RVF2 4P9WA 1CN1A 4EN8B 3RI9A 2VVFA 5BNQA 4Q4V3 2ZGKA 2X8KA 3CJIC 2HEWF 4D94A 4OUSA 1HXS2 1ZZCA 3AJZA 4Y1ZA 5LEJA 4G4FA 5EFUA 4TZDA 2D44A 4XE9A 1S0GA 3RQ0A 4MXWB 3RZZA 4AHZA 1RVF1 5I8YA 1HQLA 3M3IA 1ZRDA 4NN0A 3LWCA 1UU6A 1HRI3 2VNGA 3WUCA 2HWD1 3FC0A 1QJX1 4RS5A 4XFHA 2FQPA 5CFCB 3NV2A 1OQ1A 2P37A 1O91A 2PAEA 3VHPA 3JB4C 1AYN3 2BBVA 2YC0A 1ZBA1 2ZGUA 3ZFGB 4Y4YA 2Q8OA 1QDOA 2H0BA 1UMZA 2WS92 3LA3A 4CDUB 1XE7A 1RUD1 1UZZA 1I9RA 3N36A 3OYWA 2A73B 2ZMLA 2D5FA 3VLBB 1ND3B 1BBT1 2AYHA 5BNPB 1QXRA 2CYFA 2Q0AA 3KCCA 3MICA 1V9U1 3PNAA 3O12A 5BPXA 3VV1A 3ZXFA 1QXPA 4GB32 3AZWA 4QPGA 1SLIA 3ZFGA 1R1A1 4MXWA 4YZ4A 3QOPA 5BNOC 5C6CA 2W68A 3AMMA 1DQ6A 1MQTC 3JU9A 4PQ9A 4OI0A 2WKKA 1Z78A 2EAAA 5C8CC 1LOBA 1UPIA 3B7MA 1LJ7A 2PA7A 3HBZA 4EWAA 3AZZA 4GH4C 4C0HA 5A32A 2QZ2A 4FOQA 1H4HA 2ZGPA 1LCLA 1U5IA 3ALQA 4COUA 2A5ZA 3O0WA 3WXPA 4Y20B 1RUH2 2MHFA 2XVKA 4KG0A 4FO9A 1WW4A 2Z5WA 1QQP1 2ZGQA 3CU7A 4ISQA 4BA6A 1CAWA 3WHUA 3ZFFA 1SEFA 2RS11 2UYAA 1PNFA 4OZXA 5JOXA 3BOWA 1MQTA 2WLPA 3CF6E 4AGVA 3WCSA 3AP5A 3INAA 4AF9A 4XJUA 4URTA 4JDMA 2XG3A 5D8AA 3OBTA 2UWCA 4FXGB 1IOAA 4KGQA 4AVBA 5KHKA 4MLOA 1D0HA 1ENQA 1WMFA 1AUYA 1V6MA 2XBO1 1H9PA 2BNMA 2IXHA 5JR7B 2Q5TA 4DXZA 3JB8A 3WP3A 1OMIA 5CU1A 4WVMA 1XYNA 2R1BA 3IKWA 2CL2A 2SLIA 4AVSA 2EF6A 4XJ8A 3R4UA 4JGYA 4CEYA 2RS52 2ZACA 1WD3A 4YYOA 1IS3A 3NAPC 3WP4A 4MUVA 2PYTA 1JN2P 2RM21 4IEPA 1APNA 2ZBJA 3H7YA 4W6WA 3WLUA 3WG4A 2QUOA 3WW1A 2JG8B 3PTYA 3CJIB 1XRUA 3GHNA 4A3XA 4FPEA 5DUXA 1IZ3A 1QWRA 4JVAA 1CAWB 2N7GA 5L36A 3PVOA 3I59A 4ASMB 1RUC1 1HIXA 2DVAA 3JD73 3TN91 1I1EA 4LT5A 2XPJA 5DDJ1 2VMHA 4DRRA 1YCIA 1RUI1 1LOCA 3WR0A 4YGBA 5C33A 1GZWB 3MGUA 4HZFA 2A6YA 1PVC3 1BVP1 4CEYC 5AC92 1MS0A 1POV0 2H6BA 2R061 1XNKA 1QH6A 2VU9A 4FPCA 3FUQA 4Q29A 4DZGA 1NA1A 2K2SA 4N9IA 1O3QA 3ZFEA 1DLLA 1Q3EA 4N7UA 1Q56A 4XHBA 1A3KA 5FMOS 1QHDA 1RUF1 2XJTA 4LLOA 5ACA3 1W2UA 4DRVA 5C8CB 2PAMA 1F2NA 1AR92 4MX3A 3G6JB 4QPIA 4WVVA 1VBD1 1N1SA 4FPKA 1AR63 1W0OA 4R9BA 4XFAA 1RC6A 2PLV3 3EJKA 4Q0UA 4AEKA 2FZ1A 2PHFA 3NAPA 2R042 1AYN2 1Z7S1 4QQOA 2JEMA 4FTSA 1H2LA 3H9AA 3V56A 3USSA 3S6PA 1RUE3 1CVNA 1W6NB 3I7DA 3ECQA 4I3PA 4AQTA 4AFAA 2UU8A 2DVBA 1IPJA 1RITA 1RUF3 2HWB1 2DYCA 2VOKA 1OD5A 4J1WA 4P14A 4Q2FA 1VBB2 2H6CA 4ATEA 5AFBA 3ZN4A 1EAH3 1WLDA 3AM2A 4UW3A 2DVDA 4AFMA 1HDKA 1AL0G 1JBCA 2PELA 5DXDA 1EY2A 1M06G 3PVNA 2WNVB 3E5QA 4R52A 1J3RA 3BALA 1OI6A 3KB5A 3N7LA 1Z7S3 3FHIB 4OI2A 3VKFC 2E7TA 4JC1A 2JD4A 4CDQB 3IDCB 4UXAA 1TMF2 2UWAA 2FZ2A 3EHKA 2C5DA 5JOYA 1LHVA 1PO21 1DZRA 1MACA 2PAKA 5J7MA 4AEJA 1LHWA 1VBE3 2ZGSA 4YZ1A 4BHPA 1PGW2 1PZ9A 1HRI2 2ZGNA 2RS31 1PIV3 3GALA 4IV3C 1JTZX 4KWLA 2NN8A 2D3PA 1J3QA 1QJZA 1UU5A 2GZWA 1QMJA 5I8TA 2JG9C 1V9U2 1JYIA 1V6JA 1RHI2 1I6XA 4RR3A 1QNWA 3LSEA 4AFDA 1R081 4WM7B 2VW1A 3TN92 3BCWA 3H7JA 5DUVA 1RUE1 1U5XA 4U2AA 3RMXA 3JQWA 3I59B 1VAVA 3V64A 2R49A 5FPXA 1J59A 4AYUA 2OA2A 1AX1A 3AK0A 5DG2A 3NO8A 4LO6B 2WT1A 5KXCA 3O5SA 4BIOA 5A32B 4L11A 4DFSA 5BNPC 2ZA9A 5T3NA 3WG1A 2AREA 2CV6A 3PVBB 2UY9A 4L92A 3VZJA 4XYXA 3WDUA 2R1DA 5B2GB 4KBBA 4YZ2A 4Q0SA 1ULCA 2R32A 2ZZQA 4P9LA 4IV1C 3GZTB 4X8PA 1YFXA 4AEDB 4YFWA 5FQ0A 3OTFA 4AI0A 1O3TA 4AE2A 3VDDB 4D7SA 4DNYA 3A0NA 1QU0A 4Z92B 1Q43A 3RDIA 4CEWB 3PLQA 1L3JA 1OQEA 4M3CE 4M0NA 4E9KA 1PO23 4FQZA 4AVAA 4NPRA 1AR61 1RJ7A 2D3RA 1DQ1A 4LBLA 1H0BA 4AEDA 2E7QA 1AYM1 2HWC2 1O3RA 3TBDA 3SHRA 4RR3C 1LOFA 1DG6A 4NHKA 2HWE2 4Y22A 4E27A 2JJ6A 4RS5B 5CFCA 3FZ3A 4AFCA 5D8AB 3TWIA 1VBA2 2A70A 3ZPYA 4BCUA 4OFGA 4P9YA 5EJ3A 3V0AA 4AVTA 3NKTA 1DZQA 1KITA 4YVWB 3KT1A 1VIWB 4DQAA 1PIV1 3DKWA 2XJQA 3M3CA 5T5JA 1H4GA 2ARBA 4IEOA 5LK7B 3FLRA 2WA3A 2G9GA 1VBC2 1B35B 3H8UA 4YFZA 5IK8A 3CLPA 4S2FA 1BVVA 1W0PA 3WDTA 3B9CA 4F7ZA 1RUNA 4F3JA 4XOGA 4N53C 4Q4W2 5CG9A 5IK4A 4M3CA 2P3IA 2QVSB 2VGDA 1DGRA 1JYCA 4TYSA 3WV6A 4LHNA 4LBOA 1JXNA 3AKPA 4LBJA 1D4VB 4RQPB 2GC1A 3ST7A 1VBC3 4GQ7A 4XBLA 5FMOL 5JIUA 4HPKA 4IEXA 4LULA 2BWAA 5T50A 5KWRA 3X29B 4LLFA 1W6MA 1ZZ6A 3ES1A 3IWZA 1NLRA 1YYNA 3VZKA 4YNIA 5L7OB 3KD4A 1CX4A 4AW7A 2GDFA 2ENRA 4GULA 1CIWA 1QQP3 4MSVA 3JD71 3CNAA 1LOGA 5C8WA 2Y0IA 4JGZC 1GZ9A 4B8EA 4GMP0 1RUF2 1OQDA 3RPQA 2VOWA 4I02A 2R063 1TNRA 2CTVA 3J8F1 1RUOA 5JSPA 4IV3B 1NOVA 2FMYA 1LKNA 2MEV2 2R6QA 3N7JA 5D8AC 5FLIA 4BM8A 2DTWA 4QQHA 3VHOA 3IPVA 2AR6A 1GFF2 3BPZA 1VJ2A 4KNCA 2C9AA 1TME3 3O7OA 4FAHA 3VBFA 5LRSA 1ZVFA 2O8OA 2ZHMA 3WDYA 3AB0A 2UURA 4META 2VVDA 2ZKLA 1YJKA 1CQ9A 3OJBA 5CB7A 3VBOC 3OGGA 2KXLA 2ZMNA 1QJX3 1S0JA 2E51A 4QPIC 4XZPA 4LR4A 4OULA 3GF6A 4NWWA 2AENA 3VHNA 4XDQA 1EV13 1O4YA 2VNOA 2XL7A 4YGDA 5F6KA 3A0KA 2EXHA 3C3VA 4YARA 4E4DX 1CESA 1AXKA 1BXHA 3E6BA 5CA6A 4JCKA 3DPRC 1OHFA 1PZ7A 2YGLA 4IEUA 4CDUC 2JE9A 1AR73 2WNVC 2AH2A 1NY71 4IEQA 4L99A 1VAKA 2I2SA 2O1QA 4JTNA 4TLFA 4BPZA 2BFUS 5K8SA 1NE6A 2XBO2 1DFQA 4Z8BA 2Q4SA 5C4WB 4IERA 2WNUC 2IC1A 3RSJA 1KJRA 2BNOA 2FMDA 3OD4A 5T5PA 1DQ2A 1QJU2 4ES9A 1V70A 3GHMA 5D1IA 1D2SA 2A6WA 5GKAC 1MVQA 2EALA 1RUJ2 3ZYIB 4CDXB 3R4SA 5H9RA 3WG3A 1K5MA 2JG9B 4NWVA 3ILNA 1I5ZA 1VRH3 5KC5A 5CVRA 3WZ1A 3AX4A 3I54A 2PFWA 3I4IA 4EJRA 4K20A 4RS5C 1RMU2 4CZSA 2PLV1 1JUHA 3U10A 5J48A 2ZX3A 4RR3B 2WINB 4S2HA 1VBD3 4XTPA 1B35A 1SCSA 1ZZBA 1FMD1 2W52A 5EZWA 1WD4A 2Z69A 3WP6A 1A78A 1AZDA 5FDBA 2Y38A 4Z2WA 1Q8VA 1EAH2 4RL7A 2JG9A 2GSYA 2NLRA 1H8TC 2ZGRA 1Y7BA 5E16A 1QJU1 2CAUA 2B42B 4CEYB 1PGL2 2D6LX 3TAYA 3VL8A 2E63A 4AQ6A 3ILFA 3L2YA 3B02A 1QJX2 1ZYBA 4CEWC 3OGJA 4JV4A 1RUH3 1D0GA 5K7PA 1RUD3 5BNNB 2YV8A 2KA3A 1Q8QA 4K40A 2ZTNA 4CDUA 1KXGA 2WA4A 2ZGLA 1S0CA 3HQXA 4JGZA 1SQ4A 3ILRA 5J09A 1SLCA 1IS4A 4IEZA 4R4ZA 3ZXAC 4EN6B 4ZU7A 3MW2A 5HBAA 1LGNA 5FO7B 5CFDC 3ROUA 4EROA 1Y9QA 1O3SA 2YMZA 2PHTA 4DMIA 4EV0A 1C3HA 1W6OA 5JZGA 4QGMA 1OPMA 4XQDA 1QOTA 2GNDA 1ND2B 4I3GA 2NZ9A 3MLKA 4ASLA 3VBUB 3PMEA 3RNSA 2I45A 1EPWA 2RJLA 4H14A 3FUOA 2D3SA 1PMIA 3ZXDA 2HWC3 2P17A 3JQXA 4FPJA 2RMU2 4WZFA 5AC93 1OOPA 4Y26A 3VBHC 4D7YA 1W6OB 3J8F2 4GMP3 5JZGB 4K8FA 1AF9A 5A3LA 2GC3A 4QPIB 2ES3A 2ZCWA 3R4DB 5T52A 3WVJA 2XH6A 2R043 1LECA 1GQGA 1VB4A 1J1TA 3FMGA 4CDWA 1ENSA 3VBUA 2XVGA 1A8MA 1O4ZA 4W6XA 2JENA 2WLQA 1D4M1 2TNFA 2W0XA 4ITCA 4ZU5A 2XJVA 1DIWA 3KCYA 2WNEA 3ZIXA 4OHVA 1YI7A 2TEPA 1PK6A 4LBKA 1O7FA 3NWKA 2PHDA 4XFGA 3J9SA 1SDWA 4CRQA 2RS53 2GMPA 1C4RA 1HX6A 2R072 4GKYA 1MQTB 1HRI1 3BODA 4LA3A 2IFRA 5I93A 2GMEA 1MZFA 2RM23 3MLLA 3WQ7A 5C9AC 3WINE 3WOGA 1REEA 4D69A 4O9GA 2R041 4HK9A 4AK3A 4P9GA 4CDQC 4C0BA 3AP6A 3THTA 2A7AA 2WL1A 3O0VA 1FT9A 1TE1B 3IT8A 3NKGA 4GKXA 1MS8A 2D97A 5BNOB 2DCKA 2WFF1 3MYXA 2B39A 2G9FA 3VBFB 4HVOA 1K5MB 4Q4X3 3FJSA 2ET1A 1URXA 3JZVA 3JBG3 4DY5A 1BBT2 2CGOA 3HN1A 4WM8C 4MGIE 4CP2A 3OBRA 4K21A 4YW2A 3MEPA 1CJDA 1NZCA 3FFQA 1XXNA 4AQSA 1U12A 1NA1C 1AYN1 3POYA 5JOZA 4FQ4A 4QQ2A 3SH3A 5L73A 2E9QA 3KGLA 4NO4A 3ZVXA 1CAVA 4BMEA 5DZEA 4Q8KA 4N43A 4YW5A 1GZCA 1COV1 1XNBA 4ORFA 4FPYA 1G6NA 5J3UA 5FCCA 1TEIA 2VPVA 4HN1A 4MVTA 4P9XA 1UL9A 3KSCA 4KG8A 1NQDA 1BEV1 1ZX5A 4RQPA 3B93A 3FE5A 1N3PA 3AYAA 3D0JA 2XLGA 4XFCA 4ZKTB 2YPJA 2IXJA 1VR3A 2VW2A 3P3PA 1BEV2 1WCSA 1Q5OA 1BBT3 3MIBA 1YRZA 1R1A2 5CAZA 2XJSA 4H55A 1PK6C 1SFNA 1KS4A 2WNVA 2R0HA 5HCBA 4IV1B 2A6ZA 4JDOA 4CTEA 4OHWA 1C8M3 1R082 2XKPA 2QNKA 1MS4A 4X6QB 1QGLA 5IT6A 2RMU3 1W6PA 4RGGA 4L2NA 1MEC2 1AJKA 2OPKA 3VZMA 4PLMA 3E5XA 1ZREA 1DDLA 5JCTA 1X50A 4X8NA 2A75A 4BOWA 3IIAA 1D2QA 1ZRRA 1V6IA 4GB33 3HD8B 4HETA 2QE3A 2BPA2 4XQ4A 1NG0A 1AL23 2X5IA 2RE9A 1FOD2 2RM22 4UW5A 4XW3A 3ZSEA 2RS12 3PVEA 1BZWA 4LNVA 1FI2A 3W58A 3HT1A 2YGMA 1C1LA 2P2KA 4E2GA 5BV6A 5A33A 2RR13 2GAUA 2D6OX 1PM7A 1FV2A 3NV4A 3CO2A 1Y43B 1AXYA 1FPN1 2ZAAA 4XFBA 5GLTA 1SBDA 1GZWA 1XE8A 2JECA 3ELNA 4E2QA 5EYYA 4PJYA 1C28A 2XUMA 4LTAA 1W6QB 5LEKA 4M3CB 4PIZA 1CAUA 4LA2A 4PF5A 3K48A 4SLIA 4I09A 5ACA2 4HN0A 3SNMA 2YUEA 3JCIA 4AVCA 1REDA 3TYJA 1RTVA 1V6LA 3CJXA 4N90A 5I0UA 3MPPG 2NMOA 1DZTA 3N35A 4FAGA 1CR7A 4XJ9A 2F4PA 2PHWA 2WQZC 2ARXA 1N1TA 2UWBA 4AEMA 5FREA 1FNYA 4COYA 2BQPA 2ZGOA 2ILMA 4Q4V2 1LODA 3GBWA 1ULFA 1E57A 1K5MC 1O5UA 3MF6A 2ZX1A 1DF0A 1LGBA 5FOJB 2GN3A 2X5IC 2YROA 1S1AA 3PJYA 3ZO0B 4WM8B 2GH2A 1LENA 1C8M2 5E1RA 2ATFA 2HWE1 1X8EA 2NQYA 1FMD2 4IL7A 5I0SA 3GBFA 5GALA 3VZLA 2NMNA 4K1YA 4Y5Z0 3USUB 1DGWA 1AR62 4Q0QA 4XMIA 1ASJ3 1CAVB 3RWNA 1LU2A 1KRIA 1MEC1 1AXZA 1CJPA 5JDBA 1H1AA 2XJPA 3AP7A 5T5LA 5EV7A 5JAXA 5JPMB 1BEV3 4C90A 3B01A 4JDNA 2C0ZA 2K9ZA 2XJUA 2WZR2 3WNXA 1WW5A 4V1PA 5GLWA 2WSUA 4XILA 2FHRA 1NYWA 4XFFA 3LAGA 1IS6A 4PIYA 1LHNA 4LBMA 5C9AB 1S0IA 2B5HA 2DCZA 4FPOB 3ZSJA 1GNHA 3D6EA 2PN5A 4K7JA 3URFA 1VAMA 4I0AA 2NP0A 5CFDA 3WD5A 3VBOA 1ENRA 2B9UA 1POV3 1FNZA 1GR3A 4AI8A 5H9PA 1RUG1 1CPNA 1LOEA 5FLHA 4J1XA 4WM7A 4Z07A 4YM3A 1S0BA 1EAH1 2XLFA 4FOVA 4R9DA 5F6LB 2AZ5A 2QCSB 1EV11 5FOBB 4OHZA 3AP9A 4HBNA 1IPKA 2R0FA 2OYZA 3RS6A 1AYM3 3UL2A 5LK5A 4DS0A 1GICA 1S0EA 4EWDA 3VKNA 4MV2A 1GANA 5A33B 1OLQA 2GN7A 2VQAA 2VNRA 5C8CA 1QJY1 4FP2A 1RUG3 3V0BA 1TME1 1FYUA 2GH8A 3M3EA 2GC0A 3WG2A 4M3CF 4CDWB 2CAVA 2DUQA 1RL3A 1PHMA 3W59A 1AR83 2MEV3 3B5LB 2NM1A 3O14A 1HKDA 2OIIA 2HEVF 3VBUC 2RJKA 1LRHA 3J8F3 4XF0A 1YFUA 3J4UH 4PBPA 1GBGA 4UBHA 1R1ZA 1QNYA 3ZFFC 3KT4A 4QXKA 1WCKA 4ZU4A 1H2NA 4NOTA 1VP6A 4Y1XA 2JX9A 2BYVE 4XJZA 4EN7B 3H0OA 4N53B 5GLVA 3NVCA 1OKQA 2WNUA 4FPGA 4IQPA 3DGTA 1B35C 1IKPA 3I8TA 2XJRA 1AHSA 1DHKB 2WS93 2ZS6B 1V6KA 4BYYA 4KQ7A 1N3OA 2LALA 4O9EA 3M3OA 4W6YA 1MS5A 3L9JT 3FBYA 4BH9A 4YSFA 3RJRA 2VXRA 5BNNA 1DQ4A 3OCPA 1UIJA 4FCAA 4HKOA 5HCAA 2Z79A 4LBNA 1OFNA 1ULGA 5JSRA 4I01A 3M4FA 4U36A 3UV9A 1WBFA 4QT6A 3N7MA 4WM8A 2BTVC 4F83A 4E2SA 2CNAA 1QKQA 3A4UA 4JTOA 1CGPA 4FOWA 4H7MA 1ULDA 1J1LA 2X53S 3POSA 2V5YA 4WVZA 3FFZA 4LO8A 3AMPA 3Q9OA 2IWGB 1CD3G 3ZN6B 1S2KA 3WHTA 2WNUB 2VMGA 4NHMA 3VKLA 4N7IA 5DG1A 1RUC3 4CDXA 2JG8A 1AR71