1XNFA

Crystal structure of e.coli tpr-protein nlpi
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
KSEVLAVPLQPTLQQEVILARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein nlpI
publication title The crystal structure of NlpI. A prokaryotic tetratricopeptide repeat protein with a globular fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xnfA00
5FZRA 4W9RA 4I17A 3TGOA 1PC2A 1QZ2A 4WUYA 4BTBA 4U07A 2VSNA 4AM9A 4GA1A 5FZQA 3CVLA 2E2EA 3UUXA 3PDNA 4IN3B 3KD7A 4BWRA 3K9IA 4G25A 5BNWA 4UI9J 3LKUA 4GPKA 3LPZA 3S7DA 5JJ6A 3ZGQA 4HOQA 2XCBA 4XI0A 3CKBA 3MKRA 3KAEA 5CHEE 4YNDA 3ASGA 2NC9A 3GW4A 2PQNA 3TAXA 3QWWA 4CGWA 3S7BA 3WXXA 2UWJG 3Q5MA 3CVQA 4J0UA 4JA7A 4J8FA 4UQXA 1OUVA 3EDTB 1NA3A 4I2WA 4XI9A 5ARGA 5FZSA 2FO7A 4H7XA 3TG5A 2BUGA 2LSUA 3ZPJA 4H7YA 4N3AA 4KXKB 4N3CA 4KBQA 5FT9A 2R5SA 4AY6A 2FF4A 1IYGA 3Q49B 2C2LA 5G04C 5BT1A 3Q15A 2YQ8A 3ZHEA 2ONDA 4N3BA 5BW8C 1ZBPA 2IF4A 2KATA 2LSVA 3GYZA 3LY8A 4G26A 3RU0A 2XCCA 3ULQA 3OXFA 4U0SA 3CVPA 4GA2A 2J9QA 4KYOB 2FI7A 3MV2B 5KJKA 5ARFA 5EX0A 1WAO1 3CEQA 3RJVA 5AYWD 4I9CA 3TG4A 2KC7A 1XNFA 4GYOA 4NQ0A 3ASFA 3CVNA 4CGVA 4WNDA 2VGXB 3N71A 1E96B 5JJ7A 2XGOA 3U3WA 3RIBA 5D0QD 1QQEA 4NRHB 1NA0A 3ASDA 4WNFA 2FBNA 5LCWC 4Y6WA 3CK8A 2PZIA 3FFLA 2XEVA 2FEZA 4HOSA 3RO3A 2L6JA 5DIZA 3GZ2A 4GZ6A 2AVPA 4EQFA 4GCOA 4BT8A 4G1TA 4JA9A 5DBKA 3Q47B 2C0MA 1WM5A 2UY1B 5KJLA 3ASHA 2KCKA 1ZU2A 3GZ1A 4G24A 3SF4A 3UPVA 5LCWJ 3OXGA 1Y8MA 3RO2A 3PE3A 4JL0A 3ZN3A 3UQ3A 2VGXA 5CCLA 2HR2A 2XPIA 3QDNA 2VSYA 3CK7A 2HO1A 3ZFWA 4GYWA 1B89A 4I2ZA 4AIFA 2WPVA 1HZ4A 4WNEA 2GW1A 5M72A 3NF1A 4J8DA 4XIFA 3VTXA 4N5CA 3U4TA 1IHGA 4WNGA 4U0ZA 1KT1A 3CV0A 4Y6CA 5KJMA 2OOEA 3VTYA 4G23A 4F3VA 5FJYA 5HI7A 4GZ3A 3FWVA 4UQZA 3S7JA 5FTPA 1P5QA 2UY1A 5G04J 4J8EA 3MV3B 3MEKA 3AS4A 4O6FA 2VQ2A 4G2VA 2VYIA 5D0OD 4GZ5A 1HXIA 4HOUA 4BT9A 4APOA 2WQHA 2YHCA 1A17A 2I6HA 4JHRA 4UI9K 3BEEA 3LYAA 3ESKA 3FP3A 5A7DB 4HORA 1FCHA 4B94A 4ABNA 2VGYA 4YVQC 2C0LA 4U04A 3ZHEB 3SZ7A 3CK9A 3E4BA 4N39A 5JJTA 4YVOA 2DBAA 1KT0A 3S7FA 4RG9A 1HH8A 1KLXA 4GYYA 2XGSA 1YA0A 2LNIA 5EKQD 4UQYA 3LY7A 4HOTA 2Y4UA 3QKYA 3O48A 5CCMA 4U0UA 2Y4TA 3OXLA 1ELRA 3R9AB 2JLBA 4N2QA 3PE4A 3AS5A 2PQRA 5A6CA 2PL2A 5G05C 1W3BA 3KS2A 2MHKA 3HYMB 3QOUA 3LY9A 4ME2A 3LCAA 2HYZA 2V5FA 2XGMA 1ELWA 2KCLA 4LEUA 1TJCA 3RKVA 4I1AA 2Q7FA 2P58C 1NZNA 2IFUA 4N2SA 3QWVA 4BTAA 4CDRA 3IEGA 3MA5A 5HQ8A 5C1DA 5KJNA 3CKCA 4GA0A 5EX3A 4GCNA 3Q4AB 2KCVA 4RG6A 4I9EA 3JYSA 5G05J 3QWPA 4A1SA 3URZA 3AS8A 2QFCA 4UI9C 4AY5A
chains in the Genus database with same CATH superfamily
3HXFA 3G2WA 5LFAA 4A3VA 2KXPC 3UT7A 5AQ9A 4DX2A 4MKTA 2V4HC 2R2LA 4JVSA 4WUYA 2VSNA 4G11A 1H19A 2GRQB 2LUHA 1UN9A 5AN8A 3CVWA 2BKGA 3J5QB 1QYMA 5ENOD 4FA6A 2Y0BG 1MX6A 4G25A 1QNFA 3LKUA 4GPKA 2GRLA 3UM2A 4ILHB 4CDMA 3D9NA 4L2YA 3DSXA 1TR4A 3SI5A 3MX3A 4PS8A 5ENSD 2RD0A 3LXUX 5CHEE 4OVVA 4GB9A 3NOGD 3ASGA 2NC9A 2VJ8A 4BFRA 3TAXA 1SA4A 3QWWA 4CGWA 2KZTB 1U3DA 1WDYA 5EN5D 2J8SD 4ILGA 4HFGA 4FHKA 2UWJG 3C3QA 1SZ9A 5ENNA 2CHZA 3AG1E 2DWZA 4TUUA 4HBDA 2J4BA 4KVOA 2WXOA 1OWLA 4H7XA 3UKUG 1DCEA 2L9BA 3TG5A 5AQBA 1O1SA 3SBTB 3PZ1A 4H7YA 4LNUD 2GRMA 2VTBB 1BPOA 4KXKB 3FDHA 4I43A 3MKQA 4N3CA 4KBQA 2IO2C 5A23A 3PZ2A 2R5SA 3JQ0A 5BPPA 5G04C 3SGHA 3ULEG 5LOZA 3ZHEA 3P1UA 2KATA 5FQ7A 3LY8A 2XCCA 1E7UA 4GAAA 2EIKE 1IQRA 1UN8A 2L6BA 4G8KA 2AWIA 2BEDA 2J9QA 1SW6A 4KYOB 5AJDA 2X6HA 3T5VA 5KJKA 3EJNA 2P9IG 2YHEA 3NZSA 1FT1A 5ARFA 3SD5A 3ASOE 4XE0A 3ENEA 5AYWD 4U95D 4I9CA 4CYMD 4BSZB 4LUNU 3TG4A 2KC7A 4K5BA 2MRIA 3DSUA 1TYQG 4HRMB 4NQ0A 3AG2E 2ETAA 3HVEB 3CVNA 4WNDA 3IV0A 1BLXB 3G2TA 4U8YD 5JJ7A 3APDA 1O1RA 3UINC 2XZDG 4K5CA 2V8SE 3CLJA 3RIBA 1QQEA 2KBXA 1NA0A 4KT6B 2DCPA 5EYPF 2Y3AA 4KZ0A 2F37A 3RRMB 2XEVA 3D9LA 4HOSA 1K8KG 5CBOA 3ZYLA 2ZGDA 3GZ2A 2AVPA 4EQFA 4JZYA 4E85A 4JA9A 5DBKA 4O1PA 3Q47B 2C0MA 3PRZA 3FTZA 3RK6A 4OYSA 4K0RA 4U96D 2DZOA 2X6JA 3SF4A 3OXGA 4EZLA 2AW6A 3VLDA 3UXGA 1Y8MA 3RO2A 3PE3A 4BERA 3APCA 3ZN3A 2OVBA 2HR2A 4GTQA 4O1OA 1TN7A 2VSYA 5JHAA 2HM8A 5KCMA 3ZFWA 4J8YA 1HZ4A 3NZUA 3ONKA 4J8DA 2IO3C 3G2VA 2OVFA 2JABA 4MRUA 4B8CB 4N5CA 3TJPA 2GROB 2A5EA 2WXIA 4A63B 3R7QA 4CDNA 1KT1A 3KSQA 4ILIA 5HRYA 3KEAA 4PS7A 4RQIA 5KJMA 3D9HA 3UM3A 2OOEA 3MJWA 4DJAA 5HI7A 2QYJA 4UQZA 3S7JA 1ZB1A 1DCQA 3UM1A 2QYUA 3MEKA 3L08A 3AS4A 4OVUA 2E0IA 3TL5A 4XX5A 2VQ2A 4G2VA 2WXNA 4GU5A 5D0OD 2J08A 3EHNA 1K1AA 4APOA 4A3TA 3CIAA 4A1GA 4JC8A 1UG3A 1E8YA 2XS8A 2P9UG 4LNGA 3MKQB 1OWPA 2GGFA 5A7DB 3WG7E 1FCHA 4C0MA 3MCXA 4B94A 3ZRHA 3NBNB 4YVQC 1N95A 2ZXWE 2C0LA 1N4PA 2AXZA 4YDOA 3ZHEB 3CK9A 1N4SA 3RSEG 5JJTA 1KT0A 3V31A 1HH8A 1BU9A 3IHYA 4GYYA 3NAWA 5EKQD 4RLYA 4UQYA 1HX8A 3LY7A 4HOTA 2VSXE 3AJIA 1YMPA 3T5XA 5CCMA 4V3IA 5B3SE 3OXLA 3R9AB 3E34A 3V2OA 1Z3XA 1H2VC 1N4RA 1DC2A 1LTXA 5EYLA 3AS5A 4DLQA 1INZA 3D9PA 4TXQA 5CECB 5CEDB 1W3BA 4ME2A 2QY7A 2XGMA 4GTMA 1ELWA 1X5BA 3AU4A 4FJZA 2X6KA 2QC9A 3DXKG 2FO1E 1TJCA 1SZAA 3PEVB 4A55A 1L5JA 2KM4A 4F6RD 2J49A 3IEGA 3DSSA 3FTYA 5C1DA 3UIPC 3CKCA 5EX3A 4GCNA 2KCVA 3L17A 3UTMA 3VLFA 4APFA 5G05J 2XEHA 3QWPA 4MLPA 4P29A 4A1SA 4G8LA 4KMOA 3R7RA 3AS8A 1ELKA 4UI9C 4AY5A 5LP0A 2WQ6A 4W9RA 1MZCA 3CHMA 4I17A 4AEZC 4M7CA 3TGOA 1EDUA 1NL4A 3UMVA 2P9NG 3EIJA 4HNAD 2WXPA 4ATZD 3TWRA 3HG0D 2B6CA 2OCCE 4EBAG 5BV0A 2LXLA 3DSWA 4BWRA 2CG2A 1G3NB 2X38A 3K9IA 1TNOA 2HE0A 2GRPB 3S7DA 3CHRA 4ANVA 3BG1B 1IQUA 2XCBA 1X81A 3ZYQA 5CEAA 4CT0A 3CKBA 3Q9UC 3PS6A 1HU3A 4I6EA 3ULYA 1E8WA 3E33A 3GW4A 2I9CA 2FULA 2DVWA 2H6GA 4L9PA 2LO6A 3WXXA 4EPZA 1MX4A 5FQ4A 2EILE 3B7BA 2DYRE 4J8FA 1DVPA 3CVVA 2IONA 4JEUA 1NA3A 3QARA 5FZSA 3HXEA 3FTXA 1AWCB 2BTDA 2FO7A 2V4LA 3ML8A 4DRXE 2OV8A 3NB2A 1Y6IA 2H6HA 3E30A 2YNQA 5FT9A 2R03A 3QK0A 3U66A 4AY6A 1TN6A 4QQIA 2FF4A 5J90A 2ETCA 5BT1A 3LVRE 2WXFA 4FULA 2LSVA 3RU0A 4X8QA 3ULQA 4UWKA 4GA2A 3R9MA 1QBQA 4JHKA 2ZIRA 3LJ3A 3Q73A 1UOHA 1PAQA 2DIWA 1H6PA 2P9LG 4BETA 5JA4D 2RFMA 4CZ2D 4WWOA 3ASFA 4YDEA 2AXUA 2VGXB 1IKND 3FUHA 4DLOA 4ZFHA 4OAVB 3HHMA 4QFVA 3CHQA 5D0QD 5AIJA 3FUKA 4NRHB 4I1MA 3ASDA 1BI8B 1K1BA 4U8VD 4ACLA 4B0ZA 4WNFA 3UKRG 4B8AA 2FBNA 5AAOA 5LCWC 4AXHA 4ACKA 4TUMA 3FFLA 3FY4A 2L6JA 2WXQA 1OWNA 5DIZA 2XPZA 4F1SA 1OT8A 5BUZA 2UY1B 5KJLA 5ANLA 2ZU6B 3ONLA 2WM9A 3GZ1A 4G24A 3TWXA 2V5QC 5EIBE 3C5RA 4JL0A 3TWQA 3UQ3A 3Q79A 3UT4A 3CR3A 3Q9NC 1LD7A 3QDNA 3CK7A 2HO1A 3LS8A 3UIOC 2WPVA 3SHFA 1V55E 2IEJA 2YINA 5CMYA 5E76A 3F6QA 3FUNA 2WXGA 2MYOA 3FUFA 1YYHA 2NXPA 4Y6CA 2J09A 3PUJA 5FINA 4OAUC 4G23A 1E8XA 1TNUA 3FTUA 3D3MA 3IKOB 4DPRA 3FWVA 5KNHD 5FTPA 1P5QA 2J07A 2XRZA 4HB5A 2IOLA 4ATGA 4C0EA 3DPDA 5D66A 3SO8A 4ANXA 1EPUA 5T4YA 4BT9A 1UW4B 3CQCB 4JPSA 3ESLA 4GTSA 4K5AB 4PDXA 3NOCD 4JHRA 4HRNA 1DNPA 3FH5A 1VDYA 4BX8A 1OXJA 2I2OA 4FADA 2L0IA 3FP3A 3BQOA 4Q94A 4Q96A 2I1JA 3PVLA 1Z6TA 3SQVA 3J5PA 3UX4A 3S2AA 2M63A 2LNIA 4F53A 2WXLA 1N4QA 2Y4UA 3L13A 3CHOA 4HRLA 1N0QA 1WG0A 4YDWA 4XKCA 4GTOA 3W9GA 5A6CA 5AQAA 2PL2A 1N94A 2MOWA 1FT2A 3HYMB 3QOUA 1MHQA 3AG3E 3LCAA 1JCQA 4FLBA 3L9TA 2BKKB 4I1AA 2Q7FA 3QWVA 5HQ8A 5CRUA 2IOSA 4I6JA 3VLEA 3Q4AB 4HQDA 5HS0A 3TWUA 4LRZA 5BV1A 2CHWA 3T8KA 4C9BB 1IXVA 4LNBA 3ZKJA 1FVFA 3Q7AA 4GTRA 3ZYKA 3ZIMA 2R59A 3RAUA 1PC2A 4M3OA 5FZQA 3ZXPA 3CVLA 5FWQA 5AJLA 2E2EA 1SQMA 3JXIA 2VSOE 4IN3B 3G2SA 3EHRA 5LX8A 3I5PA 1SA5A 4UI9J 5AENA 5JJ6A 3ZNGA 4LERA 4HOQA 3FTWA 2A5UA 5ENPD 4XI0A 2OEWA 1XGWA 4FC8A 5JHBA 4JD2G 3MKRA 4TXPA 3ZW3A 3KAEA 3ISMC 1O5MA 4JEHA 3PNLB 5IY5E 3UI2A 3FEXA 3DEPA 3I4RB 5EILA 2DYSE 3IBEA 2IQCA 3RRNB 5JMND 3S7BA 3E32A 3I4GA 2H6FA 4Z68A 5CRVA 4JA7A 3EHMA 2P9SG 2OEVA 4UQXA 3PZ4A 1OUVA 3EDTB 1S70B 1H0AA 3GZSA 4UWHA 5FQ6A 3HIZA 4LG6A 2BUGA 2LSUA 3ZPJA 4N3AA 3ZVVA 3UT8A 2XRYA 2I1KA 3SY2A 3JUIA 2CFZA 4JB8P 1MQSA 3TXMA 1IYGA 1JUQA 2IJGX 1NFIE 1H6KA 2YQ8A 4HLLA 2ONDA 1N11A 1E90A 1ZBPA 3CVUA 3GYZA 4DX5D 3JUEA 4G26A 3MYVA 1H2TC 1BI7B 4U0SA 2KZTA 3C3OA 2RG8A 4DX6D 4TXRA 3MV2B 2P2CP 3V30A 5EX0A 1WAO1 3CEQA 3RJVA 1OCZE 3JXJA 4AP2A 4EZJA 1EYHA 4GYOA 2BF0X 4CGVA 4O60A 3N71A 4GMJA 4CCAA 3EHQA 4TRQA 3U64A 5ENTD 4JW1A 3AAAC 2GRRB 3V2XA 4PS3A 3PZDA 3ZYMA 4WWPA 1KPSB 3L16A 2NYJA 4B93B 3QJZA 4Y6WA 2PZIA 1JCRA 5FQ8A 1HG5A 2FEZA 4MBGA 2WXJA 3W9FA 4GZ6A 5ENQD 4GCOA 1WY6A 4FHJA 2RKKA 1GW6A 2P9KG 3B13A 1N9AA 1WM5A 3DSTA 3X2QE 3P2BA 1N54A 1KZPA 1AP7A 2KCKA 1ZU2A 4DK5A 5T8IA 3UPVA 5LCWJ 4KZCA 3DSVA 4L7TA 2XEEA 1K3ZD 4GTTA 4JXTA 5ENRD 2XPIA 3DWLG 4RSYA 1B89A 2IU1A 3LEWA 4WNEA 1OCOE 4HXIA 5M72A 3KSLA 2ETBA 2P9PG 3PREA 4XIFA 4FJYA 3VTXA 3ML9A 2F8XK 2J4DA 3U4TA 2R17C 4WWNA 4NACA 5KNGA 1RW2A 2EQXA 3VTYA 3L82A 5FJYA 4D10C 3QC1A 2CG3A 3G2UA 2LXMA 1OWMA 1D8EA 2LAHA 4GZCA 5G04J 4J8EA 2Y69E 2QZAA 3TWTA 4Q69A 2EINE 4IULA 3DEOA 4GZ5A 1U2VG 4AOFA 1HXIA 5B1AE 3CHPA 1NP7A 3B7SA 2WXHA 1TNYA 5AQ7A 3MZLB 2YHCA 3FH7A 4GPMA 2LAIA 4FU3A 3BEEA 3C72A 3B95A 3C3RA 4U8HA 3T9KA 1RZ4A 4ABNA 2AJAA 2VGYA 2X6FA 3SZ7A 1HF8A 3E4BA 3FU0A 4DX1A 4YVOA 1EF1C 4RG9A 3HXBA 2XZTG 3FU5A 4ZHBA 1KLXA 1KZOA 4XEIG 3PEUB 3T8MA 3QKYA 3O48A 4AV7A 4U0UA 4UWFA 1S0PA 1ELRA 2JLBA 1TNZA 2WVIA 2PM6A 4N2QA 5CBNA 3PE4A 4URKA 3ZU7B 4KVMA 4U7EB 2A4ZA 2WXKA 3KS2A 2ILRA 3U9WA 4XZ4A 2HYZA 2V5FA 1S64A 1HE8A 3QB2A 4RVBA 4J8SA 3HXDA 3RKVA 3V79K 2JEKA 3ZUVB 4N5QA 3I3NA 1NZNA 4HI8A 3CHSA 1NI1A 3EUVA 4CDRA 4C48B 5KJNA 3PNTB 4BY6A 4GA0A 3SFXA 1A5EA 2RFAA 3JYSA 4ANWA 3O4ZA 2XS1A 1E8ZA 3KEZA 1OCRE 2QFCA 2WB2A 4ANUA 5FZRA 5ITZF 4DUIA 2L0TB 1QZ2A 4BTBA 4U07A 4AM9A 4GA1A 4PH4B 1JWFA 2CFUA 3UUXA 1O1TA 1UJJA 1JWGA 3OAWA 3AU5A 3PDNA 3ABKE 3FU3A 4BX9A 1YCSB 3KD7A 2X6IA 4E6HA 5BNWA 3LPZA 3ZGQA 2VGEA 4YNDA 1SVXA 3TXNA 1N52A 4WAFA 2PQNA 3AG4E 3SFZA 1LF8A 5FIOA 3CSFA 4JHJA 4UUCA 3Q5MA 3CVQA 4J0UA 2H6IA 4I2WA 2Y1LE 1TJFA 4XI9A 5ARGA 4XKBA 3DXMG 3Q7FA 4J6IA 3RRUA 2WXRA 3DBSA 1TN8A 5B1BE 1MX2A 3D9OA 2XHEA 3DPYA 2DZNA 5D2MC 4K03A 3EIQC 4GMRA 3Q49B 3FULA 1HS6A 2C2LA 1V54E 4J7WA 3Q15A 3UM0A 4N3BA 5BW8C 2IF4A 3LJNA 3B7TA 4I6GA 1FPPA 4BEPA 3OXFA 3CVPA 5H7PA 5CERB 4FLHA 4YDYA 3OTNA 2FI7A 3D9MA 4IRUA 1MJ0A 5BXOA 3FTSA 3LVQE 1H6OA 4TV3A 4GMLA 1D9SA 1XNFA 3PZ3A 3APFA 2GRNB 4HI9A 1N0RA 1TNBA 3NQPA 2WQ7A 1E96B 3FUJA 4HVBA 2X3MA 1HG2A 2XGOA 3U3WA 2EIME 3SFYA 2IY0C 4GTPA 5G2NA 1U3CA 3CK8A 3TWVA 5EDSA 5ANRA 3DRAA 3RO3A 4B89A 4GTVA 4DI4A 4UWLA 3FTVA 4PUCA 3CVXA 4DX7D 4BT8A 3FEYA 3QNKA 2XQ0A 4G1TA 3PH0C 5HKPA 5C2YA 4CRWA 3ASHA 3SBSA 1S63A 4NIKA 2R02A 2NSZA 4I1OB 4EBAA 2WXMA 1Z3YA 1MYOA 5KWDA 3FU6A 2VGXA 5CCLA 2F8YA 3B7RL 4NURA 4CEMA 4CT4A 3B7UX 3D9KA 3FH8A 4GYWA 4AVXA 4EECA 4I2ZA 4AIFA 4BESA 1LD8A 1FVHA 3FUMA 3Q75A 1UJKA 1Z5SC 2GW1A 3CGHA 3FUEA 3ZXSA 3NF1A 3ZEFA 2AXVA 1OY3D 3EU9A 1IHGA 4WNGA 4U0ZA 3HDXA 4L1BA 3CV0A 1H2UA 2PM7A 3FHEA 1BD8A 3L22A 3BG0B 4F3VA 4L23A 4GZ3A 3IHVA 3LDZA 4HS2A 2UY1A 5KBAA 3C98A 4UWGA 3MV3B 3D9IA 4O6FA 4MS6A 3MGBA 3ABLE 1JPLA 3QAQA 4F1PA 1HFAA 2VYIA 1OCCE 2R05A 1HO8A 3Q78A 4HOUA 2VTBA 1D8DA 5G55A 1IHBA 2WQHA 1A17A 2I6HA 4UI9K 3CSTA 4F7AA 2WMOA 4L2LA 5CMWA 5E75A 3LYAA 3ESKA 3TWWA 4HORA 4LSZE 3CQGB 4U04A 3IXEA 4BSXA 4N39A 3HXCA 3TWSA 2WMNA 2DBAA 3BUAA 5BXUA 2XPYA 3S7FA 2EIJE 3JCKC 2XENA 4EZKA 3PUKA 5AARA 2XGSA 4FP7A 1YA0A 2V0PA 5EIDA 1E7VA 1JCSA 3L6AA 2ZISA 3BU8A 4IYPA 4EHMA 2Y4TA 1PY1A 3HVEA 2B0OE 3HRAA 3JQ1A 4AJWA 2PNNA 2PQRA 4HLEA 1Q2ZA 2F0YA 3D9JA 3EU5A 1OWOA 5G05C 2MHKA 3LY9A 4GZDA 4DI3A 3L54A 3FUIA 2KCLA 3FUDA 4LEUA 3E37A 2P58C 5T3RA 3ASNE 3CVYA 2IFUA 4N2SA 1TEZA 4BTAA 4R7LA 3MA5A 4RG6A 4I9EA 4U63A 2CHXA 4LCTA 2ZGGA 3ABME 3URZA 5J08A 3SNXA
chains in the Genus database with same CATH topology
1FVFA 3G2WA 5FZRA 4W9RA 5LFAA 3CHMA 4I17A 3ZYKA 3ZIMA 4A3VA 4AEZC 2R59A 3UT7A 3TGOA 2L0TB 1EDUA 4MKTA 1PC2A 3UMVA 4JVSA 1QZ2A 4WUYA 4BTBA 4U07A 2VSNA 4AM9A 4GA1A 4M3OA 5FZQA 3EIJA 3CVLA 5FWQA 4PH4B 4G11A 1H19A 1JWFA 5AJLA 2CFUA 2WXPA 2E2EA 3UUXA 1UJJA 1JWGA 3OAWA 3AU5A 3PDNA 4BX9A 3FU3A 1UN9A 1SQMA 3CVWA 4EBAG 5BV0A 2VSOE 4IN3B 3G2SA 3KD7A 5LX8A 4BWRA 3I5PA 2CG2A 2X6IA 4FA6A 2X38A 3K9IA 4E6HA 4G25A 5BNWA 1QNFA 4UI9J 3LKUA 4GPKA 3LPZA 2GRLA 3S7DA 3CHRA 4ANVA 3BG1B 5JJ6A 5AENA 4LERA 1IQUA 4HOQA 3ZGQA 3FTWA 2A5UA 2XCBA 4ILHB 4XI0A 4CDMA 3D9NA 4L2YA 3ZYQA 3SI5A 4CT0A 3CKBA 3MX3A 1XGWA 4FC8A 4PS8A 5JHBA 3MKRA 2RD0A 3LXUX 3ZW3A 3KAEA 5CHEE 4YNDA 4OVVA 3PS6A 4GB9A 3PNLB 4JEHA 1HU3A 3TXNA 1N52A 2NC9A 3ASGA 3FEXA 4I6EA 1E8WA 3GW4A 2VJ8A 4WAFA 3I4RB 4BFRA 2PQNA 2I9CA 3TAXA 3IBEA 2IQCA 3RRNB 3QWWA 2FULA 4CGWA 2KZTB 1U3DA 3S7BA 3SFZA 1LF8A 2LO6A 3I4GA 4ILGA 3WXXA 4HFGA 3CSFA 4FHKA 4JHJA 2UWJG 4EPZA 3Q5MA 3CVQA 4J0UA 1SZ9A 5FQ4A 4JA7A 3EHMA 5ENNA 4J8FA 1DVPA 3CVVA 4UQXA 2IONA 1OUVA 3EDTB 4JEUA 1H0AA 1NA3A 4I2WA 2CHZA 1TJFA 3GZSA 4XI9A 4UWHA 3QARA 4TUUA 5ARGA 5FZSA 3FTXA 2J4BA 4KVOA 4XKBA 5FQ6A 3HIZA 2WXOA 2BTDA 2FO7A 1OWLA 4H7XA 2V4LA 4J6IA 2L9BA 3ML8A 3RRUA 3TG5A 2WXRA 2BUGA 3SBTB 3DBSA 2LSUA 3ZPJA 4H7YA 4N3AA 3ZVVA 3UT8A 2GRMA 2XRYA 2VTBB 2I1KA 1BPOA 2OV8A 4KXKB 1Y6IA 3FDHA 3JUIA 4I43A 2CFZA 3D9OA 3MKQA 4N3CA 2XHEA 4KBQA 5A23A 2YNQA 5FT9A 4K03A 3QK0A 3EIQC 2R5SA 3U66A 4AY6A 1MQSA 3TXMA 2FF4A 1IYGA 1JUQA 5J90A 2IJGX 3Q49B 3JQ0A 3FULA 5BPPA 1HS6A 2C2LA 5G04C 3SGHA 5BT1A 1H6KA 3Q15A 2YQ8A 5LOZA 3ZHEA 3LVRE 2WXFA 2ONDA 4FULA 4N3BA 1E90A 5BW8C 1ZBPA 3CVUA 2IF4A 3P1UA 2KATA 2LSVA 3GYZA 5FQ7A 3LY8A 3B7TA 4G26A 4I6GA 2XCCA 3MYVA 3RU0A 1E7UA 1H2TC 4GAAA 1IQRA 3ULQA 4UWKA 1UN8A 3OXFA 4U0SA 3CVPA 2KZTA 4GA2A 4FLHA 2AWIA 3OTNA 2J9QA 4KYOB 2FI7A 2RG8A 5AJDA 3D9MA 3MV2B 2X6HA 3T5VA 5KJKA 3EJNA 4IRUA 2YHEA 3NZSA 5ARFA 4JHKA 5EX0A 3SD5A 1WAO1 3CEQA 4XE0A 3RJVA 3FTSA 3ENEA 5AYWD 4I9CA 3LJ3A 3LVQE 4TV3A 4GMLA 4LUNU 3TG4A 1PAQA 2KC7A 2DIWA 2MRIA 4AP2A 1XNFA 5LCWC 4EZJA 1EYHA 4GYOA 3APFA 4NQ0A 2BF0X 4WWOA 3HVEB 3ASFA 3CVNA 4CGVA 2AXUA 2VGXB 3N71A 3NQPA 4GMJA 4WNDA 3IV0A 4CCAA 2WQ7A 1E96B 3G2TA 3FUHA 3FUJA 4HVBA 5JJ7A 3APDA 4TRQA 4DLOA 3U64A 2X3MA 4JW1A 1HG2A 2XGOA 2V8SE 3CLJA 3HHMA 3RIBA 3U3WA 4QFVA 3CHQA 1QQEA 4PS3A 3FUKA 5D0QD 5AIJA 3PZDA 4I1MA 1NA0A 4NRHB 4KT6B 3ASDA 3ZYMA 4WWPA 4ACLA 4B0ZA 2DCPA 4WNFA 4B8AA 2FBNA 2Y3AA 3L16A 3QJZA 4KZ0A 1U3CA 5G2NA 4Y6WA 3CK8A 2PZIA 4ACKA 3FFLA 3FY4A 5FQ8A 3RRMB 4AXHA 5EDSA 2XEVA 5ANRA 3D9LA 1HG5A 2FEZA 4HOSA 3ZYLA 3RO3A 4B89A 2L6JA 2WXQA 4DI4A 4UWLA 1OWNA 2WXJA 5DIZA 3GZ2A 3FTVA 4GZ6A 2AVPA 4PUCA 4EQFA 4JZYA 4GCOA 3CVXA 4BT8A 1WY6A 3FEYA 4FHJA 4E85A 2XPZA 3QNKA 2XQ0A 4G1TA 1GW6A 4JA9A 3PH0C 3B13A 5DBKA 3Q47B 2C0MA 3PRZA 4F1SA 1WM5A 3FTZA 5C2YA 4CRWA 5BUZA 2UY1B 3RK6A 5KJLA 3P2BA 3ASHA 4OYSA 5ANLA 1N54A 4K0RA 2ZU6B 3SBSA 3ONLA 2KCKA 2WM9A 1ZU2A 2X6JA 5T8IA 3GZ1A 4G24A 3SF4A 4DK5A 5LCWJ 3UPVA 3OXGA 4EZLA 2AW6A 3VLDA 4KZCA 1Y8MA 3RO2A 2NSZA 3PE3A 4JL0A 4I1OB 4EBAA 4L7TA 3APCA 2WXMA 3ZN3A 1Z3YA 3UQ3A 3FU6A 2VGXA 4JXTA 3UT4A 3CR3A 5CCLA 2OVBA 2HR2A 2XPIA 3B7RL 3QDNA 4NURA 2VSYA 5JHAA 2HM8A 4RSYA 3CK7A 4CEMA 4CT4A 2HO1A 3B7UX 3LS8A 5KCMA 3ZFWA 3D9KA 3FH8A 1B89A 2IU1A 4GYWA 4AVXA 4EECA 4I2ZA 4AIFA 1FVHA 3FUMA 2WPVA 1UJKA 1HZ4A 3LEWA 4WNEA 3SHFA 3NZUA 2GW1A 4HXIA 5M72A 2YINA 3CGHA 3FUEA 3NF1A 3ONKA 4J8DA 3G2VA 2OVFA 5CMYA 3ZXSA 5E76A 3PREA 4XIFA 3ZEFA 3FUNA 2WXGA 4FJYA 2AXVA 4MRUA 3VTXA 4B8CB 4N5CA 3ML9A 3TJPA 2J4DA 2WXIA 3U4TA 3R7QA 4CDNA 1IHGA 4WNGA 3FUFA 4U0ZA 1KT1A 3HDXA 2R17C 4WWNA 4NACA 2NXPA 4L1BA 4ILIA 3CV0A 1H2UA 4Y6CA 2PM7A 3FHEA 2J09A 4PS7A 3L22A 3PUJA 5KJMA 2EQXA 3BG0B 2OOEA 3MJWA 3VTYA 4G23A 4F3VA 1E8XA 5FJYA 3FTUA 4D10C 4DJAA 3QC1A 2CG3A 3D3MA 3G2UA 3IKOB 5HI7A 4L23A 4GZ3A 4DPRA 3FWVA 3IHVA 1OWMA 4UQZA 3S7JA 5FTPA 3LDZA 2LAHA 4HS2A 1P5QA 2UY1A 4GZCA 5G04J 2J07A 3C98A 4J8EA 4UWGA 3MV3B 3MEKA 3D9IA 3AS4A 3L08A 4OVUA 2XRZA 2IOLA 4O6FA 4MS6A 2E0IA 3MGBA 3TL5A 4Q69A 4ATGA 4C0EA 4XX5A 4IULA 2VQ2A 4G2VA 1JPLA 2WXNA 3QAQA 3DPDA 4GU5A 1HFAA 2VYIA 5D0OD 4GZ5A 4AOFA 1HXIA 4ANXA 3CHPA 1HO8A 4HOUA 1EPUA 5T4YA 2VTBA 1NP7A 4BT9A 2J08A 3B7SA 3EHNA 1UW4B 2WXHA 3CQCB 5G55A 4JPSA 3ESLA 4APOA 3MZLB 4PDXA 4A3TA 2WQHA 2YHCA 3FH7A 1A17A 3CIAA 2I6HA 4JHRA 3CSTA 4UI9K 4JC8A 4A1GA 2LAIA 1DNPA 4FU3A 4F7AA 1UG3A 3BEEA 2WMOA 1E8YA 3FH5A 4L2LA 5CMWA 1VDYA 4BX8A 2I2OA 4U8HA 5E75A 3LYAA 3ESKA 1OWPA 3MKQB 4FADA 2GGFA 2L0IA 3FP3A 5A7DB 4HORA 1FCHA 4Q94A 4C0MA 4Q96A 3MCXA 4B94A 3ZRHA 4ABNA 3CQGB 2I1JA 3PVLA 2VGYA 4YVQC 2C0LA 4U04A 2AXZA 2X6FA 3ZHEB 4BSXA 1Z6TA 3SZ7A 3CK9A 1HF8A 3E4BA 3FU0A 4N39A 5JJTA 4YVOA 2WMNA 2DBAA 1EF1C 2XPYA 1KT0A 3S7FA 4RG9A 3JCKC 3UX4A 4EZKA 3FU5A 1HH8A 1KLXA 2M63A 3IHYA 3PUKA 3S2AA 3PEUB 4GYYA 2XGSA 4FP7A 1YA0A 2LNIA 2V0PA 5EKQD 1E7VA 3T8MA 4UQYA 1HX8A 3L6AA 3LY7A 2WXLA 4F53A 4HOTA 2Y4UA 2VSXE 3QKYA 3O48A 4AV7A 4IYPA 5CCMA 4U0UA 3T5XA 3L13A 2Y4TA 1PY1A 4V3IA 1S0PA 4UWFA 3HVEA 3OXLA 1ELRA 3R9AB 2JLBA 1Z3XA 2WVIA 3CHOA 1H2VC 3JQ1A 4AJWA 2PM6A 4N2QA 3PE4A 4URKA 4KVMA 3AS5A 4DLQA 2PQRA 1INZA 4HLEA 4XKCA 3D9JA 5A6CA 3D9PA 2PL2A 1OWOA 2A4ZA 5G05C 1W3BA 2MOWA 2WXKA 3KS2A 2MHKA 2ILRA 3HYMB 3QOUA 3LY9A 1MHQA 4GZDA 4ME2A 3LCAA 3U9WA 4XZ4A 2QY7A 2HYZA 2V5FA 2XGMA 4DI3A 1ELWA 1HE8A 1X5BA 3AU4A 3L54A 2X6KA 3QB2A 4FJZA 3FUIA 4FLBA 4J8SA 4RVBA 2KCLA 3FUDA 4LEUA 1TJCA 1SZAA 3RKVA 4I1AA 2Q7FA 3PEVB 2P58C 4A55A 2JEKA 1L5JA 2KM4A 3I3NA 2J49A 5T3RA 3CVYA 1NZNA 2IFUA 4N2SA 3QWVA 1TEZA 3CHSA 4BTAA 4CDRA 4R7LA 3IEGA 3FTYA 3MA5A 5C1DA 5HQ8A 5KJNA 2IOSA 3PNTB 3CKCA 4I6JA 3VLEA 4BY6A 4GA0A 5EX3A 4GCNA 3Q4AB 2KCVA 3L17A 3VLFA 4RG6A 4I9EA 4U63A 2CHXA 4LRZA 4APFA 3JYSA 4LCTA 3QWPA 5G05J 5BV1A 4ANWA 3O4ZA 2CHWA 4MLPA 4P29A 4A1SA 3URZA 1E8ZA 4KMOA 3KEZA 3R7RA 3AS8A 5J08A 2QFCA 2WB2A 1ELKA 4C9BB 4UI9C 4ANUA 3SNXA 4AY5A 5LP0A 2WQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZR A;  4W9R A;  4I17 A;  3TGO A;  1PC2 A;  1QZ2 A;  4WUY A;  4BTB A;  4U07 A;  2VSN A;  4AM9 A;  4GA1 A;  5FZQ A;  3CVL A;  2E2E A;  3UUX A;  3PDN A;  4IN3 B;  3KD7 A;  4BWR A;  3K9I A;  4G25 A;  5BNW A;  4UI9 J;  3LKU A;  4GPK A;  3LPZ A;  3S7D A;  5JJ6 A;  3ZGQ A;  4HOQ A;  2XCB A;  4XI0 A;  3CKB A;  3MKR A;  3KAE A;  5CHE E;  4YND A;  3ASG A;  2NC9 A;  3GW4 A;  2PQN A;  3TAX A;  3QWW A;  4CGW A;  3S7B A;  3WXX A;  2UWJ G;  3Q5M A;  3CVQ A;  4J0U A;  4JA7 A;  4J8F A;  4UQX A;  1OUV A;  3EDT B;  1NA3 A;  4I2W A;  4XI9 A;  5ARG A;  5FZS A;  2FO7 A;  4H7X A;  3TG5 A;  2BUG A;  2LSU A;  3ZPJ A;  4H7Y A;  4N3A A;  4KXK B;  4N3C A;  4KBQ A;  5FT9 A;  2R5S A;  4AY6 A;  2FF4 A;  1IYG A;  3Q49 B;  2C2L A;  5G04 C;  5BT1 A;  3Q15 A;  2YQ8 A;  3ZHE A;  2OND A;  4N3B A;  5BW8 C;  1ZBP A;  2IF4 A;  2KAT A;  2LSV A;  3GYZ A;  3LY8 A;  4G26 A;  3RU0 A;  2XCC A;  3ULQ A;  3OXF A;  4U0S A;  3CVP A;  4GA2 A;  2J9Q A;  4KYO B;  2FI7 A;  3MV2 B;  5KJK A;  5ARF A;  5EX0 A;  1WAO 1;  3CEQ A;  3RJV A;  5AYW D;  4I9C A;  3TG4 A;  2KC7 A;  1XNF A;  4GYO A;  4NQ0 A;  3ASF A;  3CVN A;  4CGV A;  4WND A;  2VGX B;  3N71 A;  1E96 B;  5JJ7 A;  2XGO A;  3U3W A;  3RIB A;  5D0Q D;  1QQE A;  4NRH B;  1NA0 A;  3ASD A;  4WNF A;  2FBN A;  5LCW C;  4Y6W A;  3CK8 A;  2PZI A;  3FFL A;  2XEV A;  2FEZ A;  4HOS A;  3RO3 A;  2L6J A;  5DIZ A;  3GZ2 A;  4GZ6 A;  2AVP A;  4EQF A;  4GCO A;  4BT8 A;  4G1T A;  4JA9 A;  5DBK A;  3Q47 B;  2C0M A;  1WM5 A;  2UY1 B;  5KJL A;  3ASH A;  2KCK A;  1ZU2 A;  3GZ1 A;  4G24 A;  3SF4 A;  3UPV A;  5LCW J;  3OXG A;  1Y8M A;  3RO2 A;  3PE3 A;  4JL0 A;  3ZN3 A;  3UQ3 A;  2VGX A;  5CCL A;  2HR2 A;  2XPI A;  3QDN A;  2VSY A;  3CK7 A;  2HO1 A;  3ZFW A;  4GYW A;  1B89 A;  4I2Z A;  4AIF A;  2WPV A;  1HZ4 A;  4WNE A;  2GW1 A;  5M72 A;  3NF1 A;  4J8D A;  4XIF A;  3VTX A;  4N5C A;  3U4T A;  1IHG A;  4WNG A;  4U0Z A;  1KT1 A;  3CV0 A;  4Y6C A;  5KJM A;  2OOE A;  3VTY A;  4G23 A;  4F3V A;  5FJY A;  5HI7 A;  4GZ3 A;  3FWV A;  4UQZ A;  3S7J A;  5FTP A;  1P5Q A;  2UY1 A;  5G04 J;  4J8E A;  3MV3 B;  3MEK A;  3AS4 A;  4O6F A;  2VQ2 A;  4G2V A;  2VYI A;  5D0O D;  4GZ5 A;  1HXI A;  4HOU A;  4BT9 A;  4APO A;  2WQH A;  2YHC A;  1A17 A;  2I6H A;  4JHR A;  4UI9 K;  3BEE A;  3LYA A;  3ESK A;  3FP3 A;  5A7D B;  4HOR A;  1FCH A;  4B94 A;  4ABN A;  2VGY A;  4YVQ C;  2C0L A;  4U04 A;  3ZHE B;  3SZ7 A;  3CK9 A;  3E4B A;  4N39 A;  5JJT A;  4YVO A;  2DBA A;  1KT0 A;  3S7F A;  4RG9 A;  1HH8 A;  1KLX A;  4GYY A;  2XGS A;  1YA0 A;  2LNI A;  5EKQ D;  4UQY A;  3LY7 A;  4HOT A;  2Y4U A;  3QKY A;  3O48 A;  5CCM A;  4U0U A;  2Y4T A;  3OXL A;  1ELR A;  3R9A B;  2JLB A;  4N2Q A;  3PE4 A;  3AS5 A;  2PQR A;  5A6C A;  2PL2 A;  5G05 C;  1W3B A;  3KS2 A;  2MHK A;  3HYM B;  3QOU A;  3LY9 A;  4ME2 A;  3LCA A;  2HYZ A;  2V5F A;  2XGM A;  1ELW A;  2KCL A;  4LEU A;  1TJC A;  3RKV A;  4I1A A;  2Q7F A;  2P58 C;  1NZN A;  2IFU A;  4N2S A;  3QWV A;  4BTA A;  4CDR A;  3IEG A;  3MA5 A;  5HQ8 A;  5C1D A;  5KJN A;  3CKC A;  4GA0 A;  5EX3 A;  4GCN A;  3Q4A B;  2KCV A;  4RG6 A;  4I9E A;  3JYS A;  5G05 J;  3QWP A;  4A1S A;  3URZ A;  3AS8 A;  2QFC A;  4UI9 C;  4AY5 A; 
#chains in the Genus database with same CATH topology
 3HXF A;  3G2W A;  5LFA A;  4A3V A;  2KXP C;  3UT7 A;  5AQ9 A;  4DX2 A;  4MKT A;  2V4H C;  2R2L A;  4JVS A;  4WUY A;  2VSN A;  4G11 A;  1H19 A;  2GRQ B;  2LUH A;  1UN9 A;  5AN8 A;  3CVW A;  2BKG A;  3J5Q B;  1QYM A;  5ENO D;  4FA6 A;  2Y0B G;  1MX6 A;  4G25 A;  1QNF A;  3LKU A;  4GPK A;  2GRL A;  3UM2 A;  4ILH B;  4CDM A;  3D9N A;  4L2Y A;  3DSX A;  1TR4 A;  3SI5 A;  3MX3 A;  4PS8 A;  5ENS D;  2RD0 A;  3LXU X;  5CHE E;  4OVV A;  4GB9 A;  3NOG D;  3ASG A;  2NC9 A;  2VJ8 A;  4BFR A;  3TAX A;  1SA4 A;  3QWW A;  4CGW A;  2KZT B;  1U3D A;  1WDY A;  5EN5 D;  2J8S D;  4ILG A;  4HFG A;  4FHK A;  2UWJ G;  3C3Q A;  1SZ9 A;  5ENN A;  2CHZ A;  3AG1 E;  2DWZ A;  4TUU A;  4HBD A;  2J4B A;  4KVO A;  2WXO A;  1OWL A;  4H7X A;  3UKU G;  1DCE A;  2L9B A;  3TG5 A;  5AQB A;  1O1S A;  3SBT B;  3PZ1 A;  4H7Y A;  4LNU D;  2GRM A;  2VTB B;  1BPO A;  4KXK B;  3FDH A;  4I43 A;  3MKQ A;  4N3C A;  4KBQ A;  2IO2 C;  5A23 A;  3PZ2 A;  2R5S A;  3JQ0 A;  5BPP A;  5G04 C;  3SGH A;  3ULE G;  5LOZ A;  3ZHE A;  3P1U A;  2KAT A;  5FQ7 A;  3LY8 A;  2XCC A;  1E7U A;  4GAA A;  2EIK E;  1IQR A;  1UN8 A;  2L6B A;  4G8K A;  2AWI A;  2BED A;  2J9Q A;  1SW6 A;  4KYO B;  5AJD A;  2X6H A;  3T5V A;  5KJK A;  3EJN A;  2P9I G;  2YHE A;  3NZS A;  1FT1 A;  5ARF A;  3SD5 A;  3ASO E;  4XE0 A;  3ENE A;  5AYW D;  4U95 D;  4I9C A;  4CYM D;  4BSZ B;  4LUN U;  3TG4 A;  2KC7 A;  4K5B A;  2MRI A;  3DSU A;  1TYQ G;  4HRM B;  4NQ0 A;  3AG2 E;  2ETA A;  3HVE B;  3CVN A;  4WND A;  3IV0 A;  1BLX B;  3G2T A;  4U8Y D;  5JJ7 A;  3APD A;  1O1R A;  3UIN C;  2XZD G;  4K5C A;  2V8S E;  3CLJ A;  3RIB A;  1QQE A;  2KBX A;  1NA0 A;  4KT6 B;  2DCP A;  5EYP F;  2Y3A A;  4KZ0 A;  2F37 A;  3RRM B;  2XEV A;  3D9L A;  4HOS A;  1K8K G;  5CBO A;  3ZYL A;  2ZGD A;  3GZ2 A;  2AVP A;  4EQF A;  4JZY A;  4E85 A;  4JA9 A;  5DBK A;  4O1P A;  3Q47 B;  2C0M A;  3PRZ A;  3FTZ A;  3RK6 A;  4OYS A;  4K0R A;  4U96 D;  2DZO A;  2X6J A;  3SF4 A;  3OXG A;  4EZL A;  2AW6 A;  3VLD A;  3UXG A;  1Y8M A;  3RO2 A;  3PE3 A;  4BER A;  3APC A;  3ZN3 A;  2OVB A;  2HR2 A;  4GTQ A;  4O1O A;  1TN7 A;  2VSY A;  5JHA A;  2HM8 A;  5KCM A;  3ZFW A;  4J8Y A;  1HZ4 A;  3NZU A;  3ONK A;  4J8D A;  2IO3 C;  3G2V A;  2OVF A;  2JAB A;  4MRU A;  4B8C B;  4N5C A;  3TJP A;  2GRO B;  2A5E A;  2WXI A;  4A63 B;  3R7Q A;  4CDN A;  1KT1 A;  3KSQ A;  4ILI A;  5HRY A;  3KEA A;  4PS7 A;  4RQI A;  5KJM A;  3D9H A;  3UM3 A;  2OOE A;  3MJW A;  4DJA A;  5HI7 A;  2QYJ A;  4UQZ A;  3S7J A;  1ZB1 A;  1DCQ A;  3UM1 A;  2QYU A;  3MEK A;  3L08 A;  3AS4 A;  4OVU A;  2E0I A;  3TL5 A;  4XX5 A;  2VQ2 A;  4G2V A;  2WXN A;  4GU5 A;  5D0O D;  2J08 A;  3EHN A;  1K1A A;  4APO A;  4A3T A;  3CIA A;  4A1G A;  4JC8 A;  1UG3 A;  1E8Y A;  2XS8 A;  2P9U G;  4LNG A;  3MKQ B;  1OWP A;  2GGF A;  5A7D B;  3WG7 E;  1FCH A;  4C0M A;  3MCX A;  4B94 A;  3ZRH A;  3NBN B;  4YVQ C;  1N95 A;  2ZXW E;  2C0L A;  1N4P A;  2AXZ A;  4YDO A;  3ZHE B;  3CK9 A;  1N4S A;  3RSE G;  5JJT A;  1KT0 A;  3V31 A;  1HH8 A;  1BU9 A;  3IHY A;  4GYY A;  3NAW A;  5EKQ D;  4RLY A;  4UQY A;  1HX8 A;  3LY7 A;  4HOT A;  2VSX E;  3AJI A;  1YMP A;  3T5X A;  5CCM A;  4V3I A;  5B3S E;  3OXL A;  3R9A B;  3E34 A;  3V2O A;  1Z3X A;  1H2V C;  1N4R A;  1DC2 A;  1LTX A;  5EYL A;  3AS5 A;  4DLQ A;  1INZ A;  3D9P A;  4TXQ A;  5CEC B;  5CED B;  1W3B A;  4ME2 A;  2QY7 A;  2XGM A;  4GTM A;  1ELW A;  1X5B A;  3AU4 A;  4FJZ A;  2X6K A;  2QC9 A;  3DXK G;  2FO1 E;  1TJC A;  1SZA A;  3PEV B;  4A55 A;  1L5J A;  2KM4 A;  4F6R D;  2J49 A;  3IEG A;  3DSS A;  3FTY A;  5C1D A;  3UIP C;  3CKC A;  5EX3 A;  4GCN A;  2KCV A;  3L17 A;  3UTM A;  3VLF A;  4APF A;  5G05 J;  2XEH A;  3QWP A;  4MLP A;  4P29 A;  4A1S A;  4G8L A;  4KMO A;  3R7R A;  3AS8 A;  1ELK A;  4UI9 C;  4AY5 A;  5LP0 A;  2WQ6 A;  4W9R A;  1MZC A;  3CHM A;  4I17 A;  4AEZ C;  4M7C A;  3TGO A;  1EDU A;  1NL4 A;  3UMV A;  2P9N G;  3EIJ A;  4HNA D;  2WXP A;  4ATZ D;  3TWR A;  3HG0 D;  2B6C A;  2OCC E;  4EBA G;  5BV0 A;  2LXL A;  3DSW A;  4BWR A;  2CG2 A;  1G3N B;  2X38 A;  3K9I A;  1TNO A;  2HE0 A;  2GRP B;  3S7D A;  3CHR A;  4ANV A;  3BG1 B;  1IQU A;  2XCB A;  1X81 A;  3ZYQ A;  5CEA A;  4CT0 A;  3CKB A;  3Q9U C;  3PS6 A;  1HU3 A;  4I6E A;  3ULY A;  1E8W A;  3E33 A;  3GW4 A;  2I9C A;  2FUL A;  2DVW A;  2H6G A;  4L9P A;  2LO6 A;  3WXX A;  4EPZ A;  1MX4 A;  5FQ4 A;  2EIL E;  3B7B A;  2DYR E;  4J8F A;  1DVP A;  3CVV A;  2ION A;  4JEU A;  1NA3 A;  3QAR A;  5FZS A;  3HXE A;  3FTX A;  1AWC B;  2BTD A;  2FO7 A;  2V4L A;  3ML8 A;  4DRX E;  2OV8 A;  3NB2 A;  1Y6I A;  2H6H A;  3E30 A;  2YNQ A;  5FT9 A;  2R03 A;  3QK0 A;  3U66 A;  4AY6 A;  1TN6 A;  4QQI A;  2FF4 A;  5J90 A;  2ETC A;  5BT1 A;  3LVR E;  2WXF A;  4FUL A;  2LSV A;  3RU0 A;  4X8Q A;  3ULQ A;  4UWK A;  4GA2 A;  3R9M A;  1QBQ A;  4JHK A;  2ZIR A;  3LJ3 A;  3Q73 A;  1UOH A;  1PAQ A;  2DIW A;  1H6P A;  2P9L G;  4BET A;  5JA4 D;  2RFM A;  4CZ2 D;  4WWO A;  3ASF A;  4YDE A;  2AXU A;  2VGX B;  1IKN D;  3FUH A;  4DLO A;  4ZFH A;  4OAV B;  3HHM A;  4QFV A;  3CHQ A;  5D0Q D;  5AIJ A;  3FUK A;  4NRH B;  4I1M A;  3ASD A;  1BI8 B;  1K1B A;  4U8V D;  4ACL A;  4B0Z A;  4WNF A;  3UKR G;  4B8A A;  2FBN A;  5AAO A;  5LCW C;  4AXH A;  4ACK A;  4TUM A;  3FFL A;  3FY4 A;  2L6J A;  2WXQ A;  1OWN A;  5DIZ A;  2XPZ A;  4F1S A;  1OT8 A;  5BUZ A;  2UY1 B;  5KJL A;  5ANL A;  2ZU6 B;  3ONL A;  2WM9 A;  3GZ1 A;  4G24 A;  3TWX A;  2V5Q C;  5EIB E;  3C5R A;  4JL0 A;  3TWQ A;  3UQ3 A;  3Q79 A;  3UT4 A;  3CR3 A;  3Q9N C;  1LD7 A;  3QDN A;  3CK7 A;  2HO1 A;  3LS8 A;  3UIO C;  2WPV A;  3SHF A;  1V55 E;  2IEJ A;  2YIN A;  5CMY A;  5E76 A;  3F6Q A;  3FUN A;  2WXG A;  2MYO A;  3FUF A;  1YYH A;  2NXP A;  4Y6C A;  2J09 A;  3PUJ A;  5FIN A;  4OAU C;  4G23 A;  1E8X A;  1TNU A;  3FTU A;  3D3M A;  3IKO B;  4DPR A;  3FWV A;  5KNH D;  5FTP A;  1P5Q A;  2J07 A;  2XRZ A;  4HB5 A;  2IOL A;  4ATG A;  4C0E A;  3DPD A;  5D66 A;  3SO8 A;  4ANX A;  1EPU A;  5T4Y A;  4BT9 A;  1UW4 B;  3CQC B;  4JPS A;  3ESL A;  4GTS A;  4K5A B;  4PDX A;  3NOC D;  4JHR A;  4HRN A;  1DNP A;  3FH5 A;  1VDY A;  4BX8 A;  1OXJ A;  2I2O A;  4FAD A;  2L0I A;  3FP3 A;  3BQO A;  4Q94 A;  4Q96 A;  2I1J A;  3PVL A;  1Z6T A;  3SQV A;  3J5P A;  3UX4 A;  3S2A A;  2M63 A;  2LNI A;  4F53 A;  2WXL A;  1N4Q A;  2Y4U A;  3L13 A;  3CHO A;  4HRL A;  1N0Q A;  1WG0 A;  4YDW A;  4XKC A;  4GTO A;  3W9G A;  5A6C A;  5AQA A;  2PL2 A;  1N94 A;  2MOW A;  1FT2 A;  3HYM B;  3QOU A;  1MHQ A;  3AG3 E;  3LCA A;  1JCQ A;  4FLB A;  3L9T A;  2BKK B;  4I1A A;  2Q7F A;  3QWV A;  5HQ8 A;  5CRU A;  2IOS A;  4I6J A;  3VLE A;  3Q4A B;  4HQD A;  5HS0 A;  3TWU A;  4LRZ A;  5BV1 A;  2CHW A;  3T8K A;  4C9B B;  1IXV A;  4LNB A;  3ZKJ A;  1FVF A;  3Q7A A;  4GTR A;  3ZYK A;  3ZIM A;  2R59 A;  3RAU A;  1PC2 A;  4M3O A;  5FZQ A;  3ZXP A;  3CVL A;  5FWQ A;  5AJL A;  2E2E A;  1SQM A;  3JXI A;  2VSO E;  4IN3 B;  3G2S A;  3EHR A;  5LX8 A;  3I5P A;  1SA5 A;  4UI9 J;  5AEN A;  5JJ6 A;  3ZNG A;  4LER A;  4HOQ A;  3FTW A;  2A5U A;  5ENP D;  4XI0 A;  2OEW A;  1XGW A;  4FC8 A;  5JHB A;  4JD2 G;  3MKR A;  4TXP A;  3ZW3 A;  3KAE A;  3ISM C;  1O5M A;  4JEH A;  3PNL B;  5IY5 E;  3UI2 A;  3FEX A;  3DEP A;  3I4R B;  5EIL A;  2DYS E;  3IBE A;  2IQC A;  3RRN B;  5JMN D;  3S7B A;  3E32 A;  3I4G A;  2H6F A;  4Z68 A;  5CRV A;  4JA7 A;  3EHM A;  2P9S G;  2OEV A;  4UQX A;  3PZ4 A;  1OUV A;  3EDT B;  1S70 B;  1H0A A;  3GZS A;  4UWH A;  5FQ6 A;  3HIZ A;  4LG6 A;  2BUG A;  2LSU A;  3ZPJ A;  4N3A A;  3ZVV A;  3UT8 A;  2XRY A;  2I1K A;  3SY2 A;  3JUI A;  2CFZ A;  4JB8 P;  1MQS A;  3TXM A;  1IYG A;  1JUQ A;  2IJG X;  1NFI E;  1H6K A;  2YQ8 A;  4HLL A;  2OND A;  1N11 A;  1E90 A;  1ZBP A;  3CVU A;  3GYZ A;  4DX5 D;  3JUE A;  4G26 A;  3MYV A;  1H2T C;  1BI7 B;  4U0S A;  2KZT A;  3C3O A;  2RG8 A;  4DX6 D;  4TXR A;  3MV2 B;  2P2C P;  3V30 A;  5EX0 A;  1WAO 1;  3CEQ A;  3RJV A;  1OCZ E;  3JXJ A;  4AP2 A;  4EZJ A;  1EYH A;  4GYO A;  2BF0 X;  4CGV A;  4O60 A;  3N71 A;  4GMJ A;  4CCA A;  3EHQ A;  4TRQ A;  3U64 A;  5ENT D;  4JW1 A;  3AAA C;  2GRR B;  3V2X A;  4PS3 A;  3PZD A;  3ZYM A;  4WWP A;  1KPS B;  3L16 A;  2NYJ A;  4B93 B;  3QJZ A;  4Y6W A;  2PZI A;  1JCR A;  5FQ8 A;  1HG5 A;  2FEZ A;  4MBG A;  2WXJ A;  3W9F A;  4GZ6 A;  5ENQ D;  4GCO A;  1WY6 A;  4FHJ A;  2RKK A;  1GW6 A;  2P9K G;  3B13 A;  1N9A A;  1WM5 A;  3DST A;  3X2Q E;  3P2B A;  1N54 A;  1KZP A;  1AP7 A;  2KCK A;  1ZU2 A;  4DK5 A;  5T8I A;  3UPV A;  5LCW J;  4KZC A;  3DSV A;  4L7T A;  2XEE A;  1K3Z D;  4GTT A;  4JXT A;  5ENR D;  2XPI A;  3DWL G;  4RSY A;  1B89 A;  2IU1 A;  3LEW A;  4WNE A;  1OCO E;  4HXI A;  5M72 A;  3KSL A;  2ETB A;  2P9P G;  3PRE A;  4XIF A;  4FJY A;  3VTX A;  3ML9 A;  2F8X K;  2J4D A;  3U4T A;  2R17 C;  4WWN A;  4NAC A;  5KNG A;  1RW2 A;  2EQX A;  3VTY A;  3L82 A;  5FJY A;  4D10 C;  3QC1 A;  2CG3 A;  3G2U A;  2LXM A;  1OWM A;  1D8E A;  2LAH A;  4GZC A;  5G04 J;  4J8E A;  2Y69 E;  2QZA A;  3TWT A;  4Q69 A;  2EIN E;  4IUL A;  3DEO A;  4GZ5 A;  1U2V G;  4AOF A;  1HXI A;  5B1A E;  3CHP A;  1NP7 A;  3B7S A;  2WXH A;  1TNY A;  5AQ7 A;  3MZL B;  2YHC A;  3FH7 A;  4GPM A;  2LAI A;  4FU3 A;  3BEE A;  3C72 A;  3B95 A;  3C3R A;  4U8H A;  3T9K A;  1RZ4 A;  4ABN A;  2AJA A;  2VGY A;  2X6F A;  3SZ7 A;  1HF8 A;  3E4B A;  3FU0 A;  4DX1 A;  4YVO A;  1EF1 C;  4RG9 A;  3HXB A;  2XZT G;  3FU5 A;  4ZHB A;  1KLX A;  1KZO A;  4XEI G;  3PEU B;  3T8M A;  3QKY A;  3O48 A;  4AV7 A;  4U0U A;  4UWF A;  1S0P A;  1ELR A;  2JLB A;  1TNZ A;  2WVI A;  2PM6 A;  4N2Q A;  5CBN A;  3PE4 A;  4URK A;  3ZU7 B;  4KVM A;  4U7E B;  2A4Z A;  2WXK A;  3KS2 A;  2ILR A;  3U9W A;  4XZ4 A;  2HYZ A;  2V5F A;  1S64 A;  1HE8 A;  3QB2 A;  4RVB A;  4J8S A;  3HXD A;  3RKV A;  3V79 K;  2JEK A;  3ZUV B;  4N5Q A;  3I3N A;  1NZN A;  4HI8 A;  3CHS A;  1NI1 A;  3EUV A;  4CDR A;  4C48 B;  5KJN A;  3PNT B;  4BY6 A;  4GA0 A;  3SFX A;  1A5E A;  2RFA A;  3JYS A;  4ANW A;  3O4Z A;  2XS1 A;  1E8Z A;  3KEZ A;  1OCR E;  2QFC A;  2WB2 A;  4ANU A;  5FZR A;  5ITZ F;  4DUI A;  2L0T B;  1QZ2 A;  4BTB A;  4U07 A;  4AM9 A;  4GA1 A;  4PH4 B;  1JWF A;  2CFU A;  3UUX A;  1O1T A;  1UJJ A;  1JWG A;  3OAW A;  3AU5 A;  3PDN A;  3ABK E;  3FU3 A;  4BX9 A;  1YCS B;  3KD7 A;  2X6I A;  4E6H A;  5BNW A;  3LPZ A;  3ZGQ A;  2VGE A;  4YND A;  1SVX A;  3TXN A;  1N52 A;  4WAF A;  2PQN A;  3AG4 E;  3SFZ A;  1LF8 A;  5FIO A;  3CSF A;  4JHJ A;  4UUC A;  3Q5M A;  3CVQ A;  4J0U A;  2H6I A;  4I2W A;  2Y1L E;  1TJF A;  4XI9 A;  5ARG A;  4XKB A;  3DXM G;  3Q7F A;  4J6I A;  3RRU A;  2WXR A;  3DBS A;  1TN8 A;  5B1B E;  1MX2 A;  3D9O A;  2XHE A;  3DPY A;  2DZN A;  5D2M C;  4K03 A;  3EIQ C;  4GMR A;  3Q49 B;  3FUL A;  1HS6 A;  2C2L A;  1V54 E;  4J7W A;  3Q15 A;  3UM0 A;  4N3B A;  5BW8 C;  2IF4 A;  3LJN A;  3B7T A;  4I6G A;  1FPP A;  4BEP A;  3OXF A;  3CVP A;  5H7P A;  5CER B;  4FLH A;  4YDY A;  3OTN A;  2FI7 A;  3D9M A;  4IRU A;  1MJ0 A;  5BXO A;  3FTS A;  3LVQ E;  1H6O A;  4TV3 A;  4GML A;  1D9S A;  1XNF A;  3PZ3 A;  3APF A;  2GRN B;  4HI9 A;  1N0R A;  1TNB A;  3NQP A;  2WQ7 A;  1E96 B;  3FUJ A;  4HVB A;  2X3M A;  1HG2 A;  2XGO A;  3U3W A;  2EIM E;  3SFY A;  2IY0 C;  4GTP A;  5G2N A;  1U3C A;  3CK8 A;  3TWV A;  5EDS A;  5ANR A;  3DRA A;  3RO3 A;  4B89 A;  4GTV A;  4DI4 A;  4UWL A;  3FTV A;  4PUC A;  3CVX A;  4DX7 D;  4BT8 A;  3FEY A;  3QNK A;  2XQ0 A;  4G1T A;  3PH0 C;  5HKP A;  5C2Y A;  4CRW A;  3ASH A;  3SBS A;  1S63 A;  4NIK A;  2R02 A;  2NSZ A;  4I1O B;  4EBA A;  2WXM A;  1Z3Y A;  1MYO A;  5KWD A;  3FU6 A;  2VGX A;  5CCL A;  2F8Y A;  3B7R L;  4NUR A;  4CEM A;  4CT4 A;  3B7U X;  3D9K A;  3FH8 A;  4GYW A;  4AVX A;  4EEC A;  4I2Z A;  4AIF A;  4BES A;  1LD8 A;  1FVH A;  3FUM A;  3Q75 A;  1UJK A;  1Z5S C;  2GW1 A;  3CGH A;  3FUE A;  3ZXS A;  3NF1 A;  3ZEF A;  2AXV A;  1OY3 D;  3EU9 A;  1IHG A;  4WNG A;  4U0Z A;  3HDX A;  4L1B A;  3CV0 A;  1H2U A;  2PM7 A;  3FHE A;  1BD8 A;  3L22 A;  3BG0 B;  4F3V A;  4L23 A;  4GZ3 A;  3IHV A;  3LDZ A;  4HS2 A;  2UY1 A;  5KBA A;  3C98 A;  4UWG A;  3MV3 B;  3D9I A;  4O6F A;  4MS6 A;  3MGB A;  3ABL E;  1JPL A;  3QAQ A;  4F1P A;  1HFA A;  2VYI A;  1OCC E;  2R05 A;  1HO8 A;  3Q78 A;  4HOU A;  2VTB A;  1D8D A;  5G55 A;  1IHB A;  2WQH A;  1A17 A;  2I6H A;  4UI9 K;  3CST A;  4F7A A;  2WMO A;  4L2L A;  5CMW A;  5E75 A;  3LYA A;  3ESK A;  3TWW A;  4HOR A;  4LSZ E;  3CQG B;  4U04 A;  3IXE A;  4BSX A;  4N39 A;  3HXC A;  3TWS A;  2WMN A;  2DBA A;  3BUA A;  5BXU A;  2XPY A;  3S7F A;  2EIJ E;  3JCK C;  2XEN A;  4EZK A;  3PUK A;  5AAR A;  2XGS A;  4FP7 A;  1YA0 A;  2V0P A;  5EID A;  1E7V A;  1JCS A;  3L6A A;  2ZIS A;  3BU8 A;  4IYP A;  4EHM A;  2Y4T A;  1PY1 A;  3HVE A;  2B0O E;  3HRA A;  3JQ1 A;  4AJW A;  2PNN A;  2PQR A;  4HLE A;  1Q2Z A;  2F0Y A;  3D9J A;  3EU5 A;  1OWO A;  5G05 C;  2MHK A;  3LY9 A;  4GZD A;  4DI3 A;  3L54 A;  3FUI A;  2KCL A;  3FUD A;  4LEU A;  3E37 A;  2P58 C;  5T3R A;  3ASN E;  3CVY A;  2IFU A;  4N2S A;  1TEZ A;  4BTA A;  4R7L A;  3MA5 A;  4RG6 A;  4I9E A;  4U63 A;  2CHX A;  4LCT A;  2ZGG A;  3ABM E;  3URZ A;  5J08 A;  3SNX A; 
#chains in the Genus database with same CATH homology
 1FVF A;  3G2W A;  5FZR A;  4W9R A;  5LFA A;  3CHM A;  4I17 A;  3ZYK A;  3ZIM A;  4A3V A;  4AEZ C;  2R59 A;  3UT7 A;  3TGO A;  2L0T B;  1EDU A;  4MKT A;  1PC2 A;  3UMV A;  4JVS A;  1QZ2 A;  4WUY A;  4BTB A;  4U07 A;  2VSN A;  4AM9 A;  4GA1 A;  4M3O A;  5FZQ A;  3EIJ A;  3CVL A;  5FWQ A;  4PH4 B;  4G11 A;  1H19 A;  1JWF A;  5AJL A;  2CFU A;  2WXP A;  2E2E A;  3UUX A;  1UJJ A;  1JWG A;  3OAW A;  3AU5 A;  3PDN A;  4BX9 A;  3FU3 A;  1UN9 A;  1SQM A;  3CVW A;  4EBA G;  5BV0 A;  2VSO E;  4IN3 B;  3G2S A;  3KD7 A;  5LX8 A;  4BWR A;  3I5P A;  2CG2 A;  2X6I A;  4FA6 A;  2X38 A;  3K9I A;  4E6H A;  4G25 A;  5BNW A;  1QNF A;  4UI9 J;  3LKU A;  4GPK A;  3LPZ A;  2GRL A;  3S7D A;  3CHR A;  4ANV A;  3BG1 B;  5JJ6 A;  5AEN A;  4LER A;  1IQU A;  4HOQ A;  3ZGQ A;  3FTW A;  2A5U A;  2XCB A;  4ILH B;  4XI0 A;  4CDM A;  3D9N A;  4L2Y A;  3ZYQ A;  3SI5 A;  4CT0 A;  3CKB A;  3MX3 A;  1XGW A;  4FC8 A;  4PS8 A;  5JHB A;  3MKR A;  2RD0 A;  3LXU X;  3ZW3 A;  3KAE A;  5CHE E;  4YND A;  4OVV A;  3PS6 A;  4GB9 A;  3PNL B;  4JEH A;  1HU3 A;  3TXN A;  1N52 A;  2NC9 A;  3ASG A;  3FEX A;  4I6E A;  1E8W A;  3GW4 A;  2VJ8 A;  4WAF A;  3I4R B;  4BFR A;  2PQN A;  2I9C A;  3TAX A;  3IBE A;  2IQC A;  3RRN B;  3QWW A;  2FUL A;  4CGW A;  2KZT B;  1U3D A;  3S7B A;  3SFZ A;  1LF8 A;  2LO6 A;  3I4G A;  4ILG A;  3WXX A;  4HFG A;  3CSF A;  4FHK A;  4JHJ A;  2UWJ G;  4EPZ A;  3Q5M A;  3CVQ A;  4J0U A;  1SZ9 A;  5FQ4 A;  4JA7 A;  3EHM A;  5ENN A;  4J8F A;  1DVP A;  3CVV A;  4UQX A;  2ION A;  1OUV A;  3EDT B;  4JEU A;  1H0A A;  1NA3 A;  4I2W A;  2CHZ A;  1TJF A;  3GZS A;  4XI9 A;  4UWH A;  3QAR A;  4TUU A;  5ARG A;  5FZS A;  3FTX A;  2J4B A;  4KVO A;  4XKB A;  5FQ6 A;  3HIZ A;  2WXO A;  2BTD A;  2FO7 A;  1OWL A;  4H7X A;  2V4L A;  4J6I A;  2L9B A;  3ML8 A;  3RRU A;  3TG5 A;  2WXR A;  2BUG A;  3SBT B;  3DBS A;  2LSU A;  3ZPJ A;  4H7Y A;  4N3A A;  3ZVV A;  3UT8 A;  2GRM A;  2XRY A;  2VTB B;  2I1K A;  1BPO A;  2OV8 A;  4KXK B;  1Y6I A;  3FDH A;  3JUI A;  4I43 A;  2CFZ A;  3D9O A;  3MKQ A;  4N3C A;  2XHE A;  4KBQ A;  5A23 A;  2YNQ A;  5FT9 A;  4K03 A;  3QK0 A;  3EIQ C;  2R5S A;  3U66 A;  4AY6 A;  1MQS A;  3TXM A;  2FF4 A;  1IYG A;  1JUQ A;  5J90 A;  2IJG X;  3Q49 B;  3JQ0 A;  3FUL A;  5BPP A;  1HS6 A;  2C2L A;  5G04 C;  3SGH A;  5BT1 A;  1H6K A;  3Q15 A;  2YQ8 A;  5LOZ A;  3ZHE A;  3LVR E;  2WXF A;  2OND A;  4FUL A;  4N3B A;  1E90 A;  5BW8 C;  1ZBP A;  3CVU A;  2IF4 A;  3P1U A;  2KAT A;  2LSV A;  3GYZ A;  5FQ7 A;  3LY8 A;  3B7T A;  4G26 A;  4I6G A;  2XCC A;  3MYV A;  3RU0 A;  1E7U A;  1H2T C;  4GAA A;  1IQR A;  3ULQ A;  4UWK A;  1UN8 A;  3OXF A;  4U0S A;  3CVP A;  2KZT A;  4GA2 A;  4FLH A;  2AWI A;  3OTN A;  2J9Q A;  4KYO B;  2FI7 A;  2RG8 A;  5AJD A;  3D9M A;  3MV2 B;  2X6H A;  3T5V A;  5KJK A;  3EJN A;  4IRU A;  2YHE A;  3NZS A;  5ARF A;  4JHK A;  5EX0 A;  3SD5 A;  1WAO 1;  3CEQ A;  4XE0 A;  3RJV A;  3FTS A;  3ENE A;  5AYW D;  4I9C A;  3LJ3 A;  3LVQ E;  4TV3 A;  4GML A;  4LUN U;  3TG4 A;  1PAQ A;  2KC7 A;  2DIW A;  2MRI A;  4AP2 A;  1XNF A;  5LCW C;  4EZJ A;  1EYH A;  4GYO A;  3APF A;  4NQ0 A;  2BF0 X;  4WWO A;  3HVE B;  3ASF A;  3CVN A;  4CGV A;  2AXU A;  2VGX B;  3N71 A;  3NQP A;  4GMJ A;  4WND A;  3IV0 A;  4CCA A;  2WQ7 A;  1E96 B;  3G2T A;  3FUH A;  3FUJ A;  4HVB A;  5JJ7 A;  3APD A;  4TRQ A;  4DLO A;  3U64 A;  2X3M A;  4JW1 A;  1HG2 A;  2XGO A;  2V8S E;  3CLJ A;  3HHM A;  3RIB A;  3U3W A;  4QFV A;  3CHQ A;  1QQE A;  4PS3 A;  3FUK A;  5D0Q D;  5AIJ A;  3PZD A;  4I1M A;  1NA0 A;  4NRH B;  4KT6 B;  3ASD A;  3ZYM A;  4WWP A;  4ACL A;  4B0Z A;  2DCP A;  4WNF A;  4B8A A;  2FBN A;  2Y3A A;  3L16 A;  3QJZ A;  4KZ0 A;  1U3C A;  5G2N A;  4Y6W A;  3CK8 A;  2PZI A;  4ACK A;  3FFL A;  3FY4 A;  5FQ8 A;  3RRM B;  4AXH A;  5EDS A;  2XEV A;  5ANR A;  3D9L A;  1HG5 A;  2FEZ A;  4HOS A;  3ZYL A;  3RO3 A;  4B89 A;  2L6J A;  2WXQ A;  4DI4 A;  4UWL A;  1OWN A;  2WXJ A;  5DIZ A;  3GZ2 A;  3FTV A;  4GZ6 A;  2AVP A;  4PUC A;  4EQF A;  4JZY A;  4GCO A;  3CVX A;  4BT8 A;  1WY6 A;  3FEY A;  4FHJ A;  4E85 A;  2XPZ A;  3QNK A;  2XQ0 A;  4G1T A;  1GW6 A;  4JA9 A;  3PH0 C;  3B13 A;  5DBK A;  3Q47 B;  2C0M A;  3PRZ A;  4F1S A;  1WM5 A;  3FTZ A;  5C2Y A;  4CRW A;  5BUZ A;  2UY1 B;  3RK6 A;  5KJL A;  3P2B A;  3ASH A;  4OYS A;  5ANL A;  1N54 A;  4K0R A;  2ZU6 B;  3SBS A;  3ONL A;  2KCK A;  2WM9 A;  1ZU2 A;  2X6J A;  5T8I A;  3GZ1 A;  4G24 A;  3SF4 A;  4DK5 A;  5LCW J;  3UPV A;  3OXG A;  4EZL A;  2AW6 A;  3VLD A;  4KZC A;  1Y8M A;  3RO2 A;  2NSZ A;  3PE3 A;  4JL0 A;  4I1O B;  4EBA A;  4L7T A;  3APC A;  2WXM A;  3ZN3 A;  1Z3Y A;  3UQ3 A;  3FU6 A;  2VGX A;  4JXT A;  3UT4 A;  3CR3 A;  5CCL A;  2OVB A;  2HR2 A;  2XPI A;  3B7R L;  3QDN A;  4NUR A;  2VSY A;  5JHA A;  2HM8 A;  4RSY A;  3CK7 A;  4CEM A;  4CT4 A;  2HO1 A;  3B7U X;  3LS8 A;  5KCM A;  3ZFW A;  3D9K A;  3FH8 A;  1B89 A;  2IU1 A;  4GYW A;  4AVX A;  4EEC A;  4I2Z A;  4AIF A;  1FVH A;  3FUM A;  2WPV A;  1UJK A;  1HZ4 A;  3LEW A;  4WNE A;  3SHF A;  3NZU A;  2GW1 A;  4HXI A;  5M72 A;  2YIN A;  3CGH A;  3FUE A;  3NF1 A;  3ONK A;  4J8D A;  3G2V A;  2OVF A;  5CMY A;  3ZXS A;  5E76 A;  3PRE A;  4XIF A;  3ZEF A;  3FUN A;  2WXG A;  4FJY A;  2AXV A;  4MRU A;  3VTX A;  4B8C B;  4N5C A;  3ML9 A;  3TJP A;  2J4D A;  2WXI A;  3U4T A;  3R7Q A;  4CDN A;  1IHG A;  4WNG A;  3FUF A;  4U0Z A;  1KT1 A;  3HDX A;  2R17 C;  4WWN A;  4NAC A;  2NXP A;  4L1B A;  4ILI A;  3CV0 A;  1H2U A;  4Y6C A;  2PM7 A;  3FHE A;  2J09 A;  4PS7 A;  3L22 A;  3PUJ A;  5KJM A;  2EQX A;  3BG0 B;  2OOE A;  3MJW A;  3VTY A;  4G23 A;  4F3V A;  1E8X A;  5FJY A;  3FTU A;  4D10 C;  4DJA A;  3QC1 A;  2CG3 A;  3D3M A;  3G2U A;  3IKO B;  5HI7 A;  4L23 A;  4GZ3 A;  4DPR A;  3FWV A;  3IHV A;  1OWM A;  4UQZ A;  3S7J A;  5FTP A;  3LDZ A;  2LAH A;  4HS2 A;  1P5Q A;  2UY1 A;  4GZC A;  5G04 J;  2J07 A;  3C98 A;  4J8E A;  4UWG A;  3MV3 B;  3MEK A;  3D9I A;  3AS4 A;  3L08 A;  4OVU A;  2XRZ A;  2IOL A;  4O6F A;  4MS6 A;  2E0I A;  3MGB A;  3TL5 A;  4Q69 A;  4ATG A;  4C0E A;  4XX5 A;  4IUL A;  2VQ2 A;  4G2V A;  1JPL A;  2WXN A;  3QAQ A;  3DPD A;  4GU5 A;  1HFA A;  2VYI A;  5D0O D;  4GZ5 A;  4AOF A;  1HXI A;  4ANX A;  3CHP A;  1HO8 A;  4HOU A;  1EPU A;  5T4Y A;  2VTB A;  1NP7 A;  4BT9 A;  2J08 A;  3B7S A;  3EHN A;  1UW4 B;  2WXH A;  3CQC B;  5G55 A;  4JPS A;  3ESL A;  4APO A;  3MZL B;  4PDX A;  4A3T A;  2WQH A;  2YHC A;  3FH7 A;  1A17 A;  3CIA A;  2I6H A;  4JHR A;  3CST A;  4UI9 K;  4JC8 A;  4A1G A;  2LAI A;  1DNP A;  4FU3 A;  4F7A A;  1UG3 A;  3BEE A;  2WMO A;  1E8Y A;  3FH5 A;  4L2L A;  5CMW A;  1VDY A;  4BX8 A;  2I2O A;  4U8H A;  5E75 A;  3LYA A;  3ESK A;  1OWP A;  3MKQ B;  4FAD A;  2GGF A;  2L0I A;  3FP3 A;  5A7D B;  4HOR A;  1FCH A;  4Q94 A;  4C0M A;  4Q96 A;  3MCX A;  4B94 A;  3ZRH A;  4ABN A;  3CQG B;  2I1J A;  3PVL A;  2VGY A;  4YVQ C;  2C0L A;  4U04 A;  2AXZ A;  2X6F A;  3ZHE B;  4BSX A;  1Z6T A;  3SZ7 A;  3CK9 A;  1HF8 A;  3E4B A;  3FU0 A;  4N39 A;  5JJT A;  4YVO A;  2WMN A;  2DBA A;  1EF1 C;  2XPY A;  1KT0 A;  3S7F A;  4RG9 A;  3JCK C;  3UX4 A;  4EZK A;  3FU5 A;  1HH8 A;  1KLX A;  2M63 A;  3IHY A;  3PUK A;  3S2A A;  3PEU B;  4GYY A;  2XGS A;  4FP7 A;  1YA0 A;  2LNI A;  2V0P A;  5EKQ D;  1E7V A;  3T8M A;  4UQY A;  1HX8 A;  3L6A A;  3LY7 A;  2WXL A;  4F53 A;  4HOT A;  2Y4U A;  2VSX E;  3QKY A;  3O48 A;  4AV7 A;  4IYP A;  5CCM A;  4U0U A;  3T5X A;  3L13 A;  2Y4T A;  1PY1 A;  4V3I A;  1S0P A;  4UWF A;  3HVE A;  3OXL A;  1ELR A;  3R9A B;  2JLB A;  1Z3X A;  2WVI A;  3CHO A;  1H2V C;  3JQ1 A;  4AJW A;  2PM6 A;  4N2Q A;  3PE4 A;  4URK A;  4KVM A;  3AS5 A;  4DLQ A;  2PQR A;  1INZ A;  4HLE A;  4XKC A;  3D9J A;  5A6C A;  3D9P A;  2PL2 A;  1OWO A;  2A4Z A;  5G05 C;  1W3B A;  2MOW A;  2WXK A;  3KS2 A;  2MHK A;  2ILR A;  3HYM B;  3QOU A;  3LY9 A;  1MHQ A;  4GZD A;  4ME2 A;  3LCA A;  3U9W A;  4XZ4 A;  2QY7 A;  2HYZ A;  2V5F A;  2XGM A;  4DI3 A;  1ELW A;  1HE8 A;  1X5B A;  3AU4 A;  3L54 A;  2X6K A;  3QB2 A;  4FJZ A;  3FUI A;  4FLB A;  4J8S A;  4RVB A;  2KCL A;  3FUD A;  4LEU A;  1TJC A;  1SZA A;  3RKV A;  4I1A A;  2Q7F A;  3PEV B;  2P58 C;  4A55 A;  2JEK A;  1L5J A;  2KM4 A;  3I3N A;  2J49 A;  5T3R A;  3CVY A;  1NZN A;  2IFU A;  4N2S A;  3QWV A;  1TEZ A;  3CHS A;  4BTA A;  4CDR A;  4R7L A;  3IEG A;  3FTY A;  3MA5 A;  5C1D A;  5HQ8 A;  5KJN A;  2IOS A;  3PNT B;  3CKC A;  4I6J A;  3VLE A;  4BY6 A;  4GA0 A;  5EX3 A;  4GCN A;  3Q4A B;  2KCV A;  3L17 A;  3VLF A;  4RG6 A;  4I9E A;  4U63 A;  2CHX A;  4LRZ A;  4APF A;  3JYS A;  4LCT A;  3QWP A;  5G05 J;  5BV1 A;  4ANW A;  3O4Z A;  2CHW A;  4MLP A;  4P29 A;  4A1S A;  3URZ A;  1E8Z A;  4KMO A;  3KEZ A;  3R7R A;  3AS8 A;  5J08 A;  2QFC A;  2WB2 A;  1ELK A;  4C9B B;  4UI9 C;  4ANU A;  3SNX A;  4AY5 A;  5LP0 A;  2WQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...