1XNFA

Crystal structure of e.coli tpr-protein nlpi
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
259
structure length
259
Chain Sequence
b'KSEVLAVPLQPTLQQEVILARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein nlpI
publication title The crystal structure of NlpI. A prokaryotic tetratricopeptide repeat protein with a globular fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 104
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1xnfA00
3ULQA 1OUVA 1QZ2A 3S7DA 2VGYA 5EX3A 4UI9J 3ASFA 5BNWA 2QFCA 4BTBA 3LYAA 5CHEE 4KBQA 4KXKB 3Q49B 3RO2A 3CK8A 4GPKA 2R5SA 3AS4A 3HYMB 1E96B 5D0OD 3MEKA 2UWJG 3AS8A 4HORA 4BT9A 3K9IA 3IEGA 3N71A 5FZRA 2YHCA 3FWVA 3GZ1A 5G05J 5EX0A 3ZHEA 3ZGQA 2LSUA 3ASHA 1WAO1 4JA7A 2C2LA 3TG4A 1FCHA 2I6HA 2KCVA 4F3VA 3JYSA 3LPZA 2DBAA 4RG6A 1PC2A 2XPIA 5M72A 2VGXA 5KJKA 3GZ2A 2YQ8A 3CV0A 4H7XA 4J8EA 2UY1A 2UY1B 2KATA 2GW1A 4IN3B 3S7JA 3GW4A 5HI7A 1KLXA 4U0UA 3CKBA 2VYIA 2BUGA 4AM9A 5G05C 4N3BA 2FF4A 3KAEA 1P5QA 4U0SA 2LSVA 4AIFA 1WM5A 3TAXA 2VQ2A 3PDNA 2WPVA 4AY6A 1XNFA 4I1AA 4N3CA 2XCCA 1W3BA 3MKRA 3SF4A 4U0ZA 3CK7A 4J8DA 3CKCA 3OXFA 5HQ8A 3OXGA 4GCNA 3ZN3A 4I9EA 4HOUA 4G23A 5JJTA 1HH8A 4XIFA 4ME2A 4BWRA 4AY5A 5CCMA 2IF4A 4J0UA 3RO3A 2V5FA 2FEZA 5KJNA 3PE3A 3LY8A 3MA5A 4WNFA 4UQZA 2PZIA 2LNIA 3FP3A 4H7YA 4N2QA 3UPVA 1HXIA 4UQXA 1YA0A 3AS5A 2XGMA 1ZU2A 2IFUA 3S7BA 1NA0A 4N5CA 3CVPA 3OXLA 4JA9A 5AYWD 5BW8C 3PE4A 4GZ5A 3MV3B 4GYYA 5FZQA 2KCLA 1KT0A 2C0LA 5FT9A 3ZHEB 3ASGA 3NF1A 4G24A 5LCWJ 4Y6WA 5ARGA 2FI7A 4N39A 4APOA 2FBNA 5ARFA 2KCKA 2XGOA 2MHKA 4EQFA 2VSNA 3MV2B 3QKYA 5EKQD 4CDRA 4WNDA 2HR2A 4GZ6A 4ABNA 4WNEA 2VGXB 3Q15A 4I2ZA 4WNGA 2ONDA 3CEQA 2Q7FA 3BEEA 3EDTB 4GA0A 4YNDA 3CK9A 3TG5A 4G26A 4NRHB 1IHGA 2NC9A 3RIBA 2OOEA 5LCWC 3WXXA 3ZFWA 2XCBA 3RKVA 4HOSA 5DBKA 2XGSA 3Q5MA 3KS2A 3CVLA 3QWWA 3CVNA 4U04A 2E2EA 4BTAA 2P58C 4I17A 5KJMA 4HOQA 2HO1A 4B94A 1ZBPA 5CCLA 5JJ6A 2C0MA 2JLBA 2PQNA 3UQ3A 4HOTA 4UQYA 3RU0A 4O6FA 3ESKA 2PQRA 5DIZA 3Q47B 4WUYA 1A17A 5C1DA 4BT8A 4GCOA 4JHRA 3TGOA 1NA3A 2WQHA 5KJLA 5FJYA 3UUXA 4XI9A 2PL2A 1ELWA 5G04J 3KD7A 4W9RA 3LKUA 4I2WA 3U4TA 2FO7A 4G1TA 4G2VA 5A7DB 3QWPA 1ELRA 4GYOA 3QDNA 4J8FA 2XEVA 5JJ7A 3QOUA 2AVPA 4YVQC 3R9AB 4RG9A 1HZ4A 1IYGA 2HYZA 4N3AA 3QWVA 4UI9C 3FFLA 4CGWA 5BT1A 1NZNA 1Y8MA 4LEUA 2J9QA 4U07A 5FTPA 3VTYA 1QQEA 4GZ3A 3U3WA 2Y4UA 5FZSA 4UI9K 5G04C 3O48A 4GA1A 3S7FA 3GYZA 5A6CA 2VSYA 4JL0A 4NQ0A 1TJCA 3SZ7A 1KT1A 3LY7A 4CGVA 3URZA 4Y6CA 3Q4AB 3VTXA 4GYWA 3LY9A 4I9CA 4KYOB 3ASDA 4G25A 3CVQA 2KC7A 3ZPJA 5D0QD 1B89A 4N2SA 3E4BA 4A1SA 4YVOA 4GA2A 2L6JA 3RJVA 3LCAA 4XI0A 2Y4TA
chains in the Genus database with same CATH superfamily
4JHJA 3ULQA 4ILIA 3TWTA 4CRWA 4HI8A 2VGYA 5ANLA 4PS7A 4OAUC 1S64A 1WDYA 1NI1A 1UG3A 4GMRA 1XGWA 2CFZA 2QFCA 2WXHA 2L0TB 2V4LA 4KXKB 4GPKA 4MRUA 3CVWA 4L7TA 2ETCA 3CGHA 2WXKA 1E96B 5D0OD 3CSTA 4TUUA 2X3MA 3G2WA 4PH4B 3D9NA 2AW6A 4K0RA 3ML9A 4ANWA 3B7RL 4EZLA 3FUMA 2VTBA 3FWVA 4A3TA 4UWGA 3B13A 1KPSB 2WXMA 3Q7AA 4K5AB 4L2YA 4C48B 4IULA 4CZ2D 3VLDA 1WAO1 4EZKA 2QYUA 3FTSA 3JYSA 1Q2ZA 3BG1B 4QFVA 5AJDA 2XPIA 5M72A 2YQ8A 4AP2A 2BF0X 2IONA 2KATA 3Q7FA 5CMWA 1GW6A 2R17C 4U8HA 4MBGA 3CKBA 2VYIA 2IEJA 2WXRA 2FF4A 2XHEA 4U7EB 4I43A 3PDNA 1N4PA 1UN8A 5CERB 5ENNA 3AU5A 1OWMA 4N3CA 3CIAA 3C98A 2RFMA 3D9OA 4HRMB 2BTDA 4FHJA 4FP7A 3SF4A 1D9SA 5HQ8A 4GZCA 3EHNA 2CFUA 5D66A 3ZN3A 2AWIA 4HOUA 4BETA 3D9MA 2QZAA 1JWFA 2R05A 4XIFA 4LNBA 4BWRA 3APDA 5CECB 5FQ6A 2V5FA 1BLXB 3FUJA 5ENQD 4WNFA 1BPOA 2AXVA 4UQZA 1MX4A 2LNIA 1HO8A 4PUCA 4WAFA 1HXIA 1YA0A 4LRZA 3AS5A 1JCRA 2XGMA 1IXVA 3S7BA 4GU5A 3JUIA 1FPPA 3UM1A 3OXLA 3TWRA 2OEWA 5AYWD 3T5VA 5KWDA 5AENA 5LFAA 4GTSA 5LCWJ 1QBQA 4APOA 3B7SA 2LXLA 3HXFA 2IY0C 4WNDA 4OVUA 4GTRA 1Y6IA 4WNEA 5AQAA 4EBAA 4WNGA 3CVYA 3FHEA 4XX5A 2I2OA 3NB2A 4JEHA 5CRUA 3UT8A 2X6HA 4G26A 1IKND 3R7QA 1IHGA 3CHSA 1SZAA 4PDXA 4LNUD 4CYMD 2OOEA 3LXUX 2OV8A 5LCWC 3WXXA 1NL4A 1MQSA 3CVNA 4HBDA 4HOQA 3QB2A 1UN9A 2RKKA 4U8YD 1SZ9A 3DWLG 3SFZA 3T8MA 2C0MA 4HQDA 4OYSA 4K5CA 2P9LG 4O6FA 1E7UA 3ESKA 5AN8A 2PQRA 1N9AA 3ZXSA 5DIZA 2F37A 2J4BA 2P9UG 1DCEA 4JZYA 4Q69A 3CSFA 5BXOA 4MLPA 4JHRA 4JPSA 4EECA 3E34A 5JHBA 3APFA 4DI4A 5FQ8A 4AOFA 2V8SE 2P9IG 5G04J 2AXUA 3LKUA 3E32A 2PM6A 3ONLA 4BSXA 3KSLA 3RAUA 4GYOA 3ZYQA 3QOUA 2H6HA 2BKGA 4ATZD 2HYZA 5FIOA 4J8YA 2DYSE 4XEIG 4F1SA 3QWVA 4UI9C 4CGWA 2Y69E 2WM9A 4CCAA 2XQ0A 1MYOA 4DJAA 3C3QA 3FU6A 2H6IA 3D9IA 3O4ZA 5G04C 3O48A 4GA1A 3TXMA 2R03A 3GYZA 4F1PA 4JL0A 4DLQA 4HVBA 2EILE 4JXTA 3DEOA 3LY7A 4JHKA 4CGVA 3P2BA 3Q4AB 5HRYA 4GYWA 2X38A 4TXQA 3DSXA 1TR4A 2KC7A 5D0QD 4A1SA 4YVOA 3OTNA 2WQ6A 1K8KG 1DNPA 1AWCB 3W9GA 2F8XK 3V2XA 1OWLA 3CHOA 3RJVA 2QY7A 3CR3A 3LCAA 2J08A 3C5RA 2Y4TA 3ML8A 3T8KA 3UM3A 2ILRA 1OUVA 3SD5A 4BERA 3QNKA 4D10C 5EIDA 2VJ8A 2AXZA 1MX2A 2IOSA 3SBSA 3FUEA 4CT0A 2XPZA 2DVWA 1A5EA 5CHEE 5LP0A 4KBQA 3Q49B 3SNXA 3CK8A 3FDHA 3AS4A 4PS3A 4I1OB 1X81A 3DXMG 3MEKA 3AS8A 3SY2A 1HE8A 4YDEA 4HORA 4RLYA 1HF8A 5T3RA 4Z68A 1YMPA 2MOWA 2YHCA 4L23A 4YDWA 5ITZF 4DX2A 4KVOA 3ZGQA 4DX5D 4E6HA 3OAWA 3ENEA 5T4YA 4GTQA 5EYPF 3TG4A 3PUJA 4N5QA 2I6HA 2ETBA 4F3VA 4RG6A 1PC2A 4R7LA 2VGXA 3L13A 5KJKA 4H7XA 2UY1B 3SI5A 5HI7A 2QYJA 4U0UA 2BUGA 4AM9A 4K03A 4L1BA 3T9KA 4N3BA 1TEZA 5J90A 2X6KA 4FJZA 4U0SA 3BU8A 3DRAA 4NIKA 1SVXA 5ANRA 4AIFA 5BV1A 4C0EA 1V54E 2MRIA 1K1BA 3AG2E 2WPVA 2EIKE 1XNFA 2XCCA 2CHZA 1N0RA 1EYHA 4CT4A 1W3BA 4AV7A 3MKRA 3TWWA 4U0ZA 3CK7A 3C3OA 1LD7A 3EHQA 3CQCB 4GCNA 3ZEFA 1S70B 5JJTA 4KMOA 4AY5A 5CCMA 2IF4A 4HNAD 4JW1A 4C0MA 3KSQA 4JD2G 3LY8A 1TNYA 3CQGB 3MA5A 3RRMB 1RW2A 3EUVA 2GRPB 5JMND 3L9TA 5KNHD 2KXPC 3UPVA 2V5QC 4UQXA 5IY5E 1OT8A 3PH0C 4U8VD 3D3MA 5HS0A 3FUFA 3X2QE 1ZU2A 2XS1A 2ZXWE 3UM0A 2EQXA 2EIME 3CVPA 3FUDA 3WG7E 1U2VG 5BW8C 3PE4A 3MV3B 3ZRHA 3UXGA 2GRLA 3DSSA 3NQPA 2KCLA 4DX6D 2CG2A 4G24A 4JVSA 1DVPA 5ENRD 2FI7A 3Q9NC 4YDYA 2FBNA 4C9BB 3FY4A 3PZ3A 5AIJA 5EILA 2VGEA 3MV2B 4BY6A 2I1KA 3QC1A 1SA5A 3TL5A 4U96D 4ABNA 2NXPA 2A4ZA 2VGXB 2CG3A 2Y0BG 2WQ7A 2ONDA 3CVXA 1HFAA 1TNBA 2Q7FA 4EZJA 3BEEA 4WWOA 2EINE 1EF1C 3ABKE 4ZFHA 4NRHB 2NC9A 4WWPA 3V79K 2V4HC 3ZFWA 2XCBA 3RKVA 3KS2A 3CVLA 1LTXA 4L9PA 3QWWA 1DCQA 4U04A 4ZHBA 3ZXPA 1MX6A 4O60A 1ZBPA 2I1JA 3ONKA 3ESLA 5CCLA 3HXCA 2KM4A 1E90A 2Y3AA 3G2UA 4IRUA 3UQ3A 4HOTA 4UQYA 2HM8A 3PS6A 4G11A 3PZ4A 5J08A 2IOLA 1ZB1A 3Q47B 4UWHA 3UI2A 3R7RA 5CEAA 1N94A 4HS2A 2YNQA 5FQ4A 3B7UX 3MKQA 4BT8A 4JEUA 4APFA 3C72A 3IKOB 4DLOA 3CHPA 2FULA 5FJYA 3U66A 3UUXA 2WMOA 3W9FA 3NZSA 3RRNB 4CDMA 4AXHA 3MJWA 1LD8A 3GZSA 1N4RA 3PZ1A 3DBSA 4GTOA 1TNOA 3Q73A 3JCKC 1ELRA 2YHEA 1H6KA 3QDNA 3DPDA 4J8FA 2XEVA 5JJ7A 1YYHA 1E8WA 3RRUA 4F7AA 3R9AB 4B93B 4AJWA 3UX4A 5AAOA 4URKA 4DRXE 3FTYA 2J9QA 4FC8A 5FTPA 2NYJA 3HVEB 4GZ3A 1NFIE 3B7BA 3UM2A 3EIJA 2OEVA 3U3WA 2A5UA 2Y4UA 4GTVA 4LSZE 1VDYA 2JABA 3L08A 3ZKJA 4NQ0A 1TJCA 3URZA 4HI9A 3PNLB 4IYPA 4YDOA 4AVXA 3LJNA 4F53A 4G8LA 3JXJA 4GTMA 2VSOE 3E30A 3ASDA 3IV0A 3CVQA 1HX8A 3ZPJA 3IXEA 3G2SA 4N2SA 3E4BA 1JPLA 2OVFA 3L6AA 1JCSA 1O1TA 4FLHA 4GPMA 3G2TA 4DK5A 2IQCA 4KZCA 4TV3A 3BQOA 4HLEA 2J49A 3J5QB 3ZYKA 2GRNB 3FTWA 2VSXE 3PVLA 2KZTB 3MKQB 3P1UA 1QZ2A 3V2OA 1SW6A 5EX3A 4UI9J 4ATGA 3RSEG 4B8AA 5BNWA 1WY6A 1YCSB 4BTBA 3QAQA 3LYAA 4I6JA 3MYVA 3NOCD 4L2LA 1TYQG 3DSVA 3RO2A 3DSWA 1EDUA 4GTPA 1D8EA 2JEKA 2PM7A 4GTTA 4UWKA 2J07A 5EN5D 3SQVA 3FH7A 1N54A 5EIBE 4QQIA 1PY1A 2B6CA 4KZ0A 3D9HA 4GB9A 2R2LA 3KEAA 2WVIA 2H6FA 1MZCA 1G3NB 1L5JA 3HIZA 3LS8A 3LVRE 5AQ7A 3ZHEA 3G2VA 3UIPC 2L9BA 2WXGA 2P9KG 3D9JA 4FU3A 3EJNA 1BI7B 5AJLA 2P9NG 4JA7A 1H2UA 3AAAC 2KCVA 4O1PA 3EHMA 1N4QA 3LPZA 3BUAA 5ENPD 3GZ2A 3ULYA 1DC2A 4BEPA 2UY1A 2GROB 1X5BA 4IN3B 3S7JA 4X8QA 1KLXA 5BV0A 1O5MA 5C2YA 1OWPA 4U95D 4A1GA 4HXIA 2DZNA 3MGBA 2LSVA 4OAVB 4BX9A 3AG1E 3NOGD 4J6IA 3HRAA 5CBOA 4NACA 2QC9A 2R02A 2CHXA 2OVBA 3D9KA 1N95A 3CKCA 3ULEG 3OXFA 5CBNA 2B0OE 3RK6A 2ZISA 3IHVA 2WXIA 4I9EA 3ZUVB 1HH8A 4ME2A 2J8SD 3I4RB 5ENTD 3CHMA 3ASNE 1KZOA 3Q79A 2WXLA 2F0YA 3TJPA 2PZIA 4LG6A 2DIWA 3V30A 5EDSA 4H7YA 3U64A 4UWLA 1Z5SC 4M3OA 1TN6A 1NA0A 5AQ9A 4ANVA 3QARA 4JA9A 4GZ5A 4KVMA 1UJJA 3AU4A 4K5BA 3FU5A 2M63A 3TWVA 3ZHEB 2DCPA 3ASGA 3NF1A 3FH5A 4Y6WA 5ARGA 4N39A 3V31A 1FT1A 1BD8A 3LDZA 5ARFA 4RSYA 2LUHA 3ZYMA 3PREA 1H2VC 4BX8A 3AG4E 3QKYA 3UIOC 5EKQD 2BEDA 3KEZA 3ZYLA 4GZ6A 2YINA 3TWQA 3Q15A 4I2ZA 2XZDG 5HKPA 3CEQA 2ZGDA 1H2TC 3EDTB 3PEUB 4FHKA 4RVBA 3CK9A 3L54A 3L82A 1SQMA 3RIBA 2L6BA 5ENSD 4HOSA 4DX1A 2DZOA 1K1AA 4B89A 2P58C 5FQ7A 5KJMA 1OWOA 5FWQA 4B94A 5KBAA 4F6RD 4UUCA 1E7VA 3IBEA 3LVQE 3DEPA 3PNTB 2P2CP 2L0IA 3UINC 1Z3XA 2LXMA 2E0IA 1A17A 2V0PA 3UTMA 3B95A 3J5PA 3TGOA 3TWSA 2FO1E 2WQHA 2WMNA 3PEVB 1HG5A 3IHYA 4XZ4A 3ABLE 3VLEA 3B7TA 3U9WA 1ELWA 3HXEA 2IO3C 1OXJA 4W9RA 2CHWA 3FEXA 5CRVA 3FU3A 2FO7A 3FEYA 3ISMC 4G2VA 5B1BE 2Y1LE 3MCXA 3E37A 5BPPA 2AVPA 3HG0D 4KT6B 4YVQC 4RG9A 1IYGA 4P29A 3FTUA 3FUHA 3FFLA 1NZNA 1Y8MA 3DXKG 4U07A 1EPUA 3VTYA 1FVHA 4PS8A 3HVEA 1QQEA 3MZLB 3FUNA 3D9PA 1N11A 2WXFA 1QNFA 1TJFA 2EIJE 3NBNB 1QYMA 4UI9K 3S7FA 5A6CA 4CEMA 3HDXA 1S63A 1MJ0A 1KT1A 3UT7A 4TRQA 3JUEA 2OCCE 3D9LA 4HB5A 1HU3A 3R9MA 2A5EA 1AP7A 3JQ1A 4I9CA 4KYOB 3UKUG 2KBXA 2DYRE 3DSUA 4G25A 1PAQA 1D8DA 3PRZA 3FULA 4HLLA 1B89A 3ZU7B 4MS6A 3I5PA 1E8YA 2XEEA 2XRYA 4JB8P 4DPRA 2WB2A 2L6JA 1E8ZA 1FVFA 2WXOA 3FH8A 5H7PA 2KZTA 3Q78A 1N4SA 3VLFA 2AJAA 4ILHB 4V3IA 5ENOD 3S7DA 1K3ZD 2GRQB 3CHQA 3ASFA 3FTVA 3PZ2A 5CEDB 1N52A 4NURA 3APCA 2XRZA 1MHQA 2P9SG 3Q9UC 2R5SA 3HYMB 3LJ3A 4TUMA 1S0PA 2UWJG 2IU1A 4DX7D 1E8XA 4BT9A 3K9IA 4DI3A 5EYLA 3IEGA 2XENA 1UOHA 3N71A 2GRRB 5FZRA 1HG2A 4ACLA 4LCTA 2VTBB 3GZ1A 2X6JA 2H6GA 1TN8A 4GMLA 5G05J 5EX0A 3S2AA 3L22A 3QK0A 4FA6A 2LSUA 3ASOE 4XKBA 3AG3E 3Q75A 2LAIA 3ASHA 2BKKB 5LOZA 5B1AE 1OCZE 1NP7A 2C2LA 4TXPA 1OY3D 1FCHA 1U3CA 4ANUA 4BESA 5KCMA 2DBAA 3CV0A 4J8EA 3FUKA 2GW1A 3GW4A 1Z6TA 4I1MA 5G2NA 1JCQA 4A55A 3UMVA 5G05C 3KAEA 1P5QA 1WM5A 4Q94A 2VQ2A 3TAXA 5D2MC 3ZW3A 1BU9A 2GGFA 1U3DA 2WXPA 2IO2C 4B8CB 3SHFA 4AY6A 4I1AA 4HFGA 3CVVA 4DUIA 1LF8A 5JHAA 4JC8A 2XZTG 5BXUA 4J8DA 5AARA 3F6QA 3OXGA 1OWNA 3TXNA 1N0QA 4G23A 3T5XA 4FADA 4J0UA 3RO3A 1H6PA 2FEZA 5KJNA 2RFAA 3PE3A 2IJGX 2XPYA 3E33A 4GMJA 4A63B 4FLBA 1JUQA 3FP3A 4N2QA 1UW4B 3EHRA 2J09A 2MYOA 2IFUA 1ELKA 2ZGGA 2P9PG 5E76A 4O1OA 2I9CA 4N5CA 3FU0A 1SA4A 4FULA 4GYYA 5FZQA 3JQ0A 1KT0A 2C0LA 5FT9A 1IQUA 4G8KA 2KCKA 2XGOA 1TNZA 2MHKA 4EQFA 2VSNA 4CDRA 2HR2A 3HXBA 3PUKA 2ZIRA 1BI8B 4CDNA 4XE0A 4BSZB 5CMYA 4Q96A 2PNNA 5E75A 1Z3YA 2LO6A 3EIQC 4GA0A 4YNDA 1WG0A 1TN7A 3HHMA 3LEWA 3TG5A 3MX3A 3DPYA 2HE0A 4B0ZA 2ZU6B 3CHRA 1OCCE 3NAWA 2J4DA 4AEZC 1OCOE 5DBKA 4I6GA 2XGSA 3Q5MA 2X6IA 3FUIA 3AJIA 3CVUA 3NZUA 2E2EA 4BTAA 4I17A 1RZ4A 4U63A 5BUZA 4UWFA 5FINA 2HO1A 1V55E 3HXDA 2F8YA 3EU9A 3I4GA 2RD0A 5JJ6A 3ZVVA 2JLBA 2PQNA 5KNGA 1IQRA 3SO8A 3RU0A 3C3RA 4ILGA 4I6EA 1O1RA 2XS8A 3ZNGA 4FJYA 5A23A 1H6OA 2XEHA 2RG8A 4WUYA 1KZPA 3UT4A 4XKCA 5C1DA 2LAHA 5T8IA 4EBAG 4GCOA 4TXRA 2R59A 4ANXA 1NA3A 3SBTB 4EPZA 3I3NA 4RQIA 2WXJA 3ABME 5KJLA 3DSTA 2X6FA 3PZDA 1OCRE 4XI9A 1FT2A 4GZDA 2PL2A 3KD7A 4EHMA 4I2WA 3U4TA 4G1TA 5A7DB 3QWPA 3TWUA 3L17A 4HRLA 4OVVA 4J8SA 4ACKA 2GRMA 3TWXA 1HZ4A 3SFYA 4N3AA 2NSZA 3BG0B 4LERA 5BT1A 4LEUA 4E85A 1IHBA 4GAAA 3L16A 4J7WA 5FZSA 1H0AA 4MKTA 2DWZA 3UKRG 2VSYA 5AQBA 3CLJA 1TNUA 1UJKA 5B3SE 1O1SA 4LUNU 3SZ7A 1INZA 2ETAA 4Y6CA 2WXQA 3VTXA 3LY9A 3SGHA 3FTXA 5G55A 3EU5A 4M7CA 3FTZA 4HRNA 4A3VA 2WXNA 3JXIA 3ZIMA 5JA4D 3SFXA 1JWGA 4GA2A 4XI0A 3QJZA 1H19A 4LNGA 1HS6A 4WWNA 5LX8A 4BFRA
chains in the Genus database with same CATH topology
3VLFA 4JHJA 3MKQB 2ILRA 3P1UA 1OUVA 1QZ2A 4ILHB 4ILIA 4V3IA 3SD5A 3ULQA 4CRWA 3QNKA 3S7DA 4D10C 2VGYA 5ANLA 4PS7A 2VJ8A 2AXZA 5EX3A 4UI9J 4ATGA 2IOSA 1UG3A 3CHQA 3SBSA 3ASFA 3FUEA 1XGWA 2CFZA 1WY6A 2QFCA 2WXHA 3FTVA 4B8AA 3QAQA 4BTBA 2XPZA 3LYAA 4CT0A 1N52A 2L0TB 4I6JA 5CHEE 2V4LA 3MYVA 3APCA 4KBQA 4L2LA 4KXKB 4NURA 3Q49B 5LP0A 2XRZA 3SNXA 3RO2A 1MHQA 3CK8A 3FDHA 4GPKA 4MRUA 2R5SA 3AS4A 4PS3A 3HYMB 3CVWA 4L7TA 3LJ3A 3CGHA 4I1OB 1EDUA 2WXKA 2JEKA 1E96B 1S0PA 3CSTA 3MEKA 2UWJG 2IU1A 2PM7A 3AS8A 4UWKA 5D0OD 2J07A 1E8XA 1HE8A 4HORA 4BT9A 4TUUA 3K9IA 3FH7A 4DI3A 2X3MA 1HF8A 1N54A 3G2WA 3IEGA 4PH4B 1PY1A 5BNWA 5T3RA 3D9NA 2AW6A 3N71A 5FZRA 4KZ0A 4K0RA 2MOWA 4GB9A 2YHCA 3ML9A 4ANWA 1HG2A 3B7RL 4L23A 4ACLA 4EZLA 3FUMA 4LCTA 3FWVA 4A3TA 3GZ1A 2VTBB 2X6JA 4UWGA 2VTBA 5G05J 4GMLA 3B13A 5EX0A 3S2AA 2WXMA 2WVIA 3L22A 1L5JA 3HIZA 3LS8A 3LVRE 3QK0A 3ZHEA 4FA6A 3G2VA 4KVOA 4L2YA 3ZGQA 2LSUA 2L9BA 2WXGA 4XKBA 4IULA 3D9JA 2LAIA 4E6HA 3OAWA 3EJNA 3ASHA 4FU3A 3VLDA 5AJLA 5LOZA 3ENEA 1WAO1 4JA7A 4EZKA 5T4YA 1NP7A 1H2UA 2C2LA 3TG4A 3PUJA 1FCHA 2I6HA 2KCVA 3EHMA 1U3CA 4ANUA 3FTSA 3JYSA 3LPZA 4F3VA 3BG1B 5KCMA 2DBAA 4QFVA 1PC2A 4RG6A 2XPIA 4R7LA 2VGXA 3L13A 5AJDA 5KJKA 3GZ2A 2YQ8A 5M72A 3CV0A 4H7XA 4J8EA 2BF0X 2IONA 3FUKA 4AP2A 2UY1A 2UY1B 2KATA 3SI5A 5CMWA 2GW1A 1GW6A 1X5BA 4IN3B 3S7JA 2R17C 4U8HA 3GW4A 5HI7A 1Z6TA 1KLXA 4I1MA 5G2NA 5BV0A 4U0UA 4A55A 3CKBA 5C2YA 1OWPA 2BUGA 2VYIA 4AM9A 3UMVA 4A1GA 4K03A 4HXIA 2WXRA 4L1BA 5G05C 4N3BA 2FF4A 1TEZA 2XHEA 5J90A 2X6KA 1P5QA 3KAEA 3MGBA 4FJZA 4U0SA 2LSVA 4AIFA 1WM5A 4Q94A 5ANRA 5BV1A 2VQ2A 3TAXA 3ZW3A 4I43A 4C0EA 3PDNA 4BX9A 1UN8A 2MRIA 2GGFA 1U3DA 5ENNA 2WXPA 3AU5A 4B8CB 4J6IA 2WPVA 3SHFA 4AY6A 1XNFA 4I1AA 4HFGA 3CVVA 1OWMA 4NACA 1LF8A 2XCCA 4N3CA 3CIAA 5JHAA 3C98A 2CHZA 1EYHA 4CT4A 1W3BA 4AV7A 3D9OA 4JC8A 2BTDA 2CHXA 3MKRA 4FP7A 2OVBA 3D9KA 4FHJA 3SF4A 4U0ZA 3CK7A 4J8DA 4CDMA 3CKCA 3OXFA 5HQ8A 3OXGA 4GZCA 3EHNA 2CFUA 3RK6A 3IHVA 1OWNA 2WXIA 3TXNA 3CQCB 4GCNA 3ZN3A 2AWIA 4I9EA 3ZEFA 4HOUA 3D9MA 4G23A 5JJTA 1HH8A 1JWFA 4XIFA 4KMOA 3T5XA 4FADA 4ME2A 4BWRA 3I4RB 4AY5A 5CCMA 2IF4A 4JW1A 4C0MA 3APDA 3CHMA 4J0UA 3RO3A 5FQ6A 2V5FA 2FEZA 2WXLA 5KJNA 3FUJA 3PE3A 2IJGX 3LY8A 3TJPA 3CQGB 3MA5A 4WNFA 1BPOA 3RRMB 2AXVA 2XPYA 4UQZA 2PZIA 2DIWA 4GMJA 4FLBA 2LNIA 1JUQA 1HO8A 3FP3A 4H7YA 4PUCA 1UW4B 4WAFA 3U64A 5EDSA 3UPVA 4N2QA 1HXIA 4UWLA 4UQXA 1YA0A 4LRZA 3AS5A 3PH0C 2J09A 3D3MA 2XGMA 3FUFA 1ZU2A 2IFUA 1ELKA 3S7BA 4GU5A 5E76A 4M3OA 2I9CA 1NA0A 3JUIA 4N5CA 4ANVA 2EQXA 3CVPA 3FU0A 3FUDA 3QARA 3OXLA 4JA9A 5AYWD 5BW8C 3PE4A 4GZ5A 4KVMA 4FULA 3MV3B 3ZRHA 1UJJA 2GRLA 3AU4A 4GYYA 3T5VA 5FZQA 3FU5A 3JQ0A 3NQPA 2KCLA 1KT0A 2M63A 5AENA 2C0LA 2CG2A 5LFAA 5FT9A 2DCPA 3ASGA 3NF1A 3ZHEB 4G24A 4JVSA 1IQUA 1DVPA 5LCWJ 3FH5A 4Y6WA 5ARGA 2FI7A 4N39A 4APOA 2FBNA 4C9BB 3FY4A 5ARFA 3LDZA 2KCKA 4RSYA 5AIJA 2XGOA 2MHKA 3ZYMA 4EQFA 3B7SA 3PREA 1H2VC 2VSNA 4BX8A 3MV2B 3QKYA 5EKQD 4BY6A 2I1KA 4CDRA 3KEZA 3QC1A 4OVUA 2HR2A 4WNDA 3TL5A 3PUKA 4GZ6A 3ZYLA 4ABNA 1Y6IA 4WNEA 2NXPA 2A4ZA 4CDNA 2VGXB 2YINA 4XE0A 2CG3A 3Q15A 4EBAA 4I2ZA 4WNGA 3CVYA 3FHEA 5CMYA 4Q96A 2WQ7A 2ONDA 3CEQA 5E75A 1HFAA 3CVXA 4XX5A 2I2OA 1Z3YA 2LO6A 2Q7FA 1H2TC 4EZJA 3BEEA 3EDTB 3EIQC 3PEUB 4GA0A 4JEHA 4WWOA 4YNDA 4FHKA 1EF1C 4RVBA 3CK9A 3HHMA 3LEWA 3TG5A 3UT8A 2X6HA 3MX3A 3L54A 4G26A 3R7QA 4NRHB 1IHGA 1SQMA 2NC9A 4WWPA 3RIBA 3CHSA 1SZAA 4PDXA 2ZU6B 3CHRA 4B0ZA 2OOEA 3LXUX 2OV8A 5LCWC 3WXXA 3ZFWA 2XCBA 2J4DA 3RKVA 4AEZC 4HOSA 5DBKA 4I6GA 2XGSA 3Q5MA 3KS2A 3CVLA 3QWWA 2X6IA 1MQSA 3FUIA 3CVUA 3CVNA 3NZUA 4B89A 4U04A 2E2EA 4BTAA 2P58C 5FQ7A 4I17A 5KJMA 4U63A 5BUZA 4HOQA 1OWOA 3QB2A 1UN9A 2HO1A 4UWFA 5FWQA 4B94A 1ZBPA 2I1JA 3ONKA 3ESLA 1SZ9A 5CCLA 3I4GA 2RD0A 5JJ6A 2KM4A 1E90A 3SFZA 1E7VA 3ZVVA 3T8MA 2Y3AA 3IBEA 2C0MA 2JLBA 3G2UA 2PQNA 4OYSA 3LVQE 4IRUA 3PNTB 3UQ3A 4HOTA 1IQRA 4UQYA 3RU0A 2HM8A 4ILGA 4O6FA 1E7UA 3PS6A 3ESKA 4I6EA 4G11A 2PQRA 2L0IA 4FJYA 5A23A 1Z3XA 3ZXSA 5J08A 5DIZA 2IOLA 2RG8A 3Q47B 4WUYA 2J4BA 4UWHA 3R7RA 4HS2A 3UT4A 2E0IA 2YNQA 1A17A 4XKCA 4JZYA 4Q69A 3CSFA 2V0PA 5C1DA 5FQ4A 2LAHA 3B7UX 3MKQA 4BT8A 5T8IA 4EBAG 4JEUA 4APFA 4GCOA 4MLPA 3IKOB 2R59A 4JHRA 4JPSA 4EECA 3TGOA 4ANXA 1NA3A 3SBTB 4EPZA 5JHBA 3APFA 3I3NA 2WXJA 2WQHA 4DLOA 2WMNA 3CHPA 3PEVB 1HG5A 2FULA 5KJLA 3IHYA 5FJYA 3PZDA 2X6FA 3U66A 3UUXA 2WMOA 4XZ4A 3VLEA 4DI4A 4XI9A 5FQ8A 4GZDA 4AOFA 2PL2A 3NZSA 2V8SE 3B7TA 1ELWA 3RRNB 5G04J 3U9WA 3KD7A 3MJWA 2AXUA 4W9RA 3LKUA 2CHWA 4AXHA 3FEXA 3GZSA 4I2WA 3DBSA 3U4TA 2PM6A 3FU3A 2FO7A 3FEYA 4G1TA 4G2VA 3JCKC 5A7DB 3QWPA 1ELRA 3ONLA 3L17A 3MCXA 2YHEA 4OVVA 4BSXA 1H6KA 4GYOA 4J8SA 3QDNA 3DPDA 4J8FA 3ZYQA 2XEVA 5JJ7A 3QOUA 5BPPA 1E8WA 2AVPA 4YVQC 4KT6B 4ACKA 2GRMA 3RRUA 4F7AA 3R9AB 4RG9A 1HZ4A 4AJWA 2HYZA 1IYGA 4N3AA 3UX4A 4P29A 2NSZA 3BG0B 3FTUA 3FUHA 3QWVA 4UI9C 3FFLA 4F1SA 4CGWA 4URKA 4LERA 2WM9A 4CCAA 2XQ0A 5BT1A 1NZNA 1Y8MA 4LEUA 3FTYA 2J9QA 4U07A 4FC8A 1EPUA 5FTPA 1FVHA 4PS8A 3HVEA 3HVEB 3VTYA 1QQEA 4DJAA 3FU6A 3MZLB 3FUNA 3D9PA 4E85A 4GZ3A 2WXFA 3EIJA 1QNFA 3U3WA 4GAAA 1TJFA 2A5UA 3L16A 2Y4UA 3D9IA 5FZSA 1H0AA 4UI9K 3O4ZA 5G04C 4MKTA 3O48A 4GA1A 3S7FA 3TXMA 3GYZA 5A6CA 1VDYA 4CEMA 2VSYA 3HDXA 4JL0A 4DLQA 3CLJA 3L08A 4HVBA 4NQ0A 1TJCA 4JXTA 1UJKA 4LUNU 3SZ7A 1KT1A 3LY7A 3UT7A 4JHKA 4TRQA 1INZA 4CGVA 3URZA 3P2BA 4Y6CA 2WXQA 3Q4AB 3VTXA 3D9LA 3PNLB 4GYWA 1HU3A 2X38A 3JQ1A 3LY9A 4I9CA 4IYPA 4KYOB 4AVXA 4F53A 3SGHA 2VSOE 3ASDA 4G25A 3FTXA 3CVQA 3IV0A 5G55A 1PAQA 2KC7A 1HX8A 3FTZA 3PRZA 3ZPJA 5D0QD 4A3VA 3FULA 3G2SA 1B89A 4N2SA 2WXNA 3E4BA 1JPLA 4MS6A 4A1SA 3I5PA 1E8YA 2OVFA 3L6AA 4YVOA 3OTNA 3ZIMA 4FLHA 2WQ6A 1DNPA 1JWGA 3G2TA 2XRYA 4GA2A 4DK5A 2IQCA 4DPRA 2WB2A 4KZCA 4TV3A 2L6JA 1OWLA 3CHOA 3RJVA 4HLEA 1E8ZA 1FVFA 2J49A 2QY7A 2WXOA 3FH8A 3ZYKA 3CR3A 3LCAA 2J08A 3FTWA 3QJZA 2VSXE 4XI0A 1H19A 3PVLA 1HS6A 4WWNA 5LX8A 2KZTA 2KZTB 2Y4TA 4BFRA 3ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULQ A;  1OUV A;  1QZ2 A;  3S7D A;  2VGY A;  5EX3 A;  4UI9 J;  3ASF A;  5BNW A;  2QFC A;  4BTB A;  3LYA A;  5CHE E;  4KBQ A;  4KXK B;  3Q49 B;  3RO2 A;  3CK8 A;  4GPK A;  2R5S A;  3AS4 A;  3HYM B;  1E96 B;  5D0O D;  3MEK A;  2UWJ G;  3AS8 A;  4HOR A;  4BT9 A;  3K9I A;  3IEG A;  3N71 A;  5FZR A;  2YHC A;  3FWV A;  3GZ1 A;  5G05 J;  5EX0 A;  3ZHE A;  3ZGQ A;  2LSU A;  3ASH A;  1WAO 1;  4JA7 A;  2C2L A;  3TG4 A;  1FCH A;  2I6H A;  2KCV A;  4F3V A;  3JYS A;  3LPZ A;  2DBA A;  4RG6 A;  1PC2 A;  2XPI A;  5M72 A;  2VGX A;  5KJK A;  3GZ2 A;  2YQ8 A;  3CV0 A;  4H7X A;  4J8E A;  2UY1 A;  2UY1 B;  2KAT A;  2GW1 A;  4IN3 B;  3S7J A;  3GW4 A;  5HI7 A;  1KLX A;  4U0U A;  3CKB A;  2VYI A;  2BUG A;  4AM9 A;  5G05 C;  4N3B A;  2FF4 A;  3KAE A;  1P5Q A;  4U0S A;  2LSV A;  4AIF A;  1WM5 A;  3TAX A;  2VQ2 A;  3PDN A;  2WPV A;  4AY6 A;  1XNF A;  4I1A A;  4N3C A;  2XCC A;  1W3B A;  3MKR A;  3SF4 A;  4U0Z A;  3CK7 A;  4J8D A;  3CKC A;  3OXF A;  5HQ8 A;  3OXG A;  4GCN A;  3ZN3 A;  4I9E A;  4HOU A;  4G23 A;  5JJT A;  1HH8 A;  4XIF A;  4ME2 A;  4BWR A;  4AY5 A;  5CCM A;  2IF4 A;  4J0U A;  3RO3 A;  2V5F A;  2FEZ A;  5KJN A;  3PE3 A;  3LY8 A;  3MA5 A;  4WNF A;  4UQZ A;  2PZI A;  2LNI A;  3FP3 A;  4H7Y A;  4N2Q A;  3UPV A;  1HXI A;  4UQX A;  1YA0 A;  3AS5 A;  2XGM A;  1ZU2 A;  2IFU A;  3S7B A;  1NA0 A;  4N5C A;  3CVP A;  3OXL A;  4JA9 A;  5AYW D;  5BW8 C;  3PE4 A;  4GZ5 A;  3MV3 B;  4GYY A;  5FZQ A;  2KCL A;  1KT0 A;  2C0L A;  5FT9 A;  3ZHE B;  3ASG A;  3NF1 A;  4G24 A;  5LCW J;  4Y6W A;  5ARG A;  2FI7 A;  4N39 A;  4APO A;  2FBN A;  5ARF A;  2KCK A;  2XGO A;  2MHK A;  4EQF A;  2VSN A;  3MV2 B;  3QKY A;  5EKQ D;  4CDR A;  4WND A;  2HR2 A;  4GZ6 A;  4ABN A;  4WNE A;  2VGX B;  3Q15 A;  4I2Z A;  4WNG A;  2OND A;  3CEQ A;  2Q7F A;  3BEE A;  3EDT B;  4GA0 A;  4YND A;  3CK9 A;  3TG5 A;  4G26 A;  4NRH B;  1IHG A;  2NC9 A;  3RIB A;  2OOE A;  5LCW C;  3WXX A;  3ZFW A;  2XCB A;  3RKV A;  4HOS A;  5DBK A;  2XGS A;  3Q5M A;  3KS2 A;  3CVL A;  3QWW A;  3CVN A;  4U04 A;  2E2E A;  4BTA A;  2P58 C;  4I17 A;  5KJM A;  4HOQ A;  2HO1 A;  4B94 A;  1ZBP A;  5CCL A;  5JJ6 A;  2C0M A;  2JLB A;  2PQN A;  3UQ3 A;  4HOT A;  4UQY A;  3RU0 A;  4O6F A;  3ESK A;  2PQR A;  5DIZ A;  3Q47 B;  4WUY A;  1A17 A;  5C1D A;  4BT8 A;  4GCO A;  4JHR A;  3TGO A;  1NA3 A;  2WQH A;  5KJL A;  5FJY A;  3UUX A;  4XI9 A;  2PL2 A;  1ELW A;  5G04 J;  3KD7 A;  4W9R A;  3LKU A;  4I2W A;  3U4T A;  2FO7 A;  4G1T A;  4G2V A;  5A7D B;  3QWP A;  1ELR A;  4GYO A;  3QDN A;  4J8F A;  2XEV A;  5JJ7 A;  3QOU A;  2AVP A;  4YVQ C;  3R9A B;  4RG9 A;  1HZ4 A;  1IYG A;  2HYZ A;  4N3A A;  3QWV A;  4UI9 C;  3FFL A;  4CGW A;  5BT1 A;  1NZN A;  1Y8M A;  4LEU A;  2J9Q A;  4U07 A;  5FTP A;  3VTY A;  1QQE A;  4GZ3 A;  3U3W A;  2Y4U A;  5FZS A;  4UI9 K;  5G04 C;  3O48 A;  4GA1 A;  3S7F A;  3GYZ A;  5A6C A;  2VSY A;  4JL0 A;  4NQ0 A;  1TJC A;  3SZ7 A;  1KT1 A;  3LY7 A;  4CGV A;  3URZ A;  4Y6C A;  3Q4A B;  3VTX A;  4GYW A;  3LY9 A;  4I9C A;  4KYO B;  3ASD A;  4G25 A;  3CVQ A;  2KC7 A;  3ZPJ A;  5D0Q D;  1B89 A;  4N2S A;  3E4B A;  4A1S A;  4YVO A;  4GA2 A;  2L6J A;  3RJV A;  3LCA A;  4XI0 A;  2Y4T A; 
#chains in the Genus database with same CATH topology
 4JHJ A;  3ULQ A;  4ILI A;  3TWT A;  4CRW A;  4HI8 A;  2VGY A;  5ANL A;  4PS7 A;  4OAU C;  1S64 A;  1WDY A;  1NI1 A;  1UG3 A;  4GMR A;  1XGW A;  2CFZ A;  2QFC A;  2WXH A;  2L0T B;  2V4L A;  4KXK B;  4GPK A;  4MRU A;  3CVW A;  4L7T A;  2ETC A;  3CGH A;  2WXK A;  1E96 B;  5D0O D;  3CST A;  4TUU A;  2X3M A;  3G2W A;  4PH4 B;  3D9N A;  2AW6 A;  4K0R A;  3ML9 A;  4ANW A;  3B7R L;  4EZL A;  3FUM A;  2VTB A;  3FWV A;  4A3T A;  4UWG A;  3B13 A;  1KPS B;  2WXM A;  3Q7A A;  4K5A B;  4L2Y A;  4C48 B;  4IUL A;  4CZ2 D;  3VLD A;  1WAO 1;  4EZK A;  2QYU A;  3FTS A;  3JYS A;  1Q2Z A;  3BG1 B;  4QFV A;  5AJD A;  2XPI A;  5M72 A;  2YQ8 A;  4AP2 A;  2BF0 X;  2ION A;  2KAT A;  3Q7F A;  5CMW A;  1GW6 A;  2R17 C;  4U8H A;  4MBG A;  3CKB A;  2VYI A;  2IEJ A;  2WXR A;  2FF4 A;  2XHE A;  4U7E B;  4I43 A;  3PDN A;  1N4P A;  1UN8 A;  5CER B;  5ENN A;  3AU5 A;  1OWM A;  4N3C A;  3CIA A;  3C98 A;  2RFM A;  3D9O A;  4HRM B;  2BTD A;  4FHJ A;  4FP7 A;  3SF4 A;  1D9S A;  5HQ8 A;  4GZC A;  3EHN A;  2CFU A;  5D66 A;  3ZN3 A;  2AWI A;  4HOU A;  4BET A;  3D9M A;  2QZA A;  1JWF A;  2R05 A;  4XIF A;  4LNB A;  4BWR A;  3APD A;  5CEC B;  5FQ6 A;  2V5F A;  1BLX B;  3FUJ A;  5ENQ D;  4WNF A;  1BPO A;  2AXV A;  4UQZ A;  1MX4 A;  2LNI A;  1HO8 A;  4PUC A;  4WAF A;  1HXI A;  1YA0 A;  4LRZ A;  3AS5 A;  1JCR A;  2XGM A;  1IXV A;  3S7B A;  4GU5 A;  3JUI A;  1FPP A;  3UM1 A;  3OXL A;  3TWR A;  2OEW A;  5AYW D;  3T5V A;  5KWD A;  5AEN A;  5LFA A;  4GTS A;  5LCW J;  1QBQ A;  4APO A;  3B7S A;  2LXL A;  3HXF A;  2IY0 C;  4WND A;  4OVU A;  4GTR A;  1Y6I A;  4WNE A;  5AQA A;  4EBA A;  4WNG A;  3CVY A;  3FHE A;  4XX5 A;  2I2O A;  3NB2 A;  4JEH A;  5CRU A;  3UT8 A;  2X6H A;  4G26 A;  1IKN D;  3R7Q A;  1IHG A;  3CHS A;  1SZA A;  4PDX A;  4LNU D;  4CYM D;  2OOE A;  3LXU X;  2OV8 A;  5LCW C;  3WXX A;  1NL4 A;  1MQS A;  3CVN A;  4HBD A;  4HOQ A;  3QB2 A;  1UN9 A;  2RKK A;  4U8Y D;  1SZ9 A;  3DWL G;  3SFZ A;  3T8M A;  2C0M A;  4HQD A;  4OYS A;  4K5C A;  2P9L G;  4O6F A;  1E7U A;  3ESK A;  5AN8 A;  2PQR A;  1N9A A;  3ZXS A;  5DIZ A;  2F37 A;  2J4B A;  2P9U G;  1DCE A;  4JZY A;  4Q69 A;  3CSF A;  5BXO A;  4MLP A;  4JHR A;  4JPS A;  4EEC A;  3E34 A;  5JHB A;  3APF A;  4DI4 A;  5FQ8 A;  4AOF A;  2V8S E;  2P9I G;  5G04 J;  2AXU A;  3LKU A;  3E32 A;  2PM6 A;  3ONL A;  4BSX A;  3KSL A;  3RAU A;  4GYO A;  3ZYQ A;  3QOU A;  2H6H A;  2BKG A;  4ATZ D;  2HYZ A;  5FIO A;  4J8Y A;  2DYS E;  4XEI G;  4F1S A;  3QWV A;  4UI9 C;  4CGW A;  2Y69 E;  2WM9 A;  4CCA A;  2XQ0 A;  1MYO A;  4DJA A;  3C3Q A;  3FU6 A;  2H6I A;  3D9I A;  3O4Z A;  5G04 C;  3O48 A;  4GA1 A;  3TXM A;  2R03 A;  3GYZ A;  4F1P A;  4JL0 A;  4DLQ A;  4HVB A;  2EIL E;  4JXT A;  3DEO A;  3LY7 A;  4JHK A;  4CGV A;  3P2B A;  3Q4A B;  5HRY A;  4GYW A;  2X38 A;  4TXQ A;  3DSX A;  1TR4 A;  2KC7 A;  5D0Q D;  4A1S A;  4YVO A;  3OTN A;  2WQ6 A;  1K8K G;  1DNP A;  1AWC B;  3W9G A;  2F8X K;  3V2X A;  1OWL A;  3CHO A;  3RJV A;  2QY7 A;  3CR3 A;  3LCA A;  2J08 A;  3C5R A;  2Y4T A;  3ML8 A;  3T8K A;  3UM3 A;  2ILR A;  1OUV A;  3SD5 A;  4BER A;  3QNK A;  4D10 C;  5EID A;  2VJ8 A;  2AXZ A;  1MX2 A;  2IOS A;  3SBS A;  3FUE A;  4CT0 A;  2XPZ A;  2DVW A;  1A5E A;  5CHE E;  5LP0 A;  4KBQ A;  3Q49 B;  3SNX A;  3CK8 A;  3FDH A;  3AS4 A;  4PS3 A;  4I1O B;  1X81 A;  3DXM G;  3MEK A;  3AS8 A;  3SY2 A;  1HE8 A;  4YDE A;  4HOR A;  4RLY A;  1HF8 A;  5T3R A;  4Z68 A;  1YMP A;  2MOW A;  2YHC A;  4L23 A;  4YDW A;  5ITZ F;  4DX2 A;  4KVO A;  3ZGQ A;  4DX5 D;  4E6H A;  3OAW A;  3ENE A;  5T4Y A;  4GTQ A;  5EYP F;  3TG4 A;  3PUJ A;  4N5Q A;  2I6H A;  2ETB A;  4F3V A;  4RG6 A;  1PC2 A;  4R7L A;  2VGX A;  3L13 A;  5KJK A;  4H7X A;  2UY1 B;  3SI5 A;  5HI7 A;  2QYJ A;  4U0U A;  2BUG A;  4AM9 A;  4K03 A;  4L1B A;  3T9K A;  4N3B A;  1TEZ A;  5J90 A;  2X6K A;  4FJZ A;  4U0S A;  3BU8 A;  3DRA A;  4NIK A;  1SVX A;  5ANR A;  4AIF A;  5BV1 A;  4C0E A;  1V54 E;  2MRI A;  1K1B A;  3AG2 E;  2WPV A;  2EIK E;  1XNF A;  2XCC A;  2CHZ A;  1N0R A;  1EYH A;  4CT4 A;  1W3B A;  4AV7 A;  3MKR A;  3TWW A;  4U0Z A;  3CK7 A;  3C3O A;  1LD7 A;  3EHQ A;  3CQC B;  4GCN A;  3ZEF A;  1S70 B;  5JJT A;  4KMO A;  4AY5 A;  5CCM A;  2IF4 A;  4HNA D;  4JW1 A;  4C0M A;  3KSQ A;  4JD2 G;  3LY8 A;  1TNY A;  3CQG B;  3MA5 A;  3RRM B;  1RW2 A;  3EUV A;  2GRP B;  5JMN D;  3L9T A;  5KNH D;  2KXP C;  3UPV A;  2V5Q C;  4UQX A;  5IY5 E;  1OT8 A;  3PH0 C;  4U8V D;  3D3M A;  5HS0 A;  3FUF A;  3X2Q E;  1ZU2 A;  2XS1 A;  2ZXW E;  3UM0 A;  2EQX A;  2EIM E;  3CVP A;  3FUD A;  3WG7 E;  1U2V G;  5BW8 C;  3PE4 A;  3MV3 B;  3ZRH A;  3UXG A;  2GRL A;  3DSS A;  3NQP A;  2KCL A;  4DX6 D;  2CG2 A;  4G24 A;  4JVS A;  1DVP A;  5ENR D;  2FI7 A;  3Q9N C;  4YDY A;  2FBN A;  4C9B B;  3FY4 A;  3PZ3 A;  5AIJ A;  5EIL A;  2VGE A;  3MV2 B;  4BY6 A;  2I1K A;  3QC1 A;  1SA5 A;  3TL5 A;  4U96 D;  4ABN A;  2NXP A;  2A4Z A;  2VGX B;  2CG3 A;  2Y0B G;  2WQ7 A;  2OND A;  3CVX A;  1HFA A;  1TNB A;  2Q7F A;  4EZJ A;  3BEE A;  4WWO A;  2EIN E;  1EF1 C;  3ABK E;  4ZFH A;  4NRH B;  2NC9 A;  4WWP A;  3V79 K;  2V4H C;  3ZFW A;  2XCB A;  3RKV A;  3KS2 A;  3CVL A;  1LTX A;  4L9P A;  3QWW A;  1DCQ A;  4U04 A;  4ZHB A;  3ZXP A;  1MX6 A;  4O60 A;  1ZBP A;  2I1J A;  3ONK A;  3ESL A;  5CCL A;  3HXC A;  2KM4 A;  1E90 A;  2Y3A A;  3G2U A;  4IRU A;  3UQ3 A;  4HOT A;  4UQY A;  2HM8 A;  3PS6 A;  4G11 A;  3PZ4 A;  5J08 A;  2IOL A;  1ZB1 A;  3Q47 B;  4UWH A;  3UI2 A;  3R7R A;  5CEA A;  1N94 A;  4HS2 A;  2YNQ A;  5FQ4 A;  3B7U X;  3MKQ A;  4BT8 A;  4JEU A;  4APF A;  3C72 A;  3IKO B;  4DLO A;  3CHP A;  2FUL A;  5FJY A;  3U66 A;  3UUX A;  2WMO A;  3W9F A;  3NZS A;  3RRN B;  4CDM A;  4AXH A;  3MJW A;  1LD8 A;  3GZS A;  1N4R A;  3PZ1 A;  3DBS A;  4GTO A;  1TNO A;  3Q73 A;  3JCK C;  1ELR A;  2YHE A;  1H6K A;  3QDN A;  3DPD A;  4J8F A;  2XEV A;  5JJ7 A;  1YYH A;  1E8W A;  3RRU A;  4F7A A;  3R9A B;  4B93 B;  4AJW A;  3UX4 A;  5AAO A;  4URK A;  4DRX E;  3FTY A;  2J9Q A;  4FC8 A;  5FTP A;  2NYJ A;  3HVE B;  4GZ3 A;  1NFI E;  3B7B A;  3UM2 A;  3EIJ A;  2OEV A;  3U3W A;  2A5U A;  2Y4U A;  4GTV A;  4LSZ E;  1VDY A;  2JAB A;  3L08 A;  3ZKJ A;  4NQ0 A;  1TJC A;  3URZ A;  4HI9 A;  3PNL B;  4IYP A;  4YDO A;  4AVX A;  3LJN A;  4F53 A;  4G8L A;  3JXJ A;  4GTM A;  2VSO E;  3E30 A;  3ASD A;  3IV0 A;  3CVQ A;  1HX8 A;  3ZPJ A;  3IXE A;  3G2S A;  4N2S A;  3E4B A;  1JPL A;  2OVF A;  3L6A A;  1JCS A;  1O1T A;  4FLH A;  4GPM A;  3G2T A;  4DK5 A;  2IQC A;  4KZC A;  4TV3 A;  3BQO A;  4HLE A;  2J49 A;  3J5Q B;  3ZYK A;  2GRN B;  3FTW A;  2VSX E;  3PVL A;  2KZT B;  3MKQ B;  3P1U A;  1QZ2 A;  3V2O A;  1SW6 A;  5EX3 A;  4UI9 J;  4ATG A;  3RSE G;  4B8A A;  5BNW A;  1WY6 A;  1YCS B;  4BTB A;  3QAQ A;  3LYA A;  4I6J A;  3MYV A;  3NOC D;  4L2L A;  1TYQ G;  3DSV A;  3RO2 A;  3DSW A;  1EDU A;  4GTP A;  1D8E A;  2JEK A;  2PM7 A;  4GTT A;  4UWK A;  2J07 A;  5EN5 D;  3SQV A;  3FH7 A;  1N54 A;  5EIB E;  4QQI A;  1PY1 A;  2B6C A;  4KZ0 A;  3D9H A;  4GB9 A;  2R2L A;  3KEA A;  2WVI A;  2H6F A;  1MZC A;  1G3N B;  1L5J A;  3HIZ A;  3LS8 A;  3LVR E;  5AQ7 A;  3ZHE A;  3G2V A;  3UIP C;  2L9B A;  2WXG A;  2P9K G;  3D9J A;  4FU3 A;  3EJN A;  1BI7 B;  5AJL A;  2P9N G;  4JA7 A;  1H2U A;  3AAA C;  2KCV A;  4O1P A;  3EHM A;  1N4Q A;  3LPZ A;  3BUA A;  5ENP D;  3GZ2 A;  3ULY A;  1DC2 A;  4BEP A;  2UY1 A;  2GRO B;  1X5B A;  4IN3 B;  3S7J A;  4X8Q A;  1KLX A;  5BV0 A;  1O5M A;  5C2Y A;  1OWP A;  4U95 D;  4A1G A;  4HXI A;  2DZN A;  3MGB A;  2LSV A;  4OAV B;  4BX9 A;  3AG1 E;  3NOG D;  4J6I A;  3HRA A;  5CBO A;  4NAC A;  2QC9 A;  2R02 A;  2CHX A;  2OVB A;  3D9K A;  1N95 A;  3CKC A;  3ULE G;  3OXF A;  5CBN A;  2B0O E;  3RK6 A;  2ZIS A;  3IHV A;  2WXI A;  4I9E A;  3ZUV B;  1HH8 A;  4ME2 A;  2J8S D;  3I4R B;  5ENT D;  3CHM A;  3ASN E;  1KZO A;  3Q79 A;  2WXL A;  2F0Y A;  3TJP A;  2PZI A;  4LG6 A;  2DIW A;  3V30 A;  5EDS A;  4H7Y A;  3U64 A;  4UWL A;  1Z5S C;  4M3O A;  1TN6 A;  1NA0 A;  5AQ9 A;  4ANV A;  3QAR A;  4JA9 A;  4GZ5 A;  4KVM A;  1UJJ A;  3AU4 A;  4K5B A;  3FU5 A;  2M63 A;  3TWV A;  3ZHE B;  2DCP A;  3ASG A;  3NF1 A;  3FH5 A;  4Y6W A;  5ARG A;  4N39 A;  3V31 A;  1FT1 A;  1BD8 A;  3LDZ A;  5ARF A;  4RSY A;  2LUH A;  3ZYM A;  3PRE A;  1H2V C;  4BX8 A;  3AG4 E;  3QKY A;  3UIO C;  5EKQ D;  2BED A;  3KEZ A;  3ZYL A;  4GZ6 A;  2YIN A;  3TWQ A;  3Q15 A;  4I2Z A;  2XZD G;  5HKP A;  3CEQ A;  2ZGD A;  1H2T C;  3EDT B;  3PEU B;  4FHK A;  4RVB A;  3CK9 A;  3L54 A;  3L82 A;  1SQM A;  3RIB A;  2L6B A;  5ENS D;  4HOS A;  4DX1 A;  2DZO A;  1K1A A;  4B89 A;  2P58 C;  5FQ7 A;  5KJM A;  1OWO A;  5FWQ A;  4B94 A;  5KBA A;  4F6R D;  4UUC A;  1E7V A;  3IBE A;  3LVQ E;  3DEP A;  3PNT B;  2P2C P;  2L0I A;  3UIN C;  1Z3X A;  2LXM A;  2E0I A;  1A17 A;  2V0P A;  3UTM A;  3B95 A;  3J5P A;  3TGO A;  3TWS A;  2FO1 E;  2WQH A;  2WMN A;  3PEV B;  1HG5 A;  3IHY A;  4XZ4 A;  3ABL E;  3VLE A;  3B7T A;  3U9W A;  1ELW A;  3HXE A;  2IO3 C;  1OXJ A;  4W9R A;  2CHW A;  3FEX A;  5CRV A;  3FU3 A;  2FO7 A;  3FEY A;  3ISM C;  4G2V A;  5B1B E;  2Y1L E;  3MCX A;  3E37 A;  5BPP A;  2AVP A;  3HG0 D;  4KT6 B;  4YVQ C;  4RG9 A;  1IYG A;  4P29 A;  3FTU A;  3FUH A;  3FFL A;  1NZN A;  1Y8M A;  3DXK G;  4U07 A;  1EPU A;  3VTY A;  1FVH A;  4PS8 A;  3HVE A;  1QQE A;  3MZL B;  3FUN A;  3D9P A;  1N11 A;  2WXF A;  1QNF A;  1TJF A;  2EIJ E;  3NBN B;  1QYM A;  4UI9 K;  3S7F A;  5A6C A;  4CEM A;  3HDX A;  1S63 A;  1MJ0 A;  1KT1 A;  3UT7 A;  4TRQ A;  3JUE A;  2OCC E;  3D9L A;  4HB5 A;  1HU3 A;  3R9M A;  2A5E A;  1AP7 A;  3JQ1 A;  4I9C A;  4KYO B;  3UKU G;  2KBX A;  2DYR E;  3DSU A;  4G25 A;  1PAQ A;  1D8D A;  3PRZ A;  3FUL A;  4HLL A;  1B89 A;  3ZU7 B;  4MS6 A;  3I5P A;  1E8Y A;  2XEE A;  2XRY A;  4JB8 P;  4DPR A;  2WB2 A;  2L6J A;  1E8Z A;  1FVF A;  2WXO A;  3FH8 A;  5H7P A;  2KZT A;  3Q78 A;  1N4S A;  3VLF A;  2AJA A;  4ILH B;  4V3I A;  5ENO D;  3S7D A;  1K3Z D;  2GRQ B;  3CHQ A;  3ASF A;  3FTV A;  3PZ2 A;  5CED B;  1N52 A;  4NUR A;  3APC A;  2XRZ A;  1MHQ A;  2P9S G;  3Q9U C;  2R5S A;  3HYM B;  3LJ3 A;  4TUM A;  1S0P A;  2UWJ G;  2IU1 A;  4DX7 D;  1E8X A;  4BT9 A;  3K9I A;  4DI3 A;  5EYL A;  3IEG A;  2XEN A;  1UOH A;  3N71 A;  2GRR B;  5FZR A;  1HG2 A;  4ACL A;  4LCT A;  2VTB B;  3GZ1 A;  2X6J A;  2H6G A;  1TN8 A;  4GML A;  5G05 J;  5EX0 A;  3S2A A;  3L22 A;  3QK0 A;  4FA6 A;  2LSU A;  3ASO E;  4XKB A;  3AG3 E;  3Q75 A;  2LAI A;  3ASH A;  2BKK B;  5LOZ A;  5B1A E;  1OCZ E;  1NP7 A;  2C2L A;  4TXP A;  1OY3 D;  1FCH A;  1U3C A;  4ANU A;  4BES A;  5KCM A;  2DBA A;  3CV0 A;  4J8E A;  3FUK A;  2GW1 A;  3GW4 A;  1Z6T A;  4I1M A;  5G2N A;  1JCQ A;  4A55 A;  3UMV A;  5G05 C;  3KAE A;  1P5Q A;  1WM5 A;  4Q94 A;  2VQ2 A;  3TAX A;  5D2M C;  3ZW3 A;  1BU9 A;  2GGF A;  1U3D A;  2WXP A;  2IO2 C;  4B8C B;  3SHF A;  4AY6 A;  4I1A A;  4HFG A;  3CVV A;  4DUI A;  1LF8 A;  5JHA A;  4JC8 A;  2XZT G;  5BXU A;  4J8D A;  5AAR A;  3F6Q A;  3OXG A;  1OWN A;  3TXN A;  1N0Q A;  4G23 A;  3T5X A;  4FAD A;  4J0U A;  3RO3 A;  1H6P A;  2FEZ A;  5KJN A;  2RFA A;  3PE3 A;  2IJG X;  2XPY A;  3E33 A;  4GMJ A;  4A63 B;  4FLB A;  1JUQ A;  3FP3 A;  4N2Q A;  1UW4 B;  3EHR A;  2J09 A;  2MYO A;  2IFU A;  1ELK A;  2ZGG A;  2P9P G;  5E76 A;  4O1O A;  2I9C A;  4N5C A;  3FU0 A;  1SA4 A;  4FUL A;  4GYY A;  5FZQ A;  3JQ0 A;  1KT0 A;  2C0L A;  5FT9 A;  1IQU A;  4G8K A;  2KCK A;  2XGO A;  1TNZ A;  2MHK A;  4EQF A;  2VSN A;  4CDR A;  2HR2 A;  3HXB A;  3PUK A;  2ZIR A;  1BI8 B;  4CDN A;  4XE0 A;  4BSZ B;  5CMY A;  4Q96 A;  2PNN A;  5E75 A;  1Z3Y A;  2LO6 A;  3EIQ C;  4GA0 A;  4YND A;  1WG0 A;  1TN7 A;  3HHM A;  3LEW A;  3TG5 A;  3MX3 A;  3DPY A;  2HE0 A;  4B0Z A;  2ZU6 B;  3CHR A;  1OCC E;  3NAW A;  2J4D A;  4AEZ C;  1OCO E;  5DBK A;  4I6G A;  2XGS A;  3Q5M A;  2X6I A;  3FUI A;  3AJI A;  3CVU A;  3NZU A;  2E2E A;  4BTA A;  4I17 A;  1RZ4 A;  4U63 A;  5BUZ A;  4UWF A;  5FIN A;  2HO1 A;  1V55 E;  3HXD A;  2F8Y A;  3EU9 A;  3I4G A;  2RD0 A;  5JJ6 A;  3ZVV A;  2JLB A;  2PQN A;  5KNG A;  1IQR A;  3SO8 A;  3RU0 A;  3C3R A;  4ILG A;  4I6E A;  1O1R A;  2XS8 A;  3ZNG A;  4FJY A;  5A23 A;  1H6O A;  2XEH A;  2RG8 A;  4WUY A;  1KZP A;  3UT4 A;  4XKC A;  5C1D A;  2LAH A;  5T8I A;  4EBA G;  4GCO A;  4TXR A;  2R59 A;  4ANX A;  1NA3 A;  3SBT B;  4EPZ A;  3I3N A;  4RQI A;  2WXJ A;  3ABM E;  5KJL A;  3DST A;  2X6F A;  3PZD A;  1OCR E;  4XI9 A;  1FT2 A;  4GZD A;  2PL2 A;  3KD7 A;  4EHM A;  4I2W A;  3U4T A;  4G1T A;  5A7D B;  3QWP A;  3TWU A;  3L17 A;  4HRL A;  4OVV A;  4J8S A;  4ACK A;  2GRM A;  3TWX A;  1HZ4 A;  3SFY A;  4N3A A;  2NSZ A;  3BG0 B;  4LER A;  5BT1 A;  4LEU A;  4E85 A;  1IHB A;  4GAA A;  3L16 A;  4J7W A;  5FZS A;  1H0A A;  4MKT A;  2DWZ A;  3UKR G;  2VSY A;  5AQB A;  3CLJ A;  1TNU A;  1UJK A;  5B3S E;  1O1S A;  4LUN U;  3SZ7 A;  1INZ A;  2ETA A;  4Y6C A;  2WXQ A;  3VTX A;  3LY9 A;  3SGH A;  3FTX A;  5G55 A;  3EU5 A;  4M7C A;  3FTZ A;  4HRN A;  4A3V A;  2WXN A;  3JXI A;  3ZIM A;  5JA4 D;  3SFX A;  1JWG A;  4GA2 A;  4XI0 A;  3QJZ A;  1H19 A;  4LNG A;  1HS6 A;  4WWN A;  5LX8 A;  4BFR A; 
#chains in the Genus database with same CATH homology
 3VLF A;  4JHJ A;  3MKQ B;  2ILR A;  3P1U A;  1OUV A;  1QZ2 A;  4ILH B;  4ILI A;  4V3I A;  3SD5 A;  3ULQ A;  4CRW A;  3QNK A;  3S7D A;  4D10 C;  2VGY A;  5ANL A;  4PS7 A;  2VJ8 A;  2AXZ A;  5EX3 A;  4UI9 J;  4ATG A;  2IOS A;  1UG3 A;  3CHQ A;  3SBS A;  3ASF A;  3FUE A;  1XGW A;  2CFZ A;  1WY6 A;  2QFC A;  2WXH A;  3FTV A;  4B8A A;  3QAQ A;  4BTB A;  2XPZ A;  3LYA A;  4CT0 A;  1N52 A;  2L0T B;  4I6J A;  5CHE E;  2V4L A;  3MYV A;  3APC A;  4KBQ A;  4L2L A;  4KXK B;  4NUR A;  3Q49 B;  5LP0 A;  2XRZ A;  3SNX A;  3RO2 A;  1MHQ A;  3CK8 A;  3FDH A;  4GPK A;  4MRU A;  2R5S A;  3AS4 A;  4PS3 A;  3HYM B;  3CVW A;  4L7T A;  3LJ3 A;  3CGH A;  4I1O B;  1EDU A;  2WXK A;  2JEK A;  1E96 B;  1S0P A;  3CST A;  3MEK A;  2UWJ G;  2IU1 A;  2PM7 A;  3AS8 A;  4UWK A;  5D0O D;  2J07 A;  1E8X A;  1HE8 A;  4HOR A;  4BT9 A;  4TUU A;  3K9I A;  3FH7 A;  4DI3 A;  2X3M A;  1HF8 A;  1N54 A;  3G2W A;  3IEG A;  4PH4 B;  1PY1 A;  5BNW A;  5T3R A;  3D9N A;  2AW6 A;  3N71 A;  5FZR A;  4KZ0 A;  4K0R A;  2MOW A;  4GB9 A;  2YHC A;  3ML9 A;  4ANW A;  1HG2 A;  3B7R L;  4L23 A;  4ACL A;  4EZL A;  3FUM A;  4LCT A;  3FWV A;  4A3T A;  3GZ1 A;  2VTB B;  2X6J A;  4UWG A;  2VTB A;  5G05 J;  4GML A;  3B13 A;  5EX0 A;  3S2A A;  2WXM A;  2WVI A;  3L22 A;  1L5J A;  3HIZ A;  3LS8 A;  3LVR E;  3QK0 A;  3ZHE A;  4FA6 A;  3G2V A;  4KVO A;  4L2Y A;  3ZGQ A;  2LSU A;  2L9B A;  2WXG A;  4XKB A;  4IUL A;  3D9J A;  2LAI A;  4E6H A;  3OAW A;  3EJN A;  3ASH A;  4FU3 A;  3VLD A;  5AJL A;  5LOZ A;  3ENE A;  1WAO 1;  4JA7 A;  4EZK A;  5T4Y A;  1NP7 A;  1H2U A;  2C2L A;  3TG4 A;  3PUJ A;  1FCH A;  2I6H A;  2KCV A;  3EHM A;  1U3C A;  4ANU A;  3FTS A;  3JYS A;  3LPZ A;  4F3V A;  3BG1 B;  5KCM A;  2DBA A;  4QFV A;  1PC2 A;  4RG6 A;  2XPI A;  4R7L A;  2VGX A;  3L13 A;  5AJD A;  5KJK A;  3GZ2 A;  2YQ8 A;  5M72 A;  3CV0 A;  4H7X A;  4J8E A;  2BF0 X;  2ION A;  3FUK A;  4AP2 A;  2UY1 A;  2UY1 B;  2KAT A;  3SI5 A;  5CMW A;  2GW1 A;  1GW6 A;  1X5B A;  4IN3 B;  3S7J A;  2R17 C;  4U8H A;  3GW4 A;  5HI7 A;  1Z6T A;  1KLX A;  4I1M A;  5G2N A;  5BV0 A;  4U0U A;  4A55 A;  3CKB A;  5C2Y A;  1OWP A;  2BUG A;  2VYI A;  4AM9 A;  3UMV A;  4A1G A;  4K03 A;  4HXI A;  2WXR A;  4L1B A;  5G05 C;  4N3B A;  2FF4 A;  1TEZ A;  2XHE A;  5J90 A;  2X6K A;  1P5Q A;  3KAE A;  3MGB A;  4FJZ A;  4U0S A;  2LSV A;  4AIF A;  1WM5 A;  4Q94 A;  5ANR A;  5BV1 A;  2VQ2 A;  3TAX A;  3ZW3 A;  4I43 A;  4C0E A;  3PDN A;  4BX9 A;  1UN8 A;  2MRI A;  2GGF A;  1U3D A;  5ENN A;  2WXP A;  3AU5 A;  4B8C B;  4J6I A;  2WPV A;  3SHF A;  4AY6 A;  1XNF A;  4I1A A;  4HFG A;  3CVV A;  1OWM A;  4NAC A;  1LF8 A;  2XCC A;  4N3C A;  3CIA A;  5JHA A;  3C98 A;  2CHZ A;  1EYH A;  4CT4 A;  1W3B A;  4AV7 A;  3D9O A;  4JC8 A;  2BTD A;  2CHX A;  3MKR A;  4FP7 A;  2OVB A;  3D9K A;  4FHJ A;  3SF4 A;  4U0Z A;  3CK7 A;  4J8D A;  4CDM A;  3CKC A;  3OXF A;  5HQ8 A;  3OXG A;  4GZC A;  3EHN A;  2CFU A;  3RK6 A;  3IHV A;  1OWN A;  2WXI A;  3TXN A;  3CQC B;  4GCN A;  3ZN3 A;  2AWI A;  4I9E A;  3ZEF A;  4HOU A;  3D9M A;  4G23 A;  5JJT A;  1HH8 A;  1JWF A;  4XIF A;  4KMO A;  3T5X A;  4FAD A;  4ME2 A;  4BWR A;  3I4R B;  4AY5 A;  5CCM A;  2IF4 A;  4JW1 A;  4C0M A;  3APD A;  3CHM A;  4J0U A;  3RO3 A;  5FQ6 A;  2V5F A;  2FEZ A;  2WXL A;  5KJN A;  3FUJ A;  3PE3 A;  2IJG X;  3LY8 A;  3TJP A;  3CQG B;  3MA5 A;  4WNF A;  1BPO A;  3RRM B;  2AXV A;  2XPY A;  4UQZ A;  2PZI A;  2DIW A;  4GMJ A;  4FLB A;  2LNI A;  1JUQ A;  1HO8 A;  3FP3 A;  4H7Y A;  4PUC A;  1UW4 B;  4WAF A;  3U64 A;  5EDS A;  3UPV A;  4N2Q A;  1HXI A;  4UWL A;  4UQX A;  1YA0 A;  4LRZ A;  3AS5 A;  3PH0 C;  2J09 A;  3D3M A;  2XGM A;  3FUF A;  1ZU2 A;  2IFU A;  1ELK A;  3S7B A;  4GU5 A;  5E76 A;  4M3O A;  2I9C A;  1NA0 A;  3JUI A;  4N5C A;  4ANV A;  2EQX A;  3CVP A;  3FU0 A;  3FUD A;  3QAR A;  3OXL A;  4JA9 A;  5AYW D;  5BW8 C;  3PE4 A;  4GZ5 A;  4KVM A;  4FUL A;  3MV3 B;  3ZRH A;  1UJJ A;  2GRL A;  3AU4 A;  4GYY A;  3T5V A;  5FZQ A;  3FU5 A;  3JQ0 A;  3NQP A;  2KCL A;  1KT0 A;  2M63 A;  5AEN A;  2C0L A;  2CG2 A;  5LFA A;  5FT9 A;  2DCP A;  3ASG A;  3NF1 A;  3ZHE B;  4G24 A;  4JVS A;  1IQU A;  1DVP A;  5LCW J;  3FH5 A;  4Y6W A;  5ARG A;  2FI7 A;  4N39 A;  4APO A;  2FBN A;  4C9B B;  3FY4 A;  5ARF A;  3LDZ A;  2KCK A;  4RSY A;  5AIJ A;  2XGO A;  2MHK A;  3ZYM A;  4EQF A;  3B7S A;  3PRE A;  1H2V C;  2VSN A;  4BX8 A;  3MV2 B;  3QKY A;  5EKQ D;  4BY6 A;  2I1K A;  4CDR A;  3KEZ A;  3QC1 A;  4OVU A;  2HR2 A;  4WND A;  3TL5 A;  3PUK A;  4GZ6 A;  3ZYL A;  4ABN A;  1Y6I A;  4WNE A;  2NXP A;  2A4Z A;  4CDN A;  2VGX B;  2YIN A;  4XE0 A;  2CG3 A;  3Q15 A;  4EBA A;  4I2Z A;  4WNG A;  3CVY A;  3FHE A;  5CMY A;  4Q96 A;  2WQ7 A;  2OND A;  3CEQ A;  5E75 A;  1HFA A;  3CVX A;  4XX5 A;  2I2O A;  1Z3Y A;  2LO6 A;  2Q7F A;  1H2T C;  4EZJ A;  3BEE A;  3EDT B;  3EIQ C;  3PEU B;  4GA0 A;  4JEH A;  4WWO A;  4YND A;  4FHK A;  1EF1 C;  4RVB A;  3CK9 A;  3HHM A;  3LEW A;  3TG5 A;  3UT8 A;  2X6H A;  3MX3 A;  3L54 A;  4G26 A;  3R7Q A;  4NRH B;  1IHG A;  1SQM A;  2NC9 A;  4WWP A;  3RIB A;  3CHS A;  1SZA A;  4PDX A;  2ZU6 B;  3CHR A;  4B0Z A;  2OOE A;  3LXU X;  2OV8 A;  5LCW C;  3WXX A;  3ZFW A;  2XCB A;  2J4D A;  3RKV A;  4AEZ C;  4HOS A;  5DBK A;  4I6G A;  2XGS A;  3Q5M A;  3KS2 A;  3CVL A;  3QWW A;  2X6I A;  1MQS A;  3FUI A;  3CVU A;  3CVN A;  3NZU A;  4B89 A;  4U04 A;  2E2E A;  4BTA A;  2P58 C;  5FQ7 A;  4I17 A;  5KJM A;  4U63 A;  5BUZ A;  4HOQ A;  1OWO A;  3QB2 A;  1UN9 A;  2HO1 A;  4UWF A;  5FWQ A;  4B94 A;  1ZBP A;  2I1J A;  3ONK A;  3ESL A;  1SZ9 A;  5CCL A;  3I4G A;  2RD0 A;  5JJ6 A;  2KM4 A;  1E90 A;  3SFZ A;  1E7V A;  3ZVV A;  3T8M A;  2Y3A A;  3IBE A;  2C0M A;  2JLB A;  3G2U A;  2PQN A;  4OYS A;  3LVQ E;  4IRU A;  3PNT B;  3UQ3 A;  4HOT A;  1IQR A;  4UQY A;  3RU0 A;  2HM8 A;  4ILG A;  4O6F A;  1E7U A;  3PS6 A;  3ESK A;  4I6E A;  4G11 A;  2PQR A;  2L0I A;  4FJY A;  5A23 A;  1Z3X A;  3ZXS A;  5J08 A;  5DIZ A;  2IOL A;  2RG8 A;  3Q47 B;  4WUY A;  2J4B A;  4UWH A;  3R7R A;  4HS2 A;  3UT4 A;  2E0I A;  2YNQ A;  1A17 A;  4XKC A;  4JZY A;  4Q69 A;  3CSF A;  2V0P A;  5C1D A;  5FQ4 A;  2LAH A;  3B7U X;  3MKQ A;  4BT8 A;  5T8I A;  4EBA G;  4JEU A;  4APF A;  4GCO A;  4MLP A;  3IKO B;  2R59 A;  4JHR A;  4JPS A;  4EEC A;  3TGO A;  4ANX A;  1NA3 A;  3SBT B;  4EPZ A;  5JHB A;  3APF A;  3I3N A;  2WXJ A;  2WQH A;  4DLO A;  2WMN A;  3CHP A;  3PEV B;  1HG5 A;  2FUL A;  5KJL A;  3IHY A;  5FJY A;  3PZD A;  2X6F A;  3U66 A;  3UUX A;  2WMO A;  4XZ4 A;  3VLE A;  4DI4 A;  4XI9 A;  5FQ8 A;  4GZD A;  4AOF A;  2PL2 A;  3NZS A;  2V8S E;  3B7T A;  1ELW A;  3RRN B;  5G04 J;  3U9W A;  3KD7 A;  3MJW A;  2AXU A;  4W9R A;  3LKU A;  2CHW A;  4AXH A;  3FEX A;  3GZS A;  4I2W A;  3DBS A;  3U4T A;  2PM6 A;  3FU3 A;  2FO7 A;  3FEY A;  4G1T A;  4G2V A;  3JCK C;  5A7D B;  3QWP A;  1ELR A;  3ONL A;  3L17 A;  3MCX A;  2YHE A;  4OVV A;  4BSX A;  1H6K A;  4GYO A;  4J8S A;  3QDN A;  3DPD A;  4J8F A;  3ZYQ A;  2XEV A;  5JJ7 A;  3QOU A;  5BPP A;  1E8W A;  2AVP A;  4YVQ C;  4KT6 B;  4ACK A;  2GRM A;  3RRU A;  4F7A A;  3R9A B;  4RG9 A;  1HZ4 A;  4AJW A;  2HYZ A;  1IYG A;  4N3A A;  3UX4 A;  4P29 A;  2NSZ A;  3BG0 B;  3FTU A;  3FUH A;  3QWV A;  4UI9 C;  3FFL A;  4F1S A;  4CGW A;  4URK A;  4LER A;  2WM9 A;  4CCA A;  2XQ0 A;  5BT1 A;  1NZN A;  1Y8M A;  4LEU A;  3FTY A;  2J9Q A;  4U07 A;  4FC8 A;  1EPU A;  5FTP A;  1FVH A;  4PS8 A;  3HVE A;  3HVE B;  3VTY A;  1QQE A;  4DJA A;  3FU6 A;  3MZL B;  3FUN A;  3D9P A;  4E85 A;  4GZ3 A;  2WXF A;  3EIJ A;  1QNF A;  3U3W A;  4GAA A;  1TJF A;  2A5U A;  3L16 A;  2Y4U A;  3D9I A;  5FZS A;  1H0A A;  4UI9 K;  3O4Z A;  5G04 C;  4MKT A;  3O48 A;  4GA1 A;  3S7F A;  3TXM A;  3GYZ A;  5A6C A;  1VDY A;  4CEM A;  2VSY A;  3HDX A;  4JL0 A;  4DLQ A;  3CLJ A;  3L08 A;  4HVB A;  4NQ0 A;  1TJC A;  4JXT A;  1UJK A;  4LUN U;  3SZ7 A;  1KT1 A;  3LY7 A;  3UT7 A;  4JHK A;  4TRQ A;  1INZ A;  4CGV A;  3URZ A;  3P2B A;  4Y6C A;  2WXQ A;  3Q4A B;  3VTX A;  3D9L A;  3PNL B;  4GYW A;  1HU3 A;  2X38 A;  3JQ1 A;  3LY9 A;  4I9C A;  4IYP A;  4KYO B;  4AVX A;  4F53 A;  3SGH A;  2VSO E;  3ASD A;  4G25 A;  3FTX A;  3CVQ A;  3IV0 A;  5G55 A;  1PAQ A;  2KC7 A;  1HX8 A;  3FTZ A;  3PRZ A;  3ZPJ A;  5D0Q D;  4A3V A;  3FUL A;  3G2S A;  1B89 A;  4N2S A;  2WXN A;  3E4B A;  1JPL A;  4MS6 A;  4A1S A;  3I5P A;  1E8Y A;  2OVF A;  3L6A A;  4YVO A;  3OTN A;  3ZIM A;  4FLH A;  2WQ6 A;  1DNP A;  1JWG A;  3G2T A;  2XRY A;  4GA2 A;  4DK5 A;  2IQC A;  4DPR A;  2WB2 A;  4KZC A;  4TV3 A;  2L6J A;  1OWL A;  3CHO A;  3RJV A;  4HLE A;  1E8Z A;  1FVF A;  2J49 A;  2QY7 A;  2WXO A;  3FH8 A;  3ZYK A;  3CR3 A;  3LCA A;  2J08 A;  3FTW A;  3QJZ A;  2VSX E;  4XI0 A;  1H19 A;  3PVL A;  1HS6 A;  4WWN A;  5LX8 A;  2KZT A;  2KZT B;  2Y4T A;  4BFR A;  3ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...