1XNQD

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 1xnqD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1xnqD02
4JI2D 4NXMD 4JI4D 1HNZD 4JYAD 1FJGD 1N36D 4YHHD 1HNXD 4JI5D 2UUCD 4JV5D 1KSLA 1N34D 3DH3A 1H3FA 4KHPD 1XNQD 1DM9A 4DV4D 1XNRD 4X62D 4DR5D 2UXCD 4X66D 4X65D 1IBMD 4LFBD 4LF5D 4JI7D 4GKJD 1XMQD 1IBLD 2HHHD 4DUYD 1J5ED 2E5LD 2ISTA 4JI1D 1H3EA 3T1YD 4B3RD 1IBKD 4DR1D 4K0KD 1HR0D 4DR7D 4DV1D 4NXND 4DV6D 2F4VD 3KBGA 4LFCD 1HNWD 4GKKD 4AQYD 2UXBD 4LF9D 4DR6D 4DV0D 5LMND 1VIOA 4DV2D 4DV3D 2VQED 4B3SD 1N32D 4DR2D 2UUAD 4DR4D 4LF4D 2UXDD 2KTLA 2UU9D 4LF6D 4YY3D 4LF7D 2UUBD 1N33D 4DV5D 2K6PA 4DR3D 4B3MD 4JI8D 1I94D 1XMOD 4JI3D 4LGTA 1P9KA 1C06A 4JI0D 4X64D 4LF8D 2VQFD 5LMUD 1FKAD 1JH3A 1C05A 5BR8D 2ZM6D 4DUZD 4OUDA 3HP7A 4OX9D 5IWAD 4LFAD 3OTOD 1KSKA 3T1HD 4DV7D 2JANA 1KSVA 4JI6D 4B3TD
chains in the Genus database with same CATH superfamily
4JI2D 4NXMD 4JI4D 2L3NA 1HNZD 3FN1A 4JYAD 1FJGD 5FQ2B 1N36D 4YHHD 1HNXD 4JI5D 1Y8XB 2UUCD 4JV5D 1KSLA 1N34D 5KNLA 3DH3A 1H3FA 4KHPD 1XNQD 1DM9A 2LQ7A 4DV4D 1XNRD 4X62D 4DR5D 5A2QE 2UXCD 4X66D 4X65D 1IBMD 4LFBD 4II3A 3J7AF 4LF5D 4JI7D 4GKJD 1XMQD 1IBLD 2HHHD 4DUYD 1J5ED 2E5LD 3J81E 2ISTA 4II2A 4JI1D 3KYCB 3J80E 3T1YD 4B3RD 1H3EA 1IBKD 4DR1D 4K0KD 1HR0D 4DR7D 3ONGA 4DV1D 4NXND 2NVUB 4DV6D 2F4VD 3KBGA 4LFCD 1HNWD 4GKKD 4AQYD 2UXBD 5FLXE 4LF9D 4DR6D 4DV0D 5LMND 1VIOA 4DV2D 4DV3D 2VQED 4B3SD 1N32D 4DR2D 2UUAD 4DR4D 4LF4D 2UXDD 2KTLA 2UU9D 4LF6D 3JAME 4YY3D 4LF7D 4W5VB 2UUBD 1N33D 4DV5D 2K6PA 4DR3D 4B3MD 4JI8D 1I94D 3CMMA 5LL6S 4NNJA 3ONHA 1XMOD 4JI3D 4LGTA 1P9KA 1C06A 4JI0D 1Y8QB 4X64D 4LF8D 2VQFD 5LMUD 1FKAD 1JH3A 1Y8RB 3KYDB 5IT9E 1C05A 5BR8D 2ZM6D 4DUZD 2ZTBA 4OUDA 3HP7A 4OX9D 2I1SA 5IWAD 4LFAD 3OTOD 1KSKA 3T1HD 4DV7D 2JANA 1KSVA 4JI6D 4B3TD
chains in the Genus database with same CATH topology
4JI2D 4NXMD 4JI4D 2L3NA 1HNZD 4JYAD 1FJGD 1N36D 4YHHD 1HNXD 4JI5D 2UUCD 4JV5D 1KSLA 1N34D 3DH3A 1H3FA 4KHPD 1XNQD 1DM9A 4DV4D 1XNRD 4X62D 4DR5D 2UXCD 4X66D 4X65D 1IBMD 4LFBD 4LF5D 4JI7D 4GKJD 1XMQD 1IBLD 2HHHD 4DUYD 1J5ED 2E5LD 2ISTA 4JI1D 1H3EA 3T1YD 4B3RD 1IBKD 4DR1D 4K0KD 1HR0D 4DR7D 4DV1D 4NXND 4DV6D 2F4VD 3KBGA 4LFCD 1HNWD 4GKKD 4AQYD 2UXBD 4LF9D 4DR6D 4DV0D 5LMND 1VIOA 4DV2D 4DV3D 2VQED 4B3SD 1N32D 4DR2D 2UUAD 4DR4D 4LF4D 2UXDD 2KTLA 2UU9D 4LF6D 4YY3D 4LF7D 2UUBD 1N33D 4DV5D 2K6PA 4DR3D 4B3MD 4JI8D 1I94D 1XMOD 4JI3D 4LGTA 1P9KA 1C06A 4JI0D 4X64D 4LF8D 2VQFD 5LMUD 1FKAD 1JH3A 1C05A 5BR8D 2ZM6D 4DUZD 4OUDA 3HP7A 4OX9D 5IWAD 4LFAD 3OTOD 1KSKA 3T1HD 4DV7D 2JANA 1KSVA 4JI6D 4B3TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 D;  4NXM D;  4JI4 D;  1HNZ D;  4JYA D;  1FJG D;  1N36 D;  4YHH D;  1HNX D;  4JI5 D;  2UUC D;  4JV5 D;  1KSL A;  1N34 D;  3DH3 A;  1H3F A;  4KHP D;  1XNQ D;  1DM9 A;  4DV4 D;  1XNR D;  4X62 D;  4DR5 D;  2UXC D;  4X66 D;  4X65 D;  1IBM D;  4LFB D;  4LF5 D;  4JI7 D;  4GKJ D;  1XMQ D;  1IBL D;  2HHH D;  4DUY D;  1J5E D;  2E5L D;  2IST A;  4JI1 D;  1H3E A;  3T1Y D;  4B3R D;  1IBK D;  4DR1 D;  4K0K D;  1HR0 D;  4DR7 D;  4DV1 D;  4NXN D;  4DV6 D;  2F4V D;  3KBG A;  4LFC D;  1HNW D;  4GKK D;  4AQY D;  2UXB D;  4LF9 D;  4DR6 D;  4DV0 D;  5LMN D;  1VIO A;  4DV2 D;  4DV3 D;  2VQE D;  4B3S D;  1N32 D;  4DR2 D;  2UUA D;  4DR4 D;  4LF4 D;  2UXD D;  2KTL A;  2UU9 D;  4LF6 D;  4YY3 D;  4LF7 D;  2UUB D;  1N33 D;  4DV5 D;  2K6P A;  4DR3 D;  4B3M D;  4JI8 D;  1I94 D;  1XMO D;  4JI3 D;  4LGT A;  1P9K A;  1C06 A;  4JI0 D;  4X64 D;  4LF8 D;  2VQF D;  5LMU D;  1FKA D;  1JH3 A;  1C05 A;  5BR8 D;  2ZM6 D;  4DUZ D;  4OUD A;  3HP7 A;  4OX9 D;  5IWA D;  4LFA D;  3OTO D;  1KSK A;  3T1H D;  4DV7 D;  2JAN A;  1KSV A;  4JI6 D;  4B3T D; 
#chains in the Genus database with same CATH topology
 4JI2 D;  4NXM D;  4JI4 D;  2L3N A;  1HNZ D;  3FN1 A;  4JYA D;  1FJG D;  5FQ2 B;  1N36 D;  4YHH D;  1HNX D;  4JI5 D;  1Y8X B;  2UUC D;  4JV5 D;  1KSL A;  1N34 D;  5KNL A;  3DH3 A;  1H3F A;  4KHP D;  1XNQ D;  1DM9 A;  2LQ7 A;  4DV4 D;  1XNR D;  4X62 D;  4DR5 D;  5A2Q E;  2UXC D;  4X66 D;  4X65 D;  1IBM D;  4LFB D;  4II3 A;  3J7A F;  4LF5 D;  4JI7 D;  4GKJ D;  1XMQ D;  1IBL D;  2HHH D;  4DUY D;  1J5E D;  2E5L D;  3J81 E;  2IST A;  4II2 A;  4JI1 D;  3KYC B;  3J80 E;  3T1Y D;  4B3R D;  1H3E A;  1IBK D;  4DR1 D;  4K0K D;  1HR0 D;  4DR7 D;  3ONG A;  4DV1 D;  4NXN D;  2NVU B;  4DV6 D;  2F4V D;  3KBG A;  4LFC D;  1HNW D;  4GKK D;  4AQY D;  2UXB D;  5FLX E;  4LF9 D;  4DR6 D;  4DV0 D;  5LMN D;  1VIO A;  4DV2 D;  4DV3 D;  2VQE D;  4B3S D;  1N32 D;  4DR2 D;  2UUA D;  4DR4 D;  4LF4 D;  2UXD D;  2KTL A;  2UU9 D;  4LF6 D;  3JAM E;  4YY3 D;  4LF7 D;  4W5V B;  2UUB D;  1N33 D;  4DV5 D;  2K6P A;  4DR3 D;  4B3M D;  4JI8 D;  1I94 D;  3CMM A;  5LL6 S;  4NNJ A;  3ONH A;  1XMO D;  4JI3 D;  4LGT A;  1P9K A;  1C06 A;  4JI0 D;  1Y8Q B;  4X64 D;  4LF8 D;  2VQF D;  5LMU D;  1FKA D;  1JH3 A;  1Y8R B;  3KYD B;  5IT9 E;  1C05 A;  5BR8 D;  2ZM6 D;  4DUZ D;  2ZTB A;  4OUD A;  3HP7 A;  4OX9 D;  2I1S A;  5IWA D;  4LFA D;  3OTO D;  1KSK A;  3T1H D;  4DV7 D;  2JAN A;  1KSV A;  4JI6 D;  4B3T D; 
#chains in the Genus database with same CATH homology
 4JI2 D;  4NXM D;  4JI4 D;  2L3N A;  1HNZ D;  4JYA D;  1FJG D;  1N36 D;  4YHH D;  1HNX D;  4JI5 D;  2UUC D;  4JV5 D;  1KSL A;  1N34 D;  3DH3 A;  1H3F A;  4KHP D;  1XNQ D;  1DM9 A;  4DV4 D;  1XNR D;  4X62 D;  4DR5 D;  2UXC D;  4X66 D;  4X65 D;  1IBM D;  4LFB D;  4LF5 D;  4JI7 D;  4GKJ D;  1XMQ D;  1IBL D;  2HHH D;  4DUY D;  1J5E D;  2E5L D;  2IST A;  4JI1 D;  1H3E A;  3T1Y D;  4B3R D;  1IBK D;  4DR1 D;  4K0K D;  1HR0 D;  4DR7 D;  4DV1 D;  4NXN D;  4DV6 D;  2F4V D;  3KBG A;  4LFC D;  1HNW D;  4GKK D;  4AQY D;  2UXB D;  4LF9 D;  4DR6 D;  4DV0 D;  5LMN D;  1VIO A;  4DV2 D;  4DV3 D;  2VQE D;  4B3S D;  1N32 D;  4DR2 D;  2UUA D;  4DR4 D;  4LF4 D;  2UXD D;  2KTL A;  2UU9 D;  4LF6 D;  4YY3 D;  4LF7 D;  2UUB D;  1N33 D;  4DV5 D;  2K6P A;  4DR3 D;  4B3M D;  4JI8 D;  1I94 D;  1XMO D;  4JI3 D;  4LGT A;  1P9K A;  1C06 A;  4JI0 D;  4X64 D;  4LF8 D;  2VQF D;  5LMU D;  1FKA D;  1JH3 A;  1C05 A;  5BR8 D;  2ZM6 D;  4DUZ D;  4OUD A;  3HP7 A;  4OX9 D;  5IWA D;  4LFA D;  3OTO D;  1KSK A;  3T1H D;  4DV7 D;  2JAN A;  1KSV A;  4JI6 D;  4B3T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...