1XNQI

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqI00
4X66I 1XMQE 1Z5BA 1H7UA 4JI4I 4JI2E 1N33E 4HYMA 4JYAE 2R3VA 4JI0I 1XMOE 2VQEI 4UTGA 2EFGA 1Z0WA 2X7IA 1IBLI 4LF9I 2UXBI 4HY1A 4JI5I 4DR6E 1ZXNA 4DR1E 4DR3E 4PRVA 4YY3E 4GKKI 1N34I 1H74A 1Z0EA 1HNXI 3B82A 3PYFA 1FKAE 4JI3E 4LF6E 1N34E 1MU5A 1HNWI 4AQYE 2HHHI 3T1YI 4JI7I 4YHHE 1BKNA 4DV3I 2ZM6I 1IBMI 4MYUA 5LL6R 2F4VE 2HK2A 2GS8A 4GKJI 4DV7E 2A2DA 1H73A 1XMOI 1ELOA 5IWAE 2CZ9A 3J80C 4Z7YA 2UXDI 4K0KE 4DV2E 3PYGA 1FI4A 4USKA 2NPFA 1J5EI 3F0NA 1ZM4A 3Q1QA 4WUDA 4JI1E 4P7AA 4DPUA 2V2ZA 3B8HA 2V34A 4KHPE 4UT4A 1XNQE 1OJ4A 4DR5E 4B3RE 1N36I 3ZZTA 4LFAE 1B62A 4EMDA 4NXMI 4OX9E 4DUYE 4ZVIA 1H7SA 2VQEE 4DV4I 4B3SI 1N32I 5L3JA 1K47A 1HNZE 4B3SE 3WU4A 5A2QC 1FJGI 4LF9E 2UUBI 2AJ4A 4DR6I 4DR1I 3D4JA 4LF8E 3PYEA 5IT9C 1FNMA 2E5LI 2ZBKB 4B3TI 4LF8I 4B3MI 4LF7E 4PRXA 2UU9I 4DV0E 1Z0BA 4X66E 2HHHE 2J7KA 4YHHI 1N0VC 2BV3A 3K1JA 3ZKBA 4DV6E 1N33I 3ZZ0A 2VQFI 1N0UA 1FWLA 1RR9A 5LMNI 4URLA 4JI4E 4K0KI 5IT9Q 1N32E 4FWHA 3B78A 1XNRI 4DV5E 1ZXMA 2UXCE 4DV1I 4DR2I 4DU7A 4DR3I 1HR0I 1S4EA 3LPSA 4FWGA 1Z5CA 1IBKI 3OTOE 4Z7CA 5FLXQ 5A2QQ 2UUCE 4YY3I 3J7AG 2E5LE 4HACB 5BR8I 5FLXC 1A6FA 4GKKE 4FW9A 3JAMQ 1ZM3A 1PIEA 3LTOA 3T1HE 1IBME 2DEJA 3V2UC 2HFSA 1NHIA 1I94E 4DV7I 1FJGE 1ZM2A 1ZM9A 2R42A 3ZKDA 1U2RA 2VF3A 3PYDA 2UXBE 4JI5E 2UUAI 1PVGA 4LF7I 2UU9E 4WUCA 2V2VA 4KHPI 4DR7E 3WU3A 4LFCI 2HK3A 4XTJA 3J81Q 1MX0A 1H72C 4FWDA 4NXNI 4X65I 4GKJE 5LMNE 4JYAI 4JI0E 3GONA 3WU5A 5IWAI 4JI8I 1I94I 1Z0TA 5LMUE 1Z0CA 4LF4E 3CWVA 1HR0E 3ZM7A 3OTOI 1EA6A 1NHHA 3H4LA 1RREA 2HKEA 4R1FA 1B63A 2BM1A 3J81C 4I3HA 4LF6I 1PKPA 2HKJA 4B3TE 4DV6I 3J7AM 4DR7I 1KKHA 1KIJA 4PU9A 3LNUA 3QT8A 4DV4E 4NXNE 4X65E 2VQFE 2UXDE 1IBLE 2A2CA 2UUBE 4JI6E 1XNRE 1FWKA 4JI6I 4M1KA 4LFBI 1IBKE 4LFAI 4USMA 4JI3I 2XEXA 2LJPA 4P52A 4JV5I 3M6AA 4JI7E 1D6TA 2F4VI 3J80Q 4DV3E 4OX9I 2ZITA 4HACA 2DEIA 3WU6A 3JAMC 4DR4I 2Q2EB 4JI8E 1J5EE 4WUBA 1MG7A 1EI1A 2E1RA 4LF5I 1WUUA 1Z0VA 1HNXE 1Z59A 4AQYI 4FN5A 4DPYA 3QT7A 4KQVA 1N36E 2BM0A 4B3ME 1DARA 1S16A 3HULA 2UUAE 4NXME 1HNWE 4JV5E 1XMQI 3QT6A 4DUYI 4LFCE 4DV2I 1HNZI 4DR4E 3T1HI 2V8PA 4DV1E 4DR2E 1Z0GA 2X36A 1XNQI 1KTVA 4JI1I 4DV0I 1KVKA 1VISA 3QT5A 4DUZE 3ZZUA 3V5RA 4DR5I 4X62I 4DPWA 4DXLA 3T1YE 4X62E 3K17A 1QZRA 4JI2I 2ZM6E 2HFUA 2WW4A 4ED4A 2V2QA 4MYTA 4DV5I 1NHJA 1XHKA 1Z5AA 4X64I 4DPTA 2UXCI 4HXZA 4X64E 2UUCI 1UEKA 4LF5E 5GMDA 1NZ0A 5LMUI 4LF4I 4LFBE 4RPFA 2OI2A 4B3RI 5BR8E 4DPXA 4DUZI 5GMEA 4JG4A 4DU8A
chains in the Genus database with same CATH superfamily
4X66I 1XMQE 1Z5BA 1H7UA 4JI4I 4JI2E 1N33E 4HYMA 4JYAE 4N3OA 2R3VA 4JI0I 1XMOE 5K36A 2VQEI 4UTGA 4OO1A 2EFGA 4U3BA 2Z5EA 1XXEA 1Z0WA 2X7IA 2C38A 1OYSA 1IBLI 4OZEA 4OO1D 4LF9I 2UXBI 4HY1A 4JI5I 4DR6E 1ZXNA 4DR1E 4DR3E 4PRVA 4YY3E 4GKKI 5C0XD 4BA1B 1N34I 4AIDA 1H74A 1RHYA 1Z0EA 1HNXI 3B82A 3PYFA 1FKAE 4JI3E 4LF6E 1N34E 1MU5A 2NN6D 1HNWI 4AQYE 2IOQA 2HHHI 3T1YI 4JI7I 4YHHE 2CVEA 4AIMA 1BKNA 4DV3I 2ZM6I 1IBMI 4MYUA 5LL6R 2F4VE 4LCHA 2HK2A 2GS8A 4GKJI 4GQUA 3DD6A 2WNRB 4DV7E 2A2DA 1H73A 1XMOI 1ELOA 1HK7A 5C0XE 5IWAE 2CZ9A 3J80C 4Z7YA 2UXDI 4NBQA 4K0KE 3CDJA 5JEAE 4DV2E 3PYGA 1FI4A 4USKA 2NPFA 1J5EI 3F0NA 1ZM4A 3Q1QA 4WUDA 1R6LA 4JI1E 2PO2A 4P7AA 4DPUA 2V2ZA 4IZKB 3B8HA 2V34A 4KHPE 4UT4A 4IFDB 3HJCA 1XNQE 1OJ4A 4DR5E 4B3RE 1N36I 5K36E 3ZZTA 4LFAE 1B62A 4QNJA 4EMDA 4NXMI 2O1TA 4OX9E 2WNRA 4DUYE 4ZVIA 1H7SA 2VQEE 4DV4I 4IS9A 4B3SI 1N32I 2JEBA 5L3JA 1E3PA 1K47A 2C37A 4LPFA 1HNZE 4B3SE 4LOMA 5C0XF 2NN6B 5DNLA 3WU4A 3H1CA 5A2QC 1FJGI 4LF9E 5JEAB 2UUBI 2AJ4A 4DR6I 4DR1I 3D4JA 4LF8E 3PYEA 5IT9C 1FNMA 2E5LI 4DU8A 2ZBKB 4B3TI 3M7NG 4LF8I 4B3MI 4LF7E 4PRXA 2UU9I 2BA0G 5DRRA 1Z0BA 4DV0E 4X66E 1OYPA 2J7KA 2HHHE 4YHHI 1N0VC 2BV3A 3K1JA 3ZKBA 4DV6E 1N33I 3ZZ0A 2VQFI 1N0UA 1Y4SA 4IZKA 1FWLA 1RR9A 5LMNI 4MU0A 4FW5A 4URLA 2JEBB 4JI4E 4K0KI 5IT9Q 1N32E 3PS1A 4FWHA 3B78A 1XNRI 3P3GA 4DV5E 1ZXMA 2UXCE 3P76A 2IOPA 2NN6E 4DV1I 4DR2I 4DU7A 4DR3I 1S4EA 3LPSA 2IERA 4FWGA 1HR0I 1Z5CA 3OTOE 1IBKI 4Z7CA 5FLXQ 5JEAC 4BA2A 5A2QQ 4OO1C 2UUCE 4YY3I 3KRNA 2NN6C 2BR2A 4FW3A 5JEAF 3J7AG 2E5LE 4HACB 4IFDE 5BR8I 2VESA 2JEAA 2C37B 5FLXC 1A6FA 4GKKE 4IFDC 4FW9A 3JAMQ 3P06A 2BR2B 5K36F 4FW4A 1ZM3A 4MU3A 3M85D 1PIEA 3LTOA 4U3DA 3T1HE 2CGEA 1IBME 4OO1B 2DEJA 3V2UC 2HFSA 1NHIA 1I94E 4DV7I 3Q6NA 1FJGE 4IFDA 1ZM2A 1ZM9A 2R42A 3ZKDA 1U2RA 2VF3A 3PYDA 5C0XA 2UXBE 4JI5E 2IESA 2UUAI 1USVA 1PVGA 4LF7I 2UU9E 4WUCA 2V2VA 4KHPI 4DR7E 3WU3A 3GLLA 4LFCI 2HK3A 4XTJA 1Y6ZA 4OKGA 3UHMA 1E3HA 3L7ZB 4J3DA 3J81Q 4BA2B 2JE6A 1MX0A 1H72C 2C39B 4FWDA 4NXNI 4X65I 4GKJE 5LMNE 4JYAI 2F1DA 4JI0E 4MU4A 1YHCA 3GONA 2PO0A 4IZJA 3WU5A 3GCMA 5IWAI 2AE8A 3M7ND 4IZJD 4JI8I 4BA1A 1I94I 1Z0TA 2Z5BA 5LMUE 1Z0CA 4LF4E 3CWVA 1HR0E 3ZM7A 3OTOI 1EA6A 1NHHA 3H4LA 2PO1A 2PO0B 2O3ZA 1RREA 2HKEA 4ISAA 4R1FA 1B63A 2BM1A 3J81C 4I3HA 4LF6I 3NZKA 5DRPA 1PKPA 2HKJA 4B3TE 4DV6I 3J7AM 4QNKA 2CG9A 4DR7I 4AM3A 5JEAA 1KKHA 5C0XC 1KIJA 4PU9A 3LNUA 3QT8A 2O1WA 4DV4E 2PNZA 5DNXA 4NXNE 2BA1G 2GO4A 4X65E 5ELWA 5K36D 2VQFE 4OO1E 2J65A 2WP8B 2UXDE 1VI7A 3U1YA 4LCFA 1IBLE 2A2CA 2UUBE 3HKMA 4JI6E 1XNRE 1FWKA 4JI6I 4M1KA 4FW6A 4IFDF 2PO1B 5EKWA 2Z5CA 4LFBI 1IBKE 4LFAI 4USMA 5FWKA 4JI3I 2XEXA 2LJPA 4P52A 2PO2B 4JV5I 3M6AA 4JI7E 1D6TA 2NN6A 2F4VI 3J80Q 4DV3E 2PNZB 4OX9I 3M85G 2Z5CB 2C39A 2ZITA 4HACA 1P42A 2DEIA 3WU6A 3PS2A 3JAMC 4DR4I 4LCGA 1Y60A 5JEAD 5DROA 1Y4UA 2Q2EB 4JI8E 1J5EE 4WUBA 1UDSA 1MG7A 1EI1A 2E1RA 4LF5I 1WUUA 1Z0VA 1HNXE 1Z59A 1Y5YA 3PRYA 3Q6MA 4AQYI 4FN5A 4DPYA 2Z5BB 5K36C 3QT7A 4KQVA 1N36E 2O1VA 2BM0A 4B3ME 1DARA 1S16A 3HULA 2UUAE 4NXME 1HNWE 4JV5E 2JT2A 1XMQI 3QT6A 4DUYI 4OO1F 2PNLA 4LFCE 4DV2I 1HNZI 2C38B 1USUA 1UDNA 3PS3A 4IFDD 4MQYA 4DR4E 3T1HI 2V8PA 1OYRA 2BA0D 3P3CA 4DV1E 4DR2E 2JEAB 1Z0GA 2O1UA 2X36A 2GQ0A 1XNQI 1KTVA 4MDTA 4JI1I 5DRQA 3U1KA 4DV0I 1KVKA 1VISA 3QT5A 4DUZE 3ZZUA 3V5RA 4DR5I 4X62I 4MU1A 4DPWA 2BA1D 2GO3A 4FW7A 4DXLA 3T1YE 3GMEA 4X62E 3K17A 1QZRA 4JI2I 3B4TA 2ZM6E 2HFUA 2WW4A 4ED4A 2NN6F 2V2QA 2WP8A 5C0XB 4MYTA 4DV5I 1NHJA 1XHKA 4IZJB 1Z5AA 4X64I 3CDIA 4DPTA 2UXCI 1UDOA 4HXZA 4X64E 3K85A 2UUCI 1UEKA 1R6MA 4LF5E 5GMDA 1NZ0A 1UDQA 5LMUI 1YH8A 4LF4I 4LFBE 4RPFA 2JE6B 2OI2A 3L7ZA 2PNMA 4B3RI 5K36B 5BR8E 4DPXA 4DUZI 5GMEA 3P3EA 4JG4A 5EL9A
chains in the Genus database with same CATH topology
4X66I 1XMQE 1Z5BA 1H7UA 4JI4I 4JI2E 1N33E 4HYMA 4JYAE 4N3OA 2R3VA 4JI0I 1XMOE 2VQEI 4UTGA 2EFGA 2Z5EA 1Z0WA 2X7IA 1IBLI 4LF9I 2UXBI 4HY1A 4JI5I 4DR6E 1ZXNA 4DR1E 4DR3E 4PRVA 4YY3E 4GKKI 1N34I 1H74A 1Z0EA 1HNXI 3B82A 3PYFA 1FKAE 4JI3E 4LF6E 1N34E 1MU5A 1HNWI 4AQYE 2IOQA 2HHHI 3T1YI 4JI7I 4YHHE 1BKNA 4DV3I 2ZM6I 1IBMI 4MYUA 5LL6R 2F4VE 2HK2A 2GS8A 4GKJI 4DV7E 2A2DA 1H73A 1XMOI 1ELOA 1HK7A 5IWAE 2CZ9A 3J80C 4Z7YA 2UXDI 4K0KE 4DV2E 3PYGA 1FI4A 4USKA 2NPFA 1J5EI 3F0NA 1ZM4A 3Q1QA 4WUDA 4JI1E 4P7AA 4DPUA 2V2ZA 4IZKB 3B8HA 2V34A 4KHPE 4UT4A 3HJCA 1XNQE 1OJ4A 4DR5E 4B3RE 1N36I 3ZZTA 4LFAE 1B62A 4EMDA 4NXMI 2O1TA 4OX9E 4DUYE 4ZVIA 1H7SA 2VQEE 4DV4I 4B3SI 1N32I 5L3JA 1K47A 1HNZE 4B3SE 3WU4A 5A2QC 1FJGI 4LF9E 2UUBI 2AJ4A 4DR6I 4DR1I 3D4JA 4LF8E 3PYEA 5IT9C 1FNMA 2E5LI 2ZBKB 4B3TI 4LF8I 4B3MI 4LF7E 4PRXA 2UU9I 4DV0E 1Z0BA 4X66E 2HHHE 2J7KA 4YHHI 1N0VC 2BV3A 3K1JA 3ZKBA 4DV6E 1N33I 3ZZ0A 2VQFI 1N0UA 1Y4SA 4IZKA 1FWLA 1RR9A 5LMNI 4URLA 4JI4E 4K0KI 5IT9Q 1N32E 4FWHA 3B78A 1XNRI 4DV5E 1ZXMA 2UXCE 2IOPA 4DV1I 4DR2I 4DU7A 4DR3I 1HR0I 1S4EA 3LPSA 4FWGA 3OTOE 1IBKI 1Z5CA 4Z7CA 5FLXQ 5A2QQ 2UUCE 4YY3I 3J7AG 2E5LE 4HACB 5BR8I 5FLXC 1A6FA 4GKKE 4FW9A 3JAMQ 3P06A 1ZM3A 1PIEA 3LTOA 3T1HE 2CGEA 1IBME 2DEJA 3V2UC 2HFSA 1NHIA 1I94E 4DV7I 3Q6NA 1FJGE 1ZM2A 1ZM9A 2R42A 3ZKDA 1U2RA 2VF3A 3PYDA 2UXBE 4JI5E 2UUAI 1USVA 1PVGA 4LF7I 2UU9E 4WUCA 2V2VA 4KHPI 4DR7E 3WU3A 4LFCI 2HK3A 4XTJA 1Y6ZA 3J81Q 1MX0A 1H72C 4FWDA 4NXNI 4X65I 4GKJE 5LMNE 4JYAI 4JI0E 3GONA 3WU5A 4IZJA 5IWAI 4IZJD 4JI8I 1I94I 1Z0TA 2Z5BA 5LMUE 1Z0CA 4LF4E 3CWVA 1HR0E 3ZM7A 3OTOI 1EA6A 1NHHA 3H4LA 1RREA 2HKEA 4R1FA 1B63A 2BM1A 3J81C 4I3HA 4LF6I 1PKPA 2HKJA 4B3TE 4DV6I 3J7AM 2CG9A 4DR7I 1KKHA 1KIJA 4PU9A 3LNUA 3QT8A 2O1WA 4DV4E 4NXNE 4X65E 2VQFE 2UXDE 1IBLE 2A2CA 2UUBE 4JI6E 1XNRE 1FWKA 4JI6I 4M1KA 2Z5CA 4LFBI 1IBKE 4LFAI 4USMA 5FWKA 4JI3I 2XEXA 2LJPA 4P52A 4JV5I 3M6AA 4JI7E 1D6TA 2F4VI 3J80Q 4DV3E 4OX9I 2Z5CB 2ZITA 4HACA 2DEIA 3WU6A 3JAMC 4DR4I 1Y4UA 2Q2EB 4JI8E 1J5EE 4WUBA 1MG7A 1EI1A 2E1RA 4LF5I 1WUUA 1Z0VA 1HNXE 1Z59A 3PRYA 3Q6MA 4AQYI 4FN5A 4DPYA 2Z5BB 3QT7A 4KQVA 1N36E 2O1VA 2BM0A 4B3ME 1DARA 1S16A 3HULA 2UUAE 4NXME 1HNWE 4JV5E 1XMQI 3QT6A 4DUYI 2PNLA 4LFCE 4DV2I 1HNZI 1USUA 4DR4E 3T1HI 2V8PA 4DV1E 4DR2E 1Z0GA 2O1UA 2X36A 2GQ0A 1XNQI 1KTVA 4JI1I 4DV0I 1KVKA 1VISA 3QT5A 4DUZE 3ZZUA 3V5RA 4DR5I 4X62I 4DPWA 4DXLA 3T1YE 4X62E 3K17A 1QZRA 4JI2I 2ZM6E 2HFUA 2WW4A 4ED4A 2V2QA 4MYTA 4DV5I 1NHJA 1XHKA 4IZJB 1Z5AA 4X64I 4DPTA 2UXCI 4HXZA 4X64E 3K85A 2UUCI 1UEKA 4LF5E 5GMDA 1NZ0A 5LMUI 4LF4I 4LFBE 4RPFA 2OI2A 2PNMA 4B3RI 5BR8E 4DPXA 4DUZI 5GMEA 4JG4A 4DU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 I;  1XMQ E;  1Z5B A;  1H7U A;  4JI4 I;  4JI2 E;  1N33 E;  4HYM A;  4JYA E;  2R3V A;  4JI0 I;  1XMO E;  2VQE I;  4UTG A;  2EFG A;  1Z0W A;  2X7I A;  1IBL I;  4LF9 I;  2UXB I;  4HY1 A;  4JI5 I;  4DR6 E;  1ZXN A;  4DR1 E;  4DR3 E;  4PRV A;  4YY3 E;  4GKK I;  1N34 I;  1H74 A;  1Z0E A;  1HNX I;  3B82 A;  3PYF A;  1FKA E;  4JI3 E;  4LF6 E;  1N34 E;  1MU5 A;  1HNW I;  4AQY E;  2HHH I;  3T1Y I;  4JI7 I;  4YHH E;  1BKN A;  4DV3 I;  2ZM6 I;  1IBM I;  4MYU A;  5LL6 R;  2F4V E;  2HK2 A;  2GS8 A;  4GKJ I;  4DV7 E;  2A2D A;  1H73 A;  1XMO I;  1ELO A;  5IWA E;  2CZ9 A;  3J80 C;  4Z7Y A;  2UXD I;  4K0K E;  4DV2 E;  3PYG A;  1FI4 A;  4USK A;  2NPF A;  1J5E I;  3F0N A;  1ZM4 A;  3Q1Q A;  4WUD A;  4JI1 E;  4P7A A;  4DPU A;  2V2Z A;  3B8H A;  2V34 A;  4KHP E;  4UT4 A;  1XNQ E;  1OJ4 A;  4DR5 E;  4B3R E;  1N36 I;  3ZZT A;  4LFA E;  1B62 A;  4EMD A;  4NXM I;  4OX9 E;  4DUY E;  4ZVI A;  1H7S A;  2VQE E;  4DV4 I;  4B3S I;  1N32 I;  5L3J A;  1K47 A;  1HNZ E;  4B3S E;  3WU4 A;  5A2Q C;  1FJG I;  4LF9 E;  2UUB I;  2AJ4 A;  4DR6 I;  4DR1 I;  3D4J A;  4LF8 E;  3PYE A;  5IT9 C;  1FNM A;  2E5L I;  2ZBK B;  4B3T I;  4LF8 I;  4B3M I;  4LF7 E;  4PRX A;  2UU9 I;  4DV0 E;  1Z0B A;  4X66 E;  2HHH E;  2J7K A;  4YHH I;  1N0V C;  2BV3 A;  3K1J A;  3ZKB A;  4DV6 E;  1N33 I;  3ZZ0 A;  2VQF I;  1N0U A;  1FWL A;  1RR9 A;  5LMN I;  4URL A;  4JI4 E;  4K0K I;  5IT9 Q;  1N32 E;  4FWH A;  3B78 A;  1XNR I;  4DV5 E;  1ZXM A;  2UXC E;  4DV1 I;  4DR2 I;  4DU7 A;  4DR3 I;  1HR0 I;  1S4E A;  3LPS A;  4FWG A;  1Z5C A;  1IBK I;  3OTO E;  4Z7C A;  5FLX Q;  5A2Q Q;  2UUC E;  4YY3 I;  3J7A G;  2E5L E;  4HAC B;  5BR8 I;  5FLX C;  1A6F A;  4GKK E;  4FW9 A;  3JAM Q;  1ZM3 A;  1PIE A;  3LTO A;  3T1H E;  1IBM E;  2DEJ A;  3V2U C;  2HFS A;  1NHI A;  1I94 E;  4DV7 I;  1FJG E;  1ZM2 A;  1ZM9 A;  2R42 A;  3ZKD A;  1U2R A;  2VF3 A;  3PYD A;  2UXB E;  4JI5 E;  2UUA I;  1PVG A;  4LF7 I;  2UU9 E;  4WUC A;  2V2V A;  4KHP I;  4DR7 E;  3WU3 A;  4LFC I;  2HK3 A;  4XTJ A;  3J81 Q;  1MX0 A;  1H72 C;  4FWD A;  4NXN I;  4X65 I;  4GKJ E;  5LMN E;  4JYA I;  4JI0 E;  3GON A;  3WU5 A;  5IWA I;  4JI8 I;  1I94 I;  1Z0T A;  5LMU E;  1Z0C A;  4LF4 E;  3CWV A;  1HR0 E;  3ZM7 A;  3OTO I;  1EA6 A;  1NHH A;  3H4L A;  1RRE A;  2HKE A;  4R1F A;  1B63 A;  2BM1 A;  3J81 C;  4I3H A;  4LF6 I;  1PKP A;  2HKJ A;  4B3T E;  4DV6 I;  3J7A M;  4DR7 I;  1KKH A;  1KIJ A;  4PU9 A;  3LNU A;  3QT8 A;  4DV4 E;  4NXN E;  4X65 E;  2VQF E;  2UXD E;  1IBL E;  2A2C A;  2UUB E;  4JI6 E;  1XNR E;  1FWK A;  4JI6 I;  4M1K A;  4LFB I;  1IBK E;  4LFA I;  4USM A;  4JI3 I;  2XEX A;  2LJP A;  4P52 A;  4JV5 I;  3M6A A;  4JI7 E;  1D6T A;  2F4V I;  3J80 Q;  4DV3 E;  4OX9 I;  2ZIT A;  4HAC A;  2DEI A;  3WU6 A;  3JAM C;  4DR4 I;  2Q2E B;  4JI8 E;  1J5E E;  4WUB A;  1MG7 A;  1EI1 A;  2E1R A;  4LF5 I;  1WUU A;  1Z0V A;  1HNX E;  1Z59 A;  4AQY I;  4FN5 A;  4DPY A;  3QT7 A;  4KQV A;  1N36 E;  2BM0 A;  4B3M E;  1DAR A;  1S16 A;  3HUL A;  2UUA E;  4NXM E;  1HNW E;  4JV5 E;  1XMQ I;  3QT6 A;  4DUY I;  4LFC E;  4DV2 I;  1HNZ I;  4DR4 E;  3T1H I;  2V8P A;  4DV1 E;  4DR2 E;  1Z0G A;  2X36 A;  1XNQ I;  1KTV A;  4JI1 I;  4DV0 I;  1KVK A;  1VIS A;  3QT5 A;  4DUZ E;  3ZZU A;  3V5R A;  4DR5 I;  4X62 I;  4DPW A;  4DXL A;  3T1Y E;  4X62 E;  3K17 A;  1QZR A;  4JI2 I;  2ZM6 E;  2HFU A;  2WW4 A;  4ED4 A;  2V2Q A;  4MYT A;  4DV5 I;  1NHJ A;  1XHK A;  1Z5A A;  4X64 I;  4DPT A;  2UXC I;  4HXZ A;  4X64 E;  2UUC I;  1UEK A;  4LF5 E;  5GMD A;  1NZ0 A;  5LMU I;  4LF4 I;  4LFB E;  4RPF A;  2OI2 A;  4B3R I;  5BR8 E;  4DPX A;  4DUZ I;  5GME A;  4JG4 A;  4DU8 A; 
#chains in the Genus database with same CATH topology
 4X66 I;  1XMQ E;  1Z5B A;  1H7U A;  4JI4 I;  4JI2 E;  1N33 E;  4HYM A;  4JYA E;  4N3O A;  2R3V A;  4JI0 I;  1XMO E;  5K36 A;  2VQE I;  4UTG A;  4OO1 A;  2EFG A;  4U3B A;  2Z5E A;  1XXE A;  1Z0W A;  2X7I A;  2C38 A;  1OYS A;  1IBL I;  4OZE A;  4OO1 D;  4LF9 I;  2UXB I;  4HY1 A;  4JI5 I;  4DR6 E;  1ZXN A;  4DR1 E;  4DR3 E;  4PRV A;  4YY3 E;  4GKK I;  5C0X D;  4BA1 B;  1N34 I;  4AID A;  1H74 A;  1RHY A;  1Z0E A;  1HNX I;  3B82 A;  3PYF A;  1FKA E;  4JI3 E;  4LF6 E;  1N34 E;  1MU5 A;  2NN6 D;  1HNW I;  4AQY E;  2IOQ A;  2HHH I;  3T1Y I;  4JI7 I;  4YHH E;  2CVE A;  4AIM A;  1BKN A;  4DV3 I;  2ZM6 I;  1IBM I;  4MYU A;  5LL6 R;  2F4V E;  4LCH A;  2HK2 A;  2GS8 A;  4GKJ I;  4GQU A;  3DD6 A;  2WNR B;  4DV7 E;  2A2D A;  1H73 A;  1XMO I;  1ELO A;  1HK7 A;  5C0X E;  5IWA E;  2CZ9 A;  3J80 C;  4Z7Y A;  2UXD I;  4NBQ A;  4K0K E;  3CDJ A;  5JEA E;  4DV2 E;  3PYG A;  1FI4 A;  4USK A;  2NPF A;  1J5E I;  3F0N A;  1ZM4 A;  3Q1Q A;  4WUD A;  1R6L A;  4JI1 E;  2PO2 A;  4P7A A;  4DPU A;  2V2Z A;  4IZK B;  3B8H A;  2V34 A;  4KHP E;  4UT4 A;  4IFD B;  3HJC A;  1XNQ E;  1OJ4 A;  4DR5 E;  4B3R E;  1N36 I;  5K36 E;  3ZZT A;  4LFA E;  1B62 A;  4QNJ A;  4EMD A;  4NXM I;  2O1T A;  4OX9 E;  2WNR A;  4DUY E;  4ZVI A;  1H7S A;  2VQE E;  4DV4 I;  4IS9 A;  4B3S I;  1N32 I;  2JEB A;  5L3J A;  1E3P A;  1K47 A;  2C37 A;  4LPF A;  1HNZ E;  4B3S E;  4LOM A;  5C0X F;  2NN6 B;  5DNL A;  3WU4 A;  3H1C A;  5A2Q C;  1FJG I;  4LF9 E;  5JEA B;  2UUB I;  2AJ4 A;  4DR6 I;  4DR1 I;  3D4J A;  4LF8 E;  3PYE A;  5IT9 C;  1FNM A;  2E5L I;  4DU8 A;  2ZBK B;  4B3T I;  3M7N G;  4LF8 I;  4B3M I;  4LF7 E;  4PRX A;  2UU9 I;  2BA0 G;  5DRR A;  1Z0B A;  4DV0 E;  4X66 E;  1OYP A;  2J7K A;  2HHH E;  4YHH I;  1N0V C;  2BV3 A;  3K1J A;  3ZKB A;  4DV6 E;  1N33 I;  3ZZ0 A;  2VQF I;  1N0U A;  1Y4S A;  4IZK A;  1FWL A;  1RR9 A;  5LMN I;  4MU0 A;  4FW5 A;  4URL A;  2JEB B;  4JI4 E;  4K0K I;  5IT9 Q;  1N32 E;  3PS1 A;  4FWH A;  3B78 A;  1XNR I;  3P3G A;  4DV5 E;  1ZXM A;  2UXC E;  3P76 A;  2IOP A;  2NN6 E;  4DV1 I;  4DR2 I;  4DU7 A;  4DR3 I;  1S4E A;  3LPS A;  2IER A;  4FWG A;  1HR0 I;  1Z5C A;  3OTO E;  1IBK I;  4Z7C A;  5FLX Q;  5JEA C;  4BA2 A;  5A2Q Q;  4OO1 C;  2UUC E;  4YY3 I;  3KRN A;  2NN6 C;  2BR2 A;  4FW3 A;  5JEA F;  3J7A G;  2E5L E;  4HAC B;  4IFD E;  5BR8 I;  2VES A;  2JEA A;  2C37 B;  5FLX C;  1A6F A;  4GKK E;  4IFD C;  4FW9 A;  3JAM Q;  3P06 A;  2BR2 B;  5K36 F;  4FW4 A;  1ZM3 A;  4MU3 A;  3M85 D;  1PIE A;  3LTO A;  4U3D A;  3T1H E;  2CGE A;  1IBM E;  4OO1 B;  2DEJ A;  3V2U C;  2HFS A;  1NHI A;  1I94 E;  4DV7 I;  3Q6N A;  1FJG E;  4IFD A;  1ZM2 A;  1ZM9 A;  2R42 A;  3ZKD A;  1U2R A;  2VF3 A;  3PYD A;  5C0X A;  2UXB E;  4JI5 E;  2IES A;  2UUA I;  1USV A;  1PVG A;  4LF7 I;  2UU9 E;  4WUC A;  2V2V A;  4KHP I;  4DR7 E;  3WU3 A;  3GLL A;  4LFC I;  2HK3 A;  4XTJ A;  1Y6Z A;  4OKG A;  3UHM A;  1E3H A;  3L7Z B;  4J3D A;  3J81 Q;  4BA2 B;  2JE6 A;  1MX0 A;  1H72 C;  2C39 B;  4FWD A;  4NXN I;  4X65 I;  4GKJ E;  5LMN E;  4JYA I;  2F1D A;  4JI0 E;  4MU4 A;  1YHC A;  3GON A;  2PO0 A;  4IZJ A;  3WU5 A;  3GCM A;  5IWA I;  2AE8 A;  3M7N D;  4IZJ D;  4JI8 I;  4BA1 A;  1I94 I;  1Z0T A;  2Z5B A;  5LMU E;  1Z0C A;  4LF4 E;  3CWV A;  1HR0 E;  3ZM7 A;  3OTO I;  1EA6 A;  1NHH A;  3H4L A;  2PO1 A;  2PO0 B;  2O3Z A;  1RRE A;  2HKE A;  4ISA A;  4R1F A;  1B63 A;  2BM1 A;  3J81 C;  4I3H A;  4LF6 I;  3NZK A;  5DRP A;  1PKP A;  2HKJ A;  4B3T E;  4DV6 I;  3J7A M;  4QNK A;  2CG9 A;  4DR7 I;  4AM3 A;  5JEA A;  1KKH A;  5C0X C;  1KIJ A;  4PU9 A;  3LNU A;  3QT8 A;  2O1W A;  4DV4 E;  2PNZ A;  5DNX A;  4NXN E;  2BA1 G;  2GO4 A;  4X65 E;  5ELW A;  5K36 D;  2VQF E;  4OO1 E;  2J65 A;  2WP8 B;  2UXD E;  1VI7 A;  3U1Y A;  4LCF A;  1IBL E;  2A2C A;  2UUB E;  3HKM A;  4JI6 E;  1XNR E;  1FWK A;  4JI6 I;  4M1K A;  4FW6 A;  4IFD F;  2PO1 B;  5EKW A;  2Z5C A;  4LFB I;  1IBK E;  4LFA I;  4USM A;  5FWK A;  4JI3 I;  2XEX A;  2LJP A;  4P52 A;  2PO2 B;  4JV5 I;  3M6A A;  4JI7 E;  1D6T A;  2NN6 A;  2F4V I;  3J80 Q;  4DV3 E;  2PNZ B;  4OX9 I;  3M85 G;  2Z5C B;  2C39 A;  2ZIT A;  4HAC A;  1P42 A;  2DEI A;  3WU6 A;  3PS2 A;  3JAM C;  4DR4 I;  4LCG A;  1Y60 A;  5JEA D;  5DRO A;  1Y4U A;  2Q2E B;  4JI8 E;  1J5E E;  4WUB A;  1UDS A;  1MG7 A;  1EI1 A;  2E1R A;  4LF5 I;  1WUU A;  1Z0V A;  1HNX E;  1Z59 A;  1Y5Y A;  3PRY A;  3Q6M A;  4AQY I;  4FN5 A;  4DPY A;  2Z5B B;  5K36 C;  3QT7 A;  4KQV A;  1N36 E;  2O1V A;  2BM0 A;  4B3M E;  1DAR A;  1S16 A;  3HUL A;  2UUA E;  4NXM E;  1HNW E;  4JV5 E;  2JT2 A;  1XMQ I;  3QT6 A;  4DUY I;  4OO1 F;  2PNL A;  4LFC E;  4DV2 I;  1HNZ I;  2C38 B;  1USU A;  1UDN A;  3PS3 A;  4IFD D;  4MQY A;  4DR4 E;  3T1H I;  2V8P A;  1OYR A;  2BA0 D;  3P3C A;  4DV1 E;  4DR2 E;  2JEA B;  1Z0G A;  2O1U A;  2X36 A;  2GQ0 A;  1XNQ I;  1KTV A;  4MDT A;  4JI1 I;  5DRQ A;  3U1K A;  4DV0 I;  1KVK A;  1VIS A;  3QT5 A;  4DUZ E;  3ZZU A;  3V5R A;  4DR5 I;  4X62 I;  4MU1 A;  4DPW A;  2BA1 D;  2GO3 A;  4FW7 A;  4DXL A;  3T1Y E;  3GME A;  4X62 E;  3K17 A;  1QZR A;  4JI2 I;  3B4T A;  2ZM6 E;  2HFU A;  2WW4 A;  4ED4 A;  2NN6 F;  2V2Q A;  2WP8 A;  5C0X B;  4MYT A;  4DV5 I;  1NHJ A;  1XHK A;  4IZJ B;  1Z5A A;  4X64 I;  3CDI A;  4DPT A;  2UXC I;  1UDO A;  4HXZ A;  4X64 E;  3K85 A;  2UUC I;  1UEK A;  1R6M A;  4LF5 E;  5GMD A;  1NZ0 A;  1UDQ A;  5LMU I;  1YH8 A;  4LF4 I;  4LFB E;  4RPF A;  2JE6 B;  2OI2 A;  3L7Z A;  2PNM A;  4B3R I;  5K36 B;  5BR8 E;  4DPX A;  4DUZ I;  5GME A;  3P3E A;  4JG4 A;  5EL9 A; 
#chains in the Genus database with same CATH homology
 4X66 I;  1XMQ E;  1Z5B A;  1H7U A;  4JI4 I;  4JI2 E;  1N33 E;  4HYM A;  4JYA E;  4N3O A;  2R3V A;  4JI0 I;  1XMO E;  2VQE I;  4UTG A;  2EFG A;  2Z5E A;  1Z0W A;  2X7I A;  1IBL I;  4LF9 I;  2UXB I;  4HY1 A;  4JI5 I;  4DR6 E;  1ZXN A;  4DR1 E;  4DR3 E;  4PRV A;  4YY3 E;  4GKK I;  1N34 I;  1H74 A;  1Z0E A;  1HNX I;  3B82 A;  3PYF A;  1FKA E;  4JI3 E;  4LF6 E;  1N34 E;  1MU5 A;  1HNW I;  4AQY E;  2IOQ A;  2HHH I;  3T1Y I;  4JI7 I;  4YHH E;  1BKN A;  4DV3 I;  2ZM6 I;  1IBM I;  4MYU A;  5LL6 R;  2F4V E;  2HK2 A;  2GS8 A;  4GKJ I;  4DV7 E;  2A2D A;  1H73 A;  1XMO I;  1ELO A;  1HK7 A;  5IWA E;  2CZ9 A;  3J80 C;  4Z7Y A;  2UXD I;  4K0K E;  4DV2 E;  3PYG A;  1FI4 A;  4USK A;  2NPF A;  1J5E I;  3F0N A;  1ZM4 A;  3Q1Q A;  4WUD A;  4JI1 E;  4P7A A;  4DPU A;  2V2Z A;  4IZK B;  3B8H A;  2V34 A;  4KHP E;  4UT4 A;  3HJC A;  1XNQ E;  1OJ4 A;  4DR5 E;  4B3R E;  1N36 I;  3ZZT A;  4LFA E;  1B62 A;  4EMD A;  4NXM I;  2O1T A;  4OX9 E;  4DUY E;  4ZVI A;  1H7S A;  2VQE E;  4DV4 I;  4B3S I;  1N32 I;  5L3J A;  1K47 A;  1HNZ E;  4B3S E;  3WU4 A;  5A2Q C;  1FJG I;  4LF9 E;  2UUB I;  2AJ4 A;  4DR6 I;  4DR1 I;  3D4J A;  4LF8 E;  3PYE A;  5IT9 C;  1FNM A;  2E5L I;  2ZBK B;  4B3T I;  4LF8 I;  4B3M I;  4LF7 E;  4PRX A;  2UU9 I;  4DV0 E;  1Z0B A;  4X66 E;  2HHH E;  2J7K A;  4YHH I;  1N0V C;  2BV3 A;  3K1J A;  3ZKB A;  4DV6 E;  1N33 I;  3ZZ0 A;  2VQF I;  1N0U A;  1Y4S A;  4IZK A;  1FWL A;  1RR9 A;  5LMN I;  4URL A;  4JI4 E;  4K0K I;  5IT9 Q;  1N32 E;  4FWH A;  3B78 A;  1XNR I;  4DV5 E;  1ZXM A;  2UXC E;  2IOP A;  4DV1 I;  4DR2 I;  4DU7 A;  4DR3 I;  1HR0 I;  1S4E A;  3LPS A;  4FWG A;  3OTO E;  1IBK I;  1Z5C A;  4Z7C A;  5FLX Q;  5A2Q Q;  2UUC E;  4YY3 I;  3J7A G;  2E5L E;  4HAC B;  5BR8 I;  5FLX C;  1A6F A;  4GKK E;  4FW9 A;  3JAM Q;  3P06 A;  1ZM3 A;  1PIE A;  3LTO A;  3T1H E;  2CGE A;  1IBM E;  2DEJ A;  3V2U C;  2HFS A;  1NHI A;  1I94 E;  4DV7 I;  3Q6N A;  1FJG E;  1ZM2 A;  1ZM9 A;  2R42 A;  3ZKD A;  1U2R A;  2VF3 A;  3PYD A;  2UXB E;  4JI5 E;  2UUA I;  1USV A;  1PVG A;  4LF7 I;  2UU9 E;  4WUC A;  2V2V A;  4KHP I;  4DR7 E;  3WU3 A;  4LFC I;  2HK3 A;  4XTJ A;  1Y6Z A;  3J81 Q;  1MX0 A;  1H72 C;  4FWD A;  4NXN I;  4X65 I;  4GKJ E;  5LMN E;  4JYA I;  4JI0 E;  3GON A;  3WU5 A;  4IZJ A;  5IWA I;  4IZJ D;  4JI8 I;  1I94 I;  1Z0T A;  2Z5B A;  5LMU E;  1Z0C A;  4LF4 E;  3CWV A;  1HR0 E;  3ZM7 A;  3OTO I;  1EA6 A;  1NHH A;  3H4L A;  1RRE A;  2HKE A;  4R1F A;  1B63 A;  2BM1 A;  3J81 C;  4I3H A;  4LF6 I;  1PKP A;  2HKJ A;  4B3T E;  4DV6 I;  3J7A M;  2CG9 A;  4DR7 I;  1KKH A;  1KIJ A;  4PU9 A;  3LNU A;  3QT8 A;  2O1W A;  4DV4 E;  4NXN E;  4X65 E;  2VQF E;  2UXD E;  1IBL E;  2A2C A;  2UUB E;  4JI6 E;  1XNR E;  1FWK A;  4JI6 I;  4M1K A;  2Z5C A;  4LFB I;  1IBK E;  4LFA I;  4USM A;  5FWK A;  4JI3 I;  2XEX A;  2LJP A;  4P52 A;  4JV5 I;  3M6A A;  4JI7 E;  1D6T A;  2F4V I;  3J80 Q;  4DV3 E;  4OX9 I;  2Z5C B;  2ZIT A;  4HAC A;  2DEI A;  3WU6 A;  3JAM C;  4DR4 I;  1Y4U A;  2Q2E B;  4JI8 E;  1J5E E;  4WUB A;  1MG7 A;  1EI1 A;  2E1R A;  4LF5 I;  1WUU A;  1Z0V A;  1HNX E;  1Z59 A;  3PRY A;  3Q6M A;  4AQY I;  4FN5 A;  4DPY A;  2Z5B B;  3QT7 A;  4KQV A;  1N36 E;  2O1V A;  2BM0 A;  4B3M E;  1DAR A;  1S16 A;  3HUL A;  2UUA E;  4NXM E;  1HNW E;  4JV5 E;  1XMQ I;  3QT6 A;  4DUY I;  2PNL A;  4LFC E;  4DV2 I;  1HNZ I;  1USU A;  4DR4 E;  3T1H I;  2V8P A;  4DV1 E;  4DR2 E;  1Z0G A;  2O1U A;  2X36 A;  2GQ0 A;  1XNQ I;  1KTV A;  4JI1 I;  4DV0 I;  1KVK A;  1VIS A;  3QT5 A;  4DUZ E;  3ZZU A;  3V5R A;  4DR5 I;  4X62 I;  4DPW A;  4DXL A;  3T1Y E;  4X62 E;  3K17 A;  1QZR A;  4JI2 I;  2ZM6 E;  2HFU A;  2WW4 A;  4ED4 A;  2V2Q A;  4MYT A;  4DV5 I;  1NHJ A;  1XHK A;  4IZJ B;  1Z5A A;  4X64 I;  4DPT A;  2UXC I;  4HXZ A;  4X64 E;  3K85 A;  2UUC I;  1UEK A;  4LF5 E;  5GMD A;  1NZ0 A;  5LMU I;  4LF4 I;  4LFB E;  4RPF A;  2OI2 A;  2PNM A;  4B3R I;  5BR8 E;  4DPX A;  4DUZ I;  5GME A;  4JG4 A;  4DU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...