1XNQI

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqI00
3QT5A 1FNMA 4YY3E 4JV5I 4DU7A 2F4VE 1K47A 4DR4E 1IBKE 1N34I 1IBMI 4LF8E 1RREA 2HKEA 1KIJA 5IT9Q 1DARA 1FWKA 4DUZE 5BR8E 4GKJI 1Z0VA 2BM1A 1HNWE 2WW4A 3H4LA 1IBLI 1HNXE 4DPTA 4K0KE 3JAMQ 3OTOE 1FI4A 4LF7I 1N36I 4GKKI 1MX0A 1H73A 3PYEA 2X7IA 2UXDE 4DR2I 5IT9C 1Z59A 2R3VA 2E5LI 3F0NA 4JI8I 2A2CA 3ZM7A 3LPSA 4JI7I 4EMDA 4Z7CA 1XHKA 4JI6E 4X65E 1HNZE 3PYGA 2V2ZA 4LFBE 4USMA 4YY3I 2HFSA 3ZZUA 2V8PA 3LTOA 1IBKI 3WU4A 1XMOI 2UXCI 4DV7E 3ZZTA 2UUAE 4LF8I 4P7AA 4FWHA 2LJPA 1N32I 4DUYE 4DUZI 4DV3I 5LMNE 1PVGA 1PKPA 4DR3E 4DV0E 4LFAE 2VQEE 1ZM2A 1HR0I 5IWAI 3K1JA 2DEJA 3OTOI 1XNRE 2E1RA 5FLXQ 1Z0CA 4PU9A 3J80C 1XNQE 4B3ME 4JI1I 1J5EE 4NXME 2UUCI 1XMQE 4FW9A 4B3TE 4JI3E 4JI2I 3B82A 5FLXC 2ZITA 1RR9A 2UXBI 4LF6E 4JI6I 3B8HA 1FWLA 4LF9E 4DPWA 4HACB 4FWGA 4X65I 2NPFA 5A2QQ 1I94I 4P52A 2V34A 4DR6I 1U2RA 4DV1E 3K17A 4YHHI 4HXZA 4X62E 2UUAI 4LF5E 4NXNE 4WUCA 3T1HE 4XTJA 4DUYI 4KHPI 4DV6I 4WUBA 2VQFE 1H74A 4DR3I 4LFCI 4DV0I 3V5RA 4DR1E 1OJ4A 2AJ4A 2BM0A 3LNUA 1UEKA 5LMUI 4AQYE 5LL6R 1Z0TA 2OI2A 3JAMC 4DXLA 1H7UA 1B62A 2ZM6I 2HHHE 3J81Q 1NHHA 4R1FA 1FJGE 1B63A 1Z0GA 4X66I 1J5EI 1S4EA 4MYTA 3QT7A 1S16A 2A2DA 1Z0BA 2UUBE 4B3TI 2EFGA 4DV2I 4DV4I 4JG4A 2F4VI 3QT6A 3J7AG 1N34E 4DR4I 1IBME 4LF4E 1ZXNA 3J7AM 4KQVA 3J81C 4GKJE 5BR8I 4ED4A 3M6AA 4DPUA 1HNWI 1H72C 3PYDA 1IBLE 1HNXI 1N33E 5L3JA 4K0KI 3ZKBA 1WUUA 1ELOA 3GONA 4LF7E 1KTVA 4DU8A 1N36E 4I3HA 4B3RE 4DR2E 2UXDI 4HY1A 4OX9E 2VQFI 4DPYA 2E5LE 2ZBKB 4JI5E 1KVKA 2BV3A 1VISA 3ZZ0A 3WU3A 1QZRA 2UU9E 1KKHA 4AQYI 4PRXA 4DR7E 2V2QA 2GS8A 4JI0E 3D4JA 1Z0WA 2HHHI 1FJGI 4M1KA 1HNZI 1NHJA 4DPXA 1ZXMA 3B78A 4LFBI 4DR5E 1ZM4A 4MYUA 1XMOE 2UXCE 4DV7I 4FWDA 1H7SA 4LF4I 4X64E 1NZ0A 1N32E 1Z0EA 4DV3E 2HFUA 1D6TA 3T1YE 5LMNI 1Z5AA 1MU5A 4WUDA 1NHIA 4LFAI 5A2QC 2VQEI 1HR0E 1N33I 5IWAE 4JYAE 3HULA 1XNRI 4DV5E 4ZVIA 4B3RI 2XEXA 1ZM9A 1XNQI 3V2UC 4B3MI 4JI4E 4OX9I 4B3SE 4JI1E 4JI5I 3Q1QA 2Q2EB 4NXMI 2UUCE 1XMQI 1N0VC 5GMDA 3PYFA 2UU9I 4JV5E 4JI3I 4JI2E 4DR7I 4JI0I 1MG7A 2HK3A 2UXBE 3WU5A 4LF6I 3WU6A 4LF9I 1N0UA 2HKJA 1I94E 1Z5BA 4DR5I 4DR6E 4DV1I 1EA6A 4UT4A 4YHHE 3QT8A 2HK2A 1BKNA 2J7KA 2DEIA 3CWVA 4X62I 2V2VA 5GMEA 4URLA 3J80Q 4LF5I 4GKKE 4RPFA 4X64I 4Z7YA 4NXNI 1ZM3A 3T1HI 4KHPE 4DV6E 3T1YI 4USKA 4LFCE 2R42A 4DR1I 4JI8E 2X36A 4JYAI 5LMUE 4PRVA 1A6FA 4FN5A 1Z5CA 1EI1A 4DV5I 2VF3A 4JI7E 2ZM6E 1FKAE 4HYMA 4JI4I 1PIEA 4B3SI 2CZ9A 4HACA 3ZKDA 4X66E 4UTGA 2UUBI 4DV2E 4DV4E
chains in the Genus database with same CATH superfamily
3QT5A 1FNMA 2PO2A 3PS2A 4DU7A 4YY3E 4JV5I 2F4VE 3PS1A 1K47A 1E3HA 4DR4E 1IBKE 3H1CA 1N34I 1IBMI 4LF8E 1RREA 2HKEA 1KIJA 5IT9Q 1DARA 1FWKA 5C0XC 4DUZE 5BR8E 4GKJI 1Z0VA 2BM1A 2O1WA 4AIMA 2JEAA 1YHCA 1HNWE 2WW4A 3H4LA 1IBLI 1HNXE 4DPTA 5JEAE 4K0KE 3JAMQ 3OTOE 1FI4A 4LF7I 1N36I 4GKKI 2NN6F 1MX0A 1H73A 3PYEA 2X7IA 2UXDE 5K36F 4DR2I 5IT9C 4MQYA 1Z59A 2R3VA 2E5LI 3F0NA 2C37A 2JT2A 4IFDD 4JI8I 2A2CA 3P06A 2BA1G 3P3CA 1Y6ZA 3K85A 3PS3A 3ZM7A 3LPSA 2C39A 5DNXA 4JI7I 4EMDA 4Z7CA 2CG9A 2JEBB 1OYPA 1XHKA 3PRYA 5JEAB 4JI6E 4IS9A 3GCMA 1P42A 4X65E 1HNZE 1E3PA 1UDQA 5ELWA 3PYGA 2V2ZA 4LFBE 3L7ZB 4USMA 5DNLA 4YY3I 2HFSA 3ZZUA 5C0XA 4IFDF 2PO1B 2V8PA 3LTOA 1IBKI 4LCFA 4ISAA 3WU4A 1XMOI 2UXCI 2C38A 4DV7E 3ZZTA 2UUAE 4LF8I 4P7AA 4IZJA 4FWHA 2LJPA 1N32I 4DUYE 4DUZI 4DV3I 5LMNE 1PVGA 1PKPA 2NN6A 4FW7A 4DR3E 4DV0E 4LFAE 4BA1B 2VQEE 1ZM2A 1HR0I 5K36A 5IWAI 2WP8B 3K1JA 2DEJA 3OTOI 1XNRE 2E1RA 5FLXQ 1Z0CA 4MU0A 4PU9A 3J80C 1XNQE 4B3ME 3NZKA 1USUA 1R6MA 4JI1I 1J5EE 4NXME 2PO0A 2UUCI 1XMQE 4IZJD 4FW9A 1VI7A 4B3TE 4U3DA 5DROA 4OO1B 4JI3E 5JEAF 2NN6D 4FW6A 4JI2I 5K36D 3B82A 5FLXC 2O1VA 2ZITA 1RR9A 4IFDA 2UXBI 4LF6E 4JI6I 3B8HA 1FWLA 4LF9E 2IOPA 4DPWA 4HACB 4FWGA 1OYSA 2AE8A 4X65I 2NPFA 5A2QQ 1I94I 4P52A 4DV2E 2V34A 4DR6I 5DRPA 1U2RA 4N3OA 4DV1E 3HJCA 4QNKA 3K17A 4YHHI 4HXZA 2O1UA 3U1YA 4X62E 2UUAI 4LF5E 4BA2A 5FWKA 2NN6C 2CGEA 2PNLA 4NXNE 4WUCA 3T1HE 4XTJA 4DUYI 4KHPI 4DV6I 5K36C 1Y4SA 4WUBA 2VQFE 2JEAB 1H74A 4DR3I 4LFCI 4DV0I 3V5RA 4DR1E 1OJ4A 2AJ4A 2BM0A 3LNUA 1UEKA 5LMUI 4AQYE 5LL6R 1Z0TA 2OI2A 4LOMA 3JAMC 2F1DA 4AIDA 1H7UA 4DXLA 1B62A 2BA1D 5C0XE 4FW5A 2ZM6I 3GMEA 1Y5YA 2HHHE 3J81Q 5JEAA 4R1FA 1NHHA 1FJGE 1B63A 2Z5BB 1Z0GA 4QNJA 4X66I 1J5EI 1S4EA 2C37B 4MYTA 3QT7A 1S16A 2A2DA 1Z0BA 1OYRA 2UUBE 4B3TI 2BR2A 2EFGA 4DV2I 4DV4I 4JG4A 2F4VI 2PO1A 3QT6A 3J7AG 4IFDC 1N34E 4DR4I 2WNRA 3M7ND 1IBME 2C39B 3U1KA 4FW3A 5DRQA 3KRNA 4LF4E 3P3EA 4OO1E 1ZXNA 3J7AM 3M85D 4KQVA 3J81C 4GKJE 5BR8I 4ED4A 3M6AA 4DPUA 1HNWI 1H72C 3PYDA 1IBLE 4BA1A 3HKMA 5JEAD 1HNXI 1N33E 5C0XB 5L3JA 4K0KI 4MU3A 3ZKBA 1WUUA 1ELOA 3GONA 4LF7E 1KTVA 4IZKB 4DU8A 1N36E 3Q6MA 4I3HA 4B3RE 2PNZA 4DR2E 2UXDI 4HY1A 5DRRA 4OX9E 2VQFI 4DPYA 2E5LE 2ZBKB 4JI5E 1KVKA 2JE6A 2BV3A 1VISA 3ZZ0A 2Z5CB 3WU3A 1QZRA 4NBQA 2CVEA 2UU9E 1KKHA 4MU4A 4AQYI 4OKGA 5EL9A 4PRXA 5JEAC 4DR7E 2V2QA 2IESA 2GS8A 2GO4A 4JI0E 2BA0D 4DV4E 3D4JA 1Z0WA 2HHHI 1FJGI 4M1KA 3UHMA 2GO3A 3CDJA 1HNZI 1NHJA 2PO0B 4DPXA 1ZXMA 3B78A 4LFBI 4U3BA 4DR5E 1ZM4A 2PO2B 4MYUA 1XMOE 2UXCE 4DV7I 4FWDA 1H7SA 4LF4I 4OO1D 4IFDB 4LCGA 4X64E 5C0XF 4LPFA 1NZ0A 3DD6A 1N32E 1Z0EA 4DV3E 1UDSA 2HFUA 2VESA 1YH8A 1D6TA 3T1YE 5LMNI 1Z5AA 1MU5A 4WUDA 1NHIA 2GQ0A 4LFAI 5A2QC 2VQEI 1HR0E 1N33I 5IWAE 1XXEA 2J65A 2O3ZA 3HULA 4JYAE 1UDOA 1XNRI 4DV5E 4ZVIA 4BA2B 4B3RI 2XEXA 1ZM9A 2JEBA 1XNQI 3V2UC 4B3MI 4JI4E 2Z5BA 4OX9I 4OO1F 4B3SE 1RHYA 4OO1C 4JI1E 4JI5I 3Q1QA 2Q2EB 4GQUA 4NXMI 2UUCE 1XMQI 3L7ZA 1N0VC 5GMDA 3PYFA 2UU9I 4JV5E 4JI3I 1USVA 1UDNA 4JI2E 4DR7I 2NN6E 3B4TA 4JI0I 4AM3A 1MG7A 2HK3A 5K36E 2UXBE 3WU5A 4LF6I 3WU6A 4LF9I 4FW4A 1N0UA 2HKJA 2O1TA 1I94E 1Z5BA 3M7NG 4DR5I 4DR6E 2BR2B 2PNMA 1R6LA 4MDTA 4DV1I 1EA6A 4UT4A 1Y4UA 3QT8A 4YHHE 2HK2A 2WP8A 3M85G 1BKNA 2WNRB 3GLLA 2C38B 4IZKA 2J7KA 2DEIA 3CWVA 3P3GA 2V2VA 5GMEA 4URLA 4X62I 3J80Q 4LCHA 4LF5I 4GKKE 4RPFA 4X64I 4J3DA 4Z7YA 4NXNI 4IZJB 1ZM3A 3T1HI 1HK7A 4KHPE 4DV6E 3T1YI 4USKA 4LFCE 2NN6B 2R42A 4DR1I 4JI8E 2Z5CA 4IFDE 3P76A 5K36B 1Y60A 4OO1A 2X36A 4JYAI 5LMUE 4PRVA 1A6FA 4FN5A 1Z5CA 1EI1A 4DV5I 5C0XD 2VF3A 4JI7E 2ZM6E 2IERA 1FKAE 2PNZB 4HYMA 4JI4I 1PIEA 2CZ9A 4HACA 2IOQA 3CDIA 4OZEA 4B3SI 5EKWA 3ZKDA 4X66E 4UTGA 2JE6B 2UUBI 3Q6NA 2BA0G 4MU1A 2Z5EA
chains in the Genus database with same CATH topology
3QT5A 1FNMA 4YY3E 4JV5I 4DU7A 2F4VE 1K47A 4DR4E 1IBKE 1N34I 1IBMI 4LF8E 1RREA 2HKEA 1KIJA 5IT9Q 1DARA 1FWKA 4DUZE 5BR8E 4GKJI 1Z0VA 2BM1A 2O1WA 1HNWE 2WW4A 3H4LA 1IBLI 1HNXE 4DPTA 4K0KE 3JAMQ 3OTOE 1FI4A 4LF7I 1N36I 4GKKI 1MX0A 1H73A 3PYEA 2X7IA 2UXDE 4DR2I 5IT9C 1Z59A 2R3VA 2E5LI 3F0NA 4JI8I 2A2CA 3P06A 1Y6ZA 3K85A 3ZM7A 3LPSA 4JI7I 4EMDA 4Z7CA 2CG9A 1XHKA 3PRYA 4JI6E 4X65E 1HNZE 3PYGA 2V2ZA 4LFBE 4USMA 4YY3I 2HFSA 3ZZUA 2V8PA 3LTOA 1IBKI 3WU4A 1XMOI 2UXCI 4DV7E 3ZZTA 2UUAE 4LF8I 4P7AA 4IZJA 4FWHA 2LJPA 1N32I 4DUZI 4DV3I 4DUYE 5LMNE 1PVGA 1PKPA 4DR3E 4DV0E 4LFAE 2VQEE 1ZM2A 1HR0I 5IWAI 3K1JA 2DEJA 3OTOI 1XNRE 2E1RA 5FLXQ 1Z0CA 4PU9A 3J80C 1XNQE 4B3ME 1USUA 4JI1I 1J5EE 4NXME 2UUCI 1XMQE 4IZJD 4FW9A 4B3TE 4JI3E 4JI2I 3B82A 5FLXC 2O1VA 2ZITA 1RR9A 2UXBI 4LF6E 4JI6I 3B8HA 1FWLA 4LF9E 2IOPA 4DPWA 4HACB 4FWGA 4X65I 2NPFA 5A2QQ 1I94I 4P52A 2V34A 4DR6I 1U2RA 4N3OA 4DV1E 3HJCA 3K17A 4YHHI 4HXZA 2O1UA 4X62E 2UUAI 4LF5E 5FWKA 2PNLA 2CGEA 4NXNE 4WUCA 3T1HE 4XTJA 4DUYI 4KHPI 4DV6I 1Y4SA 4WUBA 2VQFE 1H74A 4DR3I 4LFCI 4DV0I 3V5RA 4DR1E 1OJ4A 2AJ4A 2BM0A 3LNUA 1UEKA 5LMUI 4AQYE 5LL6R 1Z0TA 2OI2A 3JAMC 4DXLA 1H7UA 1B62A 2ZM6I 2HHHE 3J81Q 1NHHA 4R1FA 1FJGE 1B63A 2Z5BB 1Z0GA 4X66I 1J5EI 1S4EA 4MYTA 3QT7A 1S16A 2A2DA 1Z0BA 2UUBE 4B3TI 2EFGA 4DV2I 4DV4I 4JG4A 2F4VI 3QT6A 3J7AG 1N34E 4DR4I 1IBME 4LF4E 1ZXNA 3J7AM 4KQVA 3J81C 4GKJE 5BR8I 4ED4A 3M6AA 4DPUA 1HNWI 1H72C 3PYDA 1IBLE 1HNXI 1N33E 5L3JA 4K0KI 3ZKBA 1WUUA 1ELOA 3GONA 4LF7E 1KTVA 4IZKB 4DU8A 1N36E 3Q6MA 4I3HA 4B3RE 4DR2E 2UXDI 4HY1A 4OX9E 2VQFI 4DPYA 2E5LE 2ZBKB 4JI5E 1KVKA 2BV3A 1VISA 3ZZ0A 2Z5CB 3WU3A 1QZRA 2UU9E 1KKHA 4AQYI 4PRXA 4DR7E 2V2QA 2GS8A 4JI0E 2Z5EA 3D4JA 1Z0WA 2HHHI 1FJGI 4M1KA 1HNZI 1NHJA 4DPXA 1ZXMA 3B78A 4LFBI 4DR5E 1ZM4A 4MYUA 1XMOE 2UXCE 4DV7I 4FWDA 1H7SA 4LF4I 4X64E 1NZ0A 1N32E 1Z0EA 4DV3E 2HFUA 1D6TA 3T1YE 5LMNI 1Z5AA 1MU5A 4WUDA 1NHIA 2GQ0A 4LFAI 5A2QC 2VQEI 1HR0E 1N33I 5IWAE 4JYAE 3HULA 1XNRI 4DV5E 4ZVIA 4B3RI 2XEXA 1ZM9A 1XNQI 3V2UC 4B3MI 4JI4E 2Z5BA 4OX9I 4B3SE 4JI1E 4JI5I 3Q1QA 2Q2EB 4NXMI 2UUCE 1XMQI 1N0VC 5GMDA 3PYFA 2UU9I 4JV5E 4JI3I 1USVA 4JI2E 4DR7I 4JI0I 1MG7A 2HK3A 2UXBE 3WU5A 4LF6I 3WU6A 4LF9I 1N0UA 2HKJA 2O1TA 1I94E 1Z5BA 4DR5I 4DR6E 2PNMA 4DV1I 1EA6A 4UT4A 1Y4UA 3QT8A 4YHHE 2HK2A 1BKNA 4IZKA 2J7KA 2DEIA 3CWVA 4X62I 2V2VA 5GMEA 4URLA 3J80Q 4LF5I 4GKKE 4RPFA 4X64I 4Z7YA 4NXNI 4IZJB 1ZM3A 3T1HI 1HK7A 4KHPE 4DV6E 3T1YI 4USKA 4LFCE 2R42A 4DR1I 4JI8E 2Z5CA 2X36A 4JYAI 5LMUE 4PRVA 1A6FA 4FN5A 1Z5CA 1EI1A 4DV5I 2VF3A 4JI7E 2ZM6E 1FKAE 4HYMA 4JI4I 1PIEA 2CZ9A 4HACA 2IOQA 4B3SI 3ZKDA 4X66E 4UTGA 2UUBI 3Q6NA 4DV2E 4DV4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT5 A;  1FNM A;  4YY3 E;  4JV5 I;  4DU7 A;  2F4V E;  1K47 A;  4DR4 E;  1IBK E;  1N34 I;  1IBM I;  4LF8 E;  1RRE A;  2HKE A;  1KIJ A;  5IT9 Q;  1DAR A;  1FWK A;  4DUZ E;  5BR8 E;  4GKJ I;  1Z0V A;  2BM1 A;  1HNW E;  2WW4 A;  3H4L A;  1IBL I;  1HNX E;  4DPT A;  4K0K E;  3JAM Q;  3OTO E;  1FI4 A;  4LF7 I;  1N36 I;  4GKK I;  1MX0 A;  1H73 A;  3PYE A;  2X7I A;  2UXD E;  4DR2 I;  5IT9 C;  1Z59 A;  2R3V A;  2E5L I;  3F0N A;  4JI8 I;  2A2C A;  3ZM7 A;  3LPS A;  4JI7 I;  4EMD A;  4Z7C A;  1XHK A;  4JI6 E;  4X65 E;  1HNZ E;  3PYG A;  2V2Z A;  4LFB E;  4USM A;  4YY3 I;  2HFS A;  3ZZU A;  2V8P A;  3LTO A;  1IBK I;  3WU4 A;  1XMO I;  2UXC I;  4DV7 E;  3ZZT A;  2UUA E;  4LF8 I;  4P7A A;  4FWH A;  2LJP A;  1N32 I;  4DUY E;  4DUZ I;  4DV3 I;  5LMN E;  1PVG A;  1PKP A;  4DR3 E;  4DV0 E;  4LFA E;  2VQE E;  1ZM2 A;  1HR0 I;  5IWA I;  3K1J A;  2DEJ A;  3OTO I;  1XNR E;  2E1R A;  5FLX Q;  1Z0C A;  4PU9 A;  3J80 C;  1XNQ E;  4B3M E;  4JI1 I;  1J5E E;  4NXM E;  2UUC I;  1XMQ E;  4FW9 A;  4B3T E;  4JI3 E;  4JI2 I;  3B82 A;  5FLX C;  2ZIT A;  1RR9 A;  2UXB I;  4LF6 E;  4JI6 I;  3B8H A;  1FWL A;  4LF9 E;  4DPW A;  4HAC B;  4FWG A;  4X65 I;  2NPF A;  5A2Q Q;  1I94 I;  4P52 A;  2V34 A;  4DR6 I;  1U2R A;  4DV1 E;  3K17 A;  4YHH I;  4HXZ A;  4X62 E;  2UUA I;  4LF5 E;  4NXN E;  4WUC A;  3T1H E;  4XTJ A;  4DUY I;  4KHP I;  4DV6 I;  4WUB A;  2VQF E;  1H74 A;  4DR3 I;  4LFC I;  4DV0 I;  3V5R A;  4DR1 E;  1OJ4 A;  2AJ4 A;  2BM0 A;  3LNU A;  1UEK A;  5LMU I;  4AQY E;  5LL6 R;  1Z0T A;  2OI2 A;  3JAM C;  4DXL A;  1H7U A;  1B62 A;  2ZM6 I;  2HHH E;  3J81 Q;  1NHH A;  4R1F A;  1FJG E;  1B63 A;  1Z0G A;  4X66 I;  1J5E I;  1S4E A;  4MYT A;  3QT7 A;  1S16 A;  2A2D A;  1Z0B A;  2UUB E;  4B3T I;  2EFG A;  4DV2 I;  4DV4 I;  4JG4 A;  2F4V I;  3QT6 A;  3J7A G;  1N34 E;  4DR4 I;  1IBM E;  4LF4 E;  1ZXN A;  3J7A M;  4KQV A;  3J81 C;  4GKJ E;  5BR8 I;  4ED4 A;  3M6A A;  4DPU A;  1HNW I;  1H72 C;  3PYD A;  1IBL E;  1HNX I;  1N33 E;  5L3J A;  4K0K I;  3ZKB A;  1WUU A;  1ELO A;  3GON A;  4LF7 E;  1KTV A;  4DU8 A;  1N36 E;  4I3H A;  4B3R E;  4DR2 E;  2UXD I;  4HY1 A;  4OX9 E;  2VQF I;  4DPY A;  2E5L E;  2ZBK B;  4JI5 E;  1KVK A;  2BV3 A;  1VIS A;  3ZZ0 A;  3WU3 A;  1QZR A;  2UU9 E;  1KKH A;  4AQY I;  4PRX A;  4DR7 E;  2V2Q A;  2GS8 A;  4JI0 E;  3D4J A;  1Z0W A;  2HHH I;  1FJG I;  4M1K A;  1HNZ I;  1NHJ A;  4DPX A;  1ZXM A;  3B78 A;  4LFB I;  4DR5 E;  1ZM4 A;  4MYU A;  1XMO E;  2UXC E;  4DV7 I;  4FWD A;  1H7S A;  4LF4 I;  4X64 E;  1NZ0 A;  1N32 E;  1Z0E A;  4DV3 E;  2HFU A;  1D6T A;  3T1Y E;  5LMN I;  1Z5A A;  1MU5 A;  4WUD A;  1NHI A;  4LFA I;  5A2Q C;  2VQE I;  1HR0 E;  1N33 I;  5IWA E;  4JYA E;  3HUL A;  1XNR I;  4DV5 E;  4ZVI A;  4B3R I;  2XEX A;  1ZM9 A;  1XNQ I;  3V2U C;  4B3M I;  4JI4 E;  4OX9 I;  4B3S E;  4JI1 E;  4JI5 I;  3Q1Q A;  2Q2E B;  4NXM I;  2UUC E;  1XMQ I;  1N0V C;  5GMD A;  3PYF A;  2UU9 I;  4JV5 E;  4JI3 I;  4JI2 E;  4DR7 I;  4JI0 I;  1MG7 A;  2HK3 A;  2UXB E;  3WU5 A;  4LF6 I;  3WU6 A;  4LF9 I;  1N0U A;  2HKJ A;  1I94 E;  1Z5B A;  4DR5 I;  4DR6 E;  4DV1 I;  1EA6 A;  4UT4 A;  4YHH E;  3QT8 A;  2HK2 A;  1BKN A;  2J7K A;  2DEI A;  3CWV A;  4X62 I;  2V2V A;  5GME A;  4URL A;  3J80 Q;  4LF5 I;  4GKK E;  4RPF A;  4X64 I;  4Z7Y A;  4NXN I;  1ZM3 A;  3T1H I;  4KHP E;  4DV6 E;  3T1Y I;  4USK A;  4LFC E;  2R42 A;  4DR1 I;  4JI8 E;  2X36 A;  4JYA I;  5LMU E;  4PRV A;  1A6F A;  4FN5 A;  1Z5C A;  1EI1 A;  4DV5 I;  2VF3 A;  4JI7 E;  2ZM6 E;  1FKA E;  4HYM A;  4JI4 I;  1PIE A;  4B3S I;  2CZ9 A;  4HAC A;  3ZKD A;  4X66 E;  4UTG A;  2UUB I;  4DV2 E;  4DV4 E; 
#chains in the Genus database with same CATH topology
 3QT5 A;  1FNM A;  2PO2 A;  3PS2 A;  4DU7 A;  4YY3 E;  4JV5 I;  2F4V E;  3PS1 A;  1K47 A;  1E3H A;  4DR4 E;  1IBK E;  3H1C A;  1N34 I;  1IBM I;  4LF8 E;  1RRE A;  2HKE A;  1KIJ A;  5IT9 Q;  1DAR A;  1FWK A;  5C0X C;  4DUZ E;  5BR8 E;  4GKJ I;  1Z0V A;  2BM1 A;  2O1W A;  4AIM A;  2JEA A;  1YHC A;  1HNW E;  2WW4 A;  3H4L A;  1IBL I;  1HNX E;  4DPT A;  5JEA E;  4K0K E;  3JAM Q;  3OTO E;  1FI4 A;  4LF7 I;  1N36 I;  4GKK I;  2NN6 F;  1MX0 A;  1H73 A;  3PYE A;  2X7I A;  2UXD E;  5K36 F;  4DR2 I;  5IT9 C;  4MQY A;  1Z59 A;  2R3V A;  2E5L I;  3F0N A;  2C37 A;  2JT2 A;  4IFD D;  4JI8 I;  2A2C A;  3P06 A;  2BA1 G;  3P3C A;  1Y6Z A;  3K85 A;  3PS3 A;  3ZM7 A;  3LPS A;  2C39 A;  5DNX A;  4JI7 I;  4EMD A;  4Z7C A;  2CG9 A;  2JEB B;  1OYP A;  1XHK A;  3PRY A;  5JEA B;  4JI6 E;  4IS9 A;  3GCM A;  1P42 A;  4X65 E;  1HNZ E;  1E3P A;  1UDQ A;  5ELW A;  3PYG A;  2V2Z A;  4LFB E;  3L7Z B;  4USM A;  5DNL A;  4YY3 I;  2HFS A;  3ZZU A;  5C0X A;  4IFD F;  2PO1 B;  2V8P A;  3LTO A;  1IBK I;  4LCF A;  4ISA A;  3WU4 A;  1XMO I;  2UXC I;  2C38 A;  4DV7 E;  3ZZT A;  2UUA E;  4LF8 I;  4P7A A;  4IZJ A;  4FWH A;  2LJP A;  1N32 I;  4DUY E;  4DUZ I;  4DV3 I;  5LMN E;  1PVG A;  1PKP A;  2NN6 A;  4FW7 A;  4DR3 E;  4DV0 E;  4LFA E;  4BA1 B;  2VQE E;  1ZM2 A;  1HR0 I;  5K36 A;  5IWA I;  2WP8 B;  3K1J A;  2DEJ A;  3OTO I;  1XNR E;  2E1R A;  5FLX Q;  1Z0C A;  4MU0 A;  4PU9 A;  3J80 C;  1XNQ E;  4B3M E;  3NZK A;  1USU A;  1R6M A;  4JI1 I;  1J5E E;  4NXM E;  2PO0 A;  2UUC I;  1XMQ E;  4IZJ D;  4FW9 A;  1VI7 A;  4B3T E;  4U3D A;  5DRO A;  4OO1 B;  4JI3 E;  5JEA F;  2NN6 D;  4FW6 A;  4JI2 I;  5K36 D;  3B82 A;  5FLX C;  2O1V A;  2ZIT A;  1RR9 A;  4IFD A;  2UXB I;  4LF6 E;  4JI6 I;  3B8H A;  1FWL A;  4LF9 E;  2IOP A;  4DPW A;  4HAC B;  4FWG A;  1OYS A;  2AE8 A;  4X65 I;  2NPF A;  5A2Q Q;  1I94 I;  4P52 A;  4DV2 E;  2V34 A;  4DR6 I;  5DRP A;  1U2R A;  4N3O A;  4DV1 E;  3HJC A;  4QNK A;  3K17 A;  4YHH I;  4HXZ A;  2O1U A;  3U1Y A;  4X62 E;  2UUA I;  4LF5 E;  4BA2 A;  5FWK A;  2NN6 C;  2CGE A;  2PNL A;  4NXN E;  4WUC A;  3T1H E;  4XTJ A;  4DUY I;  4KHP I;  4DV6 I;  5K36 C;  1Y4S A;  4WUB A;  2VQF E;  2JEA B;  1H74 A;  4DR3 I;  4LFC I;  4DV0 I;  3V5R A;  4DR1 E;  1OJ4 A;  2AJ4 A;  2BM0 A;  3LNU A;  1UEK A;  5LMU I;  4AQY E;  5LL6 R;  1Z0T A;  2OI2 A;  4LOM A;  3JAM C;  2F1D A;  4AID A;  1H7U A;  4DXL A;  1B62 A;  2BA1 D;  5C0X E;  4FW5 A;  2ZM6 I;  3GME A;  1Y5Y A;  2HHH E;  3J81 Q;  5JEA A;  4R1F A;  1NHH A;  1FJG E;  1B63 A;  2Z5B B;  1Z0G A;  4QNJ A;  4X66 I;  1J5E I;  1S4E A;  2C37 B;  4MYT A;  3QT7 A;  1S16 A;  2A2D A;  1Z0B A;  1OYR A;  2UUB E;  4B3T I;  2BR2 A;  2EFG A;  4DV2 I;  4DV4 I;  4JG4 A;  2F4V I;  2PO1 A;  3QT6 A;  3J7A G;  4IFD C;  1N34 E;  4DR4 I;  2WNR A;  3M7N D;  1IBM E;  2C39 B;  3U1K A;  4FW3 A;  5DRQ A;  3KRN A;  4LF4 E;  3P3E A;  4OO1 E;  1ZXN A;  3J7A M;  3M85 D;  4KQV A;  3J81 C;  4GKJ E;  5BR8 I;  4ED4 A;  3M6A A;  4DPU A;  1HNW I;  1H72 C;  3PYD A;  1IBL E;  4BA1 A;  3HKM A;  5JEA D;  1HNX I;  1N33 E;  5C0X B;  5L3J A;  4K0K I;  4MU3 A;  3ZKB A;  1WUU A;  1ELO A;  3GON A;  4LF7 E;  1KTV A;  4IZK B;  4DU8 A;  1N36 E;  3Q6M A;  4I3H A;  4B3R E;  2PNZ A;  4DR2 E;  2UXD I;  4HY1 A;  5DRR A;  4OX9 E;  2VQF I;  4DPY A;  2E5L E;  2ZBK B;  4JI5 E;  1KVK A;  2JE6 A;  2BV3 A;  1VIS A;  3ZZ0 A;  2Z5C B;  3WU3 A;  1QZR A;  4NBQ A;  2CVE A;  2UU9 E;  1KKH A;  4MU4 A;  4AQY I;  4OKG A;  5EL9 A;  4PRX A;  5JEA C;  4DR7 E;  2V2Q A;  2IES A;  2GS8 A;  2GO4 A;  4JI0 E;  2BA0 D;  4DV4 E;  3D4J A;  1Z0W A;  2HHH I;  1FJG I;  4M1K A;  3UHM A;  2GO3 A;  3CDJ A;  1HNZ I;  1NHJ A;  2PO0 B;  4DPX A;  1ZXM A;  3B78 A;  4LFB I;  4U3B A;  4DR5 E;  1ZM4 A;  2PO2 B;  4MYU A;  1XMO E;  2UXC E;  4DV7 I;  4FWD A;  1H7S A;  4LF4 I;  4OO1 D;  4IFD B;  4LCG A;  4X64 E;  5C0X F;  4LPF A;  1NZ0 A;  3DD6 A;  1N32 E;  1Z0E A;  4DV3 E;  1UDS A;  2HFU A;  2VES A;  1YH8 A;  1D6T A;  3T1Y E;  5LMN I;  1Z5A A;  1MU5 A;  4WUD A;  1NHI A;  2GQ0 A;  4LFA I;  5A2Q C;  2VQE I;  1HR0 E;  1N33 I;  5IWA E;  1XXE A;  2J65 A;  2O3Z A;  3HUL A;  4JYA E;  1UDO A;  1XNR I;  4DV5 E;  4ZVI A;  4BA2 B;  4B3R I;  2XEX A;  1ZM9 A;  2JEB A;  1XNQ I;  3V2U C;  4B3M I;  4JI4 E;  2Z5B A;  4OX9 I;  4OO1 F;  4B3S E;  1RHY A;  4OO1 C;  4JI1 E;  4JI5 I;  3Q1Q A;  2Q2E B;  4GQU A;  4NXM I;  2UUC E;  1XMQ I;  3L7Z A;  1N0V C;  5GMD A;  3PYF A;  2UU9 I;  4JV5 E;  4JI3 I;  1USV A;  1UDN A;  4JI2 E;  4DR7 I;  2NN6 E;  3B4T A;  4JI0 I;  4AM3 A;  1MG7 A;  2HK3 A;  5K36 E;  2UXB E;  3WU5 A;  4LF6 I;  3WU6 A;  4LF9 I;  4FW4 A;  1N0U A;  2HKJ A;  2O1T A;  1I94 E;  1Z5B A;  3M7N G;  4DR5 I;  4DR6 E;  2BR2 B;  2PNM A;  1R6L A;  4MDT A;  4DV1 I;  1EA6 A;  4UT4 A;  1Y4U A;  3QT8 A;  4YHH E;  2HK2 A;  2WP8 A;  3M85 G;  1BKN A;  2WNR B;  3GLL A;  2C38 B;  4IZK A;  2J7K A;  2DEI A;  3CWV A;  3P3G A;  2V2V A;  5GME A;  4URL A;  4X62 I;  3J80 Q;  4LCH A;  4LF5 I;  4GKK E;  4RPF A;  4X64 I;  4J3D A;  4Z7Y A;  4NXN I;  4IZJ B;  1ZM3 A;  3T1H I;  1HK7 A;  4KHP E;  4DV6 E;  3T1Y I;  4USK A;  4LFC E;  2NN6 B;  2R42 A;  4DR1 I;  4JI8 E;  2Z5C A;  4IFD E;  3P76 A;  5K36 B;  1Y60 A;  4OO1 A;  2X36 A;  4JYA I;  5LMU E;  4PRV A;  1A6F A;  4FN5 A;  1Z5C A;  1EI1 A;  4DV5 I;  5C0X D;  2VF3 A;  4JI7 E;  2ZM6 E;  2IER A;  1FKA E;  2PNZ B;  4HYM A;  4JI4 I;  1PIE A;  2CZ9 A;  4HAC A;  2IOQ A;  3CDI A;  4OZE A;  4B3S I;  5EKW A;  3ZKD A;  4X66 E;  4UTG A;  2JE6 B;  2UUB I;  3Q6N A;  2BA0 G;  4MU1 A;  2Z5E A; 
#chains in the Genus database with same CATH homology
 3QT5 A;  1FNM A;  4YY3 E;  4JV5 I;  4DU7 A;  2F4V E;  1K47 A;  4DR4 E;  1IBK E;  1N34 I;  1IBM I;  4LF8 E;  1RRE A;  2HKE A;  1KIJ A;  5IT9 Q;  1DAR A;  1FWK A;  4DUZ E;  5BR8 E;  4GKJ I;  1Z0V A;  2BM1 A;  2O1W A;  1HNW E;  2WW4 A;  3H4L A;  1IBL I;  1HNX E;  4DPT A;  4K0K E;  3JAM Q;  3OTO E;  1FI4 A;  4LF7 I;  1N36 I;  4GKK I;  1MX0 A;  1H73 A;  3PYE A;  2X7I A;  2UXD E;  4DR2 I;  5IT9 C;  1Z59 A;  2R3V A;  2E5L I;  3F0N A;  4JI8 I;  2A2C A;  3P06 A;  1Y6Z A;  3K85 A;  3ZM7 A;  3LPS A;  4JI7 I;  4EMD A;  4Z7C A;  2CG9 A;  1XHK A;  3PRY A;  4JI6 E;  4X65 E;  1HNZ E;  3PYG A;  2V2Z A;  4LFB E;  4USM A;  4YY3 I;  2HFS A;  3ZZU A;  2V8P A;  3LTO A;  1IBK I;  3WU4 A;  1XMO I;  2UXC I;  4DV7 E;  3ZZT A;  2UUA E;  4LF8 I;  4P7A A;  4IZJ A;  4FWH A;  2LJP A;  1N32 I;  4DUZ I;  4DV3 I;  4DUY E;  5LMN E;  1PVG A;  1PKP A;  4DR3 E;  4DV0 E;  4LFA E;  2VQE E;  1ZM2 A;  1HR0 I;  5IWA I;  3K1J A;  2DEJ A;  3OTO I;  1XNR E;  2E1R A;  5FLX Q;  1Z0C A;  4PU9 A;  3J80 C;  1XNQ E;  4B3M E;  1USU A;  4JI1 I;  1J5E E;  4NXM E;  2UUC I;  1XMQ E;  4IZJ D;  4FW9 A;  4B3T E;  4JI3 E;  4JI2 I;  3B82 A;  5FLX C;  2O1V A;  2ZIT A;  1RR9 A;  2UXB I;  4LF6 E;  4JI6 I;  3B8H A;  1FWL A;  4LF9 E;  2IOP A;  4DPW A;  4HAC B;  4FWG A;  4X65 I;  2NPF A;  5A2Q Q;  1I94 I;  4P52 A;  2V34 A;  4DR6 I;  1U2R A;  4N3O A;  4DV1 E;  3HJC A;  3K17 A;  4YHH I;  4HXZ A;  2O1U A;  4X62 E;  2UUA I;  4LF5 E;  5FWK A;  2PNL A;  2CGE A;  4NXN E;  4WUC A;  3T1H E;  4XTJ A;  4DUY I;  4KHP I;  4DV6 I;  1Y4S A;  4WUB A;  2VQF E;  1H74 A;  4DR3 I;  4LFC I;  4DV0 I;  3V5R A;  4DR1 E;  1OJ4 A;  2AJ4 A;  2BM0 A;  3LNU A;  1UEK A;  5LMU I;  4AQY E;  5LL6 R;  1Z0T A;  2OI2 A;  3JAM C;  4DXL A;  1H7U A;  1B62 A;  2ZM6 I;  2HHH E;  3J81 Q;  1NHH A;  4R1F A;  1FJG E;  1B63 A;  2Z5B B;  1Z0G A;  4X66 I;  1J5E I;  1S4E A;  4MYT A;  3QT7 A;  1S16 A;  2A2D A;  1Z0B A;  2UUB E;  4B3T I;  2EFG A;  4DV2 I;  4DV4 I;  4JG4 A;  2F4V I;  3QT6 A;  3J7A G;  1N34 E;  4DR4 I;  1IBM E;  4LF4 E;  1ZXN A;  3J7A M;  4KQV A;  3J81 C;  4GKJ E;  5BR8 I;  4ED4 A;  3M6A A;  4DPU A;  1HNW I;  1H72 C;  3PYD A;  1IBL E;  1HNX I;  1N33 E;  5L3J A;  4K0K I;  3ZKB A;  1WUU A;  1ELO A;  3GON A;  4LF7 E;  1KTV A;  4IZK B;  4DU8 A;  1N36 E;  3Q6M A;  4I3H A;  4B3R E;  4DR2 E;  2UXD I;  4HY1 A;  4OX9 E;  2VQF I;  4DPY A;  2E5L E;  2ZBK B;  4JI5 E;  1KVK A;  2BV3 A;  1VIS A;  3ZZ0 A;  2Z5C B;  3WU3 A;  1QZR A;  2UU9 E;  1KKH A;  4AQY I;  4PRX A;  4DR7 E;  2V2Q A;  2GS8 A;  4JI0 E;  2Z5E A;  3D4J A;  1Z0W A;  2HHH I;  1FJG I;  4M1K A;  1HNZ I;  1NHJ A;  4DPX A;  1ZXM A;  3B78 A;  4LFB I;  4DR5 E;  1ZM4 A;  4MYU A;  1XMO E;  2UXC E;  4DV7 I;  4FWD A;  1H7S A;  4LF4 I;  4X64 E;  1NZ0 A;  1N32 E;  1Z0E A;  4DV3 E;  2HFU A;  1D6T A;  3T1Y E;  5LMN I;  1Z5A A;  1MU5 A;  4WUD A;  1NHI A;  2GQ0 A;  4LFA I;  5A2Q C;  2VQE I;  1HR0 E;  1N33 I;  5IWA E;  4JYA E;  3HUL A;  1XNR I;  4DV5 E;  4ZVI A;  4B3R I;  2XEX A;  1ZM9 A;  1XNQ I;  3V2U C;  4B3M I;  4JI4 E;  2Z5B A;  4OX9 I;  4B3S E;  4JI1 E;  4JI5 I;  3Q1Q A;  2Q2E B;  4NXM I;  2UUC E;  1XMQ I;  1N0V C;  5GMD A;  3PYF A;  2UU9 I;  4JV5 E;  4JI3 I;  1USV A;  4JI2 E;  4DR7 I;  4JI0 I;  1MG7 A;  2HK3 A;  2UXB E;  3WU5 A;  4LF6 I;  3WU6 A;  4LF9 I;  1N0U A;  2HKJ A;  2O1T A;  1I94 E;  1Z5B A;  4DR5 I;  4DR6 E;  2PNM A;  4DV1 I;  1EA6 A;  4UT4 A;  1Y4U A;  3QT8 A;  4YHH E;  2HK2 A;  1BKN A;  4IZK A;  2J7K A;  2DEI A;  3CWV A;  4X62 I;  2V2V A;  5GME A;  4URL A;  3J80 Q;  4LF5 I;  4GKK E;  4RPF A;  4X64 I;  4Z7Y A;  4NXN I;  4IZJ B;  1ZM3 A;  3T1H I;  1HK7 A;  4KHP E;  4DV6 E;  3T1Y I;  4USK A;  4LFC E;  2R42 A;  4DR1 I;  4JI8 E;  2Z5C A;  2X36 A;  4JYA I;  5LMU E;  4PRV A;  1A6F A;  4FN5 A;  1Z5C A;  1EI1 A;  4DV5 I;  2VF3 A;  4JI7 E;  2ZM6 E;  1FKA E;  4HYM A;  4JI4 I;  1PIE A;  2CZ9 A;  4HAC A;  2IOQ A;  4B3S I;  3ZKD A;  4X66 E;  4UTG A;  2UUB I;  3Q6N A;  4DV2 E;  4DV4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...