1XNQI

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqI00
1PVGA 1N36E 2V2QA 4KQVA 3T1YE 1ZXNA 1DARA 5LMNI 4PU9A 4M1KA 2VQFI 4DV5E 1IBLE 2LJPA 1S16A 1D6TA 5GMDA 3LTOA 4X64E 4DR2E 3QT7A 1N34I 4GKKE 1HNZI 1EI1A 4DV3E 4YHHI 1J5EE 4YY3I 1N32E 4JI1I 1N33I 3M6AA 4DR3I 2UUCE 2UUBE 4WUCA 4PRVA 4DR4E 2CZ9A 1KKHA 2BM0A 4ED4A 1HNWE 3V5RA 4JI0E 4NXNE 4HXZA 4MYUA 2A2CA 4K0KE 4JI6I 3B82A 3PYFA 4DPYA 4LF7E 5FLXC 4JI7E 3F0NA 4DV4E 2EFGA 4DV2I 4JI5I 4LFCI 1Z0GA 4DV0E 2UXDI 2ZM6E 4DPWA 1IBMI 4KHPE 1Z0CA 2UXBE 1FJGI 4LFBI 4DV7I 4LF6I 4UT4A 3WU4A 4B3RE 2HK3A 2UUAE 4LF8I 4B3SE 1XMOE 4JI2E 3PYGA 1A6FA 4DV6I 4WUDA 2OI2A 2E5LI 3D4JA 5BR8I 1XNRI 5LMNE 3QT5A 1KTVA 3QT6A 3J7AG 5LMUE 2Q2EB 1ZXMA 2HHHI 4LF5I 1MU5A 4B3TE 4YHHE 5IWAI 4DR1E 5IT9Q 5LL6R 4LF4E 4JI1E 3ZM7A 2VF3A 3JAMC 2UXCE 1XHKA 1H72C 2ZITA 4R1FA 4JI3I 4EMDA 3T1HI 4JI8I 1ZM4A 4AQYE 3ZKBA 4DR6I 3WU6A 1HNXE 1BKNA 1IBKE 4DUZE 2J7KA 4XTJA 1U2RA 4JI5E 2V2ZA 4LFCE 1NHJA 4LF9I 1UEKA 2UXDE 3PYEA 2HFUA 3OTOI 4FWDA 2DEJA 1I94I 4JYAI 4DR7I 2F4VE 3B78A 1QZRA 5IT9C 4OX9I 4DV7E 4LF6E 2A2DA 4LFAE 3ZZUA 4DR5I 2XEXA 3LPSA 4B3MI 4X66E 4HYMA 4NXMI 3HULA 1NHIA 2UU9I 1N36I 4DXLA 4GKJE 2E5LE 1K47A 4MYTA 4P52A 3T1YI 2VQEE 1XMQE 4JV5E 4DV5I 1IBLI 1H74A 4DUYE 1NZ0A 4X64I 4DR2I 1Z0TA 4X65I 2DEIA 4GKKI 5IWAE 4DV3I 1PKPA 4X62E 1J5EI 1N32I 1HR0I 1Z5BA 4USMA 1Z5AA 2BM1A 2UUCI 2UUBI 1H7UA 4DR4I 3PYDA 1EA6A 1HNWI 4JI0I 4HACB 3CWVA 2VQFE 1MX0A 4K0KI 1N0VC 1B63A 5A2QQ 1Z0VA 3H4LA 4LF7I 1N0UA 1KIJA 5GMEA 4JI7I 1XNQI 1Z5CA 1OJ4A 4LF9E 4ZVIA 1N34E 1HNZE 3WU5A 4YY3E 4DV0I 2ZM6I 1MG7A 1N33E 4DR3E 2GS8A 2UXBI 3V2UC 4FW9A 3ZZ0A 1FWLA 2X36A 4B3RI 2UUAI 4JI6E 4B3SI 1XMOI 2ZBKB 3ZKDA 4DV2E 4JI2I 4UTGA 1NHHA 5A2QC 5FLXQ 2BV3A 4P7AA 2R3VA 4JI4I 1IBME 1VISA 4FN5A 2HFSA 1FJGE 4DV1I 5LMUI 1S4EA 1PIEA 2E1RA 4LFBE 1B62A 1FWKA 3J81Q 4X65E 3K1JA 3GONA 4B3TI 4LF8E 4DU7A 4DR1I 3WU3A 4LF4I 1HR0E 1ELOA 2UXCI 1ZM3A 3QT8A 2HK2A 4WUBA 3J80Q 4DV6E 2V34A 4AQYI 5BR8E 4Z7YA 1Z0WA 1XNRE 2R42A 3J7AM 1HNXI 1FI4A 2NPFA 1IBKI 4DUZI 1Z0BA 1XNQE 3Q1QA 2HHHE 2HKJA 1H7SA 4LF5E 4DPXA 2AJ4A 2WW4A 4DPTA 3J81C 1FNMA 1Z59A 2F4VI 4JI3E 3B8HA 1RR9A 4HY1A 1H73A 3T1HE 1WUUA 2V8PA 4JI8E 4I3HA 3JAMQ 4Z7CA 4DR6E 5L3JA 4LFAI 4NXNI 3J80C 4URLA 4X66I 4DV4I 2X7IA 4PRXA 2V2VA 4FWHA 1FKAE 4GKJI 3OTOE 4JI4E 1I94E 4JYAE 4DU8A 1ZM9A 1Z0EA 2VQEI 1XMQI 4DPUA 4DR7E 4KHPI 4DV1E 4JV5I 4HACA 4DUYI 3K17A 1KVKA 4OX9E 1ZM2A 4DR5E 4FWGA 3LNUA 4X62I 4B3ME 4RPFA 1RREA 3ZZTA 4NXME 4JG4A 2UU9E 2HKEA 4USKA
chains in the Genus database with same CATH superfamily
1PVGA 1N36E 2V2QA 4KQVA 3T1YE 2C39B 1ZXNA 3GCMA 1DARA 2GO3A 5LMNI 4PU9A 2C38A 4M1KA 2VQFI 1HK7A 5K36E 4DV5E 1IBLE 1VI7A 2LJPA 1S16A 1D6TA 5GMDA 3LTOA 3PS2A 4X64E 4DR2E 3QT7A 1N34I 4GKKE 1HNZI 1EI1A 1E3HA 2NN6A 3P3GA 4DV3E 4YHHI 1J5EE 3M7NG 4YY3I 1N32E 2PO0A 4OKGA 4JI1I 1N33I 3M6AA 4BA2B 4DR3I 2UUCE 2UUBE 4WUCA 4PRVA 4DR4E 2CZ9A 2NN6E 1KKHA 2IOPA 3HKMA 2BM0A 4ED4A 5DNLA 1HNWE 3V5RA 4JI0E 4NXNE 4HXZA 4MYUA 2A2CA 2Z5BB 4K0KE 4JI6I 3B82A 2PO2A 3PYFA 4DPYA 4LF7E 5FLXC 4JI7E 3F0NA 4DV4E 2EFGA 4DV2I 4JI5I 2O1UA 4LFCI 3PS3A 1RHYA 1Z0GA 1E3PA 4DV0E 2UXDI 2ZM6E 3L7ZA 4DPWA 1IBMI 1Y5YA 3P76A 4KHPE 1Z0CA 2UXBE 1FJGI 4LFBI 3Q6MA 3KRNA 4DV7I 4LF6I 4UT4A 3WU4A 5DRPA 4B3RE 2HK3A 2UUAE 4LF8I 4B3SE 5DRQA 2PNMA 1XMOE 1P42A 4MDTA 4IFDB 4JI2E 2CG9A 2WNRA 3PYGA 1A6FA 2JEAA 4OO1B 2C37A 5DRRA 4DV6I 4WUDA 2OI2A 4IZKA 2E5LI 3D4JA 5C0XF 5BR8I 4AIMA 1XNRI 5LMNE 3QT5A 1KTVA 3QT6A 3J7AG 2JE6B 5DNXA 5LMUE 2Q2EB 3P3CA 1ZXMA 3M85G 2HHHI 1UDQA 4LF5I 1MU5A 4B3TE 4YHHE 5IWAI 4DR1E 5IT9Q 5LL6R 5EKWA 4LF4E 4JI1E 5K36B 3ZM7A 2JEBA 2VF3A 3JAMC 2UXCE 1XHKA 3UHMA 4LCFA 1H72C 2ZITA 4R1FA 2WP8B 3CDIA 4BA1A 4JI3I 4EMDA 3T1HI 2Z5EA 4JI8I 1ZM4A 4LCGA 3ZKBA 5C0XC 4AQYE 4DR6I 3WU6A 1HNXE 1BKNA 3PS1A 1IBKE 4DUZE 1YHCA 2J7KA 5C0XD 4XTJA 3H1CA 2JT2A 1U2RA 4JI5E 2V2ZA 3NZKA 2NN6B 4LFCE 1NHJA 4LF9I 1UEKA 2VESA 2UXDE 3PYEA 2HFUA 3OTOI 4FWDA 2DEJA 1I94I 4JYAI 4DR7I 2F4VE 3PRYA 3B78A 1QZRA 2F1DA 5IT9C 3M7ND 3P3EA 4OX9I 4DV7E 4LF6E 2A2DA 4LFAE 3ZZUA 4DR5I 2XEXA 5C0XA 3LPSA 4FW3A 4B3MI 4X66E 4HYMA 4OZEA 4NXMI 3HULA 1NHIA 2UU9I 1N36I 5C0XE 4DXLA 2CVEA 4GKJE 2E5LE 1K47A 4MYTA 4P52A 3T1YI 1OYPA 4MU0A 5JEAB 2VQEE 1R6MA 1XMQE 4AIDA 2PNZA 2GO4A 4JV5E 1Y4SA 4DV5I 1IBLI 1H74A 2Z5BA 4DUYE 1NZ0A 4NBQA 2CGEA 4X64I 4DR2I 4LPFA 1USVA 1Z0TA 4X65I 2DEIA 4LCHA 2PO1A 4GKKI 5IWAE 4DV3I 1PKPA 4X62E 4IFDD 2J65A 1J5EI 1N32I 1HR0I 1Z5BA 4USMA 1OYSA 1Z5AA 2BM1A 5FWKA 3U1KA 2UUCI 2UUBI 4JG4A 1H7UA 2C37B 4DR4I 3PYDA 4ISAA 4U3DA 1EA6A 4IZJB 1UDSA 1HNWI 4JI0I 4GQUA 4HACB 3CWVA 2VQFE 1MX0A 4K0KI 2O3ZA 1N0VC 1B63A 5A2QQ 1Z0VA 3H4LA 4LF7I 1N0UA 1KIJA 5GMEA 4JI7I 1XNQI 4FW4A 1Z5CA 1OJ4A 4LF9E 4IFDA 4ZVIA 1N34E 1HNZE 3WU5A 5DROA 2JEBB 4YY3E 4DV0I 2ZM6I 1MG7A 1N33E 4OO1A 3M85D 4DR3E 2GS8A 2UXBI 2AE8A 3V2UC 4IFDE 4FW9A 3ZZ0A 2JE6A 2Z5CA 1FWLA 2X36A 3GLLA 2C38B 1USUA 4OO1E 4B3RI 4AM3A 2UUAI 4JI6E 2O1WA 4B3SI 1XMOI 2ZBKB 3ZKDA 3Q6NA 4DV2E 4JI2I 4FW6A 4IS9A 4UTGA 2BR2A 1NHHA 2WP8A 5A2QC 4MU3A 2PO0B 5FLXQ 2BV3A 4P7AA 2R3VA 4JI4I 1IBME 1VISA 1OYRA 2C39A 5EL9A 4FN5A 2HFSA 2PNLA 4DV1I 5LMUI 1FJGE 1S4EA 1PIEA 1R6LA 2E1RA 4LFBE 1B62A 4IFDF 1FWKA 3J81Q 1UDOA 5C0XB 4X65E 3K1JA 3GONA 2PO2B 1Y6ZA 4B3TI 4LF8E 4DU7A 4DR1I 4OO1F 3WU3A 4MU4A 4LF4I 1HR0E 1ELOA 5JEAC 2UXCI 1ZM3A 4FW7A 3QT8A 3U1YA 4BA2A 2HK2A 3L7ZB 4WUBA 3J80Q 5JEAD 4DV6E 2V34A 4QNJA 4AQYI 2PNZB 5BR8E 4Z7YA 1Z0WA 1XNRE 2R42A 3J7AM 1HNXI 1FI4A 2NPFA 4MQYA 1IBKI 4DUZI 1Z0BA 1XNQE 5K36F 5ELWA 3GMEA 4IFDC 3Q1QA 2HHHE 2PO1B 3CDJA 2HKJA 1H7SA 4LF5E 3DD6A 4OO1C 4DPXA 2AJ4A 3HJCA 2WW4A 4FW5A 4MU1A 4DPTA 2WNRB 3J81C 3P06A 1FNMA 1Z59A 2F4VI 5JEAA 4JI3E 3B8HA 1RR9A 2JEAB 4HY1A 4OO1D 3B4TA 4IZJD 1H73A 3T1HE 4IZKB 1WUUA 2V8PA 4JI8E 4I3HA 3JAMQ 4Z7CA 4DR6E 5L3JA 4LFAI 3K85A 2NN6F 1XXEA 4NXNI 1Y60A 4QNKA 5JEAE 5K36C 3J80C 4URLA 2O1TA 4X66I 4DV4I 2X7IA 4PRXA 2BA1G 2V2VA 4FWHA 4N3OA 1FKAE 5K36D 4GKJI 3OTOE 4JI4E 1I94E 4JYAE 4BA1B 4DU8A 1ZM9A 4IZJA 1Z0EA 2VQEI 1XMQI 4DPUA 1UDNA 4DR7E 4KHPI 2BA1D 2IERA 2Z5CB 4U3BA 4HACA 4DV1E 4JV5I 2IESA 4DUYI 3K17A 2GQ0A 1KVKA 2BA0G 4J3DA 4OX9E 1ZM2A 2NN6C 4DR5E 4FWGA 3LNUA 4X62I 4B3ME 1Y4UA 2BA0D 2O1VA 4RPFA 1RREA 2NN6D 2IOQA 3ZZTA 5JEAF 2BR2B 4NXME 5K36A 4LOMA 2UU9E 2HKEA 4USKA 1YH8A
chains in the Genus database with same CATH topology
1PVGA 1N36E 2V2QA 4KQVA 3T1YE 1ZXNA 1DARA 5LMNI 4PU9A 4M1KA 2VQFI 1HK7A 4DV5E 1IBLE 2LJPA 1S16A 1D6TA 5GMDA 3LTOA 4X64E 4DR2E 3QT7A 1N34I 4GKKE 1HNZI 1EI1A 4DV3E 4YHHI 1J5EE 4YY3I 1N32E 4JI1I 1N33I 3M6AA 4DR3I 2UUCE 2UUBE 4WUCA 4PRVA 4DR4E 2CZ9A 1KKHA 2IOPA 2BM0A 4ED4A 1HNWE 3V5RA 4JI0E 4NXNE 4HXZA 4MYUA 2A2CA 2Z5BB 4K0KE 4JI6I 3B82A 3PYFA 4DPYA 4LF7E 5FLXC 4JI7E 3F0NA 4DV4E 2EFGA 4DV2I 4JI5I 2O1UA 4LFCI 1Z0GA 4DV0E 2UXDI 2ZM6E 4DPWA 1IBMI 4KHPE 1Z0CA 2UXBE 1FJGI 4LFBI 3Q6MA 4DV7I 4LF6I 4UT4A 3WU4A 4B3RE 2HK3A 2UUAE 4LF8I 4B3SE 2PNMA 1XMOE 4JI2E 2CG9A 3PYGA 1A6FA 4DV6I 4WUDA 2OI2A 4IZKA 2E5LI 3D4JA 5BR8I 1XNRI 5LMNE 3QT5A 1KTVA 3QT6A 3J7AG 5LMUE 2Q2EB 1ZXMA 2HHHI 4LF5I 1MU5A 4B3TE 4YHHE 5IWAI 4DR1E 5IT9Q 5LL6R 4LF4E 4JI1E 3ZM7A 2VF3A 3JAMC 2UXCE 1XHKA 1H72C 2ZITA 4R1FA 4JI3I 4EMDA 3T1HI 2Z5EA 4JI8I 1ZM4A 4AQYE 3ZKBA 4DR6I 3WU6A 1HNXE 1BKNA 1IBKE 4DUZE 2J7KA 4XTJA 1U2RA 4JI5E 2V2ZA 4LFCE 1NHJA 4LF9I 1UEKA 2UXDE 3PYEA 2HFUA 3OTOI 4FWDA 2DEJA 1I94I 4JYAI 4DR7I 2F4VE 3PRYA 3B78A 1QZRA 5IT9C 4OX9I 4DV7E 4LF6E 2A2DA 4LFAE 3ZZUA 4DR5I 2XEXA 3LPSA 4B3MI 4X66E 4HYMA 4NXMI 3HULA 1NHIA 2UU9I 1N36I 4DXLA 4GKJE 2E5LE 1K47A 4MYTA 4P52A 3T1YI 2VQEE 1XMQE 4JV5E 1Y4SA 4DV5I 1IBLI 1H74A 2Z5BA 4DUYE 1NZ0A 2CGEA 4X64I 4DR2I 1USVA 1Z0TA 4X65I 2DEIA 4GKKI 5IWAE 4DV3I 1PKPA 4X62E 1J5EI 1N32I 1HR0I 1Z5BA 4USMA 1Z5AA 2BM1A 5FWKA 2UUCI 2UUBI 1H7UA 4DR4I 3PYDA 1EA6A 4IZJB 1HNWI 4JI0I 4HACB 3CWVA 2VQFE 1MX0A 4K0KI 1N0VC 1B63A 5A2QQ 1Z0VA 3H4LA 4LF7I 1N0UA 1KIJA 5GMEA 4JI7I 1XNQI 1Z5CA 1OJ4A 4LF9E 4ZVIA 1N34E 1HNZE 3WU5A 4YY3E 4DV0I 2ZM6I 1MG7A 1N33E 4DR3E 2GS8A 2UXBI 3V2UC 4FW9A 3ZZ0A 2Z5CA 1FWLA 2X36A 1USUA 4B3RI 2UUAI 4JI6E 2O1WA 4B3SI 1XMOI 2ZBKB 3ZKDA 3Q6NA 4DV2E 4JI2I 4UTGA 1NHHA 5A2QC 5FLXQ 2BV3A 4P7AA 2R3VA 4JI4I 1IBME 1VISA 4FN5A 2HFSA 2PNLA 4DV1I 5LMUI 1FJGE 1S4EA 1PIEA 2E1RA 4LFBE 1B62A 1FWKA 3J81Q 4X65E 3K1JA 3GONA 1Y6ZA 4B3TI 4LF8E 4DU7A 4DR1I 3WU3A 4LF4I 1HR0E 1ELOA 2UXCI 1ZM3A 3QT8A 2HK2A 4WUBA 3J80Q 4DV6E 2V34A 4AQYI 5BR8E 4Z7YA 1Z0WA 1XNRE 2R42A 3J7AM 1HNXI 1FI4A 2NPFA 1IBKI 4DUZI 1Z0BA 1XNQE 3Q1QA 2HHHE 2HKJA 1H7SA 4LF5E 4DPXA 2AJ4A 3HJCA 2WW4A 4DPTA 3J81C 3P06A 1FNMA 1Z59A 2F4VI 4JI3E 3B8HA 1RR9A 4HY1A 4IZJD 1H73A 3T1HE 4IZKB 1WUUA 2V8PA 4JI8E 4I3HA 3JAMQ 4Z7CA 4DR6E 5L3JA 4LFAI 3K85A 4NXNI 3J80C 4URLA 2O1TA 4X66I 4DV4I 2X7IA 4PRXA 2V2VA 4FWHA 4N3OA 1FKAE 4GKJI 3OTOE 4JI4E 1I94E 4JYAE 4DU8A 1ZM9A 4IZJA 1Z0EA 2VQEI 1XMQI 4DPUA 4DR7E 4KHPI 2Z5CB 4DV1E 4HACA 4JV5I 4DUYI 3K17A 2GQ0A 1KVKA 4OX9E 1ZM2A 4DR5E 4FWGA 3LNUA 4X62I 4B3ME 1Y4UA 2O1VA 4RPFA 1RREA 2IOQA 3ZZTA 4NXME 4JG4A 2UU9E 2HKEA 4USKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVG A;  1N36 E;  2V2Q A;  4KQV A;  3T1Y E;  1ZXN A;  1DAR A;  5LMN I;  4PU9 A;  4M1K A;  2VQF I;  4DV5 E;  1IBL E;  2LJP A;  1S16 A;  1D6T A;  5GMD A;  3LTO A;  4X64 E;  4DR2 E;  3QT7 A;  1N34 I;  4GKK E;  1HNZ I;  1EI1 A;  4DV3 E;  4YHH I;  1J5E E;  4YY3 I;  1N32 E;  4JI1 I;  1N33 I;  3M6A A;  4DR3 I;  2UUC E;  2UUB E;  4WUC A;  4PRV A;  4DR4 E;  2CZ9 A;  1KKH A;  2BM0 A;  4ED4 A;  1HNW E;  3V5R A;  4JI0 E;  4NXN E;  4HXZ A;  4MYU A;  2A2C A;  4K0K E;  4JI6 I;  3B82 A;  3PYF A;  4DPY A;  4LF7 E;  5FLX C;  4JI7 E;  3F0N A;  4DV4 E;  2EFG A;  4DV2 I;  4JI5 I;  4LFC I;  1Z0G A;  4DV0 E;  2UXD I;  2ZM6 E;  4DPW A;  1IBM I;  4KHP E;  1Z0C A;  2UXB E;  1FJG I;  4LFB I;  4DV7 I;  4LF6 I;  4UT4 A;  3WU4 A;  4B3R E;  2HK3 A;  2UUA E;  4LF8 I;  4B3S E;  1XMO E;  4JI2 E;  3PYG A;  1A6F A;  4DV6 I;  4WUD A;  2OI2 A;  2E5L I;  3D4J A;  5BR8 I;  1XNR I;  5LMN E;  3QT5 A;  1KTV A;  3QT6 A;  3J7A G;  5LMU E;  2Q2E B;  1ZXM A;  2HHH I;  4LF5 I;  1MU5 A;  4B3T E;  4YHH E;  5IWA I;  4DR1 E;  5IT9 Q;  5LL6 R;  4LF4 E;  4JI1 E;  3ZM7 A;  2VF3 A;  3JAM C;  2UXC E;  1XHK A;  1H72 C;  2ZIT A;  4R1F A;  4JI3 I;  4EMD A;  3T1H I;  4JI8 I;  1ZM4 A;  4AQY E;  3ZKB A;  4DR6 I;  3WU6 A;  1HNX E;  1BKN A;  1IBK E;  4DUZ E;  2J7K A;  4XTJ A;  1U2R A;  4JI5 E;  2V2Z A;  4LFC E;  1NHJ A;  4LF9 I;  1UEK A;  2UXD E;  3PYE A;  2HFU A;  3OTO I;  4FWD A;  2DEJ A;  1I94 I;  4JYA I;  4DR7 I;  2F4V E;  3B78 A;  1QZR A;  5IT9 C;  4OX9 I;  4DV7 E;  4LF6 E;  2A2D A;  4LFA E;  3ZZU A;  4DR5 I;  2XEX A;  3LPS A;  4B3M I;  4X66 E;  4HYM A;  4NXM I;  3HUL A;  1NHI A;  2UU9 I;  1N36 I;  4DXL A;  4GKJ E;  2E5L E;  1K47 A;  4MYT A;  4P52 A;  3T1Y I;  2VQE E;  1XMQ E;  4JV5 E;  4DV5 I;  1IBL I;  1H74 A;  4DUY E;  1NZ0 A;  4X64 I;  4DR2 I;  1Z0T A;  4X65 I;  2DEI A;  4GKK I;  5IWA E;  4DV3 I;  1PKP A;  4X62 E;  1J5E I;  1N32 I;  1HR0 I;  1Z5B A;  4USM A;  1Z5A A;  2BM1 A;  2UUC I;  2UUB I;  1H7U A;  4DR4 I;  3PYD A;  1EA6 A;  1HNW I;  4JI0 I;  4HAC B;  3CWV A;  2VQF E;  1MX0 A;  4K0K I;  1N0V C;  1B63 A;  5A2Q Q;  1Z0V A;  3H4L A;  4LF7 I;  1N0U A;  1KIJ A;  5GME A;  4JI7 I;  1XNQ I;  1Z5C A;  1OJ4 A;  4LF9 E;  4ZVI A;  1N34 E;  1HNZ E;  3WU5 A;  4YY3 E;  4DV0 I;  2ZM6 I;  1MG7 A;  1N33 E;  4DR3 E;  2GS8 A;  2UXB I;  3V2U C;  4FW9 A;  3ZZ0 A;  1FWL A;  2X36 A;  4B3R I;  2UUA I;  4JI6 E;  4B3S I;  1XMO I;  2ZBK B;  3ZKD A;  4DV2 E;  4JI2 I;  4UTG A;  1NHH A;  5A2Q C;  5FLX Q;  2BV3 A;  4P7A A;  2R3V A;  4JI4 I;  1IBM E;  1VIS A;  4FN5 A;  2HFS A;  1FJG E;  4DV1 I;  5LMU I;  1S4E A;  1PIE A;  2E1R A;  4LFB E;  1B62 A;  1FWK A;  3J81 Q;  4X65 E;  3K1J A;  3GON A;  4B3T I;  4LF8 E;  4DU7 A;  4DR1 I;  3WU3 A;  4LF4 I;  1HR0 E;  1ELO A;  2UXC I;  1ZM3 A;  3QT8 A;  2HK2 A;  4WUB A;  3J80 Q;  4DV6 E;  2V34 A;  4AQY I;  5BR8 E;  4Z7Y A;  1Z0W A;  1XNR E;  2R42 A;  3J7A M;  1HNX I;  1FI4 A;  2NPF A;  1IBK I;  4DUZ I;  1Z0B A;  1XNQ E;  3Q1Q A;  2HHH E;  2HKJ A;  1H7S A;  4LF5 E;  4DPX A;  2AJ4 A;  2WW4 A;  4DPT A;  3J81 C;  1FNM A;  1Z59 A;  2F4V I;  4JI3 E;  3B8H A;  1RR9 A;  4HY1 A;  1H73 A;  3T1H E;  1WUU A;  2V8P A;  4JI8 E;  4I3H A;  3JAM Q;  4Z7C A;  4DR6 E;  5L3J A;  4LFA I;  4NXN I;  3J80 C;  4URL A;  4X66 I;  4DV4 I;  2X7I A;  4PRX A;  2V2V A;  4FWH A;  1FKA E;  4GKJ I;  3OTO E;  4JI4 E;  1I94 E;  4JYA E;  4DU8 A;  1ZM9 A;  1Z0E A;  2VQE I;  1XMQ I;  4DPU A;  4DR7 E;  4KHP I;  4DV1 E;  4JV5 I;  4HAC A;  4DUY I;  3K17 A;  1KVK A;  4OX9 E;  1ZM2 A;  4DR5 E;  4FWG A;  3LNU A;  4X62 I;  4B3M E;  4RPF A;  1RRE A;  3ZZT A;  4NXM E;  4JG4 A;  2UU9 E;  2HKE A;  4USK A; 
#chains in the Genus database with same CATH topology
 1PVG A;  1N36 E;  2V2Q A;  4KQV A;  3T1Y E;  2C39 B;  1ZXN A;  3GCM A;  1DAR A;  2GO3 A;  5LMN I;  4PU9 A;  2C38 A;  4M1K A;  2VQF I;  1HK7 A;  5K36 E;  4DV5 E;  1IBL E;  1VI7 A;  2LJP A;  1S16 A;  1D6T A;  5GMD A;  3LTO A;  3PS2 A;  4X64 E;  4DR2 E;  3QT7 A;  1N34 I;  4GKK E;  1HNZ I;  1EI1 A;  1E3H A;  2NN6 A;  3P3G A;  4DV3 E;  4YHH I;  1J5E E;  3M7N G;  4YY3 I;  1N32 E;  2PO0 A;  4OKG A;  4JI1 I;  1N33 I;  3M6A A;  4BA2 B;  4DR3 I;  2UUC E;  2UUB E;  4WUC A;  4PRV A;  4DR4 E;  2CZ9 A;  2NN6 E;  1KKH A;  2IOP A;  3HKM A;  2BM0 A;  4ED4 A;  5DNL A;  1HNW E;  3V5R A;  4JI0 E;  4NXN E;  4HXZ A;  4MYU A;  2A2C A;  2Z5B B;  4K0K E;  4JI6 I;  3B82 A;  2PO2 A;  3PYF A;  4DPY A;  4LF7 E;  5FLX C;  4JI7 E;  3F0N A;  4DV4 E;  2EFG A;  4DV2 I;  4JI5 I;  2O1U A;  4LFC I;  3PS3 A;  1RHY A;  1Z0G A;  1E3P A;  4DV0 E;  2UXD I;  2ZM6 E;  3L7Z A;  4DPW A;  1IBM I;  1Y5Y A;  3P76 A;  4KHP E;  1Z0C A;  2UXB E;  1FJG I;  4LFB I;  3Q6M A;  3KRN A;  4DV7 I;  4LF6 I;  4UT4 A;  3WU4 A;  5DRP A;  4B3R E;  2HK3 A;  2UUA E;  4LF8 I;  4B3S E;  5DRQ A;  2PNM A;  1XMO E;  1P42 A;  4MDT A;  4IFD B;  4JI2 E;  2CG9 A;  2WNR A;  3PYG A;  1A6F A;  2JEA A;  4OO1 B;  2C37 A;  5DRR A;  4DV6 I;  4WUD A;  2OI2 A;  4IZK A;  2E5L I;  3D4J A;  5C0X F;  5BR8 I;  4AIM A;  1XNR I;  5LMN E;  3QT5 A;  1KTV A;  3QT6 A;  3J7A G;  2JE6 B;  5DNX A;  5LMU E;  2Q2E B;  3P3C A;  1ZXM A;  3M85 G;  2HHH I;  1UDQ A;  4LF5 I;  1MU5 A;  4B3T E;  4YHH E;  5IWA I;  4DR1 E;  5IT9 Q;  5LL6 R;  5EKW A;  4LF4 E;  4JI1 E;  5K36 B;  3ZM7 A;  2JEB A;  2VF3 A;  3JAM C;  2UXC E;  1XHK A;  3UHM A;  4LCF A;  1H72 C;  2ZIT A;  4R1F A;  2WP8 B;  3CDI A;  4BA1 A;  4JI3 I;  4EMD A;  3T1H I;  2Z5E A;  4JI8 I;  1ZM4 A;  4LCG A;  3ZKB A;  5C0X C;  4AQY E;  4DR6 I;  3WU6 A;  1HNX E;  1BKN A;  3PS1 A;  1IBK E;  4DUZ E;  1YHC A;  2J7K A;  5C0X D;  4XTJ A;  3H1C A;  2JT2 A;  1U2R A;  4JI5 E;  2V2Z A;  3NZK A;  2NN6 B;  4LFC E;  1NHJ A;  4LF9 I;  1UEK A;  2VES A;  2UXD E;  3PYE A;  2HFU A;  3OTO I;  4FWD A;  2DEJ A;  1I94 I;  4JYA I;  4DR7 I;  2F4V E;  3PRY A;  3B78 A;  1QZR A;  2F1D A;  5IT9 C;  3M7N D;  3P3E A;  4OX9 I;  4DV7 E;  4LF6 E;  2A2D A;  4LFA E;  3ZZU A;  4DR5 I;  2XEX A;  5C0X A;  3LPS A;  4FW3 A;  4B3M I;  4X66 E;  4HYM A;  4OZE A;  4NXM I;  3HUL A;  1NHI A;  2UU9 I;  1N36 I;  5C0X E;  4DXL A;  2CVE A;  4GKJ E;  2E5L E;  1K47 A;  4MYT A;  4P52 A;  3T1Y I;  1OYP A;  4MU0 A;  5JEA B;  2VQE E;  1R6M A;  1XMQ E;  4AID A;  2PNZ A;  2GO4 A;  4JV5 E;  1Y4S A;  4DV5 I;  1IBL I;  1H74 A;  2Z5B A;  4DUY E;  1NZ0 A;  4NBQ A;  2CGE A;  4X64 I;  4DR2 I;  4LPF A;  1USV A;  1Z0T A;  4X65 I;  2DEI A;  4LCH A;  2PO1 A;  4GKK I;  5IWA E;  4DV3 I;  1PKP A;  4X62 E;  4IFD D;  2J65 A;  1J5E I;  1N32 I;  1HR0 I;  1Z5B A;  4USM A;  1OYS A;  1Z5A A;  2BM1 A;  5FWK A;  3U1K A;  2UUC I;  2UUB I;  4JG4 A;  1H7U A;  2C37 B;  4DR4 I;  3PYD A;  4ISA A;  4U3D A;  1EA6 A;  4IZJ B;  1UDS A;  1HNW I;  4JI0 I;  4GQU A;  4HAC B;  3CWV A;  2VQF E;  1MX0 A;  4K0K I;  2O3Z A;  1N0V C;  1B63 A;  5A2Q Q;  1Z0V A;  3H4L A;  4LF7 I;  1N0U A;  1KIJ A;  5GME A;  4JI7 I;  1XNQ I;  4FW4 A;  1Z5C A;  1OJ4 A;  4LF9 E;  4IFD A;  4ZVI A;  1N34 E;  1HNZ E;  3WU5 A;  5DRO A;  2JEB B;  4YY3 E;  4DV0 I;  2ZM6 I;  1MG7 A;  1N33 E;  4OO1 A;  3M85 D;  4DR3 E;  2GS8 A;  2UXB I;  2AE8 A;  3V2U C;  4IFD E;  4FW9 A;  3ZZ0 A;  2JE6 A;  2Z5C A;  1FWL A;  2X36 A;  3GLL A;  2C38 B;  1USU A;  4OO1 E;  4B3R I;  4AM3 A;  2UUA I;  4JI6 E;  2O1W A;  4B3S I;  1XMO I;  2ZBK B;  3ZKD A;  3Q6N A;  4DV2 E;  4JI2 I;  4FW6 A;  4IS9 A;  4UTG A;  2BR2 A;  1NHH A;  2WP8 A;  5A2Q C;  4MU3 A;  2PO0 B;  5FLX Q;  2BV3 A;  4P7A A;  2R3V A;  4JI4 I;  1IBM E;  1VIS A;  1OYR A;  2C39 A;  5EL9 A;  4FN5 A;  2HFS A;  2PNL A;  4DV1 I;  5LMU I;  1FJG E;  1S4E A;  1PIE A;  1R6L A;  2E1R A;  4LFB E;  1B62 A;  4IFD F;  1FWK A;  3J81 Q;  1UDO A;  5C0X B;  4X65 E;  3K1J A;  3GON A;  2PO2 B;  1Y6Z A;  4B3T I;  4LF8 E;  4DU7 A;  4DR1 I;  4OO1 F;  3WU3 A;  4MU4 A;  4LF4 I;  1HR0 E;  1ELO A;  5JEA C;  2UXC I;  1ZM3 A;  4FW7 A;  3QT8 A;  3U1Y A;  4BA2 A;  2HK2 A;  3L7Z B;  4WUB A;  3J80 Q;  5JEA D;  4DV6 E;  2V34 A;  4QNJ A;  4AQY I;  2PNZ B;  5BR8 E;  4Z7Y A;  1Z0W A;  1XNR E;  2R42 A;  3J7A M;  1HNX I;  1FI4 A;  2NPF A;  4MQY A;  1IBK I;  4DUZ I;  1Z0B A;  1XNQ E;  5K36 F;  5ELW A;  3GME A;  4IFD C;  3Q1Q A;  2HHH E;  2PO1 B;  3CDJ A;  2HKJ A;  1H7S A;  4LF5 E;  3DD6 A;  4OO1 C;  4DPX A;  2AJ4 A;  3HJC A;  2WW4 A;  4FW5 A;  4MU1 A;  4DPT A;  2WNR B;  3J81 C;  3P06 A;  1FNM A;  1Z59 A;  2F4V I;  5JEA A;  4JI3 E;  3B8H A;  1RR9 A;  2JEA B;  4HY1 A;  4OO1 D;  3B4T A;  4IZJ D;  1H73 A;  3T1H E;  4IZK B;  1WUU A;  2V8P A;  4JI8 E;  4I3H A;  3JAM Q;  4Z7C A;  4DR6 E;  5L3J A;  4LFA I;  3K85 A;  2NN6 F;  1XXE A;  4NXN I;  1Y60 A;  4QNK A;  5JEA E;  5K36 C;  3J80 C;  4URL A;  2O1T A;  4X66 I;  4DV4 I;  2X7I A;  4PRX A;  2BA1 G;  2V2V A;  4FWH A;  4N3O A;  1FKA E;  5K36 D;  4GKJ I;  3OTO E;  4JI4 E;  1I94 E;  4JYA E;  4BA1 B;  4DU8 A;  1ZM9 A;  4IZJ A;  1Z0E A;  2VQE I;  1XMQ I;  4DPU A;  1UDN A;  4DR7 E;  4KHP I;  2BA1 D;  2IER A;  2Z5C B;  4U3B A;  4HAC A;  4DV1 E;  4JV5 I;  2IES A;  4DUY I;  3K17 A;  2GQ0 A;  1KVK A;  2BA0 G;  4J3D A;  4OX9 E;  1ZM2 A;  2NN6 C;  4DR5 E;  4FWG A;  3LNU A;  4X62 I;  4B3M E;  1Y4U A;  2BA0 D;  2O1V A;  4RPF A;  1RRE A;  2NN6 D;  2IOQ A;  3ZZT A;  5JEA F;  2BR2 B;  4NXM E;  5K36 A;  4LOM A;  2UU9 E;  2HKE A;  4USK A;  1YH8 A; 
#chains in the Genus database with same CATH homology
 1PVG A;  1N36 E;  2V2Q A;  4KQV A;  3T1Y E;  1ZXN A;  1DAR A;  5LMN I;  4PU9 A;  4M1K A;  2VQF I;  1HK7 A;  4DV5 E;  1IBL E;  2LJP A;  1S16 A;  1D6T A;  5GMD A;  3LTO A;  4X64 E;  4DR2 E;  3QT7 A;  1N34 I;  4GKK E;  1HNZ I;  1EI1 A;  4DV3 E;  4YHH I;  1J5E E;  4YY3 I;  1N32 E;  4JI1 I;  1N33 I;  3M6A A;  4DR3 I;  2UUC E;  2UUB E;  4WUC A;  4PRV A;  4DR4 E;  2CZ9 A;  1KKH A;  2IOP A;  2BM0 A;  4ED4 A;  1HNW E;  3V5R A;  4JI0 E;  4NXN E;  4HXZ A;  4MYU A;  2A2C A;  2Z5B B;  4K0K E;  4JI6 I;  3B82 A;  3PYF A;  4DPY A;  4LF7 E;  5FLX C;  4JI7 E;  3F0N A;  4DV4 E;  2EFG A;  4DV2 I;  4JI5 I;  2O1U A;  4LFC I;  1Z0G A;  4DV0 E;  2UXD I;  2ZM6 E;  4DPW A;  1IBM I;  4KHP E;  1Z0C A;  2UXB E;  1FJG I;  4LFB I;  3Q6M A;  4DV7 I;  4LF6 I;  4UT4 A;  3WU4 A;  4B3R E;  2HK3 A;  2UUA E;  4LF8 I;  4B3S E;  2PNM A;  1XMO E;  4JI2 E;  2CG9 A;  3PYG A;  1A6F A;  4DV6 I;  4WUD A;  2OI2 A;  4IZK A;  2E5L I;  3D4J A;  5BR8 I;  1XNR I;  5LMN E;  3QT5 A;  1KTV A;  3QT6 A;  3J7A G;  5LMU E;  2Q2E B;  1ZXM A;  2HHH I;  4LF5 I;  1MU5 A;  4B3T E;  4YHH E;  5IWA I;  4DR1 E;  5IT9 Q;  5LL6 R;  4LF4 E;  4JI1 E;  3ZM7 A;  2VF3 A;  3JAM C;  2UXC E;  1XHK A;  1H72 C;  2ZIT A;  4R1F A;  4JI3 I;  4EMD A;  3T1H I;  2Z5E A;  4JI8 I;  1ZM4 A;  4AQY E;  3ZKB A;  4DR6 I;  3WU6 A;  1HNX E;  1BKN A;  1IBK E;  4DUZ E;  2J7K A;  4XTJ A;  1U2R A;  4JI5 E;  2V2Z A;  4LFC E;  1NHJ A;  4LF9 I;  1UEK A;  2UXD E;  3PYE A;  2HFU A;  3OTO I;  4FWD A;  2DEJ A;  1I94 I;  4JYA I;  4DR7 I;  2F4V E;  3PRY A;  3B78 A;  1QZR A;  5IT9 C;  4OX9 I;  4DV7 E;  4LF6 E;  2A2D A;  4LFA E;  3ZZU A;  4DR5 I;  2XEX A;  3LPS A;  4B3M I;  4X66 E;  4HYM A;  4NXM I;  3HUL A;  1NHI A;  2UU9 I;  1N36 I;  4DXL A;  4GKJ E;  2E5L E;  1K47 A;  4MYT A;  4P52 A;  3T1Y I;  2VQE E;  1XMQ E;  4JV5 E;  1Y4S A;  4DV5 I;  1IBL I;  1H74 A;  2Z5B A;  4DUY E;  1NZ0 A;  2CGE A;  4X64 I;  4DR2 I;  1USV A;  1Z0T A;  4X65 I;  2DEI A;  4GKK I;  5IWA E;  4DV3 I;  1PKP A;  4X62 E;  1J5E I;  1N32 I;  1HR0 I;  1Z5B A;  4USM A;  1Z5A A;  2BM1 A;  5FWK A;  2UUC I;  2UUB I;  1H7U A;  4DR4 I;  3PYD A;  1EA6 A;  4IZJ B;  1HNW I;  4JI0 I;  4HAC B;  3CWV A;  2VQF E;  1MX0 A;  4K0K I;  1N0V C;  1B63 A;  5A2Q Q;  1Z0V A;  3H4L A;  4LF7 I;  1N0U A;  1KIJ A;  5GME A;  4JI7 I;  1XNQ I;  1Z5C A;  1OJ4 A;  4LF9 E;  4ZVI A;  1N34 E;  1HNZ E;  3WU5 A;  4YY3 E;  4DV0 I;  2ZM6 I;  1MG7 A;  1N33 E;  4DR3 E;  2GS8 A;  2UXB I;  3V2U C;  4FW9 A;  3ZZ0 A;  2Z5C A;  1FWL A;  2X36 A;  1USU A;  4B3R I;  2UUA I;  4JI6 E;  2O1W A;  4B3S I;  1XMO I;  2ZBK B;  3ZKD A;  3Q6N A;  4DV2 E;  4JI2 I;  4UTG A;  1NHH A;  5A2Q C;  5FLX Q;  2BV3 A;  4P7A A;  2R3V A;  4JI4 I;  1IBM E;  1VIS A;  4FN5 A;  2HFS A;  2PNL A;  4DV1 I;  5LMU I;  1FJG E;  1S4E A;  1PIE A;  2E1R A;  4LFB E;  1B62 A;  1FWK A;  3J81 Q;  4X65 E;  3K1J A;  3GON A;  1Y6Z A;  4B3T I;  4LF8 E;  4DU7 A;  4DR1 I;  3WU3 A;  4LF4 I;  1HR0 E;  1ELO A;  2UXC I;  1ZM3 A;  3QT8 A;  2HK2 A;  4WUB A;  3J80 Q;  4DV6 E;  2V34 A;  4AQY I;  5BR8 E;  4Z7Y A;  1Z0W A;  1XNR E;  2R42 A;  3J7A M;  1HNX I;  1FI4 A;  2NPF A;  1IBK I;  4DUZ I;  1Z0B A;  1XNQ E;  3Q1Q A;  2HHH E;  2HKJ A;  1H7S A;  4LF5 E;  4DPX A;  2AJ4 A;  3HJC A;  2WW4 A;  4DPT A;  3J81 C;  3P06 A;  1FNM A;  1Z59 A;  2F4V I;  4JI3 E;  3B8H A;  1RR9 A;  4HY1 A;  4IZJ D;  1H73 A;  3T1H E;  4IZK B;  1WUU A;  2V8P A;  4JI8 E;  4I3H A;  3JAM Q;  4Z7C A;  4DR6 E;  5L3J A;  4LFA I;  3K85 A;  4NXN I;  3J80 C;  4URL A;  2O1T A;  4X66 I;  4DV4 I;  2X7I A;  4PRX A;  2V2V A;  4FWH A;  4N3O A;  1FKA E;  4GKJ I;  3OTO E;  4JI4 E;  1I94 E;  4JYA E;  4DU8 A;  1ZM9 A;  4IZJ A;  1Z0E A;  2VQE I;  1XMQ I;  4DPU A;  4DR7 E;  4KHP I;  2Z5C B;  4DV1 E;  4HAC A;  4JV5 I;  4DUY I;  3K17 A;  2GQ0 A;  1KVK A;  4OX9 E;  1ZM2 A;  4DR5 E;  4FWG A;  3LNU A;  4X62 I;  4B3M E;  1Y4U A;  2O1V A;  4RPF A;  1RRE A;  2IOQ A;  3ZZT A;  4NXM E;  4JG4 A;  2UU9 E;  2HKE A;  4USK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...