1XNQK

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xnqK00
5A2QO 1XMOK 1N32K 2HHHK 1J5EK 4LF5K 4DR7K 4LF7K 4DR2K 4DR6K 2VQEK 5IT9O 4JI4K 3J81O 5IWAK 4V19S 4DR5K 4YHHK 5LMNK 1HR0K 4JI8K 4LF8K 2VQFK 2UXCK 4JV5K 4LFBK 4B3SK 1IBKK 4YY3K 1HNWK 2UUAK 5LL6Z 3OTOK 4X64K 1I94K 3J7YP 4JI5K 4X66K 4JI0K 4B3MK 4LFAK 1XMQK 4DUYK 3J80O 5FLXO 4DR1K 4JI1K 3T1HK 4DUZK 1FJGK 2UUBK 4NXMK 4LFCK 1XNQK 4JI7K 1HNXK 4DV5K 4DV6K 4LF9K 4X62K 2UXDK 2UUCK 4DV3K 1IBMK 4JI2K 4DV0K 5LMUK 5AJ3K 3J7AP 4DV7K 4X65K 4DV4K 4DR4K 4K0KK 4JI6K 1XNRK 2UXBK 4AQYK 4NXNK 3JAMO 4DV1K 1IBLK 1N33K 2UU9K 4JYAK 4GKKK 1N34K 4KHPK 4LF4K 4CVNE 2E5LK 5BR8K 2F4VK 4LF6K 2ZM6K 4B3RK 4GKJK 1HNZK 3T1YK 4OX9K 1N36K 4DR3K 4DV2K 4B3TK 4JI3K 4CW7B
chains in the Genus database with same CATH superfamily
4CJSA 2HHWA 4J8FA 4BWJA 1IV0A 4ZTJA 3SJJA 1IH7A 3HOSA 1U2VA 4IOXA 2RPIA 5CZ1A 4BR4A 5C10A 5HP1A 3TARA 3E1YA 4DFMA 5HROA 1HJRA 4YDUC 1KAYA 1LAVA 4WFNL 3QLHA 5GADP 3OYLA 5KTQA 1QSLA 4OGEA 3HVTA 3H08A 2QWOA 5LMNK 1RT3A 4WQ4A 5HRRA 3PX4A 3KKRA 1BA0A 3V9UA 4H0PA 2KZMA 4IDKA 3K5LA 4M45A 4H0XB 2F96A 1JL2A 2YJEA 4A5AA 2X6SA 4BRPA 3L8BA 3O9UA 5KI6A 5C42A 3DI6A 3FLCO 2ZGYA 3K5OA 4DLGA 5AQXA 4JI5K 3CM6A 4FYDA 4CHZA 4CF9A 1RILA 3OYAA 1K8AO 1Z6RA 1RTJA 2Q31A 2DTUA 2I7PA 3A5LC 3WNGA 4EHTA 2OTJN 5AQIA 4DFKA 4PL7A 4JN4A 3TSUA 4HUEA 1WOQA 2HBLA 3CFRA 4H5TA 4BGBA 3VGLA 3VQQA 2YHBA 1TKDA 4E3SA 3T19A 4DTPA 5AQWA 4OVLA 3OA9A 4BDPA 2QWPA 1U2VB 3VQAA 3SI6A 1X9JA 4MFBA 1S1WA 4FLWA 4CZKA 2NZTA 5AQGA 4DV4K 1JLBA 1NK8A 3QNOA 1S1UA 3P83D 4CHYA 4RW6A 5JLHA 1T8EA 1YI2N 4Z94A 5AZJB 4FWLA 3SJHA 3MX5A 3PY8A 3AA4A 1NKCA 4CVNE 1TK8A 5HBMA 1U48A 1L3VA 5FROA 2VGNA 4E7KA 3CD6N 4B3RK 4DSJA 4JKGA 3VTIA 4CEOA 1YJ9N 3ZSRA 5HLFA 3WEEB 2I7NA 1RT4A 2ZJQL 4CZMA 1JJ2M 4FJGA 3E01A 3KLHA 1NK6A 2ZJRL 4CGJA 3E9OA 1KLNA 1EP4A 2G8HA 4O0JA 4B9MA 3H3OB 3KLEA 3DLGA 2BANA 4PA1A 3NDKA 1HR0K 1TKZA 3GBTA 3F9KA 5FRNA 1QTMA 3ZX3A 4BDYA 1LAWA 5E41A 3HTVA 4NYFA 1RTDA 1KRPA 3ZSVA 1VAZA 1TK5A 1Z25A 2YHWA 5DM7L 4Z4IA 3R3LA 2BE2A 3S3OA 1QZ5A 3QBXA 3HRGA 2UUAK 5D3GA 3VTHA 3ZEUB 1I94K 2NLXA 2ZF5O 4FM1A 3JSMA 4LD0A 1L3SA 4Z0UA 3HM9A 1R0AA 4MLEA 4BGAA 1KC8O 1D9FA 3TSQA 4DUYK 2FBYA 1XQSC 4DTRA 4N56A 2QXFA 2XHBA 4I9LA 1OH7A 1DTTA 4FJIA 2GV9A 2E88A 3WXMB 2UXDK 5FPNA 2Q0RA 1IBMK 3LDLA 3QFUA 4DV0K 3OYFA 3ENHA 3HZ6A 2Q0UA 2R7YA 2Z1JA 3A2FA 2IAJA 4BQZA 1N5YA 2QWNA 3R8EA 3THYA 1E4FT 4DHYA 1TUUA 1J54A 3O3HA 3O1WA 2PY5A 3V1QA 3LDPA 4A57A 4RW4A 4NCBA 3V9SA 1WBDA 5EX5A 2BH1A 1Y64A 4GV6A 1Q7YO 3KIOA 1VQ4N 1I39A 4DV2K 4I2PA 3HK2A 1Q18A 3LP0A 4CGGA 4BC5A 3VQCA 4GV3A 3ENOA 3V1RA 4G9ZA 3AAQA 1WBBA 4H5NA 3TAEA 1NGBA 4BE1A 4MO4A 1S9GA 4PY5A 3K0SA 4KI6A 3ULEA 1K8KB 3VQ7A 4Z4EA 3K2PA 5AZIA 3MAQA 2HHSA 1JLFA 2NRRA 1KAXA 5I3UA 2P9IA 1E3MA 2ZJPL 4E7HA 3EZWA 3VOVA 3DLHA 4F3TA 4B3SK 3THWA 4RW7A 4YORA 4CCHA 5EY4A 2J4RA 4EP4A 3ZSYA 1NJXA 4FWOA 4WQ4C 4F2SA 3IS9A 3RSEA 3KLFA 2YKNA 2HNZA 2OTLN 4CGDA 1ZBIA 3OJUA 4NO7A 4KI4A 4N47A 4FW1A 3P1GA 2YHXA 4JKEA 4M42A 1NGFA 4NXMK 3EKSA 3M8QA 4ILGB 3CPEA 3TTDA 1BIZA 3VESA 3QEWA 3DRPA 4B1UB 4C8OA 2XY5A 2XY8A 1VQMN 4KTQA 1BO5O 3GG4A 3K5NA 3IKMA 3U6FA 2BUPA 2Z1HA 3AY9A 4LH4A 3ENBA 3AVKA 5AQVA 2G8WA 4KHQA 4CJ5A 3TSPA 1Q9XA 2LSNA 3LDQA 4GV9A 1VSKA 4BROA 1IKYA 2ZD1A 3FFIA 3CC4N 4I9QA 4B9SA 3U3YA 4KV8A 5K14A 4F4KA 1TYQB 4DS5A 1ILYA 3VERA 3EE8A 3D7EO 1HKCA 2EWSA 3L2RA 3C95A 1JLEA 1VQ6N 2HNYA 1TL3A 3T7ZA 4KTZA 4CF2A 4DS4A 5J2MA 3TAPA 4BE2A 2OPQA 1X1PA 3G10A 1HUXA 4BVOA 5H1SQ 3UE5A 4KHUA 4JI8K 4YOWA 3K57A 1LWCA 1VQPN 5BPLA 3DLRA 2QEXN 3PSFA 2G8FA 3DJCA 5TKYA 3L6QA 4NYNA 5DMRA 5CY4A 4BRAA 4FJ7A 4GNIA 3QFPA 3GE1A 4JHDB 2QWRA 5AZJA 4KHWA 4DB3A 1DLOA 5BRDA 3NHGA 1RBRA 4ISGA 3J80O 3SYZA 5FPMA 3RMAA 4E1MA 2P9SA 4WQ5C 3WQUA 3BEXA 3TANA 3RRHA 3HYFA 3PX0A 4E89A 4JKGB 1EO1A 1U4BA 4E19A 3NMUA 5HOOA 4M63C 2NRZA 5AQPA 4BRKA 3OYBA 1W0HA 1A5VA 3EYZA 2X74A 3WQTA 3AO5A 3BGRA 1YITN 3OBYA 4JRQA 4BY9C 4PWDA 2HVHA 1S5JA 3AGKA 4CZIA 3OS2A 5C25A 3LDSA 4C8MA 3EE9A 1WSFA 3G4SN 3CCLN 1DT9A 3DXMB 3AA3A 4BC2A 3AVFA 3BF1A 5I42A 1UA0A 5TKWA 4K41A 2HF3A 3VQ4A 1G99A 4DTMA 5LY3A 2I5JA 2E5LK 2E2OA 3TI0A 3FZFA 4ISFA 2ZM6K 1VQ5N 3T1YK 2KHOA 3CCQN 1Y97A 2P9UB 4FVUA 4F8RA 2E2PA 1E4GT 5AQQA 2EHGA 3AAPA 1RDCA 4CW7B 4B9NA 1C0TA 4O8KA 3UKUA 3CJ9A 2O8EB 1HMVA 3H45C 3DWLA 3CJCA 3LPUA 3OYEA 5CR4A 1SZ2A 4K8ZA 1HNVA 2VG6A 1NGGA 3PIPL 1D9DA 3M1FA 1BCOA 2FXUA 2DFFA 5F0XA 2ZGZA 3DM2A 3HI0A 1TGOA 1JL1A 1RT5A 4C8NA 1RBVA 3SPZA 4KHSA 4BACA 1RTIA 3QINA 1NJIO 1IG8A 4ELVA 3ATUA 1J5OA 3MN6A 5BPNA 4N41A 2KTQA 4CZJA 4CGHA 3TPQA 4CGIA 2QTDA 4AM7A 5BRHA 3OS1A 2Q36A 2VYPA 3RMDA 4EFHA 3HPOA 2V7YA 1X3MA 3P31A 1KVCA 2GUPA 4RG8A 5AZIB 5FPDA 2F9TA 4LF9K 2QK9A 3TAMA 1JCEA 4NLBA 5EOYA 4BRDA 3MWPA 1ASUA 2OPPA 2E20A 4O8UA 2F8SA 4Q0BA 2CGJA 3V6DA 1ATRA 1QS4A 1QHTA 3CM5A 2D0PA 4ZTFA 1WAFA 3AVMA 1KFSA 3E66A 3M5RA 4DTSA 4FJMA 4C23A 4IO8A 4YNQA 3RSEB 2W41A 3AVCA 2G8KA 1VSJA 1OVQA 2KFZA 2Q3SA 1KTQA 3SNNA 3I8DA 3ZSXA 3S41A 2KZZA 1MWKA 2NUBA 3SUNA 4IG0A 4AHVA 3VEVA 3OS0A 3PO4A 3P38A 4JI3K 3PSIA 1EETA 3H1VX 3LANA 1C0FA 1C1BA 4HVJA 1VQ7N 4OPJA 3ZSWA 1WAJA 3A0IX 1NNEA 5CE3A 4BR9A 1C1CA 2VG7A 4DR2K 1NK5A 2B6AA 1QSSA 2QWLA 1RDAA 1BU6O 3ASMA 4BRFA 1RBTA 2YX6A 4KB1A 1EKEA 2D0OA 1ATNA 1SKSA 4L3QA 4AH9A 4JS5A 2QA4N 4QAGA 1WLJA 3O4NA 3ZSZA 1D4XA 3KK1A 3SZ2A 4FPAA 4B9LA 3VN5A 1M90O 4LFBK 4BDZA 4C1NK 1CLQA 4OKKA 3AO2A 4CJRA 2FBVA 4YY3K 3VEXA 1JLCA 4R5PA 4B1VA 1YAGA 5C2DA 2YHAA 1BI4B 3O9RA 1GLFO 2X78A 1XC3A 5J2NA 3L2UA 3QNNA 4DR1K 2B4JA 4KAZA 4R79A 1S9EA 1NGHA 4DQIA 4CJ7A 3QEVA 5KRTA 3NF9A 1S1VA 1TKTA 1HPZA 4FVMA 2CGLA 3V1OA 1V4SA 4CD3A 2KFNA 4DR4K 4CZGA 3QEIA 2Y1IA 3PX6A 4BRLA 3LALA 3UKRA 4DV1K 1CZAN 3HSTB 4K42A 1ASWA 3DXKA 3KZBA 1W7AA 4DFJA 1SS6A 4N76A 1FKOA 4FZZA 1L3UA 4DSKA 2AJQA 1HKBA 3FE1A 1WUAA 3SQ2A 4BRCA 3MN9A 3SQ1A 1YIJN 4CHOA 1B92A 2P5OA 4HCCA 1KXPA 1XMOK 2IDOA 3O4QA 3CCEN 4W5NA 2OYQA 4DSIA 1UWBA 3KWGA 4RW8A 4IOAL 3NF6A 1HQUA 4I7FA 3ISNC 1VRUA 2W6KA 3LZJA 4CJVA 1UOCA 1GOBA 2IVNA 5M1PA 3S9HA 3UKRB 1LCUA 4OPAA 3VF2A 4FLTA 3CG7A 4L8RB 3EN9A 1R59O 3EZ5A 1BG3A 1N8RO 4CEBA 2UYTA 1VSHA 1SKRA 3MDQA 3ZT0A 4CEZA 4DTOA 4BC3A 1BHLA 2FF3B 3CIPA 3KKSA 1MWMA 2D1KA 3O6WA 4DTUA 3SQ0A 3PLAA 3N4QA 2RHKA 5JVGL 1W97L 3U4LA 4CFCA 1IKWA 3LP2A 1T7PA 5LJVA 3CJBA 2PYJA 3SMSA 4IOCL 2XO7A 1RDWX 5CYQA 1WSGA 5AQTA 4CI6A 4JD2A 5ADXA 1ASVA 1VSIA 1RBSA 2NRHA 1NJWA 3C6AA 4ZHRA 3SPYA 2O8BA 1HNXK 5BR9A 4OKEA 1C1AA 2FSNA 4DTNA 4O55A 5J1EA 4FLYA 4FJ8A 2RF2A 4CFDA 3HO1A 4B1ZA 3EEQA 5KGXA 4DV7K 3ZLJA 3HM8A 2E6MA 4LH5A 4M3WA 3HL8A 3LDOA 4DQRA 4I2QA 1LV5A 4KH4A 5BRFA 2A1SA 2WONA 3ID8A 1GLDG 1ZBSA 3RMBA 4MLHA 4J2BA 1TL1A 3V9ZA 1YTAA 2V52B 4AHCA 3THWB 4IG3A 3KK2A 4RTFD 3DOLA 4KHYA 3MXIA 5AQLA 5F2RA 2FSKA 3DRSA 4Z4HA 3EO3A 2BGGA 1ZBLA 2O8DB 4CJ3A 1K8KA 4RWTA 3SK3A 1YVNA 1JLQA 3LM9A 3H1QA 3JXUA 5FPEA 4FPBA 4CEDA 3AVGA 1GLEG 3RMCA 2YKMA 4FK2A 3CCSN 4YDUA 3D2EB 4OJRA 3F9MA 3RWUA 4U7BA 3ZT2A 4DFPA 4CJEA 3DLLL 4DWIA 3CC7N 3CMAN 4HTLA 2Q97A 4NCGA 4E1NA 2WTUA 3CERA 4KB0A 5M1OA 4A59A 4RW9A 3QBWA 4PL8A 3NVKA 1MU2A 5C24A 4X64K 2DFHA 2D4WA 1BL3A 4QOZB 3HPHA 2NRWA 3CFOA 4OKJA 3VF4A 3CCUN 3DLBA 4B3MK 2JWKA 1GLBG 1N6QA 2HF4A 3HT3A 4IXCA 1CXQA 4XH5A 1NWKA 4KFBA 1BI4A 2DPNA 1WN7A 4BWMA 3C7NB 2Z1IA 3DLEA 1HQEA 5JMVA 5MLCQ 1NOYA 2FBTA 3I56N 4HUFA 1TK0A 1TV6A 3MMVA 2OANA 1ZXOA 4CJQA 4AQYK 2IGIA 3MEDA 2W40A 4AHSA 3AVHA 2O4IA 2Z1GA 2UU9K 3MN7A 3LL3A 4YFUA 4F3OA 3BY5A 3L2VA 3QICA 1TVRA 4K43A 4EAHD 3O80A 3AO3A 4G1QA 3OW2M 1VK0A 5AQHA 3O8MA 4GW6A 3W0LA 3THYB 3E9PA 1EWQA 5KPTA 2OZMA 4M3UA 4LC9B 3LP1A 4CK1A 1HYSA 1JLAA 4H0OA 4FZXC 2P9NA 3B6OA 2D5RA 4OPKA 5AQFA 2HHVA 1NK0A 3CC2N 3B6PA 4BQLA 3WUHA 4LF5K 5CZ2A 4HTUA 1GLLO 5CYMA 3A8YA 5AQYA 1QVGM 4CERA 4DCHA 2ITMA 4WF9L 2VWKA 4WFAL 3WEEA 2P9KB 3QO9A 4BRGA 2P9SB 5ADXH 3O08A 4CIFA 1T03A 4FK0A 1OH6A 2HBKA 4H0TB 3AVIA 1Q81O 2BTFA 2ASMA 5E84A 5KGWA 1U04A 2ASOA 3WXKA 3TAGA 4KPYA 1GOCA 4CJTA 4A5BA 1YTUA 4H8KA 1ESVA 1SL2A 2AA4A 1FKPA 1J9AA 1VQLN 1TKXA 1JLGA 5BN8A 3M8RA 2DFEA 4QS9A 4LFAK 4CEEA 4CZLA 3O5BA 3D2FB 4CZEA 1J6ZA 1QQNA 2HMPA 4DUZK 1KLMA 1BUPA 3IDHA 1EWRA 4F9OA 1X9SA 4IEIA 1QQCA 4IDHA 3CCMN 4AHRA 3HBTA 3Q7BA 3VQPA 3RR7A 3HOTA 4JK8A 4ISEA 1ZBFA 4CF0A 3DAWA 2FSJA 5AJ3K 1A5WA 2RN2A 3KD1E 1VQ8N 2UXBK 4IFEA 2A40A 3KD5E 1NK9A 4FWRA 4DTJA 2JGUA 4CEQA 3NVMA 1SL1A 5DK5A 4JKHA 3FZKA 3OYGA 2D0BA 1YJNN 1GLAG 4J2AA 1ZC6A 4CIGA 4E1JA 3SAGA 1F21A 1N36K 3U8XA 3F2KA 3IG1A 3N4PA 4K25A 4FLVA 2XRIA 1ZYQA 4QS8A 2P9LB 4AF1A 3BDPA 3SMPA 4XH1A 3ZYYX 3CJAA 3MXMA 1BIUA 3CETA 3P39A 5IT9O 4LY7A 4JI4K 3TWHA 4BG9A 2GWJA 5HRNA 4A2AA 2O8EA 2P51A 3A5NC 2HBMA 4IO9L 3BF3A 1C6VA 4FWSA 2Q2RA 3F5TA 3CHWA 3TR8A 1IKVA 4BVPA 2YV0X 2UXCK 4W5RA 3LP3A 3VETA 4DQ8A 4FLXA 4AHUA 1MDUB 1A5XA 1RFQA 2RE2A 5C2FA 2Y1JA 1RGIA 1HYZA 1TAUA 3CYMA 4MO5A 1I3AA 3OHRA 5HRSA 3AVNA 1HKGA 4LSLA 3J7YP 4IWVA 3MXJA 1VSFA 3DOKA 4X66K 4Z4GA 4C8KA 4JKCA 5LJWA 3FGUA 1XUPO 2W42A 5AQKA 4KKOA 3OYKA 4CHQA 2NRTA 4NCAA 1ZBHA 4K8XA 5FLXO 2ASPA 2A5XA 1S3XA 4RCHA 3ZCMA 1FJGK 4OLAA 2GUIA 1RT1A 3QMLA 4JEPA 2O4GA 4WE1A 4JHDA 2XY7A 1OVYA 4YOVA 2G8VA 2HHXA 3PV8A 1NGAA 2IOCA 4WYBA 5SZTA 2QW9A 4FSVA 4FJ9A 4UY8O 3MX2A 4CHPA 2UUCK 4A2BA 4E7IA 4JI2K 4BR5A 1D5AA 4JRPA 1B9DA 5J2QA 2F8TA 1U47A 1XNRK 1IG9A 2P9PA 1XHZA 3H3NO 3C65A 2NRVA 1N33K 4BE0A 4FM0A 1BGXT 3I33A 5FRMA 3L0QA 1KSPA 2YNFA 1UAXA 3R1XA 4CK2A 4O5FA 2YNIA 2QM1A 4GKJK 1HNZK 3THXA 3KJVA 1FK9A 1BCMA 4DR3K 2QKBA 1TUYA 1GLJO 4JAXA 4B3TK 1X9WA 3KK7A 1EX4A 1VQKN 4DMNA 3MWTA 5SWMA 5AQNA 3IUCA 4Z4FA 5HRPA 3NGYA 1HLUA 2ETJA 3J81O 4CD1A 3HP9A 1SQKA 2ATQA 2QKKA 3LPTA 2DY4A 1TYQA 2AP1A 4DR5K 1GOAA 3ATVA 3NBPA 2VQFK 4BRHA 1REVA 3AO1A 3CCRN 3V81A 5CHIA 4N5SA 3J7ZO 3L2WA 3CFPA 2ZE2A 1NLVA 1VSEA 4O0IA 3H46O 4HHTA 4E7LA 3A5OC 4XEIA 4JKBA 2E6LA 4ID1A 1KAZA 3QERA 1KCFA 2VWBA 2V7ZA 5J2PA 1NJZA 1XMQK 1S6PA 1VSLA 3FFKB 5HL7L 3T1HK 3VQEA 3THVA 3CI5A 1ITGA 3SAFA 4FCYA 1QQMA 4WQ5A 4M3YA 3KLGA 1LOTB 3SUOA 1XNQK 2E1ZA 4JD2B 1JCFA 5JS1A 4DV6K 4H5VA 4CK3A 3O9QA 3QEPA 4M3ZA 1ATSA 2YHYA 1BWFO 2E2NA 2KLAA 3CQXA 3J8AA 3SBGA 4NB4A 4DSEA 5BPMA 1OH8A 4K0KK 1M1KO 3KLIA 1NKEA 3OYJA 4H0YB 4NXNK 4CFAA 1JKHA 1SAZA 3OBWA 2WFBA 3L2QA 1IBLK 3MEEA 3AVJA 4W5TA 1Z05A 4KBOA 2OPSA 2IVOA 4KH5A 3NH0A 4LF4K 2KQ2A 3GL1A 3I8BA 1DEJA 2F7TA 4FM2A 4OX9K 4JKFA 4PKIA 1MA9B 1LW0A 1VSDA 5AQSA 4PKGA 2P9KA 4QS7A 3MCAB 2IVPA 4ICLA 5I9EB 3O1BA 4F2RA 5B8HA 3VEZA 1W2BM 1XC9A 2KKZA 3AVAA 5AQZA 4QCLA 4FO0A 3RR8A 1HX1A 5BN9A 4AHTA 3A5MC 4O44A 4DU4A 1O1WA 4A61A 1NMNA 2JWLA 1KD1O 4H5RA 4DSLA 1FXXA 3K5MA 2WOMA 3D6RA 1XHXA 2A6AA 4CBUA 4YOXA 1IBKK 4IFYA 5ELZA 3CJ7A 1HNWK 2BDPA 1VQON 3TABA 4C1NI 1YUWA 2ITGA 1VHXA 2W6LA 5AFUH 3OTOK 1X9MA 2HHTA 4U67L 3OYNA 1Q9YA 2VWJA 3EKUA 5DM6L 4IBNA 3ZX2A 1T05A 3C7NA 2G8UA 4DSFA 3G0ZA 4DF4A 3IRXA 3HPGA 1S72N 4FZYA 2OZSA 3CPWM 2HB5A 4LFCK 4MDBA 4M3RA 3CXCM 5T7BA 3IAYA 1QQOA 3O3FA 5JVHL 3SUQA 1NGDA 3AA2A 4BRNA 4CF1A 4M7XA 1BDGA 4BR2A 4CE9A 3V4IA 4FJKA 4CJUA 3C94A 4X65K 1WSIA 4HUGA 1U45A 4M41A 3CCJN 3C6HA 4ILHA 4CJKA 5M1KA 4GVEA 2VGMA 4H4OA 3VA0A 4DTXA 1YHQN 3C6TA 5GAHP 1CXUA 1S1TA 4ELTA 2H3GX 4CIEA 1N34K 2V51B 2P9PB 3MK6A 1DGKN 4BRMA 1HNIA 1RDDA 2P9IB 5GINA 4JK7A 4MQ3A 4FJHA 2OPRA 1YVUA 1RCHA 3BZCA 1QE1A 4BREA 2P5GA 4HWIA 3HP6A 3KWIA 5A2QO 3WXIA 2HHHK 4FJNA 3OY9A 3UB5A 3KHYA 2B5JA 3D2EA 1C0UA 1NKBA 4DR7K 4JKDA 4KREA 4IKFA 3U3GA 4OO1J 2YNHA 3FZHA 1YT3A 2A1RA 2F9WA 4YOYA 4UQGA 5C0YA 3ZETA 2O8FB 3O9TA 4IJNA 3SUPA 3WXLA 1K9MO 4H0VB 3NFAA 3OYCA 2VCPA 4FWKA 3VGKA 1NGCA 2O8CB 5F1XA 4B3OA 3LDNA 3LM2A 5C12A 3RVCA 2HMIA 1Z26A 4GMJB 5JS2A 2FBXA 4YOTA 4B1YB 1KVAA 4DQQA 5KQ8A 3O4WA 4BRQA 4EHUA 2E2QA 2PFUA 3AO4A 3QETA 1W9HA 3GDQA 3MECA 5AR0A 4A62A 2WC9A 4CJFA 2HHQA 2YI1A 3VQBA 1EQYA 4FWNA 5GIPA 3FZLA 2UUBK 4XH4A 1NK7A 4H5WA 4H4MA 4WFBL 1QSYA 1Q8IA 3W3DA 3TAFA 2OA8A 4W5QA 1RT7A 3VQ6A 1L3TA 3VENA 3OYMA 3FR0A 3PUFA 1JXEA 5KPRA 2YJFA 1K73O 3TTCA 4B9UA 3CQ8A 2GTDA 4FOEA 1HPMA 3SBTA 1JCGA 4B1XB 3VEOA 2HW3A 3R6MA 4M7YA 1J53A 2P9UA 5AQUA 3VQ5A 3NH2A 5E26A 4CEAA 2A3ZA 3SCXA 5BR8K 2F4VK 3I55N 4DLEA 2CGKA 5GAEP 2P9LA 3IFRA 1X3NA 3AV9A 4FJXA 1WSHA 3LAMA 3WNFA 3T69A 2VG5A 4MDAA 4TSXA 4JK9A 4KRFA 1NGJA 3EL2A 3ZETB 4C8LA 2GELA 3V9XA 2KW4A 1NMDA 3VQ8A 4FL9A 5AQJA 3QB0A 4DR6K 2VQEK 3HSCA 1KQSM 1NBWA 3QIOA 4CBWA 3NF8A 5KRSA 5IWAK 5GIOA 2O8CA 1NK4A 4V19S 3HVRA 4B8CA 4JNEA 2HOEA 2O8DA 4YHHK 3ID6A 3I0SA 1QZ6A 5EXWA 4LF8K 4B9VA 2E1YA 3OJSA 4Z4CA 3D0PA 3JYTA 3THXB 2A42A 2IC3A 1NM1A 3SAHA 3M6GA 5JLFA 4DF8A 4Y0WA 4CHNA 3VA3A 4ILJA 1LWFA 1NJYA 3PO5A 1YXQA 5M1QA 2ZQBA 3BZKA 3RTVA 4E0DA 3ZT4A 5EU7A 4EP5A 3LWLA 2QWQA 4Y1CA 1SUQA 2XY6A 3L4QA 4JI1K 1BOTO 4Y1DA 2O8FA 3NGIA 4PQUA 2EX3A 1RT2A 1RBUA 1ZBUA 3DMJA 1NGEA 3VEYA 3ULEB 4CEFA 2CH5A 4Q5VA 4DU3A 4CBXA 1WSEA 4CJPA 4PKHA 4O5BA 3QIPA 4FJLA 1WSJA 1S22A 3VPZA 3HJFA 4KHNA 5AQRA 4X62K 1U6ZA 3NCIA 2YCHA 3SV3A 3ZSOA 3BUZB 5LMUK 3C0BA 3GOIA 1YF5L 3P4IA 1L5UA 4GVMA 4E7JA 4FWQA 4FJ5A 3R9PA 3JAMO 5M1NA 2HVIA 3MN5A 3VF6A 3S3NA 3H6EA 4BG8A 4GKKK 2P9NB 3QESA 1BQMA 2E4LA 3VQ9A 2HSTA 1HYVA 1WB9A 2QXLA 1FW6A 4EZ9A 3ITHA 2O8BB 4BR7A 4IFVA 3K9JA 3SLCA 1RT6A 1V4TA 3O9SA 3CMEN 4LF7K 5KQDA 1S1XA 3CQYA 4IEEA 3OYHA 3CJ1A 1VRTA 3ALYA 1SL0A 3NF7A 1P8ZA 3L3VA 1U49A 3LAKA 1H1VA 1WNSA 2CH6A 3T3FA 1XI1A 2FF6A 3VMFB 4BRIA 3NAEA 1CZ9A 4DQPA 1RDBA 3MEGA 3NGZA 2PAVA 3OYDA 2IIRA 2PBDA 3M8PA 3T1AA 3U9ZA 3G6EN 1BA1A 2WUSA 4CJ4A 1VQ9N 3HXMA 4JKAA 4EIAA 2E8AA 3WNEA 4AILC 1NGIA 3D2FA 3SV4A 3RRGA 3CF5L 3QEXA 4OLBA 1LWEA 2JLEA 5LL6Z 4HCBA 2YNGA 3DXKB 2GEMA 3OYIA 3DRRA 3DYAA 4CECA 3PIOL 4YOUA 3KTQA 2NNWA 1UA1A 2A41A 3O3GA 4I6MB 3QDKA 4FLUA 4W5OA 1DKGD 1P90A 3I0RA 1Q86O 3L3UA 4B9QA 3L4IA 4BC4A 3VGMA 4CESA 1CZBA 1RDUA 3WNHA 1IJJA 3OVNA 5FDLA 3LZIA 4DV5K 1OH5A 1RTHA 1G15A 3CCVN 3KVGA 5AQMA 3WT0A 3ZT3A 1S6QA 2GWKA 2HHUA 4H03B 3NH1A 4CJWA 2Q1NA 3AVBA 1NOZA 3NE6A 1HJOA 3K58A 2X6NA 4CF8A 1BQNA 1C0MA 3B8AX 4JLHA 4J2EA 4DU1A 4B9TA 5JICA 2GBZA 5BREA 1XWLA 1HRHA 4M3TA 1DTQA 1GLCG 4FXDA 4OGCA 1Q82O 3M3ZA 1VQNN 1T44A 2QI2A 3K59A 4LF6K 3S3MA 1EXQA 4B8AB 1QVFM 4OPHA 2RKIA 3ULDA 2NRXA 5EVZA 1N32K 4IZ9A 1B9FA 2QWMA 4B08A 1J5EK 4O4GA 3C6UA 3FZMA 1D8YA 3KK3A 3JS6A 1K6YA 3UKUB 3DXMA 2PYLA 3UIQA 3WXJA 1KVBA 4WCEL 3AA5X 3G25A 3TAQA 3AARA 3M8SA 4JV5K 3AVLA 4CJLA 1SKWA 4ELUA 2D0AA 1LW2A 1TAQA 4KH6A 4JS4A 4ID5A 3SQ4A 1T3VA 1IKXA 4CFBA 2G8IA 4CZFA 4FLZA 2FLOA 4FWPA 5M1FA 2ZWHA 4FWMA 2HBJA 2PZSA 4KO0A 4M3XA 3BP8A 3MCPA 4JI0K 1RNHA 3ZT1A 4DKWA 4NLCA 4BR0A 3U9DA 2HNDA 1YJWN 4PUOA 1BISA 3DLKA 3ZX0A 1C0GA 4FJJA 1T6CA 3ZEUA 2WBNA 3G71N 4DG1A 4AM6A 1NU0A 3P5JA 3D45A 4DQSA 4CGFA 4JI7K 1NG9A 1OKJA 1QHAA 2IS3A 5C15A 3VEWA 4DV3K 2GX9A 3E9LA 5AQOA 3ZSQA 1JXBA 3Q7CA 4GY2B 2P1JA 5GAGP 3V9WA 3J7AP 1KFDA 4JI6K 1O13A 4EZ6A 1VSMA 4IJAA 4B1WB 3VQDA 3TTFA 3LWMA 3TU5A 2FC0A 4LSNA 4JYAK 4FW2A 1T6DA 4I6MA 5AFUA 4J2DA 4KHPK 4KTWA 4CZHA 2OCEA 1SV5A 4FOIA 3AGRA 1IO2A 2D0CA 4PHTX 3F73A 3K9KA 3IMXA 4FK4A 5KPZA 3EY1A 4XIUA
chains in the Genus database with same CATH topology
5A2QO 1XMOK 1N32K 2HHHK 1J5EK 4LF5K 4DR7K 4LF7K 4DR2K 4DR6K 2VQEK 5IT9O 4JI4K 3J81O 5IWAK 4V19S 4DR5K 4YHHK 5LMNK 1HR0K 4JI8K 4LF8K 2VQFK 2UXCK 4JV5K 4LFBK 4B3SK 1IBKK 4YY3K 1HNWK 2UUAK 5LL6Z 3OTOK 4X64K 1I94K 3J7YP 4JI5K 4X66K 4JI0K 4B3MK 4LFAK 1XMQK 4DUYK 3J80O 5FLXO 4DR1K 4JI1K 3T1HK 4DUZK 1FJGK 2UUBK 4NXMK 4LFCK 1XNQK 4JI7K 1HNXK 4DV5K 4DV6K 4LF9K 4X62K 2UXDK 2UUCK 4DV3K 1IBMK 4JI2K 4DV0K 5LMUK 5AJ3K 3J7AP 4DV7K 4X65K 4DV4K 4DR4K 4K0KK 4JI6K 1XNRK 2UXBK 4AQYK 4NXNK 3JAMO 4DV1K 1IBLK 1N33K 2UU9K 4JYAK 4GKKK 1N34K 4KHPK 4LF4K 4CVNE 2E5LK 5BR8K 2F4VK 4LF6K 2ZM6K 4B3RK 4GKJK 1HNZK 3T1YK 4OX9K 1N36K 4DR3K 4DV2K 4B3TK 4JI3K 4CW7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q O;  1XMO K;  1N32 K;  2HHH K;  1J5E K;  4LF5 K;  4DR7 K;  4LF7 K;  4DR2 K;  4DR6 K;  2VQE K;  5IT9 O;  4JI4 K;  3J81 O;  5IWA K;  4V19 S;  4DR5 K;  4YHH K;  5LMN K;  1HR0 K;  4JI8 K;  4LF8 K;  2VQF K;  2UXC K;  4JV5 K;  4LFB K;  4B3S K;  1IBK K;  4YY3 K;  1HNW K;  2UUA K;  5LL6 Z;  3OTO K;  4X64 K;  1I94 K;  3J7Y P;  4JI5 K;  4X66 K;  4JI0 K;  4B3M K;  4LFA K;  1XMQ K;  4DUY K;  3J80 O;  5FLX O;  4DR1 K;  4JI1 K;  3T1H K;  4DUZ K;  1FJG K;  2UUB K;  4NXM K;  4LFC K;  1XNQ K;  4JI7 K;  1HNX K;  4DV5 K;  4DV6 K;  4LF9 K;  4X62 K;  2UXD K;  2UUC K;  4DV3 K;  1IBM K;  4JI2 K;  4DV0 K;  5LMU K;  5AJ3 K;  3J7A P;  4DV7 K;  4X65 K;  4DV4 K;  4DR4 K;  4K0K K;  4JI6 K;  1XNR K;  2UXB K;  4AQY K;  4NXN K;  3JAM O;  4DV1 K;  1IBL K;  1N33 K;  2UU9 K;  4JYA K;  4GKK K;  1N34 K;  4KHP K;  4LF4 K;  4CVN E;  2E5L K;  5BR8 K;  2F4V K;  4LF6 K;  2ZM6 K;  4B3R K;  4GKJ K;  1HNZ K;  3T1Y K;  4OX9 K;  1N36 K;  4DR3 K;  4DV2 K;  4B3T K;  4JI3 K;  4CW7 B; 
#chains in the Genus database with same CATH topology
 4CJS A;  2HHW A;  4J8F A;  4BWJ A;  1IV0 A;  4ZTJ A;  3SJJ A;  1IH7 A;  3HOS A;  1U2V A;  4IOX A;  2RPI A;  5CZ1 A;  4BR4 A;  5C10 A;  5HP1 A;  3TAR A;  3E1Y A;  4DFM A;  5HRO A;  1HJR A;  4YDU C;  1KAY A;  1LAV A;  4WFN L;  3QLH A;  5GAD P;  3OYL A;  5KTQ A;  1QSL A;  4OGE A;  3HVT A;  3H08 A;  2QWO A;  5LMN K;  1RT3 A;  4WQ4 A;  5HRR A;  3PX4 A;  3KKR A;  1BA0 A;  3V9U A;  4H0P A;  2KZM A;  4IDK A;  3K5L A;  4M45 A;  4H0X B;  2F96 A;  1JL2 A;  2YJE A;  4A5A A;  2X6S A;  4BRP A;  3L8B A;  3O9U A;  5KI6 A;  5C42 A;  3DI6 A;  3FLC O;  2ZGY A;  3K5O A;  4DLG A;  5AQX A;  4JI5 K;  3CM6 A;  4FYD A;  4CHZ A;  4CF9 A;  1RIL A;  3OYA A;  1K8A O;  1Z6R A;  1RTJ A;  2Q31 A;  2DTU A;  2I7P A;  3A5L C;  3WNG A;  4EHT A;  2OTJ N;  5AQI A;  4DFK A;  4PL7 A;  4JN4 A;  3TSU A;  4HUE A;  1WOQ A;  2HBL A;  3CFR A;  4H5T A;  4BGB A;  3VGL A;  3VQQ A;  2YHB A;  1TKD A;  4E3S A;  3T19 A;  4DTP A;  5AQW A;  4OVL A;  3OA9 A;  4BDP A;  2QWP A;  1U2V B;  3VQA A;  3SI6 A;  1X9J A;  4MFB A;  1S1W A;  4FLW A;  4CZK A;  2NZT A;  5AQG A;  4DV4 K;  1JLB A;  1NK8 A;  3QNO A;  1S1U A;  3P83 D;  4CHY A;  4RW6 A;  5JLH A;  1T8E A;  1YI2 N;  4Z94 A;  5AZJ B;  4FWL A;  3SJH A;  3MX5 A;  3PY8 A;  3AA4 A;  1NKC A;  4CVN E;  1TK8 A;  5HBM A;  1U48 A;  1L3V A;  5FRO A;  2VGN A;  4E7K A;  3CD6 N;  4B3R K;  4DSJ A;  4JKG A;  3VTI A;  4CEO A;  1YJ9 N;  3ZSR A;  5HLF A;  3WEE B;  2I7N A;  1RT4 A;  2ZJQ L;  4CZM A;  1JJ2 M;  4FJG A;  3E01 A;  3KLH A;  1NK6 A;  2ZJR L;  4CGJ A;  3E9O A;  1KLN A;  1EP4 A;  2G8H A;  4O0J A;  4B9M A;  3H3O B;  3KLE A;  3DLG A;  2BAN A;  4PA1 A;  3NDK A;  1HR0 K;  1TKZ A;  3GBT A;  3F9K A;  5FRN A;  1QTM A;  3ZX3 A;  4BDY A;  1LAW A;  5E41 A;  3HTV A;  4NYF A;  1RTD A;  1KRP A;  3ZSV A;  1VAZ A;  1TK5 A;  1Z25 A;  2YHW A;  5DM7 L;  4Z4I A;  3R3L A;  2BE2 A;  3S3O A;  1QZ5 A;  3QBX A;  3HRG A;  2UUA K;  5D3G A;  3VTH A;  3ZEU B;  1I94 K;  2NLX A;  2ZF5 O;  4FM1 A;  3JSM A;  4LD0 A;  1L3S A;  4Z0U A;  3HM9 A;  1R0A A;  4MLE A;  4BGA A;  1KC8 O;  1D9F A;  3TSQ A;  4DUY K;  2FBY A;  1XQS C;  4DTR A;  4N56 A;  2QXF A;  2XHB A;  4I9L A;  1OH7 A;  1DTT A;  4FJI A;  2GV9 A;  2E88 A;  3WXM B;  2UXD K;  5FPN A;  2Q0R A;  1IBM K;  3LDL A;  3QFU A;  4DV0 K;  3OYF A;  3ENH A;  3HZ6 A;  2Q0U A;  2R7Y A;  2Z1J A;  3A2F A;  2IAJ A;  4BQZ A;  1N5Y A;  2QWN A;  3R8E A;  3THY A;  1E4F T;  4DHY A;  1TUU A;  1J54 A;  3O3H A;  3O1W A;  2PY5 A;  3V1Q A;  3LDP A;  4A57 A;  4RW4 A;  4NCB A;  3V9S A;  1WBD A;  5EX5 A;  2BH1 A;  1Y64 A;  4GV6 A;  1Q7Y O;  3KIO A;  1VQ4 N;  1I39 A;  4DV2 K;  4I2P A;  3HK2 A;  1Q18 A;  3LP0 A;  4CGG A;  4BC5 A;  3VQC A;  4GV3 A;  3ENO A;  3V1R A;  4G9Z A;  3AAQ A;  1WBB A;  4H5N A;  3TAE A;  1NGB A;  4BE1 A;  4MO4 A;  1S9G A;  4PY5 A;  3K0S A;  4KI6 A;  3ULE A;  1K8K B;  3VQ7 A;  4Z4E A;  3K2P A;  5AZI A;  3MAQ A;  2HHS A;  1JLF A;  2NRR A;  1KAX A;  5I3U A;  2P9I A;  1E3M A;  2ZJP L;  4E7H A;  3EZW A;  3VOV A;  3DLH A;  4F3T A;  4B3S K;  3THW A;  4RW7 A;  4YOR A;  4CCH A;  5EY4 A;  2J4R A;  4EP4 A;  3ZSY A;  1NJX A;  4FWO A;  4WQ4 C;  4F2S A;  3IS9 A;  3RSE A;  3KLF A;  2YKN A;  2HNZ A;  2OTL N;  4CGD A;  1ZBI A;  3OJU A;  4NO7 A;  4KI4 A;  4N47 A;  4FW1 A;  3P1G A;  2YHX A;  4JKE A;  4M42 A;  1NGF A;  4NXM K;  3EKS A;  3M8Q A;  4ILG B;  3CPE A;  3TTD A;  1BIZ A;  3VES A;  3QEW A;  3DRP A;  4B1U B;  4C8O A;  2XY5 A;  2XY8 A;  1VQM N;  4KTQ A;  1BO5 O;  3GG4 A;  3K5N A;  3IKM A;  3U6F A;  2BUP A;  2Z1H A;  3AY9 A;  4LH4 A;  3ENB A;  3AVK A;  5AQV A;  2G8W A;  4KHQ A;  4CJ5 A;  3TSP A;  1Q9X A;  2LSN A;  3LDQ A;  4GV9 A;  1VSK A;  4BRO A;  1IKY A;  2ZD1 A;  3FFI A;  3CC4 N;  4I9Q A;  4B9S A;  3U3Y A;  4KV8 A;  5K14 A;  4F4K A;  1TYQ B;  4DS5 A;  1ILY A;  3VER A;  3EE8 A;  3D7E O;  1HKC A;  2EWS A;  3L2R A;  3C95 A;  1JLE A;  1VQ6 N;  2HNY A;  1TL3 A;  3T7Z A;  4KTZ A;  4CF2 A;  4DS4 A;  5J2M A;  3TAP A;  4BE2 A;  2OPQ A;  1X1P A;  3G10 A;  1HUX A;  4BVO A;  5H1S Q;  3UE5 A;  4KHU A;  4JI8 K;  4YOW A;  3K57 A;  1LWC A;  1VQP N;  5BPL A;  3DLR A;  2QEX N;  3PSF A;  2G8F A;  3DJC A;  5TKY A;  3L6Q A;  4NYN A;  5DMR A;  5CY4 A;  4BRA A;  4FJ7 A;  4GNI A;  3QFP A;  3GE1 A;  4JHD B;  2QWR A;  5AZJ A;  4KHW A;  4DB3 A;  1DLO A;  5BRD A;  3NHG A;  1RBR A;  4ISG A;  3J80 O;  3SYZ A;  5FPM A;  3RMA A;  4E1M A;  2P9S A;  4WQ5 C;  3WQU A;  3BEX A;  3TAN A;  3RRH A;  3HYF A;  3PX0 A;  4E89 A;  4JKG B;  1EO1 A;  1U4B A;  4E19 A;  3NMU A;  5HOO A;  4M63 C;  2NRZ A;  5AQP A;  4BRK A;  3OYB A;  1W0H A;  1A5V A;  3EYZ A;  2X74 A;  3WQT A;  3AO5 A;  3BGR A;  1YIT N;  3OBY A;  4JRQ A;  4BY9 C;  4PWD A;  2HVH A;  1S5J A;  3AGK A;  4CZI A;  3OS2 A;  5C25 A;  3LDS A;  4C8M A;  3EE9 A;  1WSF A;  3G4S N;  3CCL N;  1DT9 A;  3DXM B;  3AA3 A;  4BC2 A;  3AVF A;  3BF1 A;  5I42 A;  1UA0 A;  5TKW A;  4K41 A;  2HF3 A;  3VQ4 A;  1G99 A;  4DTM A;  5LY3 A;  2I5J A;  2E5L K;  2E2O A;  3TI0 A;  3FZF A;  4ISF A;  2ZM6 K;  1VQ5 N;  3T1Y K;  2KHO A;  3CCQ N;  1Y97 A;  2P9U B;  4FVU A;  4F8R A;  2E2P A;  1E4G T;  5AQQ A;  2EHG A;  3AAP A;  1RDC A;  4CW7 B;  4B9N A;  1C0T A;  4O8K A;  3UKU A;  3CJ9 A;  2O8E B;  1HMV A;  3H45 C;  3DWL A;  3CJC A;  3LPU A;  3OYE A;  5CR4 A;  1SZ2 A;  4K8Z A;  1HNV A;  2VG6 A;  1NGG A;  3PIP L;  1D9D A;  3M1F A;  1BCO A;  2FXU A;  2DFF A;  5F0X A;  2ZGZ A;  3DM2 A;  3HI0 A;  1TGO A;  1JL1 A;  1RT5 A;  4C8N A;  1RBV A;  3SPZ A;  4KHS A;  4BAC A;  1RTI A;  3QIN A;  1NJI O;  1IG8 A;  4ELV A;  3ATU A;  1J5O A;  3MN6 A;  5BPN A;  4N41 A;  2KTQ A;  4CZJ A;  4CGH A;  3TPQ A;  4CGI A;  2QTD A;  4AM7 A;  5BRH A;  3OS1 A;  2Q36 A;  2VYP A;  3RMD A;  4EFH A;  3HPO A;  2V7Y A;  1X3M A;  3P31 A;  1KVC A;  2GUP A;  4RG8 A;  5AZI B;  5FPD A;  2F9T A;  4LF9 K;  2QK9 A;  3TAM A;  1JCE A;  4NLB A;  5EOY A;  4BRD A;  3MWP A;  1ASU A;  2OPP A;  2E20 A;  4O8U A;  2F8S A;  4Q0B A;  2CGJ A;  3V6D A;  1ATR A;  1QS4 A;  1QHT A;  3CM5 A;  2D0P A;  4ZTF A;  1WAF A;  3AVM A;  1KFS A;  3E66 A;  3M5R A;  4DTS A;  4FJM A;  4C23 A;  4IO8 A;  4YNQ A;  3RSE B;  2W41 A;  3AVC A;  2G8K A;  1VSJ A;  1OVQ A;  2KFZ A;  2Q3S A;  1KTQ A;  3SNN A;  3I8D A;  3ZSX A;  3S41 A;  2KZZ A;  1MWK A;  2NUB A;  3SUN A;  4IG0 A;  4AHV A;  3VEV A;  3OS0 A;  3PO4 A;  3P38 A;  4JI3 K;  3PSI A;  1EET A;  3H1V X;  3LAN A;  1C0F A;  1C1B A;  4HVJ A;  1VQ7 N;  4OPJ A;  3ZSW A;  1WAJ A;  3A0I X;  1NNE A;  5CE3 A;  4BR9 A;  1C1C A;  2VG7 A;  4DR2 K;  1NK5 A;  2B6A A;  1QSS A;  2QWL A;  1RDA A;  1BU6 O;  3ASM A;  4BRF A;  1RBT A;  2YX6 A;  4KB1 A;  1EKE A;  2D0O A;  1ATN A;  1SKS A;  4L3Q A;  4AH9 A;  4JS5 A;  2QA4 N;  4QAG A;  1WLJ A;  3O4N A;  3ZSZ A;  1D4X A;  3KK1 A;  3SZ2 A;  4FPA A;  4B9L A;  3VN5 A;  1M90 O;  4LFB K;  4BDZ A;  4C1N K;  1CLQ A;  4OKK A;  3AO2 A;  4CJR A;  2FBV A;  4YY3 K;  3VEX A;  1JLC A;  4R5P A;  4B1V A;  1YAG A;  5C2D A;  2YHA A;  1BI4 B;  3O9R A;  1GLF O;  2X78 A;  1XC3 A;  5J2N A;  3L2U A;  3QNN A;  4DR1 K;  2B4J A;  4KAZ A;  4R79 A;  1S9E A;  1NGH A;  4DQI A;  4CJ7 A;  3QEV A;  5KRT A;  3NF9 A;  1S1V A;  1TKT A;  1HPZ A;  4FVM A;  2CGL A;  3V1O A;  1V4S A;  4CD3 A;  2KFN A;  4DR4 K;  4CZG A;  3QEI A;  2Y1I A;  3PX6 A;  4BRL A;  3LAL A;  3UKR A;  4DV1 K;  1CZA N;  3HST B;  4K42 A;  1ASW A;  3DXK A;  3KZB A;  1W7A A;  4DFJ A;  1SS6 A;  4N76 A;  1FKO A;  4FZZ A;  1L3U A;  4DSK A;  2AJQ A;  1HKB A;  3FE1 A;  1WUA A;  3SQ2 A;  4BRC A;  3MN9 A;  3SQ1 A;  1YIJ N;  4CHO A;  1B92 A;  2P5O A;  4HCC A;  1KXP A;  1XMO K;  2IDO A;  3O4Q A;  3CCE N;  4W5N A;  2OYQ A;  4DSI A;  1UWB A;  3KWG A;  4RW8 A;  4IOA L;  3NF6 A;  1HQU A;  4I7F A;  3ISN C;  1VRU A;  2W6K A;  3LZJ A;  4CJV A;  1UOC A;  1GOB A;  2IVN A;  5M1P A;  3S9H A;  3UKR B;  1LCU A;  4OPA A;  3VF2 A;  4FLT A;  3CG7 A;  4L8R B;  3EN9 A;  1R59 O;  3EZ5 A;  1BG3 A;  1N8R O;  4CEB A;  2UYT A;  1VSH A;  1SKR A;  3MDQ A;  3ZT0 A;  4CEZ A;  4DTO A;  4BC3 A;  1BHL A;  2FF3 B;  3CIP A;  3KKS A;  1MWM A;  2D1K A;  3O6W A;  4DTU A;  3SQ0 A;  3PLA A;  3N4Q A;  2RHK A;  5JVG L;  1W97 L;  3U4L A;  4CFC A;  1IKW A;  3LP2 A;  1T7P A;  5LJV A;  3CJB A;  2PYJ A;  3SMS A;  4IOC L;  2XO7 A;  1RDW X;  5CYQ A;  1WSG A;  5AQT A;  4CI6 A;  4JD2 A;  5ADX A;  1ASV A;  1VSI A;  1RBS A;  2NRH A;  1NJW A;  3C6A A;  4ZHR A;  3SPY A;  2O8B A;  1HNX K;  5BR9 A;  4OKE A;  1C1A A;  2FSN A;  4DTN A;  4O55 A;  5J1E A;  4FLY A;  4FJ8 A;  2RF2 A;  4CFD A;  3HO1 A;  4B1Z A;  3EEQ A;  5KGX A;  4DV7 K;  3ZLJ A;  3HM8 A;  2E6M A;  4LH5 A;  4M3W A;  3HL8 A;  3LDO A;  4DQR A;  4I2Q A;  1LV5 A;  4KH4 A;  5BRF A;  2A1S A;  2WON A;  3ID8 A;  1GLD G;  1ZBS A;  3RMB A;  4MLH A;  4J2B A;  1TL1 A;  3V9Z A;  1YTA A;  2V52 B;  4AHC A;  3THW B;  4IG3 A;  3KK2 A;  4RTF D;  3DOL A;  4KHY A;  3MXI A;  5AQL A;  5F2R A;  2FSK A;  3DRS A;  4Z4H A;  3EO3 A;  2BGG A;  1ZBL A;  2O8D B;  4CJ3 A;  1K8K A;  4RWT A;  3SK3 A;  1YVN A;  1JLQ A;  3LM9 A;  3H1Q A;  3JXU A;  5FPE A;  4FPB A;  4CED A;  3AVG A;  1GLE G;  3RMC A;  2YKM A;  4FK2 A;  3CCS N;  4YDU A;  3D2E B;  4OJR A;  3F9M A;  3RWU A;  4U7B A;  3ZT2 A;  4DFP A;  4CJE A;  3DLL L;  4DWI A;  3CC7 N;  3CMA N;  4HTL A;  2Q97 A;  4NCG A;  4E1N A;  2WTU A;  3CER A;  4KB0 A;  5M1O A;  4A59 A;  4RW9 A;  3QBW A;  4PL8 A;  3NVK A;  1MU2 A;  5C24 A;  4X64 K;  2DFH A;  2D4W A;  1BL3 A;  4QOZ B;  3HPH A;  2NRW A;  3CFO A;  4OKJ A;  3VF4 A;  3CCU N;  3DLB A;  4B3M K;  2JWK A;  1GLB G;  1N6Q A;  2HF4 A;  3HT3 A;  4IXC A;  1CXQ A;  4XH5 A;  1NWK A;  4KFB A;  1BI4 A;  2DPN A;  1WN7 A;  4BWM A;  3C7N B;  2Z1I A;  3DLE A;  1HQE A;  5JMV A;  5MLC Q;  1NOY A;  2FBT A;  3I56 N;  4HUF A;  1TK0 A;  1TV6 A;  3MMV A;  2OAN A;  1ZXO A;  4CJQ A;  4AQY K;  2IGI A;  3MED A;  2W40 A;  4AHS A;  3AVH A;  2O4I A;  2Z1G A;  2UU9 K;  3MN7 A;  3LL3 A;  4YFU A;  4F3O A;  3BY5 A;  3L2V A;  3QIC A;  1TVR A;  4K43 A;  4EAH D;  3O80 A;  3AO3 A;  4G1Q A;  3OW2 M;  1VK0 A;  5AQH A;  3O8M A;  4GW6 A;  3W0L A;  3THY B;  3E9P A;  1EWQ A;  5KPT A;  2OZM A;  4M3U A;  4LC9 B;  3LP1 A;  4CK1 A;  1HYS A;  1JLA A;  4H0O A;  4FZX C;  2P9N A;  3B6O A;  2D5R A;  4OPK A;  5AQF A;  2HHV A;  1NK0 A;  3CC2 N;  3B6P A;  4BQL A;  3WUH A;  4LF5 K;  5CZ2 A;  4HTU A;  1GLL O;  5CYM A;  3A8Y A;  5AQY A;  1QVG M;  4CER A;  4DCH A;  2ITM A;  4WF9 L;  2VWK A;  4WFA L;  3WEE A;  2P9K B;  3QO9 A;  4BRG A;  2P9S B;  5ADX H;  3O08 A;  4CIF A;  1T03 A;  4FK0 A;  1OH6 A;  2HBK A;  4H0T B;  3AVI A;  1Q81 O;  2BTF A;  2ASM A;  5E84 A;  5KGW A;  1U04 A;  2ASO A;  3WXK A;  3TAG A;  4KPY A;  1GOC A;  4CJT A;  4A5B A;  1YTU A;  4H8K A;  1ESV A;  1SL2 A;  2AA4 A;  1FKP A;  1J9A A;  1VQL N;  1TKX A;  1JLG A;  5BN8 A;  3M8R A;  2DFE A;  4QS9 A;  4LFA K;  4CEE A;  4CZL A;  3O5B A;  3D2F B;  4CZE A;  1J6Z A;  1QQN A;  2HMP A;  4DUZ K;  1KLM A;  1BUP A;  3IDH A;  1EWR A;  4F9O A;  1X9S A;  4IEI A;  1QQC A;  4IDH A;  3CCM N;  4AHR A;  3HBT A;  3Q7B A;  3VQP A;  3RR7 A;  3HOT A;  4JK8 A;  4ISE A;  1ZBF A;  4CF0 A;  3DAW A;  2FSJ A;  5AJ3 K;  1A5W A;  2RN2 A;  3KD1 E;  1VQ8 N;  2UXB K;  4IFE A;  2A40 A;  3KD5 E;  1NK9 A;  4FWR A;  4DTJ A;  2JGU A;  4CEQ A;  3NVM A;  1SL1 A;  5DK5 A;  4JKH A;  3FZK A;  3OYG A;  2D0B A;  1YJN N;  1GLA G;  4J2A A;  1ZC6 A;  4CIG A;  4E1J A;  3SAG A;  1F21 A;  1N36 K;  3U8X A;  3F2K A;  3IG1 A;  3N4P A;  4K25 A;  4FLV A;  2XRI A;  1ZYQ A;  4QS8 A;  2P9L B;  4AF1 A;  3BDP A;  3SMP A;  4XH1 A;  3ZYY X;  3CJA A;  3MXM A;  1BIU A;  3CET A;  3P39 A;  5IT9 O;  4LY7 A;  4JI4 K;  3TWH A;  4BG9 A;  2GWJ A;  5HRN A;  4A2A A;  2O8E A;  2P51 A;  3A5N C;  2HBM A;  4IO9 L;  3BF3 A;  1C6V A;  4FWS A;  2Q2R A;  3F5T A;  3CHW A;  3TR8 A;  1IKV A;  4BVP A;  2YV0 X;  2UXC K;  4W5R A;  3LP3 A;  3VET A;  4DQ8 A;  4FLX A;  4AHU A;  1MDU B;  1A5X A;  1RFQ A;  2RE2 A;  5C2F A;  2Y1J A;  1RGI A;  1HYZ A;  1TAU A;  3CYM A;  4MO5 A;  1I3A A;  3OHR A;  5HRS A;  3AVN A;  1HKG A;  4LSL A;  3J7Y P;  4IWV A;  3MXJ A;  1VSF A;  3DOK A;  4X66 K;  4Z4G A;  4C8K A;  4JKC A;  5LJW A;  3FGU A;  1XUP O;  2W42 A;  5AQK A;  4KKO A;  3OYK A;  4CHQ A;  2NRT A;  4NCA A;  1ZBH A;  4K8X A;  5FLX O;  2ASP A;  2A5X A;  1S3X A;  4RCH A;  3ZCM A;  1FJG K;  4OLA A;  2GUI A;  1RT1 A;  3QML A;  4JEP A;  2O4G A;  4WE1 A;  4JHD A;  2XY7 A;  1OVY A;  4YOV A;  2G8V A;  2HHX A;  3PV8 A;  1NGA A;  2IOC A;  4WYB A;  5SZT A;  2QW9 A;  4FSV A;  4FJ9 A;  4UY8 O;  3MX2 A;  4CHP A;  2UUC K;  4A2B A;  4E7I A;  4JI2 K;  4BR5 A;  1D5A A;  4JRP A;  1B9D A;  5J2Q A;  2F8T A;  1U47 A;  1XNR K;  1IG9 A;  2P9P A;  1XHZ A;  3H3N O;  3C65 A;  2NRV A;  1N33 K;  4BE0 A;  4FM0 A;  1BGX T;  3I33 A;  5FRM A;  3L0Q A;  1KSP A;  2YNF A;  1UAX A;  3R1X A;  4CK2 A;  4O5F A;  2YNI A;  2QM1 A;  4GKJ K;  1HNZ K;  3THX A;  3KJV A;  1FK9 A;  1BCM A;  4DR3 K;  2QKB A;  1TUY A;  1GLJ O;  4JAX A;  4B3T K;  1X9W A;  3KK7 A;  1EX4 A;  1VQK N;  4DMN A;  3MWT A;  5SWM A;  5AQN A;  3IUC A;  4Z4F A;  5HRP A;  3NGY A;  1HLU A;  2ETJ A;  3J81 O;  4CD1 A;  3HP9 A;  1SQK A;  2ATQ A;  2QKK A;  3LPT A;  2DY4 A;  1TYQ A;  2AP1 A;  4DR5 K;  1GOA A;  3ATV A;  3NBP A;  2VQF K;  4BRH A;  1REV A;  3AO1 A;  3CCR N;  3V81 A;  5CHI A;  4N5S A;  3J7Z O;  3L2W A;  3CFP A;  2ZE2 A;  1NLV A;  1VSE A;  4O0I A;  3H46 O;  4HHT A;  4E7L A;  3A5O C;  4XEI A;  4JKB A;  2E6L A;  4ID1 A;  1KAZ A;  3QER A;  1KCF A;  2VWB A;  2V7Z A;  5J2P A;  1NJZ A;  1XMQ K;  1S6P A;  1VSL A;  3FFK B;  5HL7 L;  3T1H K;  3VQE A;  3THV A;  3CI5 A;  1ITG A;  3SAF A;  4FCY A;  1QQM A;  4WQ5 A;  4M3Y A;  3KLG A;  1LOT B;  3SUO A;  1XNQ K;  2E1Z A;  4JD2 B;  1JCF A;  5JS1 A;  4DV6 K;  4H5V A;  4CK3 A;  3O9Q A;  3QEP A;  4M3Z A;  1ATS A;  2YHY A;  1BWF O;  2E2N A;  2KLA A;  3CQX A;  3J8A A;  3SBG A;  4NB4 A;  4DSE A;  5BPM A;  1OH8 A;  4K0K K;  1M1K O;  3KLI A;  1NKE A;  3OYJ A;  4H0Y B;  4NXN K;  4CFA A;  1JKH A;  1SAZ A;  3OBW A;  2WFB A;  3L2Q A;  1IBL K;  3MEE A;  3AVJ A;  4W5T A;  1Z05 A;  4KBO A;  2OPS A;  2IVO A;  4KH5 A;  3NH0 A;  4LF4 K;  2KQ2 A;  3GL1 A;  3I8B A;  1DEJ A;  2F7T A;  4FM2 A;  4OX9 K;  4JKF A;  4PKI A;  1MA9 B;  1LW0 A;  1VSD A;  5AQS A;  4PKG A;  2P9K A;  4QS7 A;  3MCA B;  2IVP A;  4ICL A;  5I9E B;  3O1B A;  4F2R A;  5B8H A;  3VEZ A;  1W2B M;  1XC9 A;  2KKZ A;  3AVA A;  5AQZ A;  4QCL A;  4FO0 A;  3RR8 A;  1HX1 A;  5BN9 A;  4AHT A;  3A5M C;  4O44 A;  4DU4 A;  1O1W A;  4A61 A;  1NMN A;  2JWL A;  1KD1 O;  4H5R A;  4DSL A;  1FXX A;  3K5M A;  2WOM A;  3D6R A;  1XHX A;  2A6A A;  4CBU A;  4YOX A;  1IBK K;  4IFY A;  5ELZ A;  3CJ7 A;  1HNW K;  2BDP A;  1VQO N;  3TAB A;  4C1N I;  1YUW A;  2ITG A;  1VHX A;  2W6L A;  5AFU H;  3OTO K;  1X9M A;  2HHT A;  4U67 L;  3OYN A;  1Q9Y A;  2VWJ A;  3EKU A;  5DM6 L;  4IBN A;  3ZX2 A;  1T05 A;  3C7N A;  2G8U A;  4DSF A;  3G0Z A;  4DF4 A;  3IRX A;  3HPG A;  1S72 N;  4FZY A;  2OZS A;  3CPW M;  2HB5 A;  4LFC K;  4MDB A;  4M3R A;  3CXC M;  5T7B A;  3IAY A;  1QQO A;  3O3F A;  5JVH L;  3SUQ A;  1NGD A;  3AA2 A;  4BRN A;  4CF1 A;  4M7X A;  1BDG A;  4BR2 A;  4CE9 A;  3V4I A;  4FJK A;  4CJU A;  3C94 A;  4X65 K;  1WSI A;  4HUG A;  1U45 A;  4M41 A;  3CCJ N;  3C6H A;  4ILH A;  4CJK A;  5M1K A;  4GVE A;  2VGM A;  4H4O A;  3VA0 A;  4DTX A;  1YHQ N;  3C6T A;  5GAH P;  1CXU A;  1S1T A;  4ELT A;  2H3G X;  4CIE A;  1N34 K;  2V51 B;  2P9P B;  3MK6 A;  1DGK N;  4BRM A;  1HNI A;  1RDD A;  2P9I B;  5GIN A;  4JK7 A;  4MQ3 A;  4FJH A;  2OPR A;  1YVU A;  1RCH A;  3BZC A;  1QE1 A;  4BRE A;  2P5G A;  4HWI A;  3HP6 A;  3KWI A;  5A2Q O;  3WXI A;  2HHH K;  4FJN A;  3OY9 A;  3UB5 A;  3KHY A;  2B5J A;  3D2E A;  1C0U A;  1NKB A;  4DR7 K;  4JKD A;  4KRE A;  4IKF A;  3U3G A;  4OO1 J;  2YNH A;  3FZH A;  1YT3 A;  2A1R A;  2F9W A;  4YOY A;  4UQG A;  5C0Y A;  3ZET A;  2O8F B;  3O9T A;  4IJN A;  3SUP A;  3WXL A;  1K9M O;  4H0V B;  3NFA A;  3OYC A;  2VCP A;  4FWK A;  3VGK A;  1NGC A;  2O8C B;  5F1X A;  4B3O A;  3LDN A;  3LM2 A;  5C12 A;  3RVC A;  2HMI A;  1Z26 A;  4GMJ B;  5JS2 A;  2FBX A;  4YOT A;  4B1Y B;  1KVA A;  4DQQ A;  5KQ8 A;  3O4W A;  4BRQ A;  4EHU A;  2E2Q A;  2PFU A;  3AO4 A;  3QET A;  1W9H A;  3GDQ A;  3MEC A;  5AR0 A;  4A62 A;  2WC9 A;  4CJF A;  2HHQ A;  2YI1 A;  3VQB A;  1EQY A;  4FWN A;  5GIP A;  3FZL A;  2UUB K;  4XH4 A;  1NK7 A;  4H5W A;  4H4M A;  4WFB L;  1QSY A;  1Q8I A;  3W3D A;  3TAF A;  2OA8 A;  4W5Q A;  1RT7 A;  3VQ6 A;  1L3T A;  3VEN A;  3OYM A;  3FR0 A;  3PUF A;  1JXE A;  5KPR A;  2YJF A;  1K73 O;  3TTC A;  4B9U A;  3CQ8 A;  2GTD A;  4FOE A;  1HPM A;  3SBT A;  1JCG A;  4B1X B;  3VEO A;  2HW3 A;  3R6M A;  4M7Y A;  1J53 A;  2P9U A;  5AQU A;  3VQ5 A;  3NH2 A;  5E26 A;  4CEA A;  2A3Z A;  3SCX A;  5BR8 K;  2F4V K;  3I55 N;  4DLE A;  2CGK A;  5GAE P;  2P9L A;  3IFR A;  1X3N A;  3AV9 A;  4FJX A;  1WSH A;  3LAM A;  3WNF A;  3T69 A;  2VG5 A;  4MDA A;  4TSX A;  4JK9 A;  4KRF A;  1NGJ A;  3EL2 A;  3ZET B;  4C8L A;  2GEL A;  3V9X A;  2KW4 A;  1NMD A;  3VQ8 A;  4FL9 A;  5AQJ A;  3QB0 A;  4DR6 K;  2VQE K;  3HSC A;  1KQS M;  1NBW A;  3QIO A;  4CBW A;  3NF8 A;  5KRS A;  5IWA K;  5GIO A;  2O8C A;  1NK4 A;  4V19 S;  3HVR A;  4B8C A;  4JNE A;  2HOE A;  2O8D A;  4YHH K;  3ID6 A;  3I0S A;  1QZ6 A;  5EXW A;  4LF8 K;  4B9V A;  2E1Y A;  3OJS A;  4Z4C A;  3D0P A;  3JYT A;  3THX B;  2A42 A;  2IC3 A;  1NM1 A;  3SAH A;  3M6G A;  5JLF A;  4DF8 A;  4Y0W A;  4CHN A;  3VA3 A;  4ILJ A;  1LWF A;  1NJY A;  3PO5 A;  1YXQ A;  5M1Q A;  2ZQB A;  3BZK A;  3RTV A;  4E0D A;  3ZT4 A;  5EU7 A;  4EP5 A;  3LWL A;  2QWQ A;  4Y1C A;  1SUQ A;  2XY6 A;  3L4Q A;  4JI1 K;  1BOT O;  4Y1D A;  2O8F A;  3NGI A;  4PQU A;  2EX3 A;  1RT2 A;  1RBU A;  1ZBU A;  3DMJ A;  1NGE A;  3VEY A;  3ULE B;  4CEF A;  2CH5 A;  4Q5V A;  4DU3 A;  4CBX A;  1WSE A;  4CJP A;  4PKH A;  4O5B A;  3QIP A;  4FJL A;  1WSJ A;  1S22 A;  3VPZ A;  3HJF A;  4KHN A;  5AQR A;  4X62 K;  1U6Z A;  3NCI A;  2YCH A;  3SV3 A;  3ZSO A;  3BUZ B;  5LMU K;  3C0B A;  3GOI A;  1YF5 L;  3P4I A;  1L5U A;  4GVM A;  4E7J A;  4FWQ A;  4FJ5 A;  3R9P A;  3JAM O;  5M1N A;  2HVI A;  3MN5 A;  3VF6 A;  3S3N A;  3H6E A;  4BG8 A;  4GKK K;  2P9N B;  3QES A;  1BQM A;  2E4L A;  3VQ9 A;  2HST A;  1HYV A;  1WB9 A;  2QXL A;  1FW6 A;  4EZ9 A;  3ITH A;  2O8B B;  4BR7 A;  4IFV A;  3K9J A;  3SLC A;  1RT6 A;  1V4T A;  3O9S A;  3CME N;  4LF7 K;  5KQD A;  1S1X A;  3CQY A;  4IEE A;  3OYH A;  3CJ1 A;  1VRT A;  3ALY A;  1SL0 A;  3NF7 A;  1P8Z A;  3L3V A;  1U49 A;  3LAK A;  1H1V A;  1WNS A;  2CH6 A;  3T3F A;  1XI1 A;  2FF6 A;  3VMF B;  4BRI A;  3NAE A;  1CZ9 A;  4DQP A;  1RDB A;  3MEG A;  3NGZ A;  2PAV A;  3OYD A;  2IIR A;  2PBD A;  3M8P A;  3T1A A;  3U9Z A;  3G6E N;  1BA1 A;  2WUS A;  4CJ4 A;  1VQ9 N;  3HXM A;  4JKA A;  4EIA A;  2E8A A;  3WNE A;  4AIL C;  1NGI A;  3D2F A;  3SV4 A;  3RRG A;  3CF5 L;  3QEX A;  4OLB A;  1LWE A;  2JLE A;  5LL6 Z;  4HCB A;  2YNG A;  3DXK B;  2GEM A;  3OYI A;  3DRR A;  3DYA A;  4CEC A;  3PIO L;  4YOU A;  3KTQ A;  2NNW A;  1UA1 A;  2A41 A;  3O3G A;  4I6M B;  3QDK A;  4FLU A;  4W5O A;  1DKG D;  1P90 A;  3I0R A;  1Q86 O;  3L3U A;  4B9Q A;  3L4I A;  4BC4 A;  3VGM A;  4CES A;  1CZB A;  1RDU A;  3WNH A;  1IJJ A;  3OVN A;  5FDL A;  3LZI A;  4DV5 K;  1OH5 A;  1RTH A;  1G15 A;  3CCV N;  3KVG A;  5AQM A;  3WT0 A;  3ZT3 A;  1S6Q A;  2GWK A;  2HHU A;  4H03 B;  3NH1 A;  4CJW A;  2Q1N A;  3AVB A;  1NOZ A;  3NE6 A;  1HJO A;  3K58 A;  2X6N A;  4CF8 A;  1BQN A;  1C0M A;  3B8A X;  4JLH A;  4J2E A;  4DU1 A;  4B9T A;  5JIC A;  2GBZ A;  5BRE A;  1XWL A;  1HRH A;  4M3T A;  1DTQ A;  1GLC G;  4FXD A;  4OGC A;  1Q82 O;  3M3Z A;  1VQN N;  1T44 A;  2QI2 A;  3K59 A;  4LF6 K;  3S3M A;  1EXQ A;  4B8A B;  1QVF M;  4OPH A;  2RKI A;  3ULD A;  2NRX A;  5EVZ A;  1N32 K;  4IZ9 A;  1B9F A;  2QWM A;  4B08 A;  1J5E K;  4O4G A;  3C6U A;  3FZM A;  1D8Y A;  3KK3 A;  3JS6 A;  1K6Y A;  3UKU B;  3DXM A;  2PYL A;  3UIQ A;  3WXJ A;  1KVB A;  4WCE L;  3AA5 X;  3G25 A;  3TAQ A;  3AAR A;  3M8S A;  4JV5 K;  3AVL A;  4CJL A;  1SKW A;  4ELU A;  2D0A A;  1LW2 A;  1TAQ A;  4KH6 A;  4JS4 A;  4ID5 A;  3SQ4 A;  1T3V A;  1IKX A;  4CFB A;  2G8I A;  4CZF A;  4FLZ A;  2FLO A;  4FWP A;  5M1F A;  2ZWH A;  4FWM A;  2HBJ A;  2PZS A;  4KO0 A;  4M3X A;  3BP8 A;  3MCP A;  4JI0 K;  1RNH A;  3ZT1 A;  4DKW A;  4NLC A;  4BR0 A;  3U9D A;  2HND A;  1YJW N;  4PUO A;  1BIS A;  3DLK A;  3ZX0 A;  1C0G A;  4FJJ A;  1T6C A;  3ZEU A;  2WBN A;  3G71 N;  4DG1 A;  4AM6 A;  1NU0 A;  3P5J A;  3D45 A;  4DQS A;  4CGF A;  4JI7 K;  1NG9 A;  1OKJ A;  1QHA A;  2IS3 A;  5C15 A;  3VEW A;  4DV3 K;  2GX9 A;  3E9L A;  5AQO A;  3ZSQ A;  1JXB A;  3Q7C A;  4GY2 B;  2P1J A;  5GAG P;  3V9W A;  3J7A P;  1KFD A;  4JI6 K;  1O13 A;  4EZ6 A;  1VSM A;  4IJA A;  4B1W B;  3VQD A;  3TTF A;  3LWM A;  3TU5 A;  2FC0 A;  4LSN A;  4JYA K;  4FW2 A;  1T6D A;  4I6M A;  5AFU A;  4J2D A;  4KHP K;  4KTW A;  4CZH A;  2OCE A;  1SV5 A;  4FOI A;  3AGR A;  1IO2 A;  2D0C A;  4PHT X;  3F73 A;  3K9K A;  3IMX A;  4FK4 A;  5KPZ A;  3EY1 A;  4XIU A; 
#chains in the Genus database with same CATH homology
 5A2Q O;  1XMO K;  1N32 K;  2HHH K;  1J5E K;  4LF5 K;  4DR7 K;  4LF7 K;  4DR2 K;  4DR6 K;  2VQE K;  5IT9 O;  4JI4 K;  3J81 O;  5IWA K;  4V19 S;  4DR5 K;  4YHH K;  5LMN K;  1HR0 K;  4JI8 K;  4LF8 K;  2VQF K;  2UXC K;  4JV5 K;  4LFB K;  4B3S K;  1IBK K;  4YY3 K;  1HNW K;  2UUA K;  5LL6 Z;  3OTO K;  4X64 K;  1I94 K;  3J7Y P;  4JI5 K;  4X66 K;  4JI0 K;  4B3M K;  4LFA K;  1XMQ K;  4DUY K;  3J80 O;  5FLX O;  4DR1 K;  4JI1 K;  3T1H K;  4DUZ K;  1FJG K;  2UUB K;  4NXM K;  4LFC K;  1XNQ K;  4JI7 K;  1HNX K;  4DV5 K;  4DV6 K;  4LF9 K;  4X62 K;  2UXD K;  2UUC K;  4DV3 K;  1IBM K;  4JI2 K;  4DV0 K;  5LMU K;  5AJ3 K;  3J7A P;  4DV7 K;  4X65 K;  4DV4 K;  4DR4 K;  4K0K K;  4JI6 K;  1XNR K;  2UXB K;  4AQY K;  4NXN K;  3JAM O;  4DV1 K;  1IBL K;  1N33 K;  2UU9 K;  4JYA K;  4GKK K;  1N34 K;  4KHP K;  4LF4 K;  4CVN E;  2E5L K;  5BR8 K;  2F4V K;  4LF6 K;  2ZM6 K;  4B3R K;  4GKJ K;  1HNZ K;  3T1Y K;  4OX9 K;  1N36 K;  4DR3 K;  4DV2 K;  4B3T K;  4JI3 K;  4CW7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...