1XNQK

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xnqK00
4JI5K 2UXDK 4CW7B 3T1YK 4LF8K 2F4VK 4JYAK 3JAMO 4LF5K 4DV1K 4DV4K 4GKJK 4JI3K 4LFBK 5BR8K 1N34K 4DV7K 4GKKK 1XMQK 2UUAK 4JI1K 5IT9O 5LL6Z 4K0KK 4DUYK 2HHHK 1XNQK 4JI8K 4LF7K 4LF4K 4LF6K 4DR3K 4LFCK 4DR6K 5AJ3K 2VQEK 4B3MK 1N36K 4V19S 4DV5K 4YY3K 3OTOK 4JI7K 3J81O 1XNRK 4B3SK 1I94K 1N32K 1HNWK 4X62K 4B3TK 4JI2K 1J5EK 1FJGK 1IBLK 4DR2K 4NXMK 4JI4K 4B3RK 4DR1K 1IBKK 3J80O 5FLXO 4KHPK 4OX9K 3J7AP 5A2QO 4JI0K 1N33K 4YHHK 4CVNE 4X66K 1HNXK 4DV6K 4DV3K 1IBMK 4JV5K 4LFAK 4X65K 4X64K 4DV2K 4DR5K 3J7YP 2ZM6K 2VQFK 2UXCK 1HNZK 4LF9K 5LMNK 5IWAK 4DV0K 4DR7K 1XMOK 4DR4K 3T1HK 2E5LK 4JI6K 2UU9K 4AQYK 2UUCK 1HR0K 4DUZK 2UUBK 4NXNK 2UXBK 5LMUK
chains in the Genus database with same CATH superfamily
3AARA 3FFIA 3HT3A 1NU0A 4GKJK 4CZIA 3M5RA 3E9PA 4CEBA 3EO3A 1TUUA 4FW1A 2NRTA 3CXCM 2ASMA 3HPGA 1QQMA 1XNQK 4N41A 5J2QA 2VGNA 3S41A 3MWTA 2HNYA 3F73A 4IKFA 2W42A 1RBVA 2QWPA 3OYDA 4CJTA 3IKMA 3LWLA 4EZ9A 3CERA 5KRSA 4DSFA 2WONA 2ZQBA 4Y1DA 1TGOA 5BPLA 4NLBA 3A5LC 4BWJA 3DYAA 1VSIA 2KW4A 5J2NA 1HNWK 2AJQA 3VEZA 1DEJA 2Q0RA 3FLCO 1GLJO 5CR4A 1T7PA 4DSJA 4KTWA 3RMBA 3HP9A 5C24A 3HSTB 1YITN 3O1BA 4JRQA 1MU2A 3TTFA 3L6QA 5AZIB 4OPAA 3AVFA 3HYFA 1TL3A 2QI2A 3SAHA 5KQDA 5FLXO 5CYQA 3QEWA 3DXKB 1GOCA 4HUEA 2VCPA 4AHSA 1BIZA 4C8NA 2QK9A 2Z1IA 4IFEA 4DQSA 1TV6A 3H6EA 5I9EB 4RW9A 4BRIA 1BISA 4E7JA 1FKOA 3UKRA 3O9UA 5J1EA 3NDKA 4Z4EA 4AILC 1S1VA 1BL3A 2IIRA 1T6DA 4MLEA 4CJ5A 2P9NA 2PAVA 5AQUA 1RTJA 2X74A 5IWAK 1XMOK 1BU6O 4BRMA 2CH5A 4BG8A 3CCJN 1SL2A 4WYBA 3MEGA 4FLYA 3V9SA 3C94A 3D0PA 1P90A 4BG9A 4YOVA 4IOCL 4CEZA 3HRGA 4CZMA 2E2NA 4CK2A 3D2EB 1NOZA 3KD1E 5HLFA 3VTHA 5E26A 1ESVA 3THYB 4DV4K 3ZETA 2QA4N 4Q0BA 3ZX0A 1HYSA 4IJAA 2NRHA 4C8KA 4DTRA 4JKCA 4I2PA 2PYLA 2OCEA 3EKUA 4ID1A 2WOMA 1X9SA 2WTUA 4BC2A 3OY9A 1EETA 4HUGA 1CXUA 4KRFA 3ZT4A 3T19A 3OJSA 4FJMA 2EX3A 1HRHA 4DQIA 5JS2A 3S3NA 1OH7A 4U67L 3LZIA 4ISGA 4BQLA 3LPUA 4FWPA 4YOUA 4V19S 3TU5A 3OTOK 3WQUA 1M1KO 3TR8A 4KFBA 4FJNA 2D0PA 3QDKA 1SZ2A 4G9ZA 5BRHA 4OLBA 2G8HA 4JI2K 4WFBL 1HX1A 2P9KB 1J9AA 2E6LA 1LW0A 2D5RA 5KI6A 3LDOA 3M8QA 3MAQA 4DFJA 3PX6A 3U9ZA 3L3VA 5C2FA 3J7AP 3MWPA 1RFQA 4FVMA 1QVFM 3ZSQA 3L3UA 2HNZA 1NK4A 2HHVA 2YHYA 3QICA 4JD2B 1L3TA 3CPWM 3SV4A 5GADP 4E0DA 3KJVA 4LFAK 3I55N 5EU7A 2IAJA 2XRIA 5E41A 2O8BA 3PX4A 3C7NB 4DV0K 1KC8O 3L4IA 3CQ8A 3VA3A 1NKBA 3ZYYX 3CC4N 4H0VB 4ISFA 3HPOA 1KVAA 4IOAL 1KLNA 4CGGA 5HOOA 1E4GT 3V1QA 4CGDA 1A5WA 3CJAA 1HQEA 4DV1K 3JYTA 4AM7A 3DRRA 2QW9A 1TYQA 4R5PA 4FWSA 3O6WA 4CF9A 1W2BM 3VPZA 2RHKA 3MCPA 3FGUA 3ATVA 3LPTA 4JEPA 4KREA 2O4GA 4H03B 3ULEB 3BUZB 4JI1K 2GBZA 4K0KK 1EXQA 1S22A 2EWSA 3DI6A 3ZSVA 2HHHK 5AQFA 1U2VB 2BDPA 4WQ4C 3SBTA 2ITMA 3OYMA 1KAXA 2IOCA 1YUWA 1U6ZA 5LY3A 2PZSA 1XWLA 3HXMA 2VQEK 1L3UA 3OYNA 3H1QA 4DV5K 2P9IB 2E1YA 4A59A 1VK0A 1JL1A 4NLCA 5AQQA 3CF5L 4FJKA 3CFOA 4F3TA 4H0PA 4MDAA 1VHXA 5AQHA 4OO1J 5FPEA 4Q5VA 2WFBA 1NNEA 4FOIA 1NGGA 2BANA 4JS5A 4BC5A 3L8BA 1F21A 2IVPA 3F5TA 3QEIA 2O8CA 1D8YA 3PUFA 4DCHA 5CHIA 2F8TA 4B1WB 1KD1O 5MLCQ 2JLEA 2Z1HA 2DPNA 5AQRA 1NJIO 2QWNA 4CFCA 3CCRN 2KQ2A 3EE8A 4NB4A 4DSKA 4FVUA 4HCBA 3CQYA 4WFAL 1DLOA 3RRHA 3SUNA 1VQMN 1ASUA 5BPMA 4BGBA 4CF8A 4CHQA 1WBDA 4M3WA 4QS9A 2QM1A 4DV3K 3QFUA 3BZKA 2IS3A 1VRUA 2ATQA 3SUQA 3MEDA 4CZFA 4DLGA 4H5NA 2F8SA 3NF8A 2PY5A 3OYIA 4FM0A 1MDUB 3IUCA 4GY2B 3DLLL 3H3OB 4DWIA 1NK6A 3HI0A 1KSPA 1O13A 2NLXA 3C65A 3CJ9A 1YJ9N 3TWHA 3G6EN 3FFKB 3ISNC 3DXMA 4EIAA 1IO2A 3NCIA 5HROA 2KZZA 4AQYK 4WE1A 2RPIA 1OVQA 2VWKA 2YX6A 4EP5A 2UUCK 1XQSC 3TPQA 1V4TA 3LZJA 4CW7B 3KK3A 1U49A 4LF8K 1TK0A 5AQVA 3OYGA 1EWRA 1DTQA 3LDNA 5GINA 4H4OA 3CM6A 2DFFA 2CGKA 4EAHD 1ATRA 3OYCA 1IH7A 1JLBA 4O44A 3THWA 3EZWA 4DV7K 3KWIA 3HM8A 3O1WA 3RMDA 3LWMA 5GAEP 3SCXA 5JVGL 4FWMA 4YDUC 2VG5A 4FWOA 1U45A 3LM9A 3BF1A 3B6PA 1HLUA 4BRGA 1BA1A 3HTVA 3KIOA 4E1MA 4LF6K 1U4BA 3TTCA 3VQ8A 2QWMA 1GOBA 1N36K 1HNVA 1NJXA 2B5JA 4CJFA 4ISEA 3I56N 5M1KA 3KKSA 1WNSA 4CEEA 4CESA 4FLVA 1K8KB 3O9SA 2GELA 1JLEA 4CEDA 2J4RA 4BRDA 3V1RA 1HMVA 2FF6A 4DQPA 3VEXA 3OYEA 4B9QA 4BVPA 4AHVA 4CJEA 2E1ZA 4DTOA 4QS7A 4YOTA 2HVIA 3QLHA 3SJHA 3ZT2A 1HPMA 4JI0K 3VEYA 4KHNA 4FPAA 1RNHA 3VGKA 3ZLJA 3LL3A 4W5TA 1N8RO 3D2FB 3D45A 4CE9A 4BY9C 3KD5E 1VQ9N 4BRKA 1DT9A 1ZBSA 3SV3A 2ZWHA 3VQ7A 4CHPA 4DTJA 4LF9K 2OZMA 4B1XB 3AVAA 3AVCA 4RW6A 3ZSXA 4JHDA 2P9PB 1JJ2M 2FC0A 3HO1A 3OW2M 4NXNK 1Q7YO 1KFSA 2NRVA 3KK7A 4ZHRA 2ZE2A 4NYFA 1Z25A 4C1NK 4H0TB 3HJFA 4N76A 1KFDA 3L2QA 4KB1A 3LM2A 4KH4A 3OYKA 5AQMA 4KHWA 5TKWA 2O8DB 1RT6A 3CD6N 4B9VA 4GV9A 4DF4A 4FJLA 3OBYA 4ZTJA 5AQTA 3SAGA 4FK4A 3ID6A 4C8MA 5IT9O 4F2SA 4XEIA 1T3VA 4B9SA 1IG8A 3KHYA 1SKSA 2QEXN 2P9SA 3M6GA 3TTDA 2Y1JA 4F4KA 1QE1A 1NJYA 3DJCA 1X3MA 4FK2A 5BR9A 3J7ZO 1QZ6A 1WOQA 3A0IX 4F3OA 1XNRK 1WSIA 1WN7A 3C6TA 3DRSA 1EKEA 1HQUA 3VGMA 4OLAA 3ID8A 1VQ5N 3QETA 3B6OA 3VQ6A 3DMJA 3ZEUA 2YHWA 4CEFA 4BC3A 5HRNA 3PSFA 4WFNL 1SV5A 2GWJA 5AR0A 1TKDA 3VN5A 1UAXA 1IKXA 2ZGYA 4CD1A 2YHBA 4B3RK 1CXQA 4CI6A 2F9TA 2GTDA 3TSUA 3AGRA 5FRNA 2W6LA 3R1XA 3DAWA 2GUIA 4J8FA 4FJ9A 1HYZA 5EOYA 1EQYA 1REVA 2RF2A 3ZSRA 1HNXK 3BEXA 3D6RA 4K25A 4DF8A 2V7ZA 2RN2A 3M8SA 2QWQA 2R7YA 4DR5K 3R8EA 1D9DA 2OA8A 3O4QA 1XC3A 2OTLN 4HVJA 1E4FT 3DLBA 2D1KA 4CZEA 4AF1A 4E7HA 3PSIA 2HNDA 4MDBA 5EXWA 3L2RA 1WSEA 3K57A 3WXKA 1S9EA 5LJVA 1GLDG 3CCMN 1KAZA 2IDOA 4N56A 2BUPA 2O8EB 4O0IA 3V9XA 1RDBA 1QHAA 4JI3K 2D0BA 4UY8O 4M3XA 4BE1A 4LFBK 4IZ9A 4FWRA 2RKIA 4BE0A 3M8RA 2V51B 1TK8A 4DFPA 4KTQA 4F2RA 3HZ6A 3O9RA 4IEIA 3FZMA 1TVRA 4IJNA 2ASOA 4E89A 3ZX2A 1XC9A 2P9UB 4Z94A 5EY4A 3KLFA 5AQSA 3O3HA 1Q86O 2D0CA 1C0GA 2Z1GA 5JMVA 2G8KA 2HVHA 3NE6A 5AQGA 4IG3A 4B9MA 5DMRA 1TKZA 4BREA 5KQ8A 1XUPO 4HTLA 3TAFA 3S9HA 2IGIA 3DLEA 4MFBA 3VQBA 2LSNA 2E6MA 2XHBA 4ILHA 1BI4B 4DSLA 1ZBLA 4M7XA 4I6MB 3MN5A 3TAQA 3TSPA 4JI4K 3VQQA 4IDKA 1RDUA 3VESA 4CIGA 4PL7A 3ULDA 2G8FA 3LAMA 2E20A 4B1VA 4CEOA 1O1WA 3ENOA 3OBWA 4B9TA 1LCUA 2NRWA 1WSFA 1TAUA 5ADXH 2D4WA 4J2BA 1BUPA 4K8XA 1K6YA 4CJSA 3IAYA 1NGAA 1RTDA 4CCHA 1ASWA 5LMNK 4DS4A 1JLGA 4O8KA 1ATNA 4MQ3A 3M3ZA 5BRDA 4CJLA 3HM9A 1VAZA 3THXB 4BRFA 2IVNA 4K43A 1LOTB 4HUFA 2A1RA 4BR9A 4ID5A 1BHLA 1QTMA 3JAMO 3BDPA 1KLMA 1YTUA 3PV8A 4LF5K 4JAXA 3VTIA 3V81A 3F9MA 3NGIA 2FBYA 2I7NA 5BR8K 4R79A 5M1OA 2AP1A 4EP4A 5EX5A 4G1QA 4CHOA 2HMIA 3VF2A 4IXCA 4OGCA 1R59O 4FL9A 4M3TA 4LF7K 1FXXA 4BACA 1WLJA 3V4IA 3W0LA 1Q8IA 4W5NA 1NMDA 4DR3K 4A57A 3HVTA 3MXMA 3WEEA 4B1ZA 1YXQA 3AGKA 4B1YB 2OYQA 4YY3K 3S3OA 1LWFA 5CZ2A 4JK7A 2HOEA 4DS5A 1RDWX 1UA1A 1HNIA 5FRMA 4CJKA 3D7EO 4X62K 3SYZA 4FM2A 4KB0A 2Y1IA 3QBWA 4CFBA 4K41A 3MN9A 3VQ5A 2G8VA 5AQYA 3DOKA 2EHGA 4CBXA 3KLHA 3CETA 1K8AO 4BE2A 2NRZA 3HSCA 3CM5A 1KQSM 5K14A 5JICA 1VQPN 2P5GA 1GLEG 4FZZA 2O4IA 3VQ4A 2O8FB 3MK6A 3K5OA 3K2PA 2P9LB 2HF4A 2ITGA 3K0SA 1QZ5A 4J2DA 1CZAN 4A2BA 1NKCA 2HHUA 3OJUA 2YNHA 1C0TA 1KTQA 2E4LA 2HBLA 3JXUA 1S72N 4GVEA 3V1OA 1JCGA 2NUBA 4C1NI 1QSLA 2F96A 3QEPA 3I0SA 4KTZA 1KRPA 4CJPA 4HCCA 3I8DA 1VQON 3CMEN 3ZT0A 1QHTA 4KI6A 3AA5X 3CJCA 3EKSA 1NGDA 3HP6A 1H1VA 3PX0A 3RMAA 1NMNA 4JKGB 2UUBK 3ZSWA 4E7KA 5LMUK 4JI5K 2HSTA 3WNEA 5FPDA 3QEXA 3T1YK 2I7PA 3NBPA 4IWVA 4DU1A 4BR7A 4IO8A 3CFRA 1D4XA 4CGFA 3L2WA 4PWDA 2JGUA 4FM1A 3DLRA 4Z4FA 3EE9A 1BA0A 2VG6A 3RR7A 2YI1A 4FJ7A 3RSEA 1XMQK 1JXEA 1YJWN 1FK9A 3C6AA 3I33A 1NLVA 3NHGA 4B3OA 1J5OA 2YHAA 1S1WA 1W97L 3WXJA 4BDYA 1NK9A 5AQZA 2CH6A 4BVOA 3UB5A 1NBWA 3AVBA 3A2FA 1BWFO 3WXMB 1RDDA 3M1FA 3GG4A 3LP3A 3TI0A 2HHXA 4H8KA 2A3ZA 3O5BA 4CZGA 3AO2A 3OVNA 3V9UA 1A5XA 3SNNA 3AAQA 1RT3A 3QIOA 5AFUA 3SQ0A 3QO9A 3G0ZA 4PQUA 2P51A 3IMXA 5JLFA 2VYPA 4NYNA 2WUSA 1YF5L 4BR5A 1HPZA 3K9JA 2OANA 3FZLA 4A61A 5C42A 4LD0A 2ZJPL 3VENA 1OKJA 4I9QA 4WCEL 3LDLA 3BY5A 3L2VA 4W5QA 5CE3A 4AM6A 3N4PA 5AZJB 3VF6A 4JS4A 4DV6K 2BH1A 1VSKA 5DM6L 1V4SA 4JNEA 5AZIA 2HBJA 1HJRA 4ILJA 4Y1CA 1J54A 3VQAA 4KHQA 4CIFA 1U48A 1ASVA 5I42A 3DXKA 4DR7K 5T7BA 4I2QA 1VQKN 1VRTA 1YAGA 4B8AB 1Q9YA 1W0HA 1C0MA 4RW4A 4DTSA 3WT0A 1WB9A 4CJQA 3VEOA 4IOXA 3GL1A 4ILGB 3VETA 5I3UA 1RBSA 3G71N 2A6AA 2G8UA 4CEAA 3ZCMA 3QB0A 3ZSOA 4DLEA 1QQOA 4F9OA 4NCGA 1HKBA 4FCYA 3F9KA 2UUAK 3D2EA 1GLBG 4OPHA 1Q82O 3G25A 1NWKA 1VQ7N 2KFNA 4BRAA 1SKWA 1MWKA 4B08A 4LF4K 1QQNA 3THYA 1YJNN 3T3FA 4DKWA 1ZBFA 3O3GA 3IG1A 1IV0A 1IKWA 4YORA 1OH5A 1VQ4N 2AA4A 1ILYA 1FKPA 1WSHA 3UKUB 1BCMA 1C1AA 3CJ1A 3VQCA 3SPZA 1L3SA 4JRPA 3RWUA 3K5NA 1QVGM 1K73O 1YI2N 4EZ6A 5TKYA 4O55A 3HPHA 4C23A 2KHOA 1VSFA 3OS0A 3DM2A 3HVRA 1NOYA 3OYFA 4OX9K 5A2QO 3TSQA 3AVIA 4ZTFA 3L0QA 2KLAA 5GAGP 3PO4A 4CJRA 2KTQA 2P9KA 2KKZA 5AQXA 3LP0A 1B9FA 4IDHA 3K5LA 3ZT3A 4RG8A 4E7LA 2Q0UA 3DLGA 4RWTA 3MEEA 5HRRA 4IO9L 5BPNA 1L3VA 5HRSA 1EWQA 1Y64A 3J7YP 5D3GA 4W5OA 4FZXC 1RT5A 4DR4K 2HW3A 1IJJA 2PFUA 1ZXOA 4JI6K 2UU9K 4GMJB 1IKVA 3WNFA 3R6MA 4H5TA 4B8CA 4JD2A 5C15A 4E7IA 4H5WA 4LH4A 4HTUA 4M3YA 3C0BA 4KO0A 3FZHA 3E9LA 4PKHA 3C7NA 1WAFA 1QS4A 4M7YA 1RCHA 3MX2A 3SQ2A 2FSKA 4E3SA 2HMPA 3P83D 3QIPA 3S3MA 3QERA 2ZD1A 4JKBA 3DLKA 3WXIA 4FOEA 5J2PA 1GLAG 5DM7L 1BO5O 3P4IA 4OKEA 1KVBA 1NGJA 1SQKA 3U6FA 3AO3A 3JSMA 3SLCA 4PHTX 1U04A 3BZCA 5HP1A 3AVNA 4LFCK 1XI1A 2WC9A 4O0JA 2HF3A 3VOVA 1W7AA 4DQRA 1T6CA 3ULEA 4ICLA 1RDAA 4BR2A 1BQMA 4M3RA 4GV3A 1CZBA 4B3SK 5AQJA 1U2VA 1RBUA 3Q7CA 3QBXA 4AHTA 1RILA 4MO5A 4Z0UA 3A5OC 1IBLK 4JKEA 4FWNA 3F2KA 3C6UA 2P9IA 3UKRB 3OYHA 2FF3B 3KLEA 3QMLA 1QSYA 4GNIA 1IKYA 3CYMA 3NVMA 3VERA 5ELZA 3J80O 2P9NB 4EFHA 2DFHA 4OKJA 4O5BA 3V9WA 3GBTA 4YHHK 1YVNA 3SK3A 2CGJA 4X66K 1VQ6N 4H0YB 3AA4A 4LSLA 5E84A 3VQPA 5EVZA 2W41A 3NH1A 1Z05A 4X64K 2QXFA 1ZBHA 3H46O 1DTTA 3E01A 1T44A 3ZETB 3T1HK 4JK8A 1Q81O 3RTVA 3LDPA 3MECA 1X3NA 1SKRA 3A5NC 2V7YA 4M42A 1LV5A 4XIUA 3UE5A 3ZX3A 4IFVA 5KPTA 1NJWA 3W3DA 4K8ZA 1ZBIA 4JKHA 2XY7A 1SL1A 3NF9A 1YT3A 4BRLA 4CBWA 4CHZA 5GIPA 4HHTA 3MN6A 4M41A 4GKKK 1RGIA 2GUPA 1SS6A 5LL6Z 2XY5A 4YOXA 4M45A 4DUYK 3ENHA 2G8WA 3CCEN 3HOSA 1T05A 5KTQA 4LY7A 2XY8A 3LDQA 2YNFA 4KV8A 4QOZB 5FDLA 3SJJA 4CFDA 5AJ3K 4YNQA 2JWKA 3AO1A 1X1PA 3CPEA 2D0AA 4O8UA 2DY4A 2UYTA 3T69A 3T7ZA 4CZHA 2OTJN 4CJ7A 2WBNA 3KWGA 3AVJA 2VWJA 4FJ8A 3QNNA 4IG0A 1OH6A 3TARA 3NGZA 3U4LA 3QESA 5C12A 3HBTA 4OGEA 1FW6A 3AVKA 4CF0A 4IFYA 2YJFA 4FLWA 2HHWA 3GE1A 4A5AA 1S5JA 4DR1K 1QQCA 1K8KA 2O8BB 4KPYA 4KHPK 2YCHA 3VEWA 1N6QA 5JLHA 4CVNE 5HL7L 2ZJQL 3NGYA 2E88A 1HJOA 1J53A 3KVGA 1C1BA 4JN4A 5C10A 2B6AA 3WNHA 2Q2RA 2G8IA 1I3AA 4F8RA 4FW2A 1S1TA 1EX4A 1B9DA 1S6QA 3QFPA 3AVHA 4BRNA 4EHTA 5F0XA 4FLUA 3LP1A 4BQZA 5CZ1A 2V52B 3B8AX 1LAVA 3CIPA 1EP4A 3JS6A 1TYQB 3OYBA 4AHCA 4PKGA 4O4GA 1JCFA 1VSDA 4M3UA 4FJ5A 1C0FA 2X78A 5FPMA 3LAKA 4CGJA 5C25A 3QNOA 3D2FA 1UA0A 1NK0A 2VG7A 3EYZA 4E19A 1ATSA 1U47A 5M1NA 2F4VK 1WSJA 2YNGA 1GLFO 4DQQA 2A1SA 2QWLA 3TAEA 4LC9B 4FSVA 4KI4A 2VGMA 3NVKA 1J6ZA 4ELTA 1VQ8N 1VQNN 2Q31A 3ITHA 1HKCA 1LAWA 3KTQA 2P9PA 2GX9A 1IG9A 3R9PA 4CBUA 5B8HA 1N5YA 4HWIA 1KXPA 3V9ZA 3DLHA 3E9OA 4DU4A 1LWCA 2O8DA 2ETJA 1B92A 3KK1A 3O4WA 2O8CB 3ENBA 3VQDA 3HK2A 4FXDA 3O80A 3SZ2A 3ZSZA 2HHTA 1BIUA 3J81O 2P5OA 1BDGA 4WQ4A 4BGAA 2FBTA 5F1XA 3NF7A 4FLXA 4GW6A 2YKMA 3ATUA 3U9DA 2OPSA 4CZKA 4AH9A 3N4QA 2IVOA 3RMCA 1GLCG 1D9FA 2B4JA 3OHRA 3CQXA 3SBGA 4CF2A 3PO5A 1YVUA 1JXBA 4UQGA 1JLCA 4RW7A 1WSGA 3RRGA 3EL2A 3L4QA 4CJVA 3LALA 4KKOA 3THVA 2A42A 3DXMB 2QWOA 3VMFB 1TUYA 1IBMK 3KLIA 2A41A 4JV5K 1X9WA 1SUQA 4BRQA 1HUXA 2PYJA 4X65K 1NK5A 3HOTA 5KGXA 1HNZK 2OPPA 4LH5A 3CCUN 1TL1A 1QSSA 2NZTA 2QKBA 4FPBA 2P1JA 3THWB 3T1AA 2F9WA 4FWQA 5AQOA 3NH2A 4YFUA 4LSNA 1HR0K 1LW2A 2JWLA 1OVYA 3OS2A 4BDPA 3A8YA 3OYLA 4FJGA 4IBNA 3EN9A 4TSXA 2FSNA 5CYMA 4J2AA 3MMVA 1HKGA 1Z6RA 3ALYA 3P5JA 4CZLA 4N47A 4JI8K 4H5RA 4ELUA 4JLHA 2GWKA 3IDHA 3AO4A 2O8EA 4DR6K 1RT2A 4Z4GA 3TAMA 1RDCA 3AVLA 4CHYA 4QCLA 1RTHA 1UWBA 4KHSA 4IEEA 3AAPA 3R3LA 4YDUA 2FLOA 3E1YA 1X9JA 3TANA 1ZBUA 1YTAA 4BWMA 3TABA 1I94K 2P9UA 1N32K 1VSEA 1S3XA 3KKRA 4L3QA 4E1NA 4XH1A 4OKKA 4W5RA 4B9UA 3EEQA 1J5EK 1FJGK 1ZC6A 2BE2A 3AA2A 3O4NA 1VSLA 3MDQA 4DFKA 2E2PA 1S9GA 4Z4IA 2Q1NA 3IFRA 3SI6A 4JHDB 3K5MA 5KGWA 2ZJRL 1BI4A 1BQNA 3DRPA 2GV9A 4C8LA 5SZTA 1ZYQA 1JLFA 4I6MA 2DTUA 4FO0A 4QS8A 1JLAA 3K59A 4BC4A 3CCVN 3NH0A 4M3ZA 4DQ8A 2OPQA 2VQFK 4KH5A 4KHUA 1BCOA 3LDSA 1A5VA 3SUOA 3M8PA 3J8AA 1C1CA 5AQIA 4L8RB 1Q18A 3MXIA 3E66A 4JK9A 1C0UA 2E5LK 2ASPA 3LP2A 1RTIA 1RT4A 5FROA 3MN7A 4C8OA 2NRRA 4CJWA 2QXLA 4PL8A 2UXDK 1NGEA 3AVMA 3SQ1A 3OYAA 3TAPA 3P31A 2QWRA 3G4SN 4Z4HA 2P9SB 3CMAN 5FPNA 3OS1A 3ASMA 3PIPL 3KK2A 4FK0A 3VA0A 4CD3A 4DHYA 3THXA 1TKTA 3QINA 1GOAA 1NGCA 2HBKA 2QKKA 3O8MA 4FYDA 4I7FA 3NFAA 1D5AA 1RBRA 4DTMA 1R0AA 2QTDA 1NKEA 3MXJA 1CLQA 5ADXA 2Z1JA 1MA9B 1T8EA 1NG9A 3ZEUB 2OZSA 3VF4A 3SAFA 4FWKA 2HHSA 4A62A 4DG1A 2BGGA 2VWBA 4JI7K 4H4MA 3RR8A 3NF6A 3V6DA 2H3GX 2KZMA 1NGBA 5CY4A 4BRHA 2ZGZA 3OA9A 4BR0A 1NM1A 3DOLA 1GLLO 4FJHA 1G99A 5BN9A 2W40A 1NK8A 4CK3A 2IC3A 3U3GA 4FWLA 1NGIA 3WNGA 4DSEA 1VSJA 5AQLA 4H5VA 1L5UA 4MO4A 1BOTO 2I5JA 4CERA 2YJEA 5KPZA 3EY1A 1TKXA 4KHYA 3I0RA 3SQ4A 1HYVA 4WQ5A 1BG3A 4WF9L 4Y0WA 4A5BA 4E1JA 5JVHL 2ZM6K 2O8FA 4B1UB 2PBDA 2P9LA 3ZSYA 4BRPA 3SMSA 1K9MO 4JKAA 4PY5A 3AA3A 3CI5A 3CC7N 4JKFA 1C6VA 4N5SA 2BTFA 1KCFA 3EZ5A 3VQ9A 2DFEA 4QAGA 4KH6A 4FJJA 3VGLA 3P39A 3UIQA 4JKDA 3CCQN 4BDZA 4JYAK 1Y97A 1TK5A 4NCBA 1YIJN 5H1SQ 4PKIA 5AQKA 3FR0A 3CCSN 1JCEA 4KBOA 4OPKA 1N34K 3U8XA 4DFMA 4CEQA 4JKGA 2Q97A 1LWEA 4CZJA 3TAGA 4CGHA 1SL0A 1M90O 1CZ9A 3NAEA 5BRFA 4OVLA 3O3FA 5HRPA 1Q9XA 2E2OA 3KLGA 1Z26A 4XH4A 4B3MK 3FZKA 3MCAB 3VQEA 5C2DA 4CK1A 1XHXA 4GV6A 1MWMA 4NO7A 3PIOL 4M63C 4B3TK 2X6SA 2A40A 4A2AA 2Q36A 4CECA 4CHNA 1JKHA 4DR2K 4NXMK 5AQNA 4KAZA 5M1QA 3Q7BA 5SWMA 4O5FA 1VSHA 4I9LA 1WUAA 4RTFD 3H3NO 3AY9A 3P38A 5JS1A 4RCHA 1S1XA 3KZBA 4YOYA 1KAYA 3C6HA 3C95A 4DSIA 3CFPA 1BGXT 4CFAA 2YHXA 3QEVA 1KVCA 1W9HA 2GEMA 2YV0X 4BRCA 2F7TA 1DKGD 3FZFA 4DV2K 4DMNA 3HL8A 2UXCK 3I8BA 4FLZA 1EO1A 1YHQN 5BN8A 1UOCA 2XO7A 1VSMA 5LJWA 2YNIA 2HHQA 5AZJA 1S1UA 5BREA 5GAHP 1RT7A 5M1PA 4NCAA 3O08A 1S6PA 3LANA 3RVCA 1VQLN 4YOWA 1JL2A 4MLHA 4Z4CA 4H0OA 4B9NA 5F2RA 3H1VX 4CGIA 4B9LA 3SUPA 1RBTA 4FJXA 4EHUA 2HBMA 3PY8A 2FBVA 5KPRA 3WEEB 2X6NA 1NK7A 2OPRA 2E8AA 4CJ3A 3CC2N 4J2EA 3GOIA 4U7BA 3CJBA 3WQTA 2FXUA 2XY6A 4OJRA 3O9QA 4DU3A 3BGRA 4BROA 4OPJA 2YKNA 3AO5A 2CGLA 1P8ZA 2A5XA 4BR4A 1NGFA 3CHWA 5DK5A 3BF3A 4H0XB 4WQ5C 1SAZA 2E2QA 4GVMA 2HB5A 2RE2A 1TAQA 5J2MA 5HBMA 3U3YA 4DB3A 2FSJA 3VEVA 2KFZA 1WBBA 3DWLA 4DTXA 4AHRA 4DTPA 1E3MA 3MX5A 4AHUA 1I39A 3P1GA 3CG7A 3GDQA 3L2UA 4RW8A 3A5MC 4PA1A 1XHZA 3IS9A 3K58A 4DTNA 4FJIA 5M1FA 3CJ7A 3SPYA 4FLTA 4CJUA 3O9TA 1IBKK 3UKUA 1X9MA 4K42A 3WXLA 1NGHA 4XH5A 3FE1A 3ZT1A 1N33K 3IRXA 2Q3SA 1OH8A 4FZYA 3BP8A 5GIOA 1T03A 3G10A 1WAJA 5KRTA 2NNWA 2D0OA 3H08A 2W6KA 4ELVA 3AVGA 1RT1A 1DGKN 3WUHA 2NRXA 3SMPA 1NJZA 3OYJA 1G15A 4DTUA 4CIEA 3PLAA 3CCLN 5C0YA 3AV9A 1ITGA 4PUOA 3H45C 2FBXA 2ZF5O 4CF1A 4CJ4A 3RSEB 3K9KA 3NMUA 1JLQA 5AQPA 5AFUH 4DUZK 5AQWA 2UXBK
chains in the Genus database with same CATH topology
4JI5K 2UXDK 4CW7B 3T1YK 4LF8K 2F4VK 4JYAK 3JAMO 4LF5K 4DV1K 4DV4K 4GKJK 4JI3K 4LFBK 5BR8K 1N34K 4DV7K 4GKKK 1XMQK 2UUAK 4JI1K 5IT9O 5LL6Z 4K0KK 4DUYK 2HHHK 1XNQK 4JI8K 4LF7K 4LF4K 4LF6K 4DR3K 4LFCK 4DR6K 5AJ3K 2VQEK 4B3MK 1N36K 4V19S 4DV5K 4YY3K 3OTOK 4JI7K 3J81O 1XNRK 4B3SK 1I94K 1N32K 1HNWK 4X62K 4B3TK 4JI2K 1J5EK 1FJGK 1IBLK 4DR2K 4NXMK 4JI4K 4B3RK 4DR1K 1IBKK 3J80O 5FLXO 4KHPK 4OX9K 3J7AP 5A2QO 4JI0K 1N33K 4YHHK 4CVNE 4X66K 1HNXK 4DV6K 4DV3K 1IBMK 4JV5K 4LFAK 4X65K 4X64K 4DV2K 4DR5K 3J7YP 2ZM6K 2VQFK 2UXCK 1HNZK 4LF9K 5LMNK 5IWAK 4DV0K 4DR7K 1XMOK 4DR4K 3T1HK 2E5LK 4JI6K 2UU9K 4AQYK 2UUCK 1HR0K 4DUZK 2UUBK 4NXNK 2UXBK 5LMUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  2UXD K;  4CW7 B;  3T1Y K;  4LF8 K;  2F4V K;  4JYA K;  3JAM O;  4LF5 K;  4DV1 K;  4DV4 K;  4GKJ K;  4JI3 K;  4LFB K;  5BR8 K;  1N34 K;  4DV7 K;  4GKK K;  1XMQ K;  2UUA K;  4JI1 K;  5IT9 O;  5LL6 Z;  4K0K K;  4DUY K;  2HHH K;  1XNQ K;  4JI8 K;  4LF7 K;  4LF4 K;  4LF6 K;  4DR3 K;  4LFC K;  4DR6 K;  5AJ3 K;  2VQE K;  4B3M K;  1N36 K;  4V19 S;  4DV5 K;  4YY3 K;  3OTO K;  4JI7 K;  3J81 O;  1XNR K;  4B3S K;  1I94 K;  1N32 K;  1HNW K;  4X62 K;  4B3T K;  4JI2 K;  1J5E K;  1FJG K;  1IBL K;  4DR2 K;  4NXM K;  4JI4 K;  4B3R K;  4DR1 K;  1IBK K;  3J80 O;  5FLX O;  4KHP K;  4OX9 K;  3J7A P;  5A2Q O;  4JI0 K;  1N33 K;  4YHH K;  4CVN E;  4X66 K;  1HNX K;  4DV6 K;  4DV3 K;  1IBM K;  4JV5 K;  4LFA K;  4X65 K;  4X64 K;  4DV2 K;  4DR5 K;  3J7Y P;  2ZM6 K;  2VQF K;  2UXC K;  1HNZ K;  4LF9 K;  5LMN K;  5IWA K;  4DV0 K;  4DR7 K;  1XMO K;  4DR4 K;  3T1H K;  2E5L K;  4JI6 K;  2UU9 K;  4AQY K;  2UUC K;  1HR0 K;  4DUZ K;  2UUB K;  4NXN K;  2UXB K;  5LMU K; 
#chains in the Genus database with same CATH topology
 3AAR A;  3FFI A;  3HT3 A;  1NU0 A;  4GKJ K;  4CZI A;  3M5R A;  3E9P A;  4CEB A;  3EO3 A;  1TUU A;  4FW1 A;  2NRT A;  3CXC M;  2ASM A;  3HPG A;  1QQM A;  1XNQ K;  4N41 A;  5J2Q A;  2VGN A;  3S41 A;  3MWT A;  2HNY A;  3F73 A;  4IKF A;  2W42 A;  1RBV A;  2QWP A;  3OYD A;  4CJT A;  3IKM A;  3LWL A;  4EZ9 A;  3CER A;  5KRS A;  4DSF A;  2WON A;  2ZQB A;  4Y1D A;  1TGO A;  5BPL A;  4NLB A;  3A5L C;  4BWJ A;  3DYA A;  1VSI A;  2KW4 A;  5J2N A;  1HNW K;  2AJQ A;  3VEZ A;  1DEJ A;  2Q0R A;  3FLC O;  1GLJ O;  5CR4 A;  1T7P A;  4DSJ A;  4KTW A;  3RMB A;  3HP9 A;  5C24 A;  3HST B;  1YIT N;  3O1B A;  4JRQ A;  1MU2 A;  3TTF A;  3L6Q A;  5AZI B;  4OPA A;  3AVF A;  3HYF A;  1TL3 A;  2QI2 A;  3SAH A;  5KQD A;  5FLX O;  5CYQ A;  3QEW A;  3DXK B;  1GOC A;  4HUE A;  2VCP A;  4AHS A;  1BIZ A;  4C8N A;  2QK9 A;  2Z1I A;  4IFE A;  4DQS A;  1TV6 A;  3H6E A;  5I9E B;  4RW9 A;  4BRI A;  1BIS A;  4E7J A;  1FKO A;  3UKR A;  3O9U A;  5J1E A;  3NDK A;  4Z4E A;  4AIL C;  1S1V A;  1BL3 A;  2IIR A;  1T6D A;  4MLE A;  4CJ5 A;  2P9N A;  2PAV A;  5AQU A;  1RTJ A;  2X74 A;  5IWA K;  1XMO K;  1BU6 O;  4BRM A;  2CH5 A;  4BG8 A;  3CCJ N;  1SL2 A;  4WYB A;  3MEG A;  4FLY A;  3V9S A;  3C94 A;  3D0P A;  1P90 A;  4BG9 A;  4YOV A;  4IOC L;  4CEZ A;  3HRG A;  4CZM A;  2E2N A;  4CK2 A;  3D2E B;  1NOZ A;  3KD1 E;  5HLF A;  3VTH A;  5E26 A;  1ESV A;  3THY B;  4DV4 K;  3ZET A;  2QA4 N;  4Q0B A;  3ZX0 A;  1HYS A;  4IJA A;  2NRH A;  4C8K A;  4DTR A;  4JKC A;  4I2P A;  2PYL A;  2OCE A;  3EKU A;  4ID1 A;  2WOM A;  1X9S A;  2WTU A;  4BC2 A;  3OY9 A;  1EET A;  4HUG A;  1CXU A;  4KRF A;  3ZT4 A;  3T19 A;  3OJS A;  4FJM A;  2EX3 A;  1HRH A;  4DQI A;  5JS2 A;  3S3N A;  1OH7 A;  4U67 L;  3LZI A;  4ISG A;  4BQL A;  3LPU A;  4FWP A;  4YOU A;  4V19 S;  3TU5 A;  3OTO K;  3WQU A;  1M1K O;  3TR8 A;  4KFB A;  4FJN A;  2D0P A;  3QDK A;  1SZ2 A;  4G9Z A;  5BRH A;  4OLB A;  2G8H A;  4JI2 K;  4WFB L;  1HX1 A;  2P9K B;  1J9A A;  2E6L A;  1LW0 A;  2D5R A;  5KI6 A;  3LDO A;  3M8Q A;  3MAQ A;  4DFJ A;  3PX6 A;  3U9Z A;  3L3V A;  5C2F A;  3J7A P;  3MWP A;  1RFQ A;  4FVM A;  1QVF M;  3ZSQ A;  3L3U A;  2HNZ A;  1NK4 A;  2HHV A;  2YHY A;  3QIC A;  4JD2 B;  1L3T A;  3CPW M;  3SV4 A;  5GAD P;  4E0D A;  3KJV A;  4LFA K;  3I55 N;  5EU7 A;  2IAJ A;  2XRI A;  5E41 A;  2O8B A;  3PX4 A;  3C7N B;  4DV0 K;  1KC8 O;  3L4I A;  3CQ8 A;  3VA3 A;  1NKB A;  3ZYY X;  3CC4 N;  4H0V B;  4ISF A;  3HPO A;  1KVA A;  4IOA L;  1KLN A;  4CGG A;  5HOO A;  1E4G T;  3V1Q A;  4CGD A;  1A5W A;  3CJA A;  1HQE A;  4DV1 K;  3JYT A;  4AM7 A;  3DRR A;  2QW9 A;  1TYQ A;  4R5P A;  4FWS A;  3O6W A;  4CF9 A;  1W2B M;  3VPZ A;  2RHK A;  3MCP A;  3FGU A;  3ATV A;  3LPT A;  4JEP A;  4KRE A;  2O4G A;  4H03 B;  3ULE B;  3BUZ B;  4JI1 K;  2GBZ A;  4K0K K;  1EXQ A;  1S22 A;  2EWS A;  3DI6 A;  3ZSV A;  2HHH K;  5AQF A;  1U2V B;  2BDP A;  4WQ4 C;  3SBT A;  2ITM A;  3OYM A;  1KAX A;  2IOC A;  1YUW A;  1U6Z A;  5LY3 A;  2PZS A;  1XWL A;  3HXM A;  2VQE K;  1L3U A;  3OYN A;  3H1Q A;  4DV5 K;  2P9I B;  2E1Y A;  4A59 A;  1VK0 A;  1JL1 A;  4NLC A;  5AQQ A;  3CF5 L;  4FJK A;  3CFO A;  4F3T A;  4H0P A;  4MDA A;  1VHX A;  5AQH A;  4OO1 J;  5FPE A;  4Q5V A;  2WFB A;  1NNE A;  4FOI A;  1NGG A;  2BAN A;  4JS5 A;  4BC5 A;  3L8B A;  1F21 A;  2IVP A;  3F5T A;  3QEI A;  2O8C A;  1D8Y A;  3PUF A;  4DCH A;  5CHI A;  2F8T A;  4B1W B;  1KD1 O;  5MLC Q;  2JLE A;  2Z1H A;  2DPN A;  5AQR A;  1NJI O;  2QWN A;  4CFC A;  3CCR N;  2KQ2 A;  3EE8 A;  4NB4 A;  4DSK A;  4FVU A;  4HCB A;  3CQY A;  4WFA L;  1DLO A;  3RRH A;  3SUN A;  1VQM N;  1ASU A;  5BPM A;  4BGB A;  4CF8 A;  4CHQ A;  1WBD A;  4M3W A;  4QS9 A;  2QM1 A;  4DV3 K;  3QFU A;  3BZK A;  2IS3 A;  1VRU A;  2ATQ A;  3SUQ A;  3MED A;  4CZF A;  4DLG A;  4H5N A;  2F8S A;  3NF8 A;  2PY5 A;  3OYI A;  4FM0 A;  1MDU B;  3IUC A;  4GY2 B;  3DLL L;  3H3O B;  4DWI A;  1NK6 A;  3HI0 A;  1KSP A;  1O13 A;  2NLX A;  3C65 A;  3CJ9 A;  1YJ9 N;  3TWH A;  3G6E N;  3FFK B;  3ISN C;  3DXM A;  4EIA A;  1IO2 A;  3NCI A;  5HRO A;  2KZZ A;  4AQY K;  4WE1 A;  2RPI A;  1OVQ A;  2VWK A;  2YX6 A;  4EP5 A;  2UUC K;  1XQS C;  3TPQ A;  1V4T A;  3LZJ A;  4CW7 B;  3KK3 A;  1U49 A;  4LF8 K;  1TK0 A;  5AQV A;  3OYG A;  1EWR A;  1DTQ A;  3LDN A;  5GIN A;  4H4O A;  3CM6 A;  2DFF A;  2CGK A;  4EAH D;  1ATR A;  3OYC A;  1IH7 A;  1JLB A;  4O44 A;  3THW A;  3EZW A;  4DV7 K;  3KWI A;  3HM8 A;  3O1W A;  3RMD A;  3LWM A;  5GAE P;  3SCX A;  5JVG L;  4FWM A;  4YDU C;  2VG5 A;  4FWO A;  1U45 A;  3LM9 A;  3BF1 A;  3B6P A;  1HLU A;  4BRG A;  1BA1 A;  3HTV A;  3KIO A;  4E1M A;  4LF6 K;  1U4B A;  3TTC A;  3VQ8 A;  2QWM A;  1GOB A;  1N36 K;  1HNV A;  1NJX A;  2B5J A;  4CJF A;  4ISE A;  3I56 N;  5M1K A;  3KKS A;  1WNS A;  4CEE A;  4CES A;  4FLV A;  1K8K B;  3O9S A;  2GEL A;  1JLE A;  4CED A;  2J4R A;  4BRD A;  3V1R A;  1HMV A;  2FF6 A;  4DQP A;  3VEX A;  3OYE A;  4B9Q A;  4BVP A;  4AHV A;  4CJE A;  2E1Z A;  4DTO A;  4QS7 A;  4YOT A;  2HVI A;  3QLH A;  3SJH A;  3ZT2 A;  1HPM A;  4JI0 K;  3VEY A;  4KHN A;  4FPA A;  1RNH A;  3VGK A;  3ZLJ A;  3LL3 A;  4W5T A;  1N8R O;  3D2F B;  3D45 A;  4CE9 A;  4BY9 C;  3KD5 E;  1VQ9 N;  4BRK A;  1DT9 A;  1ZBS A;  3SV3 A;  2ZWH A;  3VQ7 A;  4CHP A;  4DTJ A;  4LF9 K;  2OZM A;  4B1X B;  3AVA A;  3AVC A;  4RW6 A;  3ZSX A;  4JHD A;  2P9P B;  1JJ2 M;  2FC0 A;  3HO1 A;  3OW2 M;  4NXN K;  1Q7Y O;  1KFS A;  2NRV A;  3KK7 A;  4ZHR A;  2ZE2 A;  4NYF A;  1Z25 A;  4C1N K;  4H0T B;  3HJF A;  4N76 A;  1KFD A;  3L2Q A;  4KB1 A;  3LM2 A;  4KH4 A;  3OYK A;  5AQM A;  4KHW A;  5TKW A;  2O8D B;  1RT6 A;  3CD6 N;  4B9V A;  4GV9 A;  4DF4 A;  4FJL A;  3OBY A;  4ZTJ A;  5AQT A;  3SAG A;  4FK4 A;  3ID6 A;  4C8M A;  5IT9 O;  4F2S A;  4XEI A;  1T3V A;  4B9S A;  1IG8 A;  3KHY A;  1SKS A;  2QEX N;  2P9S A;  3M6G A;  3TTD A;  2Y1J A;  4F4K A;  1QE1 A;  1NJY A;  3DJC A;  1X3M A;  4FK2 A;  5BR9 A;  3J7Z O;  1QZ6 A;  1WOQ A;  3A0I X;  4F3O A;  1XNR K;  1WSI A;  1WN7 A;  3C6T A;  3DRS A;  1EKE A;  1HQU A;  3VGM A;  4OLA A;  3ID8 A;  1VQ5 N;  3QET A;  3B6O A;  3VQ6 A;  3DMJ A;  3ZEU A;  2YHW A;  4CEF A;  4BC3 A;  5HRN A;  3PSF A;  4WFN L;  1SV5 A;  2GWJ A;  5AR0 A;  1TKD A;  3VN5 A;  1UAX A;  1IKX A;  2ZGY A;  4CD1 A;  2YHB A;  4B3R K;  1CXQ A;  4CI6 A;  2F9T A;  2GTD A;  3TSU A;  3AGR A;  5FRN A;  2W6L A;  3R1X A;  3DAW A;  2GUI A;  4J8F A;  4FJ9 A;  1HYZ A;  5EOY A;  1EQY A;  1REV A;  2RF2 A;  3ZSR A;  1HNX K;  3BEX A;  3D6R A;  4K25 A;  4DF8 A;  2V7Z A;  2RN2 A;  3M8S A;  2QWQ A;  2R7Y A;  4DR5 K;  3R8E A;  1D9D A;  2OA8 A;  3O4Q A;  1XC3 A;  2OTL N;  4HVJ A;  1E4F T;  3DLB A;  2D1K A;  4CZE A;  4AF1 A;  4E7H A;  3PSI A;  2HND A;  4MDB A;  5EXW A;  3L2R A;  1WSE A;  3K57 A;  3WXK A;  1S9E A;  5LJV A;  1GLD G;  3CCM N;  1KAZ A;  2IDO A;  4N56 A;  2BUP A;  2O8E B;  4O0I A;  3V9X A;  1RDB A;  1QHA A;  4JI3 K;  2D0B A;  4UY8 O;  4M3X A;  4BE1 A;  4LFB K;  4IZ9 A;  4FWR A;  2RKI A;  4BE0 A;  3M8R A;  2V51 B;  1TK8 A;  4DFP A;  4KTQ A;  4F2R A;  3HZ6 A;  3O9R A;  4IEI A;  3FZM A;  1TVR A;  4IJN A;  2ASO A;  4E89 A;  3ZX2 A;  1XC9 A;  2P9U B;  4Z94 A;  5EY4 A;  3KLF A;  5AQS A;  3O3H A;  1Q86 O;  2D0C A;  1C0G A;  2Z1G A;  5JMV A;  2G8K A;  2HVH A;  3NE6 A;  5AQG A;  4IG3 A;  4B9M A;  5DMR A;  1TKZ A;  4BRE A;  5KQ8 A;  1XUP O;  4HTL A;  3TAF A;  3S9H A;  2IGI A;  3DLE A;  4MFB A;  3VQB A;  2LSN A;  2E6M A;  2XHB A;  4ILH A;  1BI4 B;  4DSL A;  1ZBL A;  4M7X A;  4I6M B;  3MN5 A;  3TAQ A;  3TSP A;  4JI4 K;  3VQQ A;  4IDK A;  1RDU A;  3VES A;  4CIG A;  4PL7 A;  3ULD A;  2G8F A;  3LAM A;  2E20 A;  4B1V A;  4CEO A;  1O1W A;  3ENO A;  3OBW A;  4B9T A;  1LCU A;  2NRW A;  1WSF A;  1TAU A;  5ADX H;  2D4W A;  4J2B A;  1BUP A;  4K8X A;  1K6Y A;  4CJS A;  3IAY A;  1NGA A;  1RTD A;  4CCH A;  1ASW A;  5LMN K;  4DS4 A;  1JLG A;  4O8K A;  1ATN A;  4MQ3 A;  3M3Z A;  5BRD A;  4CJL A;  3HM9 A;  1VAZ A;  3THX B;  4BRF A;  2IVN A;  4K43 A;  1LOT B;  4HUF A;  2A1R A;  4BR9 A;  4ID5 A;  1BHL A;  1QTM A;  3JAM O;  3BDP A;  1KLM A;  1YTU A;  3PV8 A;  4LF5 K;  4JAX A;  3VTI A;  3V81 A;  3F9M A;  3NGI A;  2FBY A;  2I7N A;  5BR8 K;  4R79 A;  5M1O A;  2AP1 A;  4EP4 A;  5EX5 A;  4G1Q A;  4CHO A;  2HMI A;  3VF2 A;  4IXC A;  4OGC A;  1R59 O;  4FL9 A;  4M3T A;  4LF7 K;  1FXX A;  4BAC A;  1WLJ A;  3V4I A;  3W0L A;  1Q8I A;  4W5N A;  1NMD A;  4DR3 K;  4A57 A;  3HVT A;  3MXM A;  3WEE A;  4B1Z A;  1YXQ A;  3AGK A;  4B1Y B;  2OYQ A;  4YY3 K;  3S3O A;  1LWF A;  5CZ2 A;  4JK7 A;  2HOE A;  4DS5 A;  1RDW X;  1UA1 A;  1HNI A;  5FRM A;  4CJK A;  3D7E O;  4X62 K;  3SYZ A;  4FM2 A;  4KB0 A;  2Y1I A;  3QBW A;  4CFB A;  4K41 A;  3MN9 A;  3VQ5 A;  2G8V A;  5AQY A;  3DOK A;  2EHG A;  4CBX A;  3KLH A;  3CET A;  1K8A O;  4BE2 A;  2NRZ A;  3HSC A;  3CM5 A;  1KQS M;  5K14 A;  5JIC A;  1VQP N;  2P5G A;  1GLE G;  4FZZ A;  2O4I A;  3VQ4 A;  2O8F B;  3MK6 A;  3K5O A;  3K2P A;  2P9L B;  2HF4 A;  2ITG A;  3K0S A;  1QZ5 A;  4J2D A;  1CZA N;  4A2B A;  1NKC A;  2HHU A;  3OJU A;  2YNH A;  1C0T A;  1KTQ A;  2E4L A;  2HBL A;  3JXU A;  1S72 N;  4GVE A;  3V1O A;  1JCG A;  2NUB A;  4C1N I;  1QSL A;  2F96 A;  3QEP A;  3I0S A;  4KTZ A;  1KRP A;  4CJP A;  4HCC A;  3I8D A;  1VQO N;  3CME N;  3ZT0 A;  1QHT A;  4KI6 A;  3AA5 X;  3CJC A;  3EKS A;  1NGD A;  3HP6 A;  1H1V A;  3PX0 A;  3RMA A;  1NMN A;  4JKG B;  2UUB K;  3ZSW A;  4E7K A;  5LMU K;  4JI5 K;  2HST A;  3WNE A;  5FPD A;  3QEX A;  3T1Y K;  2I7P A;  3NBP A;  4IWV A;  4DU1 A;  4BR7 A;  4IO8 A;  3CFR A;  1D4X A;  4CGF A;  3L2W A;  4PWD A;  2JGU A;  4FM1 A;  3DLR A;  4Z4F A;  3EE9 A;  1BA0 A;  2VG6 A;  3RR7 A;  2YI1 A;  4FJ7 A;  3RSE A;  1XMQ K;  1JXE A;  1YJW N;  1FK9 A;  3C6A A;  3I33 A;  1NLV A;  3NHG A;  4B3O A;  1J5O A;  2YHA A;  1S1W A;  1W97 L;  3WXJ A;  4BDY A;  1NK9 A;  5AQZ A;  2CH6 A;  4BVO A;  3UB5 A;  1NBW A;  3AVB A;  3A2F A;  1BWF O;  3WXM B;  1RDD A;  3M1F A;  3GG4 A;  3LP3 A;  3TI0 A;  2HHX A;  4H8K A;  2A3Z A;  3O5B A;  4CZG A;  3AO2 A;  3OVN A;  3V9U A;  1A5X A;  3SNN A;  3AAQ A;  1RT3 A;  3QIO A;  5AFU A;  3SQ0 A;  3QO9 A;  3G0Z A;  4PQU A;  2P51 A;  3IMX A;  5JLF A;  2VYP A;  4NYN A;  2WUS A;  1YF5 L;  4BR5 A;  1HPZ A;  3K9J A;  2OAN A;  3FZL A;  4A61 A;  5C42 A;  4LD0 A;  2ZJP L;  3VEN A;  1OKJ A;  4I9Q A;  4WCE L;  3LDL A;  3BY5 A;  3L2V A;  4W5Q A;  5CE3 A;  4AM6 A;  3N4P A;  5AZJ B;  3VF6 A;  4JS4 A;  4DV6 K;  2BH1 A;  1VSK A;  5DM6 L;  1V4S A;  4JNE A;  5AZI A;  2HBJ A;  1HJR A;  4ILJ A;  4Y1C A;  1J54 A;  3VQA A;  4KHQ A;  4CIF A;  1U48 A;  1ASV A;  5I42 A;  3DXK A;  4DR7 K;  5T7B A;  4I2Q A;  1VQK N;  1VRT A;  1YAG A;  4B8A B;  1Q9Y A;  1W0H A;  1C0M A;  4RW4 A;  4DTS A;  3WT0 A;  1WB9 A;  4CJQ A;  3VEO A;  4IOX A;  3GL1 A;  4ILG B;  3VET A;  5I3U A;  1RBS A;  3G71 N;  2A6A A;  2G8U A;  4CEA A;  3ZCM A;  3QB0 A;  3ZSO A;  4DLE A;  1QQO A;  4F9O A;  4NCG A;  1HKB A;  4FCY A;  3F9K A;  2UUA K;  3D2E A;  1GLB G;  4OPH A;  1Q82 O;  3G25 A;  1NWK A;  1VQ7 N;  2KFN A;  4BRA A;  1SKW A;  1MWK A;  4B08 A;  4LF4 K;  1QQN A;  3THY A;  1YJN N;  3T3F A;  4DKW A;  1ZBF A;  3O3G A;  3IG1 A;  1IV0 A;  1IKW A;  4YOR A;  1OH5 A;  1VQ4 N;  2AA4 A;  1ILY A;  1FKP A;  1WSH A;  3UKU B;  1BCM A;  1C1A A;  3CJ1 A;  3VQC A;  3SPZ A;  1L3S A;  4JRP A;  3RWU A;  3K5N A;  1QVG M;  1K73 O;  1YI2 N;  4EZ6 A;  5TKY A;  4O55 A;  3HPH A;  4C23 A;  2KHO A;  1VSF A;  3OS0 A;  3DM2 A;  3HVR A;  1NOY A;  3OYF A;  4OX9 K;  5A2Q O;  3TSQ A;  3AVI A;  4ZTF A;  3L0Q A;  2KLA A;  5GAG P;  3PO4 A;  4CJR A;  2KTQ A;  2P9K A;  2KKZ A;  5AQX A;  3LP0 A;  1B9F A;  4IDH A;  3K5L A;  3ZT3 A;  4RG8 A;  4E7L A;  2Q0U A;  3DLG A;  4RWT A;  3MEE A;  5HRR A;  4IO9 L;  5BPN A;  1L3V A;  5HRS A;  1EWQ A;  1Y64 A;  3J7Y P;  5D3G A;  4W5O A;  4FZX C;  1RT5 A;  4DR4 K;  2HW3 A;  1IJJ A;  2PFU A;  1ZXO A;  4JI6 K;  2UU9 K;  4GMJ B;  1IKV A;  3WNF A;  3R6M A;  4H5T A;  4B8C A;  4JD2 A;  5C15 A;  4E7I A;  4H5W A;  4LH4 A;  4HTU A;  4M3Y A;  3C0B A;  4KO0 A;  3FZH A;  3E9L A;  4PKH A;  3C7N A;  1WAF A;  1QS4 A;  4M7Y A;  1RCH A;  3MX2 A;  3SQ2 A;  2FSK A;  4E3S A;  2HMP A;  3P83 D;  3QIP A;  3S3M A;  3QER A;  2ZD1 A;  4JKB A;  3DLK A;  3WXI A;  4FOE A;  5J2P A;  1GLA G;  5DM7 L;  1BO5 O;  3P4I A;  4OKE A;  1KVB A;  1NGJ A;  1SQK A;  3U6F A;  3AO3 A;  3JSM A;  3SLC A;  4PHT X;  1U04 A;  3BZC A;  5HP1 A;  3AVN A;  4LFC K;  1XI1 A;  2WC9 A;  4O0J A;  2HF3 A;  3VOV A;  1W7A A;  4DQR A;  1T6C A;  3ULE A;  4ICL A;  1RDA A;  4BR2 A;  1BQM A;  4M3R A;  4GV3 A;  1CZB A;  4B3S K;  5AQJ A;  1U2V A;  1RBU A;  3Q7C A;  3QBX A;  4AHT A;  1RIL A;  4MO5 A;  4Z0U A;  3A5O C;  1IBL K;  4JKE A;  4FWN A;  3F2K A;  3C6U A;  2P9I A;  3UKR B;  3OYH A;  2FF3 B;  3KLE A;  3QML A;  1QSY A;  4GNI A;  1IKY A;  3CYM A;  3NVM A;  3VER A;  5ELZ A;  3J80 O;  2P9N B;  4EFH A;  2DFH A;  4OKJ A;  4O5B A;  3V9W A;  3GBT A;  4YHH K;  1YVN A;  3SK3 A;  2CGJ A;  4X66 K;  1VQ6 N;  4H0Y B;  3AA4 A;  4LSL A;  5E84 A;  3VQP A;  5EVZ A;  2W41 A;  3NH1 A;  1Z05 A;  4X64 K;  2QXF A;  1ZBH A;  3H46 O;  1DTT A;  3E01 A;  1T44 A;  3ZET B;  3T1H K;  4JK8 A;  1Q81 O;  3RTV A;  3LDP A;  3MEC A;  1X3N A;  1SKR A;  3A5N C;  2V7Y A;  4M42 A;  1LV5 A;  4XIU A;  3UE5 A;  3ZX3 A;  4IFV A;  5KPT A;  1NJW A;  3W3D A;  4K8Z A;  1ZBI A;  4JKH A;  2XY7 A;  1SL1 A;  3NF9 A;  1YT3 A;  4BRL A;  4CBW A;  4CHZ A;  5GIP A;  4HHT A;  3MN6 A;  4M41 A;  4GKK K;  1RGI A;  2GUP A;  1SS6 A;  5LL6 Z;  2XY5 A;  4YOX A;  4M45 A;  4DUY K;  3ENH A;  2G8W A;  3CCE N;  3HOS A;  1T05 A;  5KTQ A;  4LY7 A;  2XY8 A;  3LDQ A;  2YNF A;  4KV8 A;  4QOZ B;  5FDL A;  3SJJ A;  4CFD A;  5AJ3 K;  4YNQ A;  2JWK A;  3AO1 A;  1X1P A;  3CPE A;  2D0A A;  4O8U A;  2DY4 A;  2UYT A;  3T69 A;  3T7Z A;  4CZH A;  2OTJ N;  4CJ7 A;  2WBN A;  3KWG A;  3AVJ A;  2VWJ A;  4FJ8 A;  3QNN A;  4IG0 A;  1OH6 A;  3TAR A;  3NGZ A;  3U4L A;  3QES A;  5C12 A;  3HBT A;  4OGE A;  1FW6 A;  3AVK A;  4CF0 A;  4IFY A;  2YJF A;  4FLW A;  2HHW A;  3GE1 A;  4A5A A;  1S5J A;  4DR1 K;  1QQC A;  1K8K A;  2O8B B;  4KPY A;  4KHP K;  2YCH A;  3VEW A;  1N6Q A;  5JLH A;  4CVN E;  5HL7 L;  2ZJQ L;  3NGY A;  2E88 A;  1HJO A;  1J53 A;  3KVG A;  1C1B A;  4JN4 A;  5C10 A;  2B6A A;  3WNH A;  2Q2R A;  2G8I A;  1I3A A;  4F8R A;  4FW2 A;  1S1T A;  1EX4 A;  1B9D A;  1S6Q A;  3QFP A;  3AVH A;  4BRN A;  4EHT A;  5F0X A;  4FLU A;  3LP1 A;  4BQZ A;  5CZ1 A;  2V52 B;  3B8A X;  1LAV A;  3CIP A;  1EP4 A;  3JS6 A;  1TYQ B;  3OYB A;  4AHC A;  4PKG A;  4O4G A;  1JCF A;  1VSD A;  4M3U A;  4FJ5 A;  1C0F A;  2X78 A;  5FPM A;  3LAK A;  4CGJ A;  5C25 A;  3QNO A;  3D2F A;  1UA0 A;  1NK0 A;  2VG7 A;  3EYZ A;  4E19 A;  1ATS A;  1U47 A;  5M1N A;  2F4V K;  1WSJ A;  2YNG A;  1GLF O;  4DQQ A;  2A1S A;  2QWL A;  3TAE A;  4LC9 B;  4FSV A;  4KI4 A;  2VGM A;  3NVK A;  1J6Z A;  4ELT A;  1VQ8 N;  1VQN N;  2Q31 A;  3ITH A;  1HKC A;  1LAW A;  3KTQ A;  2P9P A;  2GX9 A;  1IG9 A;  3R9P A;  4CBU A;  5B8H A;  1N5Y A;  4HWI A;  1KXP A;  3V9Z A;  3DLH A;  3E9O A;  4DU4 A;  1LWC A;  2O8D A;  2ETJ A;  1B92 A;  3KK1 A;  3O4W A;  2O8C B;  3ENB A;  3VQD A;  3HK2 A;  4FXD A;  3O80 A;  3SZ2 A;  3ZSZ A;  2HHT A;  1BIU A;  3J81 O;  2P5O A;  1BDG A;  4WQ4 A;  4BGA A;  2FBT A;  5F1X A;  3NF7 A;  4FLX A;  4GW6 A;  2YKM A;  3ATU A;  3U9D A;  2OPS A;  4CZK A;  4AH9 A;  3N4Q A;  2IVO A;  3RMC A;  1GLC G;  1D9F A;  2B4J A;  3OHR A;  3CQX A;  3SBG A;  4CF2 A;  3PO5 A;  1YVU A;  1JXB A;  4UQG A;  1JLC A;  4RW7 A;  1WSG A;  3RRG A;  3EL2 A;  3L4Q A;  4CJV A;  3LAL A;  4KKO A;  3THV A;  2A42 A;  3DXM B;  2QWO A;  3VMF B;  1TUY A;  1IBM K;  3KLI A;  2A41 A;  4JV5 K;  1X9W A;  1SUQ A;  4BRQ A;  1HUX A;  2PYJ A;  4X65 K;  1NK5 A;  3HOT A;  5KGX A;  1HNZ K;  2OPP A;  4LH5 A;  3CCU N;  1TL1 A;  1QSS A;  2NZT A;  2QKB A;  4FPB A;  2P1J A;  3THW B;  3T1A A;  2F9W A;  4FWQ A;  5AQO A;  3NH2 A;  4YFU A;  4LSN A;  1HR0 K;  1LW2 A;  2JWL A;  1OVY A;  3OS2 A;  4BDP A;  3A8Y A;  3OYL A;  4FJG A;  4IBN A;  3EN9 A;  4TSX A;  2FSN A;  5CYM A;  4J2A A;  3MMV A;  1HKG A;  1Z6R A;  3ALY A;  3P5J A;  4CZL A;  4N47 A;  4JI8 K;  4H5R A;  4ELU A;  4JLH A;  2GWK A;  3IDH A;  3AO4 A;  2O8E A;  4DR6 K;  1RT2 A;  4Z4G A;  3TAM A;  1RDC A;  3AVL A;  4CHY A;  4QCL A;  1RTH A;  1UWB A;  4KHS A;  4IEE A;  3AAP A;  3R3L A;  4YDU A;  2FLO A;  3E1Y A;  1X9J A;  3TAN A;  1ZBU A;  1YTA A;  4BWM A;  3TAB A;  1I94 K;  2P9U A;  1N32 K;  1VSE A;  1S3X A;  3KKR A;  4L3Q A;  4E1N A;  4XH1 A;  4OKK A;  4W5R A;  4B9U A;  3EEQ A;  1J5E K;  1FJG K;  1ZC6 A;  2BE2 A;  3AA2 A;  3O4N A;  1VSL A;  3MDQ A;  4DFK A;  2E2P A;  1S9G A;  4Z4I A;  2Q1N A;  3IFR A;  3SI6 A;  4JHD B;  3K5M A;  5KGW A;  2ZJR L;  1BI4 A;  1BQN A;  3DRP A;  2GV9 A;  4C8L A;  5SZT A;  1ZYQ A;  1JLF A;  4I6M A;  2DTU A;  4FO0 A;  4QS8 A;  1JLA A;  3K59 A;  4BC4 A;  3CCV N;  3NH0 A;  4M3Z A;  4DQ8 A;  2OPQ A;  2VQF K;  4KH5 A;  4KHU A;  1BCO A;  3LDS A;  1A5V A;  3SUO A;  3M8P A;  3J8A A;  1C1C A;  5AQI A;  4L8R B;  1Q18 A;  3MXI A;  3E66 A;  4JK9 A;  1C0U A;  2E5L K;  2ASP A;  3LP2 A;  1RTI A;  1RT4 A;  5FRO A;  3MN7 A;  4C8O A;  2NRR A;  4CJW A;  2QXL A;  4PL8 A;  2UXD K;  1NGE A;  3AVM A;  3SQ1 A;  3OYA A;  3TAP A;  3P31 A;  2QWR A;  3G4S N;  4Z4H A;  2P9S B;  3CMA N;  5FPN A;  3OS1 A;  3ASM A;  3PIP L;  3KK2 A;  4FK0 A;  3VA0 A;  4CD3 A;  4DHY A;  3THX A;  1TKT A;  3QIN A;  1GOA A;  1NGC A;  2HBK A;  2QKK A;  3O8M A;  4FYD A;  4I7F A;  3NFA A;  1D5A A;  1RBR A;  4DTM A;  1R0A A;  2QTD A;  1NKE A;  3MXJ A;  1CLQ A;  5ADX A;  2Z1J A;  1MA9 B;  1T8E A;  1NG9 A;  3ZEU B;  2OZS A;  3VF4 A;  3SAF A;  4FWK A;  2HHS A;  4A62 A;  4DG1 A;  2BGG A;  2VWB A;  4JI7 K;  4H4M A;  3RR8 A;  3NF6 A;  3V6D A;  2H3G X;  2KZM A;  1NGB A;  5CY4 A;  4BRH A;  2ZGZ A;  3OA9 A;  4BR0 A;  1NM1 A;  3DOL A;  1GLL O;  4FJH A;  1G99 A;  5BN9 A;  2W40 A;  1NK8 A;  4CK3 A;  2IC3 A;  3U3G A;  4FWL A;  1NGI A;  3WNG A;  4DSE A;  1VSJ A;  5AQL A;  4H5V A;  1L5U A;  4MO4 A;  1BOT O;  2I5J A;  4CER A;  2YJE A;  5KPZ A;  3EY1 A;  1TKX A;  4KHY A;  3I0R A;  3SQ4 A;  1HYV A;  4WQ5 A;  1BG3 A;  4WF9 L;  4Y0W A;  4A5B A;  4E1J A;  5JVH L;  2ZM6 K;  2O8F A;  4B1U B;  2PBD A;  2P9L A;  3ZSY A;  4BRP A;  3SMS A;  1K9M O;  4JKA A;  4PY5 A;  3AA3 A;  3CI5 A;  3CC7 N;  4JKF A;  1C6V A;  4N5S A;  2BTF A;  1KCF A;  3EZ5 A;  3VQ9 A;  2DFE A;  4QAG A;  4KH6 A;  4FJJ A;  3VGL A;  3P39 A;  3UIQ A;  4JKD A;  3CCQ N;  4BDZ A;  4JYA K;  1Y97 A;  1TK5 A;  4NCB A;  1YIJ N;  5H1S Q;  4PKI A;  5AQK A;  3FR0 A;  3CCS N;  1JCE A;  4KBO A;  4OPK A;  1N34 K;  3U8X A;  4DFM A;  4CEQ A;  4JKG A;  2Q97 A;  1LWE A;  4CZJ A;  3TAG A;  4CGH A;  1SL0 A;  1M90 O;  1CZ9 A;  3NAE A;  5BRF A;  4OVL A;  3O3F A;  5HRP A;  1Q9X A;  2E2O A;  3KLG A;  1Z26 A;  4XH4 A;  4B3M K;  3FZK A;  3MCA B;  3VQE A;  5C2D A;  4CK1 A;  1XHX A;  4GV6 A;  1MWM A;  4NO7 A;  3PIO L;  4M63 C;  4B3T K;  2X6S A;  2A40 A;  4A2A A;  2Q36 A;  4CEC A;  4CHN A;  1JKH A;  4DR2 K;  4NXM K;  5AQN A;  4KAZ A;  5M1Q A;  3Q7B A;  5SWM A;  4O5F A;  1VSH A;  4I9L A;  1WUA A;  4RTF D;  3H3N O;  3AY9 A;  3P38 A;  5JS1 A;  4RCH A;  1S1X A;  3KZB A;  4YOY A;  1KAY A;  3C6H A;  3C95 A;  4DSI A;  3CFP A;  1BGX T;  4CFA A;  2YHX A;  3QEV A;  1KVC A;  1W9H A;  2GEM A;  2YV0 X;  4BRC A;  2F7T A;  1DKG D;  3FZF A;  4DV2 K;  4DMN A;  3HL8 A;  2UXC K;  3I8B A;  4FLZ A;  1EO1 A;  1YHQ N;  5BN8 A;  1UOC A;  2XO7 A;  1VSM A;  5LJW A;  2YNI A;  2HHQ A;  5AZJ A;  1S1U A;  5BRE A;  5GAH P;  1RT7 A;  5M1P A;  4NCA A;  3O08 A;  1S6P A;  3LAN A;  3RVC A;  1VQL N;  4YOW A;  1JL2 A;  4MLH A;  4Z4C A;  4H0O A;  4B9N A;  5F2R A;  3H1V X;  4CGI A;  4B9L A;  3SUP A;  1RBT A;  4FJX A;  4EHU A;  2HBM A;  3PY8 A;  2FBV A;  5KPR A;  3WEE B;  2X6N A;  1NK7 A;  2OPR A;  2E8A A;  4CJ3 A;  3CC2 N;  4J2E A;  3GOI A;  4U7B A;  3CJB A;  3WQT A;  2FXU A;  2XY6 A;  4OJR A;  3O9Q A;  4DU3 A;  3BGR A;  4BRO A;  4OPJ A;  2YKN A;  3AO5 A;  2CGL A;  1P8Z A;  2A5X A;  4BR4 A;  1NGF A;  3CHW A;  5DK5 A;  3BF3 A;  4H0X B;  4WQ5 C;  1SAZ A;  2E2Q A;  4GVM A;  2HB5 A;  2RE2 A;  1TAQ A;  5J2M A;  5HBM A;  3U3Y A;  4DB3 A;  2FSJ A;  3VEV A;  2KFZ A;  1WBB A;  3DWL A;  4DTX A;  4AHR A;  4DTP A;  1E3M A;  3MX5 A;  4AHU A;  1I39 A;  3P1G A;  3CG7 A;  3GDQ A;  3L2U A;  4RW8 A;  3A5M C;  4PA1 A;  1XHZ A;  3IS9 A;  3K58 A;  4DTN A;  4FJI A;  5M1F A;  3CJ7 A;  3SPY A;  4FLT A;  4CJU A;  3O9T A;  1IBK K;  3UKU A;  1X9M A;  4K42 A;  3WXL A;  1NGH A;  4XH5 A;  3FE1 A;  3ZT1 A;  1N33 K;  3IRX A;  2Q3S A;  1OH8 A;  4FZY A;  3BP8 A;  5GIO A;  1T03 A;  3G10 A;  1WAJ A;  5KRT A;  2NNW A;  2D0O A;  3H08 A;  2W6K A;  4ELV A;  3AVG A;  1RT1 A;  1DGK N;  3WUH A;  2NRX A;  3SMP A;  1NJZ A;  3OYJ A;  1G15 A;  4DTU A;  4CIE A;  3PLA A;  3CCL N;  5C0Y A;  3AV9 A;  1ITG A;  4PUO A;  3H45 C;  2FBX A;  2ZF5 O;  4CF1 A;  4CJ4 A;  3RSE B;  3K9K A;  3NMU A;  1JLQ A;  5AQP A;  5AFU H;  4DUZ K;  5AQW A;  2UXB K; 
#chains in the Genus database with same CATH homology
 4JI5 K;  2UXD K;  4CW7 B;  3T1Y K;  4LF8 K;  2F4V K;  4JYA K;  3JAM O;  4LF5 K;  4DV1 K;  4DV4 K;  4GKJ K;  4JI3 K;  4LFB K;  5BR8 K;  1N34 K;  4DV7 K;  4GKK K;  1XMQ K;  2UUA K;  4JI1 K;  5IT9 O;  5LL6 Z;  4K0K K;  4DUY K;  2HHH K;  1XNQ K;  4JI8 K;  4LF7 K;  4LF4 K;  4LF6 K;  4DR3 K;  4LFC K;  4DR6 K;  5AJ3 K;  2VQE K;  4B3M K;  1N36 K;  4V19 S;  4DV5 K;  4YY3 K;  3OTO K;  4JI7 K;  3J81 O;  1XNR K;  4B3S K;  1I94 K;  1N32 K;  1HNW K;  4X62 K;  4B3T K;  4JI2 K;  1J5E K;  1FJG K;  1IBL K;  4DR2 K;  4NXM K;  4JI4 K;  4B3R K;  4DR1 K;  1IBK K;  3J80 O;  5FLX O;  4KHP K;  4OX9 K;  3J7A P;  5A2Q O;  4JI0 K;  1N33 K;  4YHH K;  4CVN E;  4X66 K;  1HNX K;  4DV6 K;  4DV3 K;  1IBM K;  4JV5 K;  4LFA K;  4X65 K;  4X64 K;  4DV2 K;  4DR5 K;  3J7Y P;  2ZM6 K;  2VQF K;  2UXC K;  1HNZ K;  4LF9 K;  5LMN K;  5IWA K;  4DV0 K;  4DR7 K;  1XMO K;  4DR4 K;  3T1H K;  2E5L K;  4JI6 K;  2UU9 K;  4AQY K;  2UUC K;  1HR0 K;  4DUZ K;  2UUB K;  4NXN K;  2UXB K;  5LMU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...