1XNQT

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xnqT00
2VQET 4B3MT 2UUBT 4X62T 1IBLT 1XMOT 4GKKT 4DV0T 4JI7T 1HNWT 4JYAT 4DR4T 4LF9T 4LFBT 3OTOT 4JI0T 4LF6T 4JI5T 4LF7T 1HNZT 4DV5T 1I94T 4LF5T 4AQYT 4JI1T 4YY3T 4LFCT 4B3TT 4LF8T 1IBKT 2UXBT 4OX9T 2UUAT 4K0KT 4DV2T 2HHHT 4DV4T 1FJGT 4LFAT 4DR3T 4GKJT 2UUCT 4B3ST 1XNQT 4JI2T 5IWAT 2VQFT 4B3RT 1HNXT 4NXMT 5BR8T 1N36T 4DUZT 1N34T 4X64T 1IBMT 4NXNT 3T1HT 2UXDT 4DR7T 4DR5T 1N33T 4JV5T 4DUYT 2UXCT 1HR0T 4JI6T 3T1YT 4DR1T 5LMUT 4DV1T 4YHHT 2E5LT 4DR2T 1XMQT 4DV7T 4DV3T 1N32T 4JI4T 4DV6T 2F4VT 5LMNT 4DR6T 4X65T 4KHPT 4JI8T 4X66T 1XNRT 1J5ET 4LF4T 2ZM6T 4JI3T 2UU9T
chains in the Genus database with same CATH superfamily
2CA5A 2J1DG 3KINB 3FB2A 1HNWT 1Y01A 2IHR1 2QVAA 3C51A 2DCFA 5AQSB 4OYJA 2PTFA 2D9DA 1CUNA 4N78D 4UV8B 4JI1T 4AI6A 4PFOA 3LBXA 5L3BB 4B3TT 5L2LA 5JR9A 2RA1A 3FZMB 4TZ4C 4HWHA 4DV4T 3PUQA 4AISA 3RIFA 4LFAT 2ZM2A 4COFA 5LYJE 1R8IA 3RC8A 5L3DB 2AE9A 2VQFT 4UIGA 2V7MA 2VL8A 1N36T 3CX6B 2XAHB 3O4XE 5CB4E 5ABFB 2K5BB 5AQUB 4O2AE 3NZPA 4EB6E 3W15B 3MJXA 1IJ5A 3K3OA 1MNDA 4ANJA 3AA1B 2JMHA 2UXCT 1HR0T 2L3LA 3BQLA 3F31A 4IDZA 2UXNB 3U78A 4YHHT 5JRCA 3HA4A 1VCSA 2VASA 1XMQT 3RYCE 2EHOC 4HN9A 5HEOA 4FI5A 2LSYA 4HFCA 3RIUA 4DBQA 4JI4T 2BZBA 2KMFA 4PK5A 5HXEA 2ZM6T 4P0AA 4LMLA 4I55E 3KFWX 1D1BA 1KFYA 4QH5A 4GYRA 4YHJA 2Q9QC 1MNEA 2BS4A 4HGAA 1ZOYA 4DR4T 4KUMB 3QB5A 4LF5T 4O4JE 1B7TA 2D5UA 3CPZA 3MK7C 4LFCT 2NW7A 3AEEA 1ZEEA 2CHOA 2UUAT 1UK5A 4TV8E 3PE0A 3WI3A 2YU2A 4UV9B 4EYYR 4HFVA 2WQYA 2HN2A 4B3RT 4KX6A 4JLEA 3LG7A 5AQOB 3PUVF 5AQHB 4Z8XA 2IC6A 3DJBA 1IZNB 3JAFA 5L4HA 3UUNA 3GN5A 5JR9C 2UXDT 3PUWF 5AQQB 1ZKEA 5F3JA 1N33T 4A56A 2MAWA 2JQKA 4U72A 4DUYT 4QXBB 1VCTA 2B76A 5FXVA 3X1DA 5HYAA 1YW0A 3JAEA 4A5XA 4HFHA 5ABFA 2K9AA 2E9XA 4ZZBA 2R6GF 1YKHB 3P8CD 3N9OA 4AIUA 1N32T 4IL9A 5JDMA 5EK3A 5AQRB 3E0ZA 2JQ9A 2W61A 3ZC0A 5AQPB 3ZYLA 5LJNA 3P4SA 5CGMA 4UXNB 4X62T 4YTMA 3QB5K 4EXTA 3QC9A 1YQ4A 3N2GE 4JYAT 3A5XA 3EABA 4X1YE 3FHNA 2DHRA 4LF7T 1OEDB 1I94T 2X9YA 2C5IT 4YJ3E 4OYKA 4WW0A 2V6YA 4CXXA 2A9UA 3OVUA 4QXCB 2LLYA 4QH4A 4NPPA 1WYCA 4TX5A 1HG5A 1WR6A 2YU1A 4Z90A 3EDUA 1HF8A 3HR0A 5JDFA 3RH3A 4QXHB 4U7YA 5BR8T 4IDNA 3C4ZA 3E08A 4ZOLE 5HXRA 4YTNA 5FMNA 5FY0A 2XM2A 5J2UE 4CN1A 2HN1A 2V5CA 3FZHB 5HEGA 4DR7T 3PJAJ 2MOZA 1MIYA 5ABHA 3RC3A 3T1YT 4DR1T 2EHOD 3TLTA 4UVAB 2W0GA 4QHOA 1U5PA 2RP4A 3ZEFB 2DNXA 3K1SA 3ONLC 2V1DB 2LRKA 3TLSA 4IGUA 2P9BA 2Q9QD 2VQET 4B3MT 1M7KA 2N9DA 3AB3B 3I1AA 4LF9T 2CBJA 1S94A 2L8KA 5DABA 2E9XC 2XSAA 4BAYB 2QRXA 2NOXA 3RI5A 4HTEA 2JQHA 4PK6A 3AE2A 4KP3C 1LVKA 4KI0F 2XQ4A 3C4WA 4EYUA 3N5LA 4IDPA 4NXMT 5HXSA 2KZ7B 1Y64B 3BQIA 3Q5WA 4WBOA 3O9XA 5DQWA 4PAGA 1WFDA 2LEHA 1NAFA 2X9XA 3IF8B 3AEGA 3KVAA 5HEUA 2EHOB 2Z6EA 5A1LA 3KDSE 2LM9A 5HWXA 5CA1E 2WZIA 3SFEA 5FVLA 4LMJA 1L0VA 5KXJA 4DV6T 3ETVA 2IDOB 4JI8T 3MXZA 5LHHB 3AE3A 2V7KA 4G2AA 3O1IA 2ES0A 3D0TA 3Q2MA 3OYXA 2XPKA 1VOMA 3RGLA 2JRKA 3P4QA 4AQYT 2WZHA 2LKHA 4V1Av 3ZSSA 5AQJB 4OHFA 1KNPA 2BVLA 4NUVA 2W63A 2LT3A 3VU7H 2I6HA 2NR4A 2XJ7A 2YK0A 4ILUA 1AJ3A 1D1CA 1UGOA 2C5JA 3E22E 2IAKA 2G0UA 2IIUA 3NVOA 4ZEYA 2WM9A 1KF6A 4IHJE 3ZYKA 3JADA 4ADZA 3RKGA 1SUMB 2X9WA 2HPLA 3IEEA 5LHIB 2D0TA 5L3CB 3MA9A 5H6RB 4YLHA 3AE8A 4JI6T 3ONXA 1NENA 2BBHA 5HCMA 5ABGA 3TLVA 4TUYE 1LVFA 5JQGE 3CMLA 1IAPA 2XQ6A 3A8YC 2XAQB 4HE8A 4XZCA 2YKSA 3P7IA 4UF0A 2CM0A 2VWAA 3B13A 3P50A 1NEKA 1V9DA 3R84B 1FIOA 3BQKA 5LP6E 2LHRA 3PURA 2D2SA 4OK0A 5ADXL 3OPCA 3Q5DA 3JC6C 2YOEA 4C91A 1KEYA 3AEDA 1WR0A 2V7IA 2QYWA 4UEMA 3UQ7A 4CN6A 4ZI7E 2W66A 4IE0A 1X79A 1BR2A 4IT4A 4NIQA 5LGTB 2XQ5A 1WYBA 4AKRB 3T1HT 4I43B 4I0UA 4FJOA 2IC9A 3L3PA 2DL1A 2E2AA 1OWAA 3AAIA 1YD8G 2Y48B 3RQUA 3NKZA 2WWVA 4Q25A 3CQGB 4CI1B 3ZCJA 1XZYA 1J1JA 2BVMA 3I9YA 1BR4A 2ZMAA 2A3DA 5FY1A 5C3JA 3AA6B 4O8SA 4U2ZA 1VRBA 4UELA 1X9BA 2WSSV 3EI0A 4WZXA 2VKHA 2KLQA 3UQ4A 2XZEA 4YY3T 4L9IA 1MMNA 3CWZB 1MIWA 3V5UA 5IYZE 3WAJA 4F8HA 1UX5A 2X0HA 3ANWB 3AXJB 5FY7A 4E7ZA 3KVBA 4DV2T 1QUUA 1OEDE 4DR3T 3HKCE 2LHNA 2MTQA 3B5MA 4A97A 2WDRA 2LOSA 4U74A 4H9RC 1HTJF 2XQ8A 3H37A 2WAUA 4ISSA 3FXEB 4C90A 2Y6XA 3CVRA 4EEBA 2XHEB 3AEBA 5H6QB 2XQ9A 4JEHB 3AE9A 3AA7B 5LG4A 2NWBA 2GK9A 5J1GA 2JIWA 5JTGA 2M67A 4ZI2C 4AQFA 3RYFE 5LB7B 3WAKA 1MMDA 2FJAA 4TNVA 5FXZA 5HXHA 4IE6A 3J7Yq 3QUJA 5M4YA 1HX8A 4K0UA 3ZMUB 3LK2B 2MBGA 2UUBT 4QKNA 4JI7T 3A7MA 3PUYF 5AQIB 3JC6D 2BG9B 3ZYMA 4DMVA 2YDQA 3RYHE 4O2BE 1HNZT 4HWFA 4H63H 5LBQB 3AA0B 2H89A 4IL4A 4QX7B 5FYMA 3LK42 4YSZA 3AEFA 2JPFA 2V26A 2HHHT 3UTKA 4PJNA 3ZT6A 2DLRA 4CZZB 4E7SA 3RX6A 3H3MA 5FXXA 1N34T 3AEAA 2WY2A 3RIUC 3EHZA 5LA6E 2CXFA 4X64T 3KV6A 3KV4A 4KHZF 2XAFB 3AXJA 1XDOA 3DTOA 1MMAA 5AQGB 3ZT7A 2BBJA 4JEUB 5E0OA 2V7LA 2LRLA 5LXTE 2N1GA 3B57A 1EZ3A 1E1HB 1YKEB 2E5VA 2WDVA 3LFMA 2KT9A 2KXPB 4QH1A 2M6BA 2CLYC 5IUXA 3ESLA 5HEJA 1JNZA 2W67A 2JJ9A 3OKQA 4LF4T 2CBIA 4MALA 3P4RA 4EAHA 4AQFC 4CXYA 2ZM8A 1MMGA 4LF6T 4HFIA 2ODUA 4X20E 1XDPA 2JQQA 3LDQB 1G8XA 4K0KT 4P09A 1WRDA 5CFBA 5AQNB 3QK6A 1FJGT 2VURA 5AQMB 5HAXA 3J9X1 5IWAT 3RHWA 4O4IE 1HNXT 4PK4A 2C5KT 3UUMA 4DBRA 4GOUA 5L3GB 3SFDA 2LM2A 5JDHA 4X1KE 2XASB 4NXNT 3PUZF 2CEAA 2V7JA 4UVCB 4ZI2D 2XUEA 4YT0A 3I0QA 4I4TE 1G73A 1OEDA 1YXRA 1S35A 4CQIA 2LSJA 4DO0A 2I59A 4DR2T 2HPJA 1US7B 2VKJA 4PJMA 2KWIB 4IDOA 3O1JA 4CI3B 4IREA 3IHRA 5C8YE 3P4PA 3PV0F 5J0ZA 3SOLA 3AE7A 1QLBA 4O4HE 4JI3T 3KBTA 3K3NA 2H7VC 3NRYA 3RKOA 3ZKRA 4DIDB 5EK2A 4O4LE 2H88A 2Q9QB 4DV5T 1U4QA 4AQGA 3R6NA 2V6XA 3FZKB 2OLTA 2WBLA 3Q5XA 4X1IE 5FP3A 5JREA 4QWNB 3CIRA 4OX9T 3FZLB 2WMNA 4H9QC 2VKDA 4GKJT 4JBWF 3CQCB 2XQ3A 4JI2T 5LHGB 3IA3A 3UULA 4TWHA 4IE5A 5EZYE 2OV9A 4PFPA 3ZMSB 4UVBB 3KBUA 5KDMC 5LGNB 3N9PA 2HH7A 1DU2A 1UX4A 3Q9DA 2FJEA 4P1NA 5FL0A 3PUSA 5JR9B 2KSRA 5JDGA 4X5TA 3UUBA 1IJ6A 3HL6A 3HKEE 4ERRA 4U3CA 2FUPA 3GWHA 2CCQA 4ZHQE 2LSGA 3SWHA 2UU9T 4PW8A 3ABVA 3C50A 2DI4A 4AKGA 2CMRA 4PJLA 3H3AA 4EIWA 1O3XA 1T98A 2PBIA 4GK0E 1CHUA 2BKNA 4H9SE 2EHOA 4A98A 3N9LA 3AECA 4LF8T 1I6ZA 2UXBT 3LJCA 3UT5E 5CA0E 3VKGA 2KWHA 1KK7A 1YQ3A 1KNZA 2UUCT 4UR9A 2E9XD 2KINB 2Q9QA 1SHZC 2X51A 2XSBA 5EK4A 1WCRA 4ZI3C 2ACXA 4BJNA 2NTXA 4AKIA 4U33A 2CPTA 5L47A 5AQVB 3AVSA 3SS1A 4JV5T 4Z91A 4CN4A 3VR9A 3P4WA 1LRZA 1UUSA 3RYIE 4U31A 1FMWA 4KBMB 2ZM0A 2D0UA 4DVDA 3ZN0B 1JNRA 1W9RA 5LMNT 4KHPT 3NRXA 2VVNA 3OYZA 3T8OA 5JDQA 5F8PA 1H7CA 3AAAB 2W2UA 3CQXC 1QSDA 2A72A 2WWUA 4IE4A 3GN5B 3HKBE 4TNWA 3CKDA 5FVKA 3NBXX 3PUAA 4LFBT 4JI0T 4ASKA 5KX5E 4TV9E 5TAOA 1KNRA 2IUBA 5C2TA 2E9XB 3RRWA 2XM1A 2BG9E 1HX1B 3RPUA 2QA7A 1E2AA 3F57A 5LBMA 4TWDA 1HG2A 4ISTA 3K3QC 3TLUA 3Q5EA 3AE4A 4G63A 3FXDB 2M6IA 4DUZT 3C98B 2ODVA 3TLWA 4ILCA 1T7SA 3PDYA 1MIVA 3ZJ1A 4PJJA 3KV9A 3VHLA 5L3FB 3I0OA 4HWIB 4ZS3A 2A2FX 5LNKA 2V6YB 5LMUT 4BA9A 3M3ZB 3ZMTB 5CJ5A 2E5LT 4EGWA 4ILBA 3O1HA 1T8BA 2NW9A 3S4UA 3PJAA 5HEHA 4X65T 4X66T 1XNRT 2J4GA 3UFGA 3ZPOA 2FJBA 1Z8UA 3VR8A 3ZJ2A 3ZSTA 4HKAA 2SPCA 5LG3A 4QX8B 4LMKA 3ZMZB 2W62A 5DQVA 5AQKB 4CXWA 4AKLA 3RRCA 4BJMA 1FEWA 5GONE 2UXXB 4H9NC 4TWFA 5LOVE 3CX8B 5JVDE 2MYSA 4L5GA 3LSVA 3RIAA 4P0BA 2DWKA 4IE7A 4TN7B 5JDLA 2N2NA 4NUUA 2XAGB 5FXWA 4ZI3D 3CK6A 3C64A 4HEAA 2NP9A 4WYVA 2BKPA 2IMLA 1BR0A 2C0SA 4WBNE 1D0YA 2LE8A 4DR5T 3HI2A 5KMGP 2V5DA 3BK9A 4PNIA 3ETUA 5BMVE 3MACA 4U7IA 1HCIA 4IIJE 5AQTB 3RQWA 2I0MA 5HWYA 4MLKA 2PG8A 1SE7A 2WP9A 3AAEB 3ANWA 3UFEA 3TKLB 3EVYA 2VL0A 2CHNA 2XQ7A 4ZZCA 2JMKA 5LCYA 2XQYA 1OXZA 1XWMA 3N9QA 2K48A 2YEVC 1IBLT 2XY8B 1XMOT 4YSXA 4GKKT 1D0ZA 2L9QA 3I9WA 1W0AA 2MPKA 2NTYA 4EZHA 4EZ4A 2WCAA 3C4XA 2X9HA 1ZHCA 3GA8A 2BS3A 5HCJA 2FJDA 4F6RC 4GYSA 4B3ST 4M1PA 1XNQT 1E7PA 3N9NA 4HFBA 2K3WA 3QNUA 1NWMX 3OJAA 4EV6A 1ZP0A 4WNKA 1W0BA 3N2KE 4YXDA 5L4EA 1IBMT 2VKOA 1BR1A 5IHYA 3UU8A 2YINA 3NWIA 1J5WA 3RLFF 4YSYA 2BG9A 2XAJB 2X67A 4EEDA 4DV1T 3EAMA 2IW5B 5F5WA 4MBQA 2WU5A 2OA5A 3UU3A 4DV7T 3AVRA 4KMCA 4DMWA 2WS3A 4I50E 4ZS2A 3QOFA 5HXCA 2Y8DA 4AKHA 3KV5A 4YTPA 2CWYA 1HS7A 2X68A 3MZKB 2VK9A 3PTRB 4ILAA 4YJ2E 4DV0T 1D1AA 2WB5A 4J2CA 1Z0PA 3OTOT 4JI5T 3MKDA 2KNDA 3PU8A 2BS2A 3RF1A 5L3EB 3F2EA 1HFAA 2X0LB 4HWDA 3DP7A 3PUGA 2W00A 5AQLB 2AXDS 2CRBA 2QGSA 3UU5A 4UF0B 5AFUL 3ZCIA 1FMVA 5DJQC 4L0RA 4YFSA 3G06A 2DWGA 5ABEA 2VVSA 4B6XA 2ZLYA 2XTLA 3UU4A 4U2YA 3FZFB 4OFZA 3VRBA 5AQFB 2BKOA 4H9OC 3FBLA 3LK3B 3EDVA 3UU6A 2WDQA 4HFEA 2E8IA 4XBFB 2X0YA 1M62A 2CWOA 1LKXA 3FBZA 4H9PC 2YDSA 2WU2A 4HFDA 1W09A 3UUXB 4HWCA 2J62A 4MFRA 2BDEA 2LKGA 4DV3T 5FNVE 3ZN1B 2F4VT 4AXPA 3LBXB 3U3IA 2X66A 3L8RA 2YN6A 5LGUB 1J5ET 2H3RA 2K24A 2RPAA 2LSIA 2LSKA 4XAXB 1GQEA 2LOPA 3ZC1A 4EOZB 2BG9C 3ZLIA 2XQAA 2ACZA 5FL1A 3AE1A 4GIWA 2PFVA 5LJMA 3AE5A 2PJQA 2CXDA 3GMIA 3VRAA 2W4XA 3L09A 3VKHA 2FBWA 1IBKT 2WMOA 2H7OA 4MHCA 3SRZA 1OEDC 1SA0E 4ZXLA 3CX7B 4DNDA 3V5SA 3N9MA 4CI2B 3ZMVB 1UCUA 4H63V 2NW8A 5JRCB 1ZV4X 3N2OA 1UURA 4GK5E 5JDNA 3M65A 2YDRA 3PU3A 1D0XA 3PUXF 3OBVE 3ZT5A 4IDQA 3ONJA 5FKYA 2CXLA 2B1EA 2J47A 3HKDE 1WLXA 5ETWA 2CE7A 3L39A 1T72A 3EUHA 4DR6T 2VB6A 3JCFA 2CLYB 2V8SV 5JH7E 2LJLA 5J2TE 4JUYA 3IBPA 3NZQA 3AE6A 3K8PC
chains in the Genus database with same CATH topology
2VQET 4B3MT 2UUBT 4X62T 1IBLT 1XMOT 4GKKT 4DV0T 4JI7T 1HNWT 4JYAT 4DR4T 4LF9T 4LFBT 3OTOT 4JI0T 4LF6T 4JI5T 4LF7T 1HNZT 4DV5T 1I94T 4LF5T 4AQYT 4JI1T 4YY3T 4LFCT 4B3TT 4LF8T 1IBKT 2UXBT 4OX9T 2UUAT 4K0KT 4DV2T 2HHHT 4DV4T 1FJGT 4LFAT 4DR3T 4GKJT 2UUCT 4B3ST 1XNQT 4JI2T 5IWAT 2VQFT 4B3RT 1HNXT 4NXMT 5BR8T 1N36T 4DUZT 1N34T 4X64T 1IBMT 4NXNT 3T1HT 2UXDT 4DR7T 4DR5T 1N33T 4JV5T 4DUYT 2UXCT 1HR0T 4JI6T 3T1YT 4DR1T 5LMUT 4DV1T 4YHHT 2E5LT 4DR2T 1XMQT 4DV7T 4DV3T 1N32T 4JI4T 4DV6T 2F4VT 5LMNT 4DR6T 4X65T 4KHPT 4JI8T 4X66T 1XNRT 1J5ET 4LF4T 2ZM6T 4JI3T 2UU9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE T;  4B3M T;  2UUB T;  4X62 T;  1IBL T;  1XMO T;  4GKK T;  4DV0 T;  4JI7 T;  1HNW T;  4JYA T;  4DR4 T;  4LF9 T;  4LFB T;  3OTO T;  4JI0 T;  4LF6 T;  4JI5 T;  4LF7 T;  1HNZ T;  4DV5 T;  1I94 T;  4LF5 T;  4AQY T;  4JI1 T;  4YY3 T;  4LFC T;  4B3T T;  4LF8 T;  1IBK T;  2UXB T;  4OX9 T;  2UUA T;  4K0K T;  4DV2 T;  2HHH T;  4DV4 T;  1FJG T;  4LFA T;  4DR3 T;  4GKJ T;  2UUC T;  4B3S T;  1XNQ T;  4JI2 T;  5IWA T;  2VQF T;  4B3R T;  1HNX T;  4NXM T;  5BR8 T;  1N36 T;  4DUZ T;  1N34 T;  4X64 T;  1IBM T;  4NXN T;  3T1H T;  2UXD T;  4DR7 T;  4DR5 T;  1N33 T;  4JV5 T;  4DUY T;  2UXC T;  1HR0 T;  4JI6 T;  3T1Y T;  4DR1 T;  5LMU T;  4DV1 T;  4YHH T;  2E5L T;  4DR2 T;  1XMQ T;  4DV7 T;  4DV3 T;  1N32 T;  4JI4 T;  4DV6 T;  2F4V T;  5LMN T;  4DR6 T;  4X65 T;  4KHP T;  4JI8 T;  4X66 T;  1XNR T;  1J5E T;  4LF4 T;  2ZM6 T;  4JI3 T;  2UU9 T; 
#chains in the Genus database with same CATH topology
 2CA5 A;  2J1D G;  3KIN B;  3FB2 A;  1HNW T;  1Y01 A;  2IHR 1;  2QVA A;  3C51 A;  2DCF A;  5AQS B;  4OYJ A;  2PTF A;  2D9D A;  1CUN A;  4N78 D;  4UV8 B;  4JI1 T;  4AI6 A;  4PFO A;  3LBX A;  5L3B B;  4B3T T;  5L2L A;  5JR9 A;  2RA1 A;  3FZM B;  4TZ4 C;  4HWH A;  4DV4 T;  3PUQ A;  4AIS A;  3RIF A;  4LFA T;  2ZM2 A;  4COF A;  5LYJ E;  1R8I A;  3RC8 A;  5L3D B;  2AE9 A;  2VQF T;  4UIG A;  2V7M A;  2VL8 A;  1N36 T;  3CX6 B;  2XAH B;  3O4X E;  5CB4 E;  5ABF B;  2K5B B;  5AQU B;  4O2A E;  3NZP A;  4EB6 E;  3W15 B;  3MJX A;  1IJ5 A;  3K3O A;  1MND A;  4ANJ A;  3AA1 B;  2JMH A;  2UXC T;  1HR0 T;  2L3L A;  3BQL A;  3F31 A;  4IDZ A;  2UXN B;  3U78 A;  4YHH T;  5JRC A;  3HA4 A;  1VCS A;  2VAS A;  1XMQ T;  3RYC E;  2EHO C;  4HN9 A;  5HEO A;  4FI5 A;  2LSY A;  4HFC A;  3RIU A;  4DBQ A;  4JI4 T;  2BZB A;  2KMF A;  4PK5 A;  5HXE A;  2ZM6 T;  4P0A A;  4LML A;  4I55 E;  3KFW X;  1D1B A;  1KFY A;  4QH5 A;  4GYR A;  4YHJ A;  2Q9Q C;  1MNE A;  2BS4 A;  4HGA A;  1ZOY A;  4DR4 T;  4KUM B;  3QB5 A;  4LF5 T;  4O4J E;  1B7T A;  2D5U A;  3CPZ A;  3MK7 C;  4LFC T;  2NW7 A;  3AEE A;  1ZEE A;  2CHO A;  2UUA T;  1UK5 A;  4TV8 E;  3PE0 A;  3WI3 A;  2YU2 A;  4UV9 B;  4EYY R;  4HFV A;  2WQY A;  2HN2 A;  4B3R T;  4KX6 A;  4JLE A;  3LG7 A;  5AQO B;  3PUV F;  5AQH B;  4Z8X A;  2IC6 A;  3DJB A;  1IZN B;  3JAF A;  5L4H A;  3UUN A;  3GN5 A;  5JR9 C;  2UXD T;  3PUW F;  5AQQ B;  1ZKE A;  5F3J A;  1N33 T;  4A56 A;  2MAW A;  2JQK A;  4U72 A;  4DUY T;  4QXB B;  1VCT A;  2B76 A;  5FXV A;  3X1D A;  5HYA A;  1YW0 A;  3JAE A;  4A5X A;  4HFH A;  5ABF A;  2K9A A;  2E9X A;  4ZZB A;  2R6G F;  1YKH B;  3P8C D;  3N9O A;  4AIU A;  1N32 T;  4IL9 A;  5JDM A;  5EK3 A;  5AQR B;  3E0Z A;  2JQ9 A;  2W61 A;  3ZC0 A;  5AQP B;  3ZYL A;  5LJN A;  3P4S A;  5CGM A;  4UXN B;  4X62 T;  4YTM A;  3QB5 K;  4EXT A;  3QC9 A;  1YQ4 A;  3N2G E;  4JYA T;  3A5X A;  3EAB A;  4X1Y E;  3FHN A;  2DHR A;  4LF7 T;  1OED B;  1I94 T;  2X9Y A;  2C5I T;  4YJ3 E;  4OYK A;  4WW0 A;  2V6Y A;  4CXX A;  2A9U A;  3OVU A;  4QXC B;  2LLY A;  4QH4 A;  4NPP A;  1WYC A;  4TX5 A;  1HG5 A;  1WR6 A;  2YU1 A;  4Z90 A;  3EDU A;  1HF8 A;  3HR0 A;  5JDF A;  3RH3 A;  4QXH B;  4U7Y A;  5BR8 T;  4IDN A;  3C4Z A;  3E08 A;  4ZOL E;  5HXR A;  4YTN A;  5FMN A;  5FY0 A;  2XM2 A;  5J2U E;  4CN1 A;  2HN1 A;  2V5C A;  3FZH B;  5HEG A;  4DR7 T;  3PJA J;  2MOZ A;  1MIY A;  5ABH A;  3RC3 A;  3T1Y T;  4DR1 T;  2EHO D;  3TLT A;  4UVA B;  2W0G A;  4QHO A;  1U5P A;  2RP4 A;  3ZEF B;  2DNX A;  3K1S A;  3ONL C;  2V1D B;  2LRK A;  3TLS A;  4IGU A;  2P9B A;  2Q9Q D;  2VQE T;  4B3M T;  1M7K A;  2N9D A;  3AB3 B;  3I1A A;  4LF9 T;  2CBJ A;  1S94 A;  2L8K A;  5DAB A;  2E9X C;  2XSA A;  4BAY B;  2QRX A;  2NOX A;  3RI5 A;  4HTE A;  2JQH A;  4PK6 A;  3AE2 A;  4KP3 C;  1LVK A;  4KI0 F;  2XQ4 A;  3C4W A;  4EYU A;  3N5L A;  4IDP A;  4NXM T;  5HXS A;  2KZ7 B;  1Y64 B;  3BQI A;  3Q5W A;  4WBO A;  3O9X A;  5DQW A;  4PAG A;  1WFD A;  2LEH A;  1NAF A;  2X9X A;  3IF8 B;  3AEG A;  3KVA A;  5HEU A;  2EHO B;  2Z6E A;  5A1L A;  3KDS E;  2LM9 A;  5HWX A;  5CA1 E;  2WZI A;  3SFE A;  5FVL A;  4LMJ A;  1L0V A;  5KXJ A;  4DV6 T;  3ETV A;  2IDO B;  4JI8 T;  3MXZ A;  5LHH B;  3AE3 A;  2V7K A;  4G2A A;  3O1I A;  2ES0 A;  3D0T A;  3Q2M A;  3OYX A;  2XPK A;  1VOM A;  3RGL A;  2JRK A;  3P4Q A;  4AQY T;  2WZH A;  2LKH A;  4V1A v;  3ZSS A;  5AQJ B;  4OHF A;  1KNP A;  2BVL A;  4NUV A;  2W63 A;  2LT3 A;  3VU7 H;  2I6H A;  2NR4 A;  2XJ7 A;  2YK0 A;  4ILU A;  1AJ3 A;  1D1C A;  1UGO A;  2C5J A;  3E22 E;  2IAK A;  2G0U A;  2IIU A;  3NVO A;  4ZEY A;  2WM9 A;  1KF6 A;  4IHJ E;  3ZYK A;  3JAD A;  4ADZ A;  3RKG A;  1SUM B;  2X9W A;  2HPL A;  3IEE A;  5LHI B;  2D0T A;  5L3C B;  3MA9 A;  5H6R B;  4YLH A;  3AE8 A;  4JI6 T;  3ONX A;  1NEN A;  2BBH A;  5HCM A;  5ABG A;  3TLV A;  4TUY E;  1LVF A;  5JQG E;  3CML A;  1IAP A;  2XQ6 A;  3A8Y C;  2XAQ B;  4HE8 A;  4XZC A;  2YKS A;  3P7I A;  4UF0 A;  2CM0 A;  2VWA A;  3B13 A;  3P50 A;  1NEK A;  1V9D A;  3R84 B;  1FIO A;  3BQK A;  5LP6 E;  2LHR A;  3PUR A;  2D2S A;  4OK0 A;  5ADX L;  3OPC A;  3Q5D A;  3JC6 C;  2YOE A;  4C91 A;  1KEY A;  3AED A;  1WR0 A;  2V7I A;  2QYW A;  4UEM A;  3UQ7 A;  4CN6 A;  4ZI7 E;  2W66 A;  4IE0 A;  1X79 A;  1BR2 A;  4IT4 A;  4NIQ A;  5LGT B;  2XQ5 A;  1WYB A;  4AKR B;  3T1H T;  4I43 B;  4I0U A;  4FJO A;  2IC9 A;  3L3P A;  2DL1 A;  2E2A A;  1OWA A;  3AAI A;  1YD8 G;  2Y48 B;  3RQU A;  3NKZ A;  2WWV A;  4Q25 A;  3CQG B;  4CI1 B;  3ZCJ A;  1XZY A;  1J1J A;  2BVM A;  3I9Y A;  1BR4 A;  2ZMA A;  2A3D A;  5FY1 A;  5C3J A;  3AA6 B;  4O8S A;  4U2Z A;  1VRB A;  4UEL A;  1X9B A;  2WSS V;  3EI0 A;  4WZX A;  2VKH A;  2KLQ A;  3UQ4 A;  2XZE A;  4YY3 T;  4L9I A;  1MMN A;  3CWZ B;  1MIW A;  3V5U A;  5IYZ E;  3WAJ A;  4F8H A;  1UX5 A;  2X0H A;  3ANW B;  3AXJ B;  5FY7 A;  4E7Z A;  3KVB A;  4DV2 T;  1QUU A;  1OED E;  4DR3 T;  3HKC E;  2LHN A;  2MTQ A;  3B5M A;  4A97 A;  2WDR A;  2LOS A;  4U74 A;  4H9R C;  1HTJ F;  2XQ8 A;  3H37 A;  2WAU A;  4ISS A;  3FXE B;  4C90 A;  2Y6X A;  3CVR A;  4EEB A;  2XHE B;  3AEB A;  5H6Q B;  2XQ9 A;  4JEH B;  3AE9 A;  3AA7 B;  5LG4 A;  2NWB A;  2GK9 A;  5J1G A;  2JIW A;  5JTG A;  2M67 A;  4ZI2 C;  4AQF A;  3RYF E;  5LB7 B;  3WAK A;  1MMD A;  2FJA A;  4TNV A;  5FXZ A;  5HXH A;  4IE6 A;  3J7Y q;  3QUJ A;  5M4Y A;  1HX8 A;  4K0U A;  3ZMU B;  3LK2 B;  2MBG A;  2UUB T;  4QKN A;  4JI7 T;  3A7M A;  3PUY F;  5AQI B;  3JC6 D;  2BG9 B;  3ZYM A;  4DMV A;  2YDQ A;  3RYH E;  4O2B E;  1HNZ T;  4HWF A;  4H63 H;  5LBQ B;  3AA0 B;  2H89 A;  4IL4 A;  4QX7 B;  5FYM A;  3LK4 2;  4YSZ A;  3AEF A;  2JPF A;  2V26 A;  2HHH T;  3UTK A;  4PJN A;  3ZT6 A;  2DLR A;  4CZZ B;  4E7S A;  3RX6 A;  3H3M A;  5FXX A;  1N34 T;  3AEA A;  2WY2 A;  3RIU C;  3EHZ A;  5LA6 E;  2CXF A;  4X64 T;  3KV6 A;  3KV4 A;  4KHZ F;  2XAF B;  3AXJ A;  1XDO A;  3DTO A;  1MMA A;  5AQG B;  3ZT7 A;  2BBJ A;  4JEU B;  5E0O A;  2V7L A;  2LRL A;  5LXT E;  2N1G A;  3B57 A;  1EZ3 A;  1E1H B;  1YKE B;  2E5V A;  2WDV A;  3LFM A;  2KT9 A;  2KXP B;  4QH1 A;  2M6B A;  2CLY C;  5IUX A;  3ESL A;  5HEJ A;  1JNZ A;  2W67 A;  2JJ9 A;  3OKQ A;  4LF4 T;  2CBI A;  4MAL A;  3P4R A;  4EAH A;  4AQF C;  4CXY A;  2ZM8 A;  1MMG A;  4LF6 T;  4HFI A;  2ODU A;  4X20 E;  1XDP A;  2JQQ A;  3LDQ B;  1G8X A;  4K0K T;  4P09 A;  1WRD A;  5CFB A;  5AQN B;  3QK6 A;  1FJG T;  2VUR A;  5AQM B;  5HAX A;  3J9X 1;  5IWA T;  3RHW A;  4O4I E;  1HNX T;  4PK4 A;  2C5K T;  3UUM A;  4DBR A;  4GOU A;  5L3G B;  3SFD A;  2LM2 A;  5JDH A;  4X1K E;  2XAS B;  4NXN T;  3PUZ F;  2CEA A;  2V7J A;  4UVC B;  4ZI2 D;  2XUE A;  4YT0 A;  3I0Q A;  4I4T E;  1G73 A;  1OED A;  1YXR A;  1S35 A;  4CQI A;  2LSJ A;  4DO0 A;  2I59 A;  4DR2 T;  2HPJ A;  1US7 B;  2VKJ A;  4PJM A;  2KWI B;  4IDO A;  3O1J A;  4CI3 B;  4IRE A;  3IHR A;  5C8Y E;  3P4P A;  3PV0 F;  5J0Z A;  3SOL A;  3AE7 A;  1QLB A;  4O4H E;  4JI3 T;  3KBT A;  3K3N A;  2H7V C;  3NRY A;  3RKO A;  3ZKR A;  4DID B;  5EK2 A;  4O4L E;  2H88 A;  2Q9Q B;  4DV5 T;  1U4Q A;  4AQG A;  3R6N A;  2V6X A;  3FZK B;  2OLT A;  2WBL A;  3Q5X A;  4X1I E;  5FP3 A;  5JRE A;  4QWN B;  3CIR A;  4OX9 T;  3FZL B;  2WMN A;  4H9Q C;  2VKD A;  4GKJ T;  4JBW F;  3CQC B;  2XQ3 A;  4JI2 T;  5LHG B;  3IA3 A;  3UUL A;  4TWH A;  4IE5 A;  5EZY E;  2OV9 A;  4PFP A;  3ZMS B;  4UVB B;  3KBU A;  5KDM C;  5LGN B;  3N9P A;  2HH7 A;  1DU2 A;  1UX4 A;  3Q9D A;  2FJE A;  4P1N A;  5FL0 A;  3PUS A;  5JR9 B;  2KSR A;  5JDG A;  4X5T A;  3UUB A;  1IJ6 A;  3HL6 A;  3HKE E;  4ERR A;  4U3C A;  2FUP A;  3GWH A;  2CCQ A;  4ZHQ E;  2LSG A;  3SWH A;  2UU9 T;  4PW8 A;  3ABV A;  3C50 A;  2DI4 A;  4AKG A;  2CMR A;  4PJL A;  3H3A A;  4EIW A;  1O3X A;  1T98 A;  2PBI A;  4GK0 E;  1CHU A;  2BKN A;  4H9S E;  2EHO A;  4A98 A;  3N9L A;  3AEC A;  4LF8 T;  1I6Z A;  2UXB T;  3LJC A;  3UT5 E;  5CA0 E;  3VKG A;  2KWH A;  1KK7 A;  1YQ3 A;  1KNZ A;  2UUC T;  4UR9 A;  2E9X D;  2KIN B;  2Q9Q A;  1SHZ C;  2X51 A;  2XSB A;  5EK4 A;  1WCR A;  4ZI3 C;  2ACX A;  4BJN A;  2NTX A;  4AKI A;  4U33 A;  2CPT A;  5L47 A;  5AQV B;  3AVS A;  3SS1 A;  4JV5 T;  4Z91 A;  4CN4 A;  3VR9 A;  3P4W A;  1LRZ A;  1UUS A;  3RYI E;  4U31 A;  1FMW A;  4KBM B;  2ZM0 A;  2D0U A;  4DVD A;  3ZN0 B;  1JNR A;  1W9R A;  5LMN T;  4KHP T;  3NRX A;  2VVN A;  3OYZ A;  3T8O A;  5JDQ A;  5F8P A;  1H7C A;  3AAA B;  2W2U A;  3CQX C;  1QSD A;  2A72 A;  2WWU A;  4IE4 A;  3GN5 B;  3HKB E;  4TNW A;  3CKD A;  5FVK A;  3NBX X;  3PUA A;  4LFB T;  4JI0 T;  4ASK A;  5KX5 E;  4TV9 E;  5TAO A;  1KNR A;  2IUB A;  5C2T A;  2E9X B;  3RRW A;  2XM1 A;  2BG9 E;  1HX1 B;  3RPU A;  2QA7 A;  1E2A A;  3F57 A;  5LBM A;  4TWD A;  1HG2 A;  4IST A;  3K3Q C;  3TLU A;  3Q5E A;  3AE4 A;  4G63 A;  3FXD B;  2M6I A;  4DUZ T;  3C98 B;  2ODV A;  3TLW A;  4ILC A;  1T7S A;  3PDY A;  1MIV A;  3ZJ1 A;  4PJJ A;  3KV9 A;  3VHL A;  5L3F B;  3I0O A;  4HWI B;  4ZS3 A;  2A2F X;  5LNK A;  2V6Y B;  5LMU T;  4BA9 A;  3M3Z B;  3ZMT B;  5CJ5 A;  2E5L T;  4EGW A;  4ILB A;  3O1H A;  1T8B A;  2NW9 A;  3S4U A;  3PJA A;  5HEH A;  4X65 T;  4X66 T;  1XNR T;  2J4G A;  3UFG A;  3ZPO A;  2FJB A;  1Z8U A;  3VR8 A;  3ZJ2 A;  3ZST A;  4HKA A;  2SPC A;  5LG3 A;  4QX8 B;  4LMK A;  3ZMZ B;  2W62 A;  5DQV A;  5AQK B;  4CXW A;  4AKL A;  3RRC A;  4BJM A;  1FEW A;  5GON E;  2UXX B;  4H9N C;  4TWF A;  5LOV E;  3CX8 B;  5JVD E;  2MYS A;  4L5G A;  3LSV A;  3RIA A;  4P0B A;  2DWK A;  4IE7 A;  4TN7 B;  5JDL A;  2N2N A;  4NUU A;  2XAG B;  5FXW A;  4ZI3 D;  3CK6 A;  3C64 A;  4HEA A;  2NP9 A;  4WYV A;  2BKP A;  2IML A;  1BR0 A;  2C0S A;  4WBN E;  1D0Y A;  2LE8 A;  4DR5 T;  3HI2 A;  5KMG P;  2V5D A;  3BK9 A;  4PNI A;  3ETU A;  5BMV E;  3MAC A;  4U7I A;  1HCI A;  4IIJ E;  5AQT B;  3RQW A;  2I0M A;  5HWY A;  4MLK A;  2PG8 A;  1SE7 A;  2WP9 A;  3AAE B;  3ANW A;  3UFE A;  3TKL B;  3EVY A;  2VL0 A;  2CHN A;  2XQ7 A;  4ZZC A;  2JMK A;  5LCY A;  2XQY A;  1OXZ A;  1XWM A;  3N9Q A;  2K48 A;  2YEV C;  1IBL T;  2XY8 B;  1XMO T;  4YSX A;  4GKK T;  1D0Z A;  2L9Q A;  3I9W A;  1W0A A;  2MPK A;  2NTY A;  4EZH A;  4EZ4 A;  2WCA A;  3C4X A;  2X9H A;  1ZHC A;  3GA8 A;  2BS3 A;  5HCJ A;  2FJD A;  4F6R C;  4GYS A;  4B3S T;  4M1P A;  1XNQ T;  1E7P A;  3N9N A;  4HFB A;  2K3W A;  3QNU A;  1NWM X;  3OJA A;  4EV6 A;  1ZP0 A;  4WNK A;  1W0B A;  3N2K E;  4YXD A;  5L4E A;  1IBM T;  2VKO A;  1BR1 A;  5IHY A;  3UU8 A;  2YIN A;  3NWI A;  1J5W A;  3RLF F;  4YSY A;  2BG9 A;  2XAJ B;  2X67 A;  4EED A;  4DV1 T;  3EAM A;  2IW5 B;  5F5W A;  4MBQ A;  2WU5 A;  2OA5 A;  3UU3 A;  4DV7 T;  3AVR A;  4KMC A;  4DMW A;  2WS3 A;  4I50 E;  4ZS2 A;  3QOF A;  5HXC A;  2Y8D A;  4AKH A;  3KV5 A;  4YTP A;  2CWY A;  1HS7 A;  2X68 A;  3MZK B;  2VK9 A;  3PTR B;  4ILA A;  4YJ2 E;  4DV0 T;  1D1A A;  2WB5 A;  4J2C A;  1Z0P A;  3OTO T;  4JI5 T;  3MKD A;  2KND A;  3PU8 A;  2BS2 A;  3RF1 A;  5L3E B;  3F2E A;  1HFA A;  2X0L B;  4HWD A;  3DP7 A;  3PUG A;  2W00 A;  5AQL B;  2AXD S;  2CRB A;  2QGS A;  3UU5 A;  4UF0 B;  5AFU L;  3ZCI A;  1FMV A;  5DJQ C;  4L0R A;  4YFS A;  3G06 A;  2DWG A;  5ABE A;  2VVS A;  4B6X A;  2ZLY A;  2XTL A;  3UU4 A;  4U2Y A;  3FZF B;  4OFZ A;  3VRB A;  5AQF B;  2BKO A;  4H9O C;  3FBL A;  3LK3 B;  3EDV A;  3UU6 A;  2WDQ A;  4HFE A;  2E8I A;  4XBF B;  2X0Y A;  1M62 A;  2CWO A;  1LKX A;  3FBZ A;  4H9P C;  2YDS A;  2WU2 A;  4HFD A;  1W09 A;  3UUX B;  4HWC A;  2J62 A;  4MFR A;  2BDE A;  2LKG A;  4DV3 T;  5FNV E;  3ZN1 B;  2F4V T;  4AXP A;  3LBX B;  3U3I A;  2X66 A;  3L8R A;  2YN6 A;  5LGU B;  1J5E T;  2H3R A;  2K24 A;  2RPA A;  2LSI A;  2LSK A;  4XAX B;  1GQE A;  2LOP A;  3ZC1 A;  4EOZ B;  2BG9 C;  3ZLI A;  2XQA A;  2ACZ A;  5FL1 A;  3AE1 A;  4GIW A;  2PFV A;  5LJM A;  3AE5 A;  2PJQ A;  2CXD A;  3GMI A;  3VRA A;  2W4X A;  3L09 A;  3VKH A;  2FBW A;  1IBK T;  2WMO A;  2H7O A;  4MHC A;  3SRZ A;  1OED C;  1SA0 E;  4ZXL A;  3CX7 B;  4DND A;  3V5S A;  3N9M A;  4CI2 B;  3ZMV B;  1UCU A;  4H63 V;  2NW8 A;  5JRC B;  1ZV4 X;  3N2O A;  1UUR A;  4GK5 E;  5JDN A;  3M65 A;  2YDR A;  3PU3 A;  1D0X A;  3PUX F;  3OBV E;  3ZT5 A;  4IDQ A;  3ONJ A;  5FKY A;  2CXL A;  2B1E A;  2J47 A;  3HKD E;  1WLX A;  5ETW A;  2CE7 A;  3L39 A;  1T72 A;  3EUH A;  4DR6 T;  2VB6 A;  3JCF A;  2CLY B;  2V8S V;  5JH7 E;  2LJL A;  5J2T E;  4JUY A;  3IBP A;  3NZQ A;  3AE6 A;  3K8P C; 
#chains in the Genus database with same CATH homology
 2VQE T;  4B3M T;  2UUB T;  4X62 T;  1IBL T;  1XMO T;  4GKK T;  4DV0 T;  4JI7 T;  1HNW T;  4JYA T;  4DR4 T;  4LF9 T;  4LFB T;  3OTO T;  4JI0 T;  4LF6 T;  4JI5 T;  4LF7 T;  1HNZ T;  4DV5 T;  1I94 T;  4LF5 T;  4AQY T;  4JI1 T;  4YY3 T;  4LFC T;  4B3T T;  4LF8 T;  1IBK T;  2UXB T;  4OX9 T;  2UUA T;  4K0K T;  4DV2 T;  2HHH T;  4DV4 T;  1FJG T;  4LFA T;  4DR3 T;  4GKJ T;  2UUC T;  4B3S T;  1XNQ T;  4JI2 T;  5IWA T;  2VQF T;  4B3R T;  1HNX T;  4NXM T;  5BR8 T;  1N36 T;  4DUZ T;  1N34 T;  4X64 T;  1IBM T;  4NXN T;  3T1H T;  2UXD T;  4DR7 T;  4DR5 T;  1N33 T;  4JV5 T;  4DUY T;  2UXC T;  1HR0 T;  4JI6 T;  3T1Y T;  4DR1 T;  5LMU T;  4DV1 T;  4YHH T;  2E5L T;  4DR2 T;  1XMQ T;  4DV7 T;  4DV3 T;  1N32 T;  4JI4 T;  4DV6 T;  2F4V T;  5LMN T;  4DR6 T;  4X65 T;  4KHP T;  4JI8 T;  4X66 T;  1XNR T;  1J5E T;  4LF4 T;  2ZM6 T;  4JI3 T;  2UU9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...