1XNQT

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xnqT00
4JI2T 5LMNT 1HNWT 4JYAT 4DR3T 2VQET 3T1YT 4X66T 4DUYT 4JI1T 4LF8T 4B3RT 5BR8T 5IWAT 1HNZT 3T1HT 4JV5T 1XMOT 1N34T 1XNRT 4DR1T 4DV4T 1HNXT 1N32T 4X62T 4X65T 4LF9T 2UUCT 4NXMT 4K0KT 2HHHT 2UUAT 4JI0T 4JI7T 5LMUT 4LFCT 4B3TT 4DR2T 3OTOT 4YY3T 4DV7T 1XNQT 4LFBT 4DV0T 4DV6T 1J5ET 2UUBT 4JI4T 1HR0T 4LF5T 2VQFT 4LF6T 2ZM6T 4OX9T 4GKKT 2UXBT 1IBMT 4NXNT 2F4VT 2UU9T 4LF7T 4DV2T 1FJGT 1I94T 4X64T 4DR7T 4LFAT 1N33T 2UXCT 4DR4T 1IBLT 4DUZT 4JI6T 4DR6T 2UXDT 4DV1T 4B3ST 1N36T 4AQYT 4B3MT 4YHHT 4DV5T 4JI8T 4GKJT 4DV3T 4JI3T 4DR5T 4LF4T 1IBKT 1XMQT 2E5LT 4KHPT 4JI5T
chains in the Genus database with same CATH superfamily
2E5VA 1YQ3A 3UUBA 4PFOA 2CBJA 5FKYA 4BJNA 5HXCA 4X66T 2KINB 4P1NA 3A8YC 4QH5A 4B3RT 2I6HA 3DP7A 2PFVA 4IL4A 4EOZB 3B13A 4UXNB 4DV4T 3ZJ2A 1N32T 3FXEB 3TLWA 4LF9T 3W15B 4HTEA 5CJ5A 5L3EB 4GIWA 4QXHB 5JDHA 2NW9A 4H9PC 1LVKA 4BJMA 3CPZA 3LJCA 4AIUA 2CXLA 4AKGA 2W66A 5FY0A 5FXWA 4NXNT 2BG9B 2F4VT 3RYFE 5JDQA 4I0UA 3HKDE 2K3WA 3F31A 3FZLB 2M67A 5JH7E 3ZSSA 3HKBE 2WCAA 2EHOA 2VKJA 4MLKA 2D2SA 4B6XA 2WDQA 4I50E 4TUYE 3AEAA 3TLTA 4LMJA 5L3FB 4B3MT 5ABGA 3KINB 4KBMB 4PK4A 4JI3T 3ZMVB 1J1JA 4LF4T 2DCFA 3AE9A 3AEFA 3L39A 2UXXB 3ZT6A 2KXPB 2E5LT 2A9UA 3ESLA 3JADA 4YT0A 1HNWT 4IL9A 4UF0B 5JRCB 3AB3B 4JYAT 1Z8UA 4K0UA 1OEDA 3C51A 3AEEA 3CQCB 2VQET 5CGMA 3HKEE 4U31A 4ZI7E 3KV5A 5DJQC 2BKOA 3ZSTA 1G73A 5EZYE 4J2CA 3PUWF 4PAGA 1XNRT 4A5XA 4HN9A 3RIFA 4YTNA 4PK6A 2MBGA 2UUAT 1D1BA 2RPAA 3BQKA 2LOPA 3A7MA 1YKEB 1WR0A 3IBPA 2ODVA 3NRYA 4GKKT 3AE8A 2UXBT 3AA0B 4QXCB 3PTRB 1UX5A 2WSSV 4GYSA 2BVLA 2UXCT 1IAPA 2VB6A 2YOEA 2CLYC 1GQEA 1BR4A 3Q5DA 5BMVE 3LBXB 2C5IT 5HXHA 3L3PA 2XQYA 1ZEEA 5F5WA 1R8IA 1JNZA 4TWHA 1W9RA 4LMLA 2XHEB 1VCTA 3Q2MA 3PJAA 5LCYA 2MTQA 4HGAA 1OEDC 4CXXA 1HX1B 5JTGA 5FY1A 5A1LA 2CWOA 4Z8XA 2LOSA 4YSYA 4DBRA 4F8HA 1I6ZA 4L5GA 4ZS2A 2HH7A 4JI1T 5L3GB 5IWAT 3ZC1A 5LOVE 3H3MA 1N34T 3AAIA 1IJ5A 5JDFA 4AI6A 3RIAA 2K24A 3H3AA 2XQ7A 3NZQA 4GYRA 2L8KA 4TNVA 2IUBA 1YXRA 2W62A 5F3JA 3U78A 4B3TT 2JRKA 3Q9DA 3H37A 4DV6T 3SFDA 1J5ET 4JI4T 1KNZA 2Z6EA 2RP4A 2XM2A 3MJXA 4ZI2D 2LSIA 3KV9A 4H9RC 1FJGT 3AE6A 4Z91A 3AA1B 5JDGA 3UQ4A 1VOMA 1WR6A 2WAUA 3LK42 3RLFF 3PJAJ 3RX6A 3RF1A 2V5DA 1N36T 3EVYA 2GK9A 2X68A 4UVAB 2CXFA 4PJMA 2BG9A 3JC6D 2C5JA 3ZN1B 5FYMA 2K9AA 3CK6A 2ZM8A 4EEBA 3EDVA 4AKHA 4HWCA 3ZC0A 3P4PA 4EYUA 2D5UA 3UFGA 3IHRA 2CCQA 3K3QC 2V7IA 4MBQA 2N2NA 2LKHA 3ETVA 2M6IA 2NR4A 2P9BA 3AE7A 3F57A 4X65T 2XQAA 5LGNB 2D0TA 4NUVA 1S94A 4UF0A 4JI7T 5JVDE 5AQNB 5JRCA 3EHZA 3Q5EA 4DV7T 3AECA 3MXZA 1BR0A 5DABA 3N9QA 1MIVA 3LDQB 2Q9QB 2VKDA 4UVBB 3V5SA 1OWAA 4DIDB 5E0OA 4HWHA 4C91A 2A2FX 4DR7T 4UR9A 3P4QA 4LMKA 5CB4E 2LM2A 3P7IA 2J1DG 3EUHA 2LSGA 1D1AA 3O4XE 5EK3A 2CM0A 5AQQB 2BG9C 5H6RB 4TNWA 2BBHA 4O4JE 4DV5T 2BKPA 3RKGA 2J4GA 3C4XA 3HA4A 4KP3C 1US7B 2Y8DA 2IW5B 2NOXA 3M3ZB 4YLHA 3ZT5A 3S4UA 1S35A 2X9WA 5HXRA 3Q5XA 4JI5T 2JQQA 5LMNT 5LHIB 3C4WA 2HN1A 3LBXA 2XUEA 1MMGA 2LHNA 2XM1A 4E7ZA 4ZZCA 2XPKA 3EABA 4CXYA 1ZP0A 2ZM2A 1QSDA 2XQ6A 4X1YE 3UFEA 2D9DA 4IE4A 4TN7B 4WYVA 2V8SV 3VRBA 2J62A 2UUCT 4NPPA 3JAEA 4K0KT 4ZI2C 2AE9A 3HL6A 1ZKEA 3LSVA 4DR2T 5L47A 3E08A 2XQ3A 5C2TA 3RC3A 4MFRA 3AE3A 1VRBA 2UU9T 1VCSA 2CRBA 3RGLA 4YJ2E 3ABVA 1O3XA 5LJMA 2XAHB 4COFA 3KV6A 3ZMZB 4AQFC 4EAHA 2Y6XA 2RA1A 3UU8A 3DJBA 1G8XA 4ZOLE 4YHHT 4UEMA 2X9XA 1D1CA 3UUXB 4QKNA 2WY2A 1M7KA 3QOFA 1WYCA 1XMQT 5FXZA 2EHOD 4YHJA 3FZHB 3PUAA 3HR0A 3RYHE 1T7SA 3RRWA 5FNVE 1BR1A 4EZHA 2VWAA 4HKAA 3CX8B 1HTJF 3G06A 2PTFA 3CX7B 1WRDA 3NWIA 3OJAA 2DWGA 4CI1B 4ZZBA 5AQPB 2Y48B 3C98B 4JBWF 1NWMX 3ZJ1A 3GN5B 4O2AE 1AJ3A 3OYXA 1H7CA 4CXWA 3PUYF 4KI0F 2KWIB 4ILCA 2VVNA 3SRZA 4X5TA 2CMRA 2LSYA 4ZI3D 4KMCA 3HI2A 3I1AA 2E2AA 1N33T 3QB5A 3N2GE 5F8PA 4AQGA 4ILBA 2DWKA 3VHLA 4YTPA 4DMWA 2VASA 2V6YB 2YKSA 1NEKA 3VU7H 1SA0E 2LLYA 3RHWA 3ONLC 3FZFB 1SUMB 5JR9B 1NENA 2Q9QA 1IJ6A 2NTXA 5H6QB 5J0ZA 2IC6A 5LGUB 3ETUA 1FMVA 2V7JA 4CN1A 4PFPA 4CN6A 3O9XA 3GA8A 2HPLA 3ZEFB 4OYJA 3FBLA 4H9OC 3O1JA 3QB5K 2MAWA 2XQ5A 1MIWA 4IE0A 1WFDA 2K5BB 3T8OA 3ZCIA 2I59A 4IDZA 4OK0A 3E22E 2QYWA 4QH1A 2BKNA 2ACXA 1Y64B 2IMLA 5FY7A 5AQRB 4LF5T 2VQFT 4XBFB 4IT4A 2BS2A 2QGSA 1KK7A 3IF8B 5AQVB 2LEHA 4IE5A 4LFAT 3BK9A 2LSKA 3EDUA 2ZLYA 1W09A 5L2LA 1KEYA 4ZHQE 4JI6T 4AKIA 3A5XA 3OPCA 5FVLA 2XAQB 4V1Av 4M1PA 1JNRA 2EHOC 3NVOA 2X67A 3UUMA 4DV3T 2G0UA 2DL1A 1U5PA 4CZZB 4YSZA 2W63A 1W0AA 2WDVA 3U3IA 3LFMA 2WS3A 5LBMA 3FHNA 3OBVE 3TKLB 4QX8B 5L3BB 4HEAA 2VKHA 4GK5E 5HEUA 5IYZE 5AQIB 3UULA 3VKGA 4O8SA 3P4WA 4KUMB 3VR9A 1HNZT 5HYAA 2H89A 2J47A 4H63H 2YU2A 3J9X1 3IA3A 3N2KE 2VL8A 4UV9B 2LT3A 4U2YA 5HXSA 1OEDE 5AQOB 4L0RA 3CMLA 5FMNA 4ZI3C 1EZ3A 3PU8A 2ZM6T 5LJNA 4WBOA 5KXJA 5HAXA 2E9XB 1ZV4X 3WI3A 3AVSA 3PDYA 4AXPA 5HEJA 2X9HA 2LSJA 4Q25A 3F2EA 4UELA 1IBLT 4YXDA 2L9QA 4P0BA 2C5KT 4DR6T 4TV9E 3GN5A 5L4EA 4ILUA 2LJLA 2YEVC 3VKHA 2XASB 5FXXA 1HX8A 1E1HB 2W67A 3UTKA 5LHGB 4DR5T 2KMFA 4TX5A 5LP6E 4QX7B 4F6RC 4U7IA 3KVAA 4DNDA 5ABFB 4OHFA 2WWVA 3MA9A 3ZPOA 3N2OA 2OV9A 3NBXX 5JR9A 2V7MA 1V9DA 3AEDA 3T1HT 3ZYMA 4NIQA 3UU3A 4IHJE 4O4HE 3UUNA 5KMGP 5GONE 5M4YA 4NXMT 2C0SA 4JI0T 1YW0A 3L8RA 2X0HA 4HE8A 1XNQT 4EB6E 2LE8A 2UUBT 1MIYA 3N9NA 4OX9T 4YSXA 4PW8A 2PBIA 3L09A 3TLSA 3AEGA 2XQ9A 2H7VC 4IREA 2BS3A 5LYJE 3GMIA 5J2UE 3UQ7A 3AXJB 2JQHA 2N9DA 2VVSA 2H88A 2DNXA 3I9YA 2W0GA 3LK3B 4CQIA 1NAFA 4DV1T 4ISTA 2VK9A 1MNDA 3R84B 4DMVA 5HCJA 3UU6A 3B5MA 4H63V 4TWDA 3WAKA 2E9XD 1YQ4A 2V6XA 3PE0A 1D0ZA 4JI2T 2V26A 4XZCA 4X20E 1DU2A 2FJDA 2FBWA 2KZ7B 4A98A 5AQFB 2JMHA 5JR9C 3QNUA 2BDEA 1UURA 4A97A 1T8BA 1KF6A 2LHRA 2AXDS 2BG9E 2M6BA 4UIGA 2I0MA 4ISSA 4HFHA 3EAMA 4I4TE 1WCRA 2XAGB 4H9NC 4HFVA 3RPUA 2XQ8A 4WNKA 4HWDA 4ADZA 1ZHCA 5IUXA 4JEHB 4EIWA 4LF7T 4DV2T 2WMNA 2W2UA 4H9SE 4EGWA 1M62A 4MHCA 3O1IA 2ZMAA 5JDLA 5ETWA 2JQKA 4IIJE 1LRZA 4U33A 1HG2A 2H3RA 3FXDB 4PJLA 5JREA 1MMDA 2B76A 4YFSA 4TZ4C 2XY8B 1E7PA 3JCFA 3BQIA 4BAYB 4GKJT 3ANWB 2E9XA 5HWXA 3PV0F 4EZ4A 3PUVF 2DHRA 1L0VA 3JAFA 4ZS3A 2HPJA 4HFEA 1SHZC 4DR3T 3ZLIA 4QWNB 2BZBA 3N9MA 3PUSA 1X9BA 2Q9QD 5BR8T 4QH4A 4N78D 3OVUA 2A72A 3MACA 5FL1A 5HWYA 4PJNA 5JDMA 3NKZA 4WW0A 2NTYA 2YDSA 3RQUA 5ABFA 4FI5A 3LG7A 1UCUA 1IBMT 5L3CB 3TLVA 3QC9A 1FEWA 1MMNA 2FUPA 2IC9A 2CHNA 5LG3A 1XWMA 4IE7A 4DR4T 2PJQA 1XDOA 3CIRA 3LK2B 3RC8A 2E9XC 3SOLA 4EYYR 4YJ3E 3QK6A 1U4QA 4TV8E 4OFZA 2YU1A 3J7Yq 5AQLB 2FJEA 4KHPT 2DI4A 5DQVA 3AXJA 2W00A 2JJ9A 5FXVA 3E0ZA 4ASKA 3CX6B 2LRKA 1CUNA 2X51A 3NRXA 5LHHB 3AE4A 4IDQA 3RRCA 5ABHA 4LF8T 2V7KA 2BVMA 5HEGA 5JDNA 4G63A 4U7YA 1XMOT 2JPFA 1HG5A 3I9WA 5EK2A 4C90A 4IDNA 2KSRA 2HHHT 5L3DB 2XAJB 1UX4A 2WM9A 3FZKB 3RI5A 3OTOT 4LFBT 1HR0T 2YINA 5LNKA 2BS4A 3D0TA 5J2TE 1D0XA 3CKDA 2KWHA 5AQTB 2PG8A 2ES0A 4HWIB 4ZEYA 4X64T 1UGOA 4PK5A 5LGTB 3KVBA 3UU4A 1CHUA 3ONJA 3UT5E 3I0QA 4E7SA 4UV8B 5HEHA 2XQ4A 4JI8T 2VL0A 3N9LA 2A3DA 4HFIA 3RQWA 3ZMUB 5KDMC 1WYBA 5HEOA 4HFCA 3AAEB 3N5LA 5ADXL 3SS1A 2WZHA 2WWUA 3PUZF 2Q9QC 3AE1A 5CFBA 3C64A 2ZM0A 2NW8A 3NZPA 2X0YA 1XDPA 5CA0E 5FL0A 3RYIE 2VKOA 2HN2A 3ANWA 4JV5T 4HFDA 3SWHA 2CBIA 2WDRA 3VR8A 4X62T 4ANJA 3QUJA 5LG4A 2WU5A 2H7OA 5AQMB 2XJ7A 3FZMB 3PUXF 5LMUT 2XSBA 2YDRA 3ZMSB 3MZKB 3K1SA 3OKQA 5AQJB 4H9QC 3Q5WA 4L9IA 2ODUA 2LRLA 3ZT7A 1HFAA 5LXTE 4FJOA 3PUQA 3AA7B 1B7TA 2CHOA 4PNIA 4G2AA 2QVAA 1YD8G 4CN4A 3P4RA 1Z0PA 2CPTA 2V1DB 4IDPA 2JIWA 4ZXLA 4CI2B 3X1DA 2NW7A 1IBKT 4NUUA 2YDQA 2FJBA 2WBLA 3GWHA 4ILAA 3AVRA 2JMKA 2OLTA 2IDOB 3PUGA 2YK0A 4WZXA 4EXTA 1YKHB 2WMOA 2IHR1 4DO0A 2WQYA 3KBUA 4IDOA 2MPKA 3ZN0B 1W0BA 4AKRB 2IAKA 2JQ9A 1HNXT 1IZNB 4YTMA 3ZKRA 3RIUA 4LFCT 2V6YA 2LKGA 2YN6A 3KBTA 2B1EA 4X1KE 3ZYLA 3P50A 5JQGE 2KNDA 4WBNE 2WB5A 5AQHB 1LVFA 4JEUB 1X79A 3HKCE 2XAFB 3K8PC 2W61A 4CI3B 4GOUA 3AE5A 1I94T 2K48A 2WZIA 2W4XA 4IGUA 3TLUA 5LA6E 2ACZA 1KNPA 3FBZA 2NWBA 4Z90A 2LM9A 4I55E 3FB2A 4O2BE 1KNRA 4U3CA 5AQSB 4A56A 3R6NA 2X9YA 5HXEA 5FVKA 1HS7A 5HCMA 3KFWX 4DBQA 1OXZA 3MK7C 2QRXA 5LBQB 4IE6A 1LKXA 1FMWA 4PJJA 1QUUA 3SFEA 3CWZB 2OA5A 3PURA 4UVCB 4DUYT 2D0UA 4HFBA 3AE2A 3CVRA 3I0OA 3K3NA 3RIUC 2XTLA 4P0AA 4KHZF 3C4ZA 3M65A 3O1HA 2EHOB 2CEAA 4AISA 2FJAA 3OYZA 4JUYA 4DV0T 2IIUA 2CE7A 3ZMTB 4AKLA 4TWFA 3AEBA 4X1IE 3WAJA 4XAXB 2CLYB 5CA1E 2R6GF 3CQXC 1XZYA 3CQGB 2MYSA 2V7LA 4AQFA 4KX6A 3ZCJA 1HF8A 2QA7A 4U2ZA 3RYCE 2XSAA 2VURA 1D0YA 2SPCA 1FIOA 1WLXA 1Y01A 1J5WA 1OEDB 5LB7B 4DUZT 5J1GA 2UXDT 4DVDA 4B3ST 5C3JA 4AQYT 3B57A 3VRAA 3PU3A 5DQWA 4GK0E 2KLQA 3ZYKA 2CA5A 2WU2A 3BQLA 2E8IA 3EI0A 4EEDA 3KV4A 1E2AA 2NP9A 1T98A 4EV6A 5AQGB 5EK4A 1MMAA 3N9PA 2BBJA 4QXBB 3IEEA 3T1YT 3P4SA 5AQKB 4JLEA 3DTOA 2X66A 2MOZA 3N9OA 2V5CA 4O4LE 4U74A 2DLRA 4DR1T 4HWFA 5ABEA 4MALA 4OYKA 4I43B 5TAOA 3ONXA 2KT9A 5AFUL 2XZEA 4YY3T 3C50A 2WP9A 5AQUB 1SE7A 3AA6B 3JC6C 2UXNB 4LF6T 4QHOA 2X0LB 3KDSE 4BA9A 2CXDA 1KFYA 1UUSA 4O4IE 3K3OA 3RH3A 1T72A 1ZOYA 1UK5A 3RKOA 1QLBA 3AAAB 2CWYA 2L3LA 5C8YE 1HCIA 3UU5A 3MKDA 2N1GA 4U72A 3P8CD 5FP3A 1BR2A 4P09A 3V5UA 1MNEA 5KX5E 5IHYA 4ERRA 5L4HA
chains in the Genus database with same CATH topology
4JI2T 5LMNT 1HNWT 4JYAT 4DR3T 2VQET 3T1YT 4X66T 4DUYT 4JI1T 4LF8T 4B3RT 5BR8T 5IWAT 1HNZT 3T1HT 4JV5T 1XMOT 1N34T 1XNRT 4DR1T 4DV4T 1HNXT 1N32T 4X62T 4X65T 4LF9T 2UUCT 4NXMT 4K0KT 2HHHT 2UUAT 4JI0T 4JI7T 5LMUT 4LFCT 4B3TT 4DR2T 3OTOT 4YY3T 4DV7T 1XNQT 4LFBT 4DV0T 4DV6T 1J5ET 2UUBT 4JI4T 1HR0T 4LF5T 2VQFT 4LF6T 2ZM6T 4OX9T 4GKKT 2UXBT 1IBMT 4NXNT 2F4VT 2UU9T 4LF7T 4DV2T 1FJGT 1I94T 4X64T 4DR7T 4LFAT 1N33T 2UXCT 4DR4T 1IBLT 4DUZT 4JI6T 4DR6T 2UXDT 4DV1T 4B3ST 1N36T 4AQYT 4B3MT 4YHHT 4DV5T 4JI8T 4GKJT 4DV3T 4JI3T 4DR5T 4LF4T 1IBKT 1XMQT 2E5LT 4KHPT 4JI5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 T;  5LMN T;  1HNW T;  4JYA T;  4DR3 T;  2VQE T;  3T1Y T;  4X66 T;  4DUY T;  4JI1 T;  4LF8 T;  4B3R T;  5BR8 T;  5IWA T;  1HNZ T;  3T1H T;  4JV5 T;  1XMO T;  1N34 T;  1XNR T;  4DR1 T;  4DV4 T;  1HNX T;  1N32 T;  4X62 T;  4X65 T;  4LF9 T;  2UUC T;  4NXM T;  4K0K T;  2HHH T;  2UUA T;  4JI0 T;  4JI7 T;  5LMU T;  4LFC T;  4B3T T;  4DR2 T;  3OTO T;  4YY3 T;  4DV7 T;  1XNQ T;  4LFB T;  4DV0 T;  4DV6 T;  1J5E T;  2UUB T;  4JI4 T;  1HR0 T;  4LF5 T;  2VQF T;  4LF6 T;  2ZM6 T;  4OX9 T;  4GKK T;  2UXB T;  1IBM T;  4NXN T;  2F4V T;  2UU9 T;  4LF7 T;  4DV2 T;  1FJG T;  1I94 T;  4X64 T;  4DR7 T;  4LFA T;  1N33 T;  2UXC T;  4DR4 T;  1IBL T;  4DUZ T;  4JI6 T;  4DR6 T;  2UXD T;  4DV1 T;  4B3S T;  1N36 T;  4AQY T;  4B3M T;  4YHH T;  4DV5 T;  4JI8 T;  4GKJ T;  4DV3 T;  4JI3 T;  4DR5 T;  4LF4 T;  1IBK T;  1XMQ T;  2E5L T;  4KHP T;  4JI5 T; 
#chains in the Genus database with same CATH topology
 2E5V A;  1YQ3 A;  3UUB A;  4PFO A;  2CBJ A;  5FKY A;  4BJN A;  5HXC A;  4X66 T;  2KIN B;  4P1N A;  3A8Y C;  4QH5 A;  4B3R T;  2I6H A;  3DP7 A;  2PFV A;  4IL4 A;  4EOZ B;  3B13 A;  4UXN B;  4DV4 T;  3ZJ2 A;  1N32 T;  3FXE B;  3TLW A;  4LF9 T;  3W15 B;  4HTE A;  5CJ5 A;  5L3E B;  4GIW A;  4QXH B;  5JDH A;  2NW9 A;  4H9P C;  1LVK A;  4BJM A;  3CPZ A;  3LJC A;  4AIU A;  2CXL A;  4AKG A;  2W66 A;  5FY0 A;  5FXW A;  4NXN T;  2BG9 B;  2F4V T;  3RYF E;  5JDQ A;  4I0U A;  3HKD E;  2K3W A;  3F31 A;  3FZL B;  2M67 A;  5JH7 E;  3ZSS A;  3HKB E;  2WCA A;  2EHO A;  2VKJ A;  4MLK A;  2D2S A;  4B6X A;  2WDQ A;  4I50 E;  4TUY E;  3AEA A;  3TLT A;  4LMJ A;  5L3F B;  4B3M T;  5ABG A;  3KIN B;  4KBM B;  4PK4 A;  4JI3 T;  3ZMV B;  1J1J A;  4LF4 T;  2DCF A;  3AE9 A;  3AEF A;  3L39 A;  2UXX B;  3ZT6 A;  2KXP B;  2E5L T;  2A9U A;  3ESL A;  3JAD A;  4YT0 A;  1HNW T;  4IL9 A;  4UF0 B;  5JRC B;  3AB3 B;  4JYA T;  1Z8U A;  4K0U A;  1OED A;  3C51 A;  3AEE A;  3CQC B;  2VQE T;  5CGM A;  3HKE E;  4U31 A;  4ZI7 E;  3KV5 A;  5DJQ C;  2BKO A;  3ZST A;  1G73 A;  5EZY E;  4J2C A;  3PUW F;  4PAG A;  1XNR T;  4A5X A;  4HN9 A;  3RIF A;  4YTN A;  4PK6 A;  2MBG A;  2UUA T;  1D1B A;  2RPA A;  3BQK A;  2LOP A;  3A7M A;  1YKE B;  1WR0 A;  3IBP A;  2ODV A;  3NRY A;  4GKK T;  3AE8 A;  2UXB T;  3AA0 B;  4QXC B;  3PTR B;  1UX5 A;  2WSS V;  4GYS A;  2BVL A;  2UXC T;  1IAP A;  2VB6 A;  2YOE A;  2CLY C;  1GQE A;  1BR4 A;  3Q5D A;  5BMV E;  3LBX B;  2C5I T;  5HXH A;  3L3P A;  2XQY A;  1ZEE A;  5F5W A;  1R8I A;  1JNZ A;  4TWH A;  1W9R A;  4LML A;  2XHE B;  1VCT A;  3Q2M A;  3PJA A;  5LCY A;  2MTQ A;  4HGA A;  1OED C;  4CXX A;  1HX1 B;  5JTG A;  5FY1 A;  5A1L A;  2CWO A;  4Z8X A;  2LOS A;  4YSY A;  4DBR A;  4F8H A;  1I6Z A;  4L5G A;  4ZS2 A;  2HH7 A;  4JI1 T;  5L3G B;  5IWA T;  3ZC1 A;  5LOV E;  3H3M A;  1N34 T;  3AAI A;  1IJ5 A;  5JDF A;  4AI6 A;  3RIA A;  2K24 A;  3H3A A;  2XQ7 A;  3NZQ A;  4GYR A;  2L8K A;  4TNV A;  2IUB A;  1YXR A;  2W62 A;  5F3J A;  3U78 A;  4B3T T;  2JRK A;  3Q9D A;  3H37 A;  4DV6 T;  3SFD A;  1J5E T;  4JI4 T;  1KNZ A;  2Z6E A;  2RP4 A;  2XM2 A;  3MJX A;  4ZI2 D;  2LSI A;  3KV9 A;  4H9R C;  1FJG T;  3AE6 A;  4Z91 A;  3AA1 B;  5JDG A;  3UQ4 A;  1VOM A;  1WR6 A;  2WAU A;  3LK4 2;  3RLF F;  3PJA J;  3RX6 A;  3RF1 A;  2V5D A;  1N36 T;  3EVY A;  2GK9 A;  2X68 A;  4UVA B;  2CXF A;  4PJM A;  2BG9 A;  3JC6 D;  2C5J A;  3ZN1 B;  5FYM A;  2K9A A;  3CK6 A;  2ZM8 A;  4EEB A;  3EDV A;  4AKH A;  4HWC A;  3ZC0 A;  3P4P A;  4EYU A;  2D5U A;  3UFG A;  3IHR A;  2CCQ A;  3K3Q C;  2V7I A;  4MBQ A;  2N2N A;  2LKH A;  3ETV A;  2M6I A;  2NR4 A;  2P9B A;  3AE7 A;  3F57 A;  4X65 T;  2XQA A;  5LGN B;  2D0T A;  4NUV A;  1S94 A;  4UF0 A;  4JI7 T;  5JVD E;  5AQN B;  5JRC A;  3EHZ A;  3Q5E A;  4DV7 T;  3AEC A;  3MXZ A;  1BR0 A;  5DAB A;  3N9Q A;  1MIV A;  3LDQ B;  2Q9Q B;  2VKD A;  4UVB B;  3V5S A;  1OWA A;  4DID B;  5E0O A;  4HWH A;  4C91 A;  2A2F X;  4DR7 T;  4UR9 A;  3P4Q A;  4LMK A;  5CB4 E;  2LM2 A;  3P7I A;  2J1D G;  3EUH A;  2LSG A;  1D1A A;  3O4X E;  5EK3 A;  2CM0 A;  5AQQ B;  2BG9 C;  5H6R B;  4TNW A;  2BBH A;  4O4J E;  4DV5 T;  2BKP A;  3RKG A;  2J4G A;  3C4X A;  3HA4 A;  4KP3 C;  1US7 B;  2Y8D A;  2IW5 B;  2NOX A;  3M3Z B;  4YLH A;  3ZT5 A;  3S4U A;  1S35 A;  2X9W A;  5HXR A;  3Q5X A;  4JI5 T;  2JQQ A;  5LMN T;  5LHI B;  3C4W A;  2HN1 A;  3LBX A;  2XUE A;  1MMG A;  2LHN A;  2XM1 A;  4E7Z A;  4ZZC A;  2XPK A;  3EAB A;  4CXY A;  1ZP0 A;  2ZM2 A;  1QSD A;  2XQ6 A;  4X1Y E;  3UFE A;  2D9D A;  4IE4 A;  4TN7 B;  4WYV A;  2V8S V;  3VRB A;  2J62 A;  2UUC T;  4NPP A;  3JAE A;  4K0K T;  4ZI2 C;  2AE9 A;  3HL6 A;  1ZKE A;  3LSV A;  4DR2 T;  5L47 A;  3E08 A;  2XQ3 A;  5C2T A;  3RC3 A;  4MFR A;  3AE3 A;  1VRB A;  2UU9 T;  1VCS A;  2CRB A;  3RGL A;  4YJ2 E;  3ABV A;  1O3X A;  5LJM A;  2XAH B;  4COF A;  3KV6 A;  3ZMZ B;  4AQF C;  4EAH A;  2Y6X A;  2RA1 A;  3UU8 A;  3DJB A;  1G8X A;  4ZOL E;  4YHH T;  4UEM A;  2X9X A;  1D1C A;  3UUX B;  4QKN A;  2WY2 A;  1M7K A;  3QOF A;  1WYC A;  1XMQ T;  5FXZ A;  2EHO D;  4YHJ A;  3FZH B;  3PUA A;  3HR0 A;  3RYH E;  1T7S A;  3RRW A;  5FNV E;  1BR1 A;  4EZH A;  2VWA A;  4HKA A;  3CX8 B;  1HTJ F;  3G06 A;  2PTF A;  3CX7 B;  1WRD A;  3NWI A;  3OJA A;  2DWG A;  4CI1 B;  4ZZB A;  5AQP B;  2Y48 B;  3C98 B;  4JBW F;  1NWM X;  3ZJ1 A;  3GN5 B;  4O2A E;  1AJ3 A;  3OYX A;  1H7C A;  4CXW A;  3PUY F;  4KI0 F;  2KWI B;  4ILC A;  2VVN A;  3SRZ A;  4X5T A;  2CMR A;  2LSY A;  4ZI3 D;  4KMC A;  3HI2 A;  3I1A A;  2E2A A;  1N33 T;  3QB5 A;  3N2G E;  5F8P A;  4AQG A;  4ILB A;  2DWK A;  3VHL A;  4YTP A;  4DMW A;  2VAS A;  2V6Y B;  2YKS A;  1NEK A;  3VU7 H;  1SA0 E;  2LLY A;  3RHW A;  3ONL C;  3FZF B;  1SUM B;  5JR9 B;  1NEN A;  2Q9Q A;  1IJ6 A;  2NTX A;  5H6Q B;  5J0Z A;  2IC6 A;  5LGU B;  3ETU A;  1FMV A;  2V7J A;  4CN1 A;  4PFP A;  4CN6 A;  3O9X A;  3GA8 A;  2HPL A;  3ZEF B;  4OYJ A;  3FBL A;  4H9O C;  3O1J A;  3QB5 K;  2MAW A;  2XQ5 A;  1MIW A;  4IE0 A;  1WFD A;  2K5B B;  3T8O A;  3ZCI A;  2I59 A;  4IDZ A;  4OK0 A;  3E22 E;  2QYW A;  4QH1 A;  2BKN A;  2ACX A;  1Y64 B;  2IML A;  5FY7 A;  5AQR B;  4LF5 T;  2VQF T;  4XBF B;  4IT4 A;  2BS2 A;  2QGS A;  1KK7 A;  3IF8 B;  5AQV B;  2LEH A;  4IE5 A;  4LFA T;  3BK9 A;  2LSK A;  3EDU A;  2ZLY A;  1W09 A;  5L2L A;  1KEY A;  4ZHQ E;  4JI6 T;  4AKI A;  3A5X A;  3OPC A;  5FVL A;  2XAQ B;  4V1A v;  4M1P A;  1JNR A;  2EHO C;  3NVO A;  2X67 A;  3UUM A;  4DV3 T;  2G0U A;  2DL1 A;  1U5P A;  4CZZ B;  4YSZ A;  2W63 A;  1W0A A;  2WDV A;  3U3I A;  3LFM A;  2WS3 A;  5LBM A;  3FHN A;  3OBV E;  3TKL B;  4QX8 B;  5L3B B;  4HEA A;  2VKH A;  4GK5 E;  5HEU A;  5IYZ E;  5AQI B;  3UUL A;  3VKG A;  4O8S A;  3P4W A;  4KUM B;  3VR9 A;  1HNZ T;  5HYA A;  2H89 A;  2J47 A;  4H63 H;  2YU2 A;  3J9X 1;  3IA3 A;  3N2K E;  2VL8 A;  4UV9 B;  2LT3 A;  4U2Y A;  5HXS A;  1OED E;  5AQO B;  4L0R A;  3CML A;  5FMN A;  4ZI3 C;  1EZ3 A;  3PU8 A;  2ZM6 T;  5LJN A;  4WBO A;  5KXJ A;  5HAX A;  2E9X B;  1ZV4 X;  3WI3 A;  3AVS A;  3PDY A;  4AXP A;  5HEJ A;  2X9H A;  2LSJ A;  4Q25 A;  3F2E A;  4UEL A;  1IBL T;  4YXD A;  2L9Q A;  4P0B A;  2C5K T;  4DR6 T;  4TV9 E;  3GN5 A;  5L4E A;  4ILU A;  2LJL A;  2YEV C;  3VKH A;  2XAS B;  5FXX A;  1HX8 A;  1E1H B;  2W67 A;  3UTK A;  5LHG B;  4DR5 T;  2KMF A;  4TX5 A;  5LP6 E;  4QX7 B;  4F6R C;  4U7I A;  3KVA A;  4DND A;  5ABF B;  4OHF A;  2WWV A;  3MA9 A;  3ZPO A;  3N2O A;  2OV9 A;  3NBX X;  5JR9 A;  2V7M A;  1V9D A;  3AED A;  3T1H T;  3ZYM A;  4NIQ A;  3UU3 A;  4IHJ E;  4O4H E;  3UUN A;  5KMG P;  5GON E;  5M4Y A;  4NXM T;  2C0S A;  4JI0 T;  1YW0 A;  3L8R A;  2X0H A;  4HE8 A;  1XNQ T;  4EB6 E;  2LE8 A;  2UUB T;  1MIY A;  3N9N A;  4OX9 T;  4YSX A;  4PW8 A;  2PBI A;  3L09 A;  3TLS A;  3AEG A;  2XQ9 A;  2H7V C;  4IRE A;  2BS3 A;  5LYJ E;  3GMI A;  5J2U E;  3UQ7 A;  3AXJ B;  2JQH A;  2N9D A;  2VVS A;  2H88 A;  2DNX A;  3I9Y A;  2W0G A;  3LK3 B;  4CQI A;  1NAF A;  4DV1 T;  4IST A;  2VK9 A;  1MND A;  3R84 B;  4DMV A;  5HCJ A;  3UU6 A;  3B5M A;  4H63 V;  4TWD A;  3WAK A;  2E9X D;  1YQ4 A;  2V6X A;  3PE0 A;  1D0Z A;  4JI2 T;  2V26 A;  4XZC A;  4X20 E;  1DU2 A;  2FJD A;  2FBW A;  2KZ7 B;  4A98 A;  5AQF B;  2JMH A;  5JR9 C;  3QNU A;  2BDE A;  1UUR A;  4A97 A;  1T8B A;  1KF6 A;  2LHR A;  2AXD S;  2BG9 E;  2M6B A;  4UIG A;  2I0M A;  4ISS A;  4HFH A;  3EAM A;  4I4T E;  1WCR A;  2XAG B;  4H9N C;  4HFV A;  3RPU A;  2XQ8 A;  4WNK A;  4HWD A;  4ADZ A;  1ZHC A;  5IUX A;  4JEH B;  4EIW A;  4LF7 T;  4DV2 T;  2WMN A;  2W2U A;  4H9S E;  4EGW A;  1M62 A;  4MHC A;  3O1I A;  2ZMA A;  5JDL A;  5ETW A;  2JQK A;  4IIJ E;  1LRZ A;  4U33 A;  1HG2 A;  2H3R A;  3FXD B;  4PJL A;  5JRE A;  1MMD A;  2B76 A;  4YFS A;  4TZ4 C;  2XY8 B;  1E7P A;  3JCF A;  3BQI A;  4BAY B;  4GKJ T;  3ANW B;  2E9X A;  5HWX A;  3PV0 F;  4EZ4 A;  3PUV F;  2DHR A;  1L0V A;  3JAF A;  4ZS3 A;  2HPJ A;  4HFE A;  1SHZ C;  4DR3 T;  3ZLI A;  4QWN B;  2BZB A;  3N9M A;  3PUS A;  1X9B A;  2Q9Q D;  5BR8 T;  4QH4 A;  4N78 D;  3OVU A;  2A72 A;  3MAC A;  5FL1 A;  5HWY A;  4PJN A;  5JDM A;  3NKZ A;  4WW0 A;  2NTY A;  2YDS A;  3RQU A;  5ABF A;  4FI5 A;  3LG7 A;  1UCU A;  1IBM T;  5L3C B;  3TLV A;  3QC9 A;  1FEW A;  1MMN A;  2FUP A;  2IC9 A;  2CHN A;  5LG3 A;  1XWM A;  4IE7 A;  4DR4 T;  2PJQ A;  1XDO A;  3CIR A;  3LK2 B;  3RC8 A;  2E9X C;  3SOL A;  4EYY R;  4YJ3 E;  3QK6 A;  1U4Q A;  4TV8 E;  4OFZ A;  2YU1 A;  3J7Y q;  5AQL B;  2FJE A;  4KHP T;  2DI4 A;  5DQV A;  3AXJ A;  2W00 A;  2JJ9 A;  5FXV A;  3E0Z A;  4ASK A;  3CX6 B;  2LRK A;  1CUN A;  2X51 A;  3NRX A;  5LHH B;  3AE4 A;  4IDQ A;  3RRC A;  5ABH A;  4LF8 T;  2V7K A;  2BVM A;  5HEG A;  5JDN A;  4G63 A;  4U7Y A;  1XMO T;  2JPF A;  1HG5 A;  3I9W A;  5EK2 A;  4C90 A;  4IDN A;  2KSR A;  2HHH T;  5L3D B;  2XAJ B;  1UX4 A;  2WM9 A;  3FZK B;  3RI5 A;  3OTO T;  4LFB T;  1HR0 T;  2YIN A;  5LNK A;  2BS4 A;  3D0T A;  5J2T E;  1D0X A;  3CKD A;  2KWH A;  5AQT B;  2PG8 A;  2ES0 A;  4HWI B;  4ZEY A;  4X64 T;  1UGO A;  4PK5 A;  5LGT B;  3KVB A;  3UU4 A;  1CHU A;  3ONJ A;  3UT5 E;  3I0Q A;  4E7S A;  4UV8 B;  5HEH A;  2XQ4 A;  4JI8 T;  2VL0 A;  3N9L A;  2A3D A;  4HFI A;  3RQW A;  3ZMU B;  5KDM C;  1WYB A;  5HEO A;  4HFC A;  3AAE B;  3N5L A;  5ADX L;  3SS1 A;  2WZH A;  2WWU A;  3PUZ F;  2Q9Q C;  3AE1 A;  5CFB A;  3C64 A;  2ZM0 A;  2NW8 A;  3NZP A;  2X0Y A;  1XDP A;  5CA0 E;  5FL0 A;  3RYI E;  2VKO A;  2HN2 A;  3ANW A;  4JV5 T;  4HFD A;  3SWH A;  2CBI A;  2WDR A;  3VR8 A;  4X62 T;  4ANJ A;  3QUJ A;  5LG4 A;  2WU5 A;  2H7O A;  5AQM B;  2XJ7 A;  3FZM B;  3PUX F;  5LMU T;  2XSB A;  2YDR A;  3ZMS B;  3MZK B;  3K1S A;  3OKQ A;  5AQJ B;  4H9Q C;  3Q5W A;  4L9I A;  2ODU A;  2LRL A;  3ZT7 A;  1HFA A;  5LXT E;  4FJO A;  3PUQ A;  3AA7 B;  1B7T A;  2CHO A;  4PNI A;  4G2A A;  2QVA A;  1YD8 G;  4CN4 A;  3P4R A;  1Z0P A;  2CPT A;  2V1D B;  4IDP A;  2JIW A;  4ZXL A;  4CI2 B;  3X1D A;  2NW7 A;  1IBK T;  4NUU A;  2YDQ A;  2FJB A;  2WBL A;  3GWH A;  4ILA A;  3AVR A;  2JMK A;  2OLT A;  2IDO B;  3PUG A;  2YK0 A;  4WZX A;  4EXT A;  1YKH B;  2WMO A;  2IHR 1;  4DO0 A;  2WQY A;  3KBU A;  4IDO A;  2MPK A;  3ZN0 B;  1W0B A;  4AKR B;  2IAK A;  2JQ9 A;  1HNX T;  1IZN B;  4YTM A;  3ZKR A;  3RIU A;  4LFC T;  2V6Y A;  2LKG A;  2YN6 A;  3KBT A;  2B1E A;  4X1K E;  3ZYL A;  3P50 A;  5JQG E;  2KND A;  4WBN E;  2WB5 A;  5AQH B;  1LVF A;  4JEU B;  1X79 A;  3HKC E;  2XAF B;  3K8P C;  2W61 A;  4CI3 B;  4GOU A;  3AE5 A;  1I94 T;  2K48 A;  2WZI A;  2W4X A;  4IGU A;  3TLU A;  5LA6 E;  2ACZ A;  1KNP A;  3FBZ A;  2NWB A;  4Z90 A;  2LM9 A;  4I55 E;  3FB2 A;  4O2B E;  1KNR A;  4U3C A;  5AQS B;  4A56 A;  3R6N A;  2X9Y A;  5HXE A;  5FVK A;  1HS7 A;  5HCM A;  3KFW X;  4DBQ A;  1OXZ A;  3MK7 C;  2QRX A;  5LBQ B;  4IE6 A;  1LKX A;  1FMW A;  4PJJ A;  1QUU A;  3SFE A;  3CWZ B;  2OA5 A;  3PUR A;  4UVC B;  4DUY T;  2D0U A;  4HFB A;  3AE2 A;  3CVR A;  3I0O A;  3K3N A;  3RIU C;  2XTL A;  4P0A A;  4KHZ F;  3C4Z A;  3M65 A;  3O1H A;  2EHO B;  2CEA A;  4AIS A;  2FJA A;  3OYZ A;  4JUY A;  4DV0 T;  2IIU A;  2CE7 A;  3ZMT B;  4AKL A;  4TWF A;  3AEB A;  4X1I E;  3WAJ A;  4XAX B;  2CLY B;  5CA1 E;  2R6G F;  3CQX C;  1XZY A;  3CQG B;  2MYS A;  2V7L A;  4AQF A;  4KX6 A;  3ZCJ A;  1HF8 A;  2QA7 A;  4U2Z A;  3RYC E;  2XSA A;  2VUR A;  1D0Y A;  2SPC A;  1FIO A;  1WLX A;  1Y01 A;  1J5W A;  1OED B;  5LB7 B;  4DUZ T;  5J1G A;  2UXD T;  4DVD A;  4B3S T;  5C3J A;  4AQY T;  3B57 A;  3VRA A;  3PU3 A;  5DQW A;  4GK0 E;  2KLQ A;  3ZYK A;  2CA5 A;  2WU2 A;  3BQL A;  2E8I A;  3EI0 A;  4EED A;  3KV4 A;  1E2A A;  2NP9 A;  1T98 A;  4EV6 A;  5AQG B;  5EK4 A;  1MMA A;  3N9P A;  2BBJ A;  4QXB B;  3IEE A;  3T1Y T;  3P4S A;  5AQK B;  4JLE A;  3DTO A;  2X66 A;  2MOZ A;  3N9O A;  2V5C A;  4O4L E;  4U74 A;  2DLR A;  4DR1 T;  4HWF A;  5ABE A;  4MAL A;  4OYK A;  4I43 B;  5TAO A;  3ONX A;  2KT9 A;  5AFU L;  2XZE A;  4YY3 T;  3C50 A;  2WP9 A;  5AQU B;  1SE7 A;  3AA6 B;  3JC6 C;  2UXN B;  4LF6 T;  4QHO A;  2X0L B;  3KDS E;  4BA9 A;  2CXD A;  1KFY A;  1UUS A;  4O4I E;  3K3O A;  3RH3 A;  1T72 A;  1ZOY A;  1UK5 A;  3RKO A;  1QLB A;  3AAA B;  2CWY A;  2L3L A;  5C8Y E;  1HCI A;  3UU5 A;  3MKD A;  2N1G A;  4U72 A;  3P8C D;  5FP3 A;  1BR2 A;  4P09 A;  3V5U A;  1MNE A;  5KX5 E;  5IHY A;  4ERR A;  5L4H A; 
#chains in the Genus database with same CATH homology
 4JI2 T;  5LMN T;  1HNW T;  4JYA T;  4DR3 T;  2VQE T;  3T1Y T;  4X66 T;  4DUY T;  4JI1 T;  4LF8 T;  4B3R T;  5BR8 T;  5IWA T;  1HNZ T;  3T1H T;  4JV5 T;  1XMO T;  1N34 T;  1XNR T;  4DR1 T;  4DV4 T;  1HNX T;  1N32 T;  4X62 T;  4X65 T;  4LF9 T;  2UUC T;  4NXM T;  4K0K T;  2HHH T;  2UUA T;  4JI0 T;  4JI7 T;  5LMU T;  4LFC T;  4B3T T;  4DR2 T;  3OTO T;  4YY3 T;  4DV7 T;  1XNQ T;  4LFB T;  4DV0 T;  4DV6 T;  1J5E T;  2UUB T;  4JI4 T;  1HR0 T;  4LF5 T;  2VQF T;  4LF6 T;  2ZM6 T;  4OX9 T;  4GKK T;  2UXB T;  1IBM T;  4NXN T;  2F4V T;  2UU9 T;  4LF7 T;  4DV2 T;  1FJG T;  1I94 T;  4X64 T;  4DR7 T;  4LFA T;  1N33 T;  2UXC T;  4DR4 T;  1IBL T;  4DUZ T;  4JI6 T;  4DR6 T;  2UXD T;  4DV1 T;  4B3S T;  1N36 T;  4AQY T;  4B3M T;  4YHH T;  4DV5 T;  4JI8 T;  4GKJ T;  4DV3 T;  4JI3 T;  4DR5 T;  4LF4 T;  1IBK T;  1XMQ T;  2E5L T;  4KHP T;  4JI5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...