1XNRI

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrI00
4B3MI 4DV1I 4JG4A 1KIJA 2HFSA 4DV7E 4JI1E 4JI3E 2X7IA 4DV6E 4B3SI 1HNXI 4LF6I 4B3TI 4LF8I 1U2RA 1XMOI 4GKJE 4EMDA 1HNWE 1XHKA 1H74A 4YY3E 4DV0E 3ZZUA 3OTOI 5IWAE 4GKKE 4UTGA 1ZM9A 1EI1A 4DXLA 4B3RE 3PYGA 1H7UA 5A2QC 4JI4I 3WU5A 3D4JA 1A6FA 4DPUA 3QT6A 2AJ4A 4X64I 4DV5I 1DARA 1N36I 4WUDA 2HK3A 5LMNE 5IT9C 4KHPI 1B63A 2R42A 4DR7E 3B8HA 1QZRA 1HNZE 3K17A 4OX9I 3Q1QA 4LFCE 4DR1E 4DUYI 2UU9I 3T1YE 1N33I 1NZ0A 2ZBKB 3WU4A 1IBLI 4LF5I 1S4EA 1PKPA 4LFBE 3J81Q 4DR5E 2VQEE 3ZM7A 4JI2E 1NHJA 2X36A 5GMDA 1H73A 4DPWA 4FWDA 4JI1I 2XEXA 1PVGA 4JI8E 2V2VA 1XNQE 4DV6I 4HXZA 4DPTA 4DR2E 1N34I 1N32E 1Z0BA 4FN5A 2HKEA 1KVKA 2VQFE 4GKJI 2BM0A 3F0NA 3JAMQ 1HNWI 1RR9A 4YY3I 4DV0I 1MU5A 4FW9A 2HHHE 1UEKA 4RPFA 4JYAE 1OJ4A 4WUCA 5IWAI 4DPXA 3V2UC 4JV5E 4GKKI 2DEIA 3GONA 4R1FA 4B3RI 1NHIA 4FWHA 4DV3I 4DPYA 1Z0GA 1MG7A 4MYUA 3ZZ0A 4DU7A 5FLXC 4LFAE 4NXNE 4P52A 5LMNI 4X66E 4DR7I 1N0VC 4Z7CA 2BM1A 1IBKE 1HNZI 1ZM2A 4PRVA 4LFCI 4DR1I 1RREA 1B62A 1Z0EA 3T1YI 2WW4A 2UUBE 4DR4E 3ZKBA 5BR8E 4WUBA 3T1HE 4LF9E 4LF7E 1FJGE 4LFBI 4P7AA 4DR5I 4YHHE 2VQEI 3J7AM 3ZZTA 5A2QQ 4JI2I 4DV4E 1K47A 2UUAE 4ED4A 1IBME 4JI8I 1XNQI 3LPSA 1WUUA 3V5RA 4DR2I 5IT9Q 3QT8A 4HACB 1N32I 2VQFI 1FWLA 2E5LE 1XNRE 1HR0E 3PYDA 4M1KA 2V2ZA 1Z0VA 2V2QA 3WU6A 2HHHI 4K0KE 4PRXA 1EA6A 4JI6E 1I94E 4HYMA 4JV5I 4DV7I 2UXBE 3B78A 2UXDE 4JI3I 4DUZE 4USMA 1ELOA 4DV2E 4HACA 2DEJA 2LJPA 1Z5CA 4DR6E 2VF3A 4Z7YA 4ZVIA 3CWVA 3PYFA 4X65E 1FI4A 2E1RA 4DR3E 4LFAI 3J80Q 4NXNI 5GMEA 4X66I 1ZM3A 1XMQE 4USKA 1IBKI 2UUCE 4NXME 1BKNA 1ZXNA 2UXCE 1S16A 1Z5BA 3ZKDA 2ZM6E 2UUBI 3M6AA 4DR4I 4LF4E 5BR8I 3T1HI 4JI5E 4LF7I 4LF9I 2F4VE 1FJGI 1J5EE 4JI0E 1Z0WA 4YHHI 4DU8A 2J7KA 2CZ9A 4X62E 4FWGA 4DV4I 5L3JA 1Z0TA 2V8PA 2UUAI 1FWKA 4AQYE 1N34E 1IBMI 4PU9A 5FLXQ 4JI7E 5LMUE 2GS8A 2A2CA 4B3ME 4DV1E 1Z5AA 2E5LI 4XTJA 3LNUA 1XNRI 2R3VA 1HR0I 3LTOA 2HK2A 5LL6R 2ZITA 2NPFA 3QT5A 4K0KI 4B3SE 1HNXE 4LF6E 4B3TE 4LF8E 4JI6I 1XMOE 1I94I 4DV3E 2UXBI 4URLA 2UXDI 2HFUA 4HY1A 4DUZI 1KKHA 4DV2I 2OI2A 1Z0CA 2HKJA 4DR6I 3H4LA 1D6TA 4UT4A 4X65I 3OTOE 1FKAE 2A2DA 1PIEA 3K1JA 4DR3I 3B82A 1ZM4A 3J81C 4JYAI 1XMQI 1H7SA 4JI4E 2UUCI 4NXMI 3PYEA 2UXCI 3WU3A 3J7AG 4X64E 1N0UA 4DV5E 1KTVA 2ZM6I 2V34A 1N36E 1NHHA 1ZXMA 4LF4I 4KHPE 4KQVA 1VISA 4MYTA 1H72C 4JI5I 2F4VI 1Z59A 1J5EI 4JI0I 3JAMC 1FNMA 4OX9E 2EFGA 4X62I 3J80C 4I3HA 4DUYE 2BV3A 2Q2EB 4AQYI 2UU9E 1MX0A 3HULA 1N33E 1IBLE 4LF5E 4JI7I 5LMUI 3QT7A
chains in the Genus database with same CATH superfamily
4MU4A 3K85A 2JT2A 4B3MI 4DV1I 3UHMA 4OO1B 4JG4A 1KIJA 2HFSA 4DV7E 4OO1D 2WNRA 4JI1E 4JI3E 5C0XC 2X7IA 4OO1F 3PRYA 4DV6E 1OYSA 5DRPA 4B3SI 1HNXI 4ISAA 4LF6I 4B3TI 3U1KA 4LF8I 1U2RA 1XMOI 2BA0G 2BR2A 4IZKA 2AE8A 4GKJE 4EMDA 4U3DA 4OO1A 1HNWE 1XHKA 1H74A 4YY3E 4DV0E 2JE6B 5JEAB 3ZZUA 2PNMA 5IWAE 3OTOI 1OYRA 4IFDE 4GKKE 4UTGA 1ZM9A 5JEAD 1EI1A 1UDSA 2IESA 5JEAF 4DXLA 4B3RE 3PYGA 1H7UA 5A2QC 4JI4I 3L7ZA 3WU5A 3D4JA 2C37B 4QNJA 1A6FA 1USVA 4DPUA 3QT6A 5C0XD 2AJ4A 4LPFA 4X64I 3H1CA 4DV5I 2JE6A 5JEAA 1DARA 4LCGA 1N36I 4WUDA 2HK3A 5LMNE 5IT9C 3M85G 4KHPI 1B63A 1RHYA 5K36B 2R42A 4DR7E 1R6LA 3B8HA 1QZRA 1HNZE 3K17A 5K36D 4OX9I 3Q1QA 4LFCE 5C0XA 5K36F 4DR1E 4DUYI 1P42A 2UU9I 2C37A 3T1YE 1N33I 1NZ0A 2ZBKB 3WU4A 1IBLI 5DRRA 4LF5I 1S4EA 1PKPA 3B4TA 4LFBE 3J81Q 4DR5E 2VQEE 5K36A 3ZM7A 4JI2E 1NHJA 2C39B 2X36A 2PO0B 3M85D 5GMDA 1H73A 4LCFA 4DPWA 4FWDA 4JI1I 2XEXA 1PVGA 4JI8E 2V2VA 4BA1B 1XNQE 2IOPA 4AIMA 4HXZA 4DV6I 1E3HA 2WNRB 4LCHA 4DPTA 2CG9A 4DR2E 1N34I 1USUA 1N32E 1Z0BA 4FN5A 2HKEA 1KVKA 2VQFE 5DNXA 4GKJI 2BM0A 3F0NA 3JAMQ 2C39A 3HJCA 1HNWI 1RR9A 4YY3I 2PO0A 4DV0I 1MU5A 4FW9A 2IERA 2HHHE 3Q6MA 1UEKA 4RPFA 4JYAE 1OJ4A 5EKWA 4BA1A 4WUCA 5IWAI 4DPXA 5C0XE 3V2UC 4JV5E 4GKKI 2GO3A 3NZKA 2DEIA 3GONA 4R1FA 4B3RI 1NHIA 4FWHA 4DV3I 4DPYA 5ELWA 2VESA 5K36E 4QNKA 1Z0GA 4MDTA 3L7ZB 3P76A 1MG7A 4MYUA 3ZZ0A 4DU7A 5FLXC 4LFAE 3P3CA 4NXNE 1R6MA 4FW7A 4P52A 5LMNI 4X66E 2NN6C 4DR7I 1N0VC 4Z7CA 2BM1A 1IBKE 1HNZI 1ZM2A 4PRVA 4LFCI 2O1VA 5DRQA 4DR1I 1RREA 2CVEA 4NBQA 1B62A 1Z0EA 2IOQA 3T1YI 5C0XB 2WW4A 2BA0D 1UDOA 1Y60A 2UUBE 4DR4E 4IZJB 3HKMA 3ZKBA 5BR8E 1YHCA 4WUBA 3T1HE 4LF9E 4LF7E 3KRNA 1FJGE 4LFBI 5C0XF 4P7AA 4IZJD 4DR5I 4YHHE 2VQEI 3J7AM 3ZZTA 4LOMA 4IFDC 5A2QQ 4JI2I 4DV4E 1K47A 2UUAE 4ED4A 1IBME 4JI8I 1XNQI 2CGEA 3LPSA 1WUUA 3V5RA 2NN6B 4MU1A 4DR2I 5IT9Q 4IZJA 3QT8A 4FW5A 3P3EA 4HACB 1N32I 2NN6D 2VQFI 1FWLA 2NN6F 2E5LE 3DD6A 1XNRE 1HR0E 3PYDA 4M1KA 2V2ZA 1Z0VA 2V2QA 3WU6A 2HHHI 4K0KE 4PRXA 1EA6A 4JI6E 1I94E 4HYMA 4JV5I 4DV7I 2UXBE 3B78A 2UXDE 4JI3I 4DUZE 4USMA 2NN6A 1ELOA 4OO1C 4DV2E 2Z5CA 4HACA 2WP8B 2DEJA 2LJPA 3GMEA 1Z5CA 4DR6E 2VF3A 4Z7YA 2GQ0A 4ZVIA 3CWVA 3PYFA 4X65E 1FI4A 4FW6A 1YH8A 1HK7A 2E1RA 4IS9A 2C38A 5DROA 2BA1G 4DR3E 4LFAI 3J80Q 1UDNA 5DNLA 4NXNI 2O1TA 5GMEA 4X66I 1ZM3A 1XMQE 4USKA 2WP8A 1IBKI 2UUCE 4NXME 2Z5EA 1BKNA 3PS1A 1ZXNA 5JEAC 2UXCE 4U3BA 1VI7A 1S16A 1Z5BA 2JEAB 3ZKDA 2ZM6E 3Q6NA 4FW3A 3P3GA 2UUBI 4AIDA 3M6AA 4DR4I 4LF4E 2J65A 5BR8I 2PNZA 4MU3A 3T1HI 4JI5E 4LF7I 4LF9I 2F4VE 5EL9A 1FJGI 1J5EE 4JI0E 1Z0WA 2BA1D 4YHHI 4MQYA 1E3PA 4DU8A 2PO2B 2NN6E 2J7KA 2CZ9A 4X62E 4BA2B 3CDJA 4FWGA 4DV4I 5L3JA 1Z0TA 2V8PA 2UUAI 1FWKA 4AQYE 1N34E 1IBMI 2PNLA 4PU9A 2JEAA 5FLXQ 3U1YA 4JI7E 5LMUE 5K36C 2GS8A 2Z5BB 2A2CA 4B3ME 4DV1E 1Z5AA 3PS3A 3GCMA 2E5LI 4XTJA 2PO2A 3LNUA 1XNRI 1OYPA 2R3VA 1HR0I 3LTOA 2HK2A 4BA2A 3GLLA 3M7NG 1Y6ZA 5LL6R 2ZITA 4OZEA 1XXEA 4OKGA 2NPFA 2O3ZA 3QT5A 4K0KI 4B3SE 1HNXE 4N3OA 4B3TE 4LF6E 2PO1B 4LF8E 4JI6I 1XMOE 1I94I 4DV3E 2UXBI 4URLA 2UXDI 2HFUA 4HY1A 4DUZI 1KKHA 2F1DA 1Y4SA 4DV2I 2Z5BA 2OI2A 1Z0CA 2HKJA 4DR6I 2Z5CB 3H4LA 1D6TA 4UT4A 4X65I 1UDQA 3OTOE 1FKAE 2A2DA 1PIEA 3K1JA 2O1UA 4DR3I 2PO1A 3B82A 3M7ND 1ZM4A 3P06A 3J81C 2C38B 4JYAI 1XMQI 1Y4UA 1H7SA 4JI4E 4OO1E 4J3DA 2UUCI 4MU0A 4NXMI 4IFDB 1Y5YA 2O1WA 3PS2A 3PYEA 2UXCI 3WU3A 3J7AG 4X64E 1N0UA 4IFDD 4DV5E 1KTVA 2ZM6I 2V34A 4IFDF 1N36E 2JEBB 2GO4A 1NHHA 1ZXMA 5FWKA 4LF4I 3CDIA 4AM3A 4GQUA 4KHPE 4KQVA 1VISA 4MYTA 1H72C 4JI5I 2F4VI 1Z59A 1J5EI 4JI0I 3JAMC 2PNZB 1FNMA 4OX9E 2EFGA 4X62I 4IFDA 3J80C 4I3HA 4DUYE 2BV3A 2Q2EB 4AQYI 2UU9E 1MX0A 3HULA 1N33E 1IBLE 5JEAE 4LF5E 4FW4A 4JI7I 5LMUI 3QT7A 2BR2B 4IZKB 2JEBA
chains in the Genus database with same CATH topology
3K85A 4B3MI 4DV1I 4JG4A 1KIJA 2HFSA 4DV7E 4JI1E 4JI3E 2X7IA 3PRYA 4DV6E 4B3SI 1HNXI 4LF6I 4B3TI 4LF8I 1U2RA 1XMOI 4IZKA 4GKJE 4EMDA 1HNWE 1XHKA 1H74A 4YY3E 4DV0E 3ZZUA 2PNMA 5IWAE 3OTOI 4GKKE 4UTGA 1ZM9A 1EI1A 4DXLA 4B3RE 3PYGA 1H7UA 5A2QC 4JI4I 3WU5A 3D4JA 1A6FA 1USVA 4DPUA 3QT6A 2AJ4A 4X64I 4DV5I 1DARA 1N36I 4WUDA 2HK3A 5LMNE 5IT9C 4KHPI 1B63A 2R42A 4DR7E 3B8HA 1QZRA 1HNZE 3K17A 4OX9I 3Q1QA 4LFCE 4DR1E 4DUYI 2UU9I 3T1YE 1N33I 1NZ0A 2ZBKB 3WU4A 1IBLI 4LF5I 1S4EA 1PKPA 4LFBE 3J81Q 4DR5E 2VQEE 3ZM7A 4JI2E 1NHJA 2X36A 5GMDA 1H73A 4DPWA 4FWDA 4JI1I 2XEXA 1PVGA 4JI8E 2V2VA 1XNQE 2IOPA 4DV6I 4HXZA 4DPTA 2CG9A 4DR2E 1N34I 1USUA 1N32E 1Z0BA 4FN5A 2HKEA 1KVKA 2VQFE 4GKJI 2BM0A 3F0NA 3JAMQ 3HJCA 1HNWI 1RR9A 4YY3I 4DV0I 1MU5A 4FW9A 2HHHE 3Q6MA 1UEKA 4RPFA 4JYAE 1OJ4A 4WUCA 5IWAI 4DPXA 3V2UC 4JV5E 4GKKI 2DEIA 3GONA 4R1FA 4B3RI 1NHIA 4FWHA 4DV3I 4DPYA 1Z0GA 1MG7A 4MYUA 3ZZ0A 4DU7A 5FLXC 4LFAE 4NXNE 4P52A 5LMNI 4X66E 4DR7I 1N0VC 4Z7CA 2BM1A 1IBKE 1HNZI 1ZM2A 4PRVA 4LFCI 2O1VA 4DR1I 1RREA 1B62A 1Z0EA 2IOQA 3T1YI 2WW4A 2UUBE 4DR4E 4IZJB 3ZKBA 5BR8E 4WUBA 3T1HE 4LF9E 4LF7E 1FJGE 4LFBI 4P7AA 4IZJD 4DR5I 4YHHE 2VQEI 3J7AM 3ZZTA 5A2QQ 4JI2I 4DV4E 1K47A 2UUAE 4ED4A 1IBME 4JI8I 1XNQI 2CGEA 3LPSA 1WUUA 3V5RA 4DR2I 5IT9Q 4IZJA 3QT8A 4HACB 1N32I 2VQFI 1FWLA 2E5LE 1XNRE 1HR0E 3PYDA 4M1KA 2V2ZA 1Z0VA 2V2QA 3WU6A 2HHHI 4K0KE 4PRXA 1EA6A 4JI6E 1I94E 4HYMA 4JV5I 4DV7I 2UXBE 3B78A 2UXDE 4JI3I 4DUZE 4USMA 1ELOA 4DV2E 2Z5CA 4HACA 2DEJA 2LJPA 1Z5CA 4DR6E 2VF3A 4Z7YA 2GQ0A 4ZVIA 3CWVA 3PYFA 4X65E 1FI4A 1HK7A 2E1RA 4DR3E 4LFAI 3J80Q 4NXNI 2O1TA 5GMEA 4X66I 1ZM3A 1XMQE 4USKA 1IBKI 2UUCE 4NXME 2Z5EA 1BKNA 1ZXNA 2UXCE 1S16A 1Z5BA 3ZKDA 2ZM6E 3Q6NA 2UUBI 3M6AA 4DR4I 4LF4E 5BR8I 3T1HI 4JI5E 4LF7I 4LF9I 2F4VE 1FJGI 1J5EE 4JI0E 1Z0WA 4YHHI 4DU8A 2J7KA 2CZ9A 4X62E 4FWGA 4DV4I 5L3JA 1Z0TA 2V8PA 2UUAI 1FWKA 4AQYE 1N34E 1IBMI 2PNLA 4PU9A 5FLXQ 4JI7E 5LMUE 2GS8A 2Z5BB 2A2CA 4B3ME 4DV1E 1Z5AA 2E5LI 4XTJA 3LNUA 1XNRI 2R3VA 1HR0I 3LTOA 2HK2A 1Y6ZA 5LL6R 2ZITA 2NPFA 3QT5A 4K0KI 4B3SE 1HNXE 4N3OA 4B3TE 4LF6E 4LF8E 4JI6I 1XMOE 1I94I 4DV3E 2UXBI 4URLA 2UXDI 2HFUA 4HY1A 4DUZI 1KKHA 1Y4SA 4DV2I 2Z5BA 2OI2A 1Z0CA 2HKJA 4DR6I 2Z5CB 3H4LA 1D6TA 4UT4A 4X65I 3OTOE 1FKAE 2A2DA 1PIEA 3K1JA 2O1UA 4DR3I 3B82A 1ZM4A 3P06A 3J81C 4JYAI 1XMQI 1Y4UA 1H7SA 4JI4E 2UUCI 4NXMI 2O1WA 3PYEA 2UXCI 3WU3A 3J7AG 4X64E 1N0UA 4DV5E 1KTVA 2ZM6I 2V34A 1N36E 1NHHA 1ZXMA 5FWKA 4LF4I 4KHPE 4KQVA 1VISA 4MYTA 1H72C 4JI5I 2F4VI 1Z59A 1J5EI 4JI0I 3JAMC 1FNMA 4OX9E 2EFGA 4X62I 3J80C 4I3HA 4DUYE 2BV3A 2Q2EB 4AQYI 2UU9E 1MX0A 3HULA 1N33E 1IBLE 4LF5E 4JI7I 5LMUI 3QT7A 4IZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M I;  4DV1 I;  4JG4 A;  1KIJ A;  2HFS A;  4DV7 E;  4JI1 E;  4JI3 E;  2X7I A;  4DV6 E;  4B3S I;  1HNX I;  4LF6 I;  4B3T I;  4LF8 I;  1U2R A;  1XMO I;  4GKJ E;  4EMD A;  1HNW E;  1XHK A;  1H74 A;  4YY3 E;  4DV0 E;  3ZZU A;  3OTO I;  5IWA E;  4GKK E;  4UTG A;  1ZM9 A;  1EI1 A;  4DXL A;  4B3R E;  3PYG A;  1H7U A;  5A2Q C;  4JI4 I;  3WU5 A;  3D4J A;  1A6F A;  4DPU A;  3QT6 A;  2AJ4 A;  4X64 I;  4DV5 I;  1DAR A;  1N36 I;  4WUD A;  2HK3 A;  5LMN E;  5IT9 C;  4KHP I;  1B63 A;  2R42 A;  4DR7 E;  3B8H A;  1QZR A;  1HNZ E;  3K17 A;  4OX9 I;  3Q1Q A;  4LFC E;  4DR1 E;  4DUY I;  2UU9 I;  3T1Y E;  1N33 I;  1NZ0 A;  2ZBK B;  3WU4 A;  1IBL I;  4LF5 I;  1S4E A;  1PKP A;  4LFB E;  3J81 Q;  4DR5 E;  2VQE E;  3ZM7 A;  4JI2 E;  1NHJ A;  2X36 A;  5GMD A;  1H73 A;  4DPW A;  4FWD A;  4JI1 I;  2XEX A;  1PVG A;  4JI8 E;  2V2V A;  1XNQ E;  4DV6 I;  4HXZ A;  4DPT A;  4DR2 E;  1N34 I;  1N32 E;  1Z0B A;  4FN5 A;  2HKE A;  1KVK A;  2VQF E;  4GKJ I;  2BM0 A;  3F0N A;  3JAM Q;  1HNW I;  1RR9 A;  4YY3 I;  4DV0 I;  1MU5 A;  4FW9 A;  2HHH E;  1UEK A;  4RPF A;  4JYA E;  1OJ4 A;  4WUC A;  5IWA I;  4DPX A;  3V2U C;  4JV5 E;  4GKK I;  2DEI A;  3GON A;  4R1F A;  4B3R I;  1NHI A;  4FWH A;  4DV3 I;  4DPY A;  1Z0G A;  1MG7 A;  4MYU A;  3ZZ0 A;  4DU7 A;  5FLX C;  4LFA E;  4NXN E;  4P52 A;  5LMN I;  4X66 E;  4DR7 I;  1N0V C;  4Z7C A;  2BM1 A;  1IBK E;  1HNZ I;  1ZM2 A;  4PRV A;  4LFC I;  4DR1 I;  1RRE A;  1B62 A;  1Z0E A;  3T1Y I;  2WW4 A;  2UUB E;  4DR4 E;  3ZKB A;  5BR8 E;  4WUB A;  3T1H E;  4LF9 E;  4LF7 E;  1FJG E;  4LFB I;  4P7A A;  4DR5 I;  4YHH E;  2VQE I;  3J7A M;  3ZZT A;  5A2Q Q;  4JI2 I;  4DV4 E;  1K47 A;  2UUA E;  4ED4 A;  1IBM E;  4JI8 I;  1XNQ I;  3LPS A;  1WUU A;  3V5R A;  4DR2 I;  5IT9 Q;  3QT8 A;  4HAC B;  1N32 I;  2VQF I;  1FWL A;  2E5L E;  1XNR E;  1HR0 E;  3PYD A;  4M1K A;  2V2Z A;  1Z0V A;  2V2Q A;  3WU6 A;  2HHH I;  4K0K E;  4PRX A;  1EA6 A;  4JI6 E;  1I94 E;  4HYM A;  4JV5 I;  4DV7 I;  2UXB E;  3B78 A;  2UXD E;  4JI3 I;  4DUZ E;  4USM A;  1ELO A;  4DV2 E;  4HAC A;  2DEJ A;  2LJP A;  1Z5C A;  4DR6 E;  2VF3 A;  4Z7Y A;  4ZVI A;  3CWV A;  3PYF A;  4X65 E;  1FI4 A;  2E1R A;  4DR3 E;  4LFA I;  3J80 Q;  4NXN I;  5GME A;  4X66 I;  1ZM3 A;  1XMQ E;  4USK A;  1IBK I;  2UUC E;  4NXM E;  1BKN A;  1ZXN A;  2UXC E;  1S16 A;  1Z5B A;  3ZKD A;  2ZM6 E;  2UUB I;  3M6A A;  4DR4 I;  4LF4 E;  5BR8 I;  3T1H I;  4JI5 E;  4LF7 I;  4LF9 I;  2F4V E;  1FJG I;  1J5E E;  4JI0 E;  1Z0W A;  4YHH I;  4DU8 A;  2J7K A;  2CZ9 A;  4X62 E;  4FWG A;  4DV4 I;  5L3J A;  1Z0T A;  2V8P A;  2UUA I;  1FWK A;  4AQY E;  1N34 E;  1IBM I;  4PU9 A;  5FLX Q;  4JI7 E;  5LMU E;  2GS8 A;  2A2C A;  4B3M E;  4DV1 E;  1Z5A A;  2E5L I;  4XTJ A;  3LNU A;  1XNR I;  2R3V A;  1HR0 I;  3LTO A;  2HK2 A;  5LL6 R;  2ZIT A;  2NPF A;  3QT5 A;  4K0K I;  4B3S E;  1HNX E;  4LF6 E;  4B3T E;  4LF8 E;  4JI6 I;  1XMO E;  1I94 I;  4DV3 E;  2UXB I;  4URL A;  2UXD I;  2HFU A;  4HY1 A;  4DUZ I;  1KKH A;  4DV2 I;  2OI2 A;  1Z0C A;  2HKJ A;  4DR6 I;  3H4L A;  1D6T A;  4UT4 A;  4X65 I;  3OTO E;  1FKA E;  2A2D A;  1PIE A;  3K1J A;  4DR3 I;  3B82 A;  1ZM4 A;  3J81 C;  4JYA I;  1XMQ I;  1H7S A;  4JI4 E;  2UUC I;  4NXM I;  3PYE A;  2UXC I;  3WU3 A;  3J7A G;  4X64 E;  1N0U A;  4DV5 E;  1KTV A;  2ZM6 I;  2V34 A;  1N36 E;  1NHH A;  1ZXM A;  4LF4 I;  4KHP E;  4KQV A;  1VIS A;  4MYT A;  1H72 C;  4JI5 I;  2F4V I;  1Z59 A;  1J5E I;  4JI0 I;  3JAM C;  1FNM A;  4OX9 E;  2EFG A;  4X62 I;  3J80 C;  4I3H A;  4DUY E;  2BV3 A;  2Q2E B;  4AQY I;  2UU9 E;  1MX0 A;  3HUL A;  1N33 E;  1IBL E;  4LF5 E;  4JI7 I;  5LMU I;  3QT7 A; 
#chains in the Genus database with same CATH topology
 4MU4 A;  3K85 A;  2JT2 A;  4B3M I;  4DV1 I;  3UHM A;  4OO1 B;  4JG4 A;  1KIJ A;  2HFS A;  4DV7 E;  4OO1 D;  2WNR A;  4JI1 E;  4JI3 E;  5C0X C;  2X7I A;  4OO1 F;  3PRY A;  4DV6 E;  1OYS A;  5DRP A;  4B3S I;  1HNX I;  4ISA A;  4LF6 I;  4B3T I;  3U1K A;  4LF8 I;  1U2R A;  1XMO I;  2BA0 G;  2BR2 A;  4IZK A;  2AE8 A;  4GKJ E;  4EMD A;  4U3D A;  4OO1 A;  1HNW E;  1XHK A;  1H74 A;  4YY3 E;  4DV0 E;  2JE6 B;  5JEA B;  3ZZU A;  2PNM A;  5IWA E;  3OTO I;  1OYR A;  4IFD E;  4GKK E;  4UTG A;  1ZM9 A;  5JEA D;  1EI1 A;  1UDS A;  2IES A;  5JEA F;  4DXL A;  4B3R E;  3PYG A;  1H7U A;  5A2Q C;  4JI4 I;  3L7Z A;  3WU5 A;  3D4J A;  2C37 B;  4QNJ A;  1A6F A;  1USV A;  4DPU A;  3QT6 A;  5C0X D;  2AJ4 A;  4LPF A;  4X64 I;  3H1C A;  4DV5 I;  2JE6 A;  5JEA A;  1DAR A;  4LCG A;  1N36 I;  4WUD A;  2HK3 A;  5LMN E;  5IT9 C;  3M85 G;  4KHP I;  1B63 A;  1RHY A;  5K36 B;  2R42 A;  4DR7 E;  1R6L A;  3B8H A;  1QZR A;  1HNZ E;  3K17 A;  5K36 D;  4OX9 I;  3Q1Q A;  4LFC E;  5C0X A;  5K36 F;  4DR1 E;  4DUY I;  1P42 A;  2UU9 I;  2C37 A;  3T1Y E;  1N33 I;  1NZ0 A;  2ZBK B;  3WU4 A;  1IBL I;  5DRR A;  4LF5 I;  1S4E A;  1PKP A;  3B4T A;  4LFB E;  3J81 Q;  4DR5 E;  2VQE E;  5K36 A;  3ZM7 A;  4JI2 E;  1NHJ A;  2C39 B;  2X36 A;  2PO0 B;  3M85 D;  5GMD A;  1H73 A;  4LCF A;  4DPW A;  4FWD A;  4JI1 I;  2XEX A;  1PVG A;  4JI8 E;  2V2V A;  4BA1 B;  1XNQ E;  2IOP A;  4AIM A;  4HXZ A;  4DV6 I;  1E3H A;  2WNR B;  4LCH A;  4DPT A;  2CG9 A;  4DR2 E;  1N34 I;  1USU A;  1N32 E;  1Z0B A;  4FN5 A;  2HKE A;  1KVK A;  2VQF E;  5DNX A;  4GKJ I;  2BM0 A;  3F0N A;  3JAM Q;  2C39 A;  3HJC A;  1HNW I;  1RR9 A;  4YY3 I;  2PO0 A;  4DV0 I;  1MU5 A;  4FW9 A;  2IER A;  2HHH E;  3Q6M A;  1UEK A;  4RPF A;  4JYA E;  1OJ4 A;  5EKW A;  4BA1 A;  4WUC A;  5IWA I;  4DPX A;  5C0X E;  3V2U C;  4JV5 E;  4GKK I;  2GO3 A;  3NZK A;  2DEI A;  3GON A;  4R1F A;  4B3R I;  1NHI A;  4FWH A;  4DV3 I;  4DPY A;  5ELW A;  2VES A;  5K36 E;  4QNK A;  1Z0G A;  4MDT A;  3L7Z B;  3P76 A;  1MG7 A;  4MYU A;  3ZZ0 A;  4DU7 A;  5FLX C;  4LFA E;  3P3C A;  4NXN E;  1R6M A;  4FW7 A;  4P52 A;  5LMN I;  4X66 E;  2NN6 C;  4DR7 I;  1N0V C;  4Z7C A;  2BM1 A;  1IBK E;  1HNZ I;  1ZM2 A;  4PRV A;  4LFC I;  2O1V A;  5DRQ A;  4DR1 I;  1RRE A;  2CVE A;  4NBQ A;  1B62 A;  1Z0E A;  2IOQ A;  3T1Y I;  5C0X B;  2WW4 A;  2BA0 D;  1UDO A;  1Y60 A;  2UUB E;  4DR4 E;  4IZJ B;  3HKM A;  3ZKB A;  5BR8 E;  1YHC A;  4WUB A;  3T1H E;  4LF9 E;  4LF7 E;  3KRN A;  1FJG E;  4LFB I;  5C0X F;  4P7A A;  4IZJ D;  4DR5 I;  4YHH E;  2VQE I;  3J7A M;  3ZZT A;  4LOM A;  4IFD C;  5A2Q Q;  4JI2 I;  4DV4 E;  1K47 A;  2UUA E;  4ED4 A;  1IBM E;  4JI8 I;  1XNQ I;  2CGE A;  3LPS A;  1WUU A;  3V5R A;  2NN6 B;  4MU1 A;  4DR2 I;  5IT9 Q;  4IZJ A;  3QT8 A;  4FW5 A;  3P3E A;  4HAC B;  1N32 I;  2NN6 D;  2VQF I;  1FWL A;  2NN6 F;  2E5L E;  3DD6 A;  1XNR E;  1HR0 E;  3PYD A;  4M1K A;  2V2Z A;  1Z0V A;  2V2Q A;  3WU6 A;  2HHH I;  4K0K E;  4PRX A;  1EA6 A;  4JI6 E;  1I94 E;  4HYM A;  4JV5 I;  4DV7 I;  2UXB E;  3B78 A;  2UXD E;  4JI3 I;  4DUZ E;  4USM A;  2NN6 A;  1ELO A;  4OO1 C;  4DV2 E;  2Z5C A;  4HAC A;  2WP8 B;  2DEJ A;  2LJP A;  3GME A;  1Z5C A;  4DR6 E;  2VF3 A;  4Z7Y A;  2GQ0 A;  4ZVI A;  3CWV A;  3PYF A;  4X65 E;  1FI4 A;  4FW6 A;  1YH8 A;  1HK7 A;  2E1R A;  4IS9 A;  2C38 A;  5DRO A;  2BA1 G;  4DR3 E;  4LFA I;  3J80 Q;  1UDN A;  5DNL A;  4NXN I;  2O1T A;  5GME A;  4X66 I;  1ZM3 A;  1XMQ E;  4USK A;  2WP8 A;  1IBK I;  2UUC E;  4NXM E;  2Z5E A;  1BKN A;  3PS1 A;  1ZXN A;  5JEA C;  2UXC E;  4U3B A;  1VI7 A;  1S16 A;  1Z5B A;  2JEA B;  3ZKD A;  2ZM6 E;  3Q6N A;  4FW3 A;  3P3G A;  2UUB I;  4AID A;  3M6A A;  4DR4 I;  4LF4 E;  2J65 A;  5BR8 I;  2PNZ A;  4MU3 A;  3T1H I;  4JI5 E;  4LF7 I;  4LF9 I;  2F4V E;  5EL9 A;  1FJG I;  1J5E E;  4JI0 E;  1Z0W A;  2BA1 D;  4YHH I;  4MQY A;  1E3P A;  4DU8 A;  2PO2 B;  2NN6 E;  2J7K A;  2CZ9 A;  4X62 E;  4BA2 B;  3CDJ A;  4FWG A;  4DV4 I;  5L3J A;  1Z0T A;  2V8P A;  2UUA I;  1FWK A;  4AQY E;  1N34 E;  1IBM I;  2PNL A;  4PU9 A;  2JEA A;  5FLX Q;  3U1Y A;  4JI7 E;  5LMU E;  5K36 C;  2GS8 A;  2Z5B B;  2A2C A;  4B3M E;  4DV1 E;  1Z5A A;  3PS3 A;  3GCM A;  2E5L I;  4XTJ A;  2PO2 A;  3LNU A;  1XNR I;  1OYP A;  2R3V A;  1HR0 I;  3LTO A;  2HK2 A;  4BA2 A;  3GLL A;  3M7N G;  1Y6Z A;  5LL6 R;  2ZIT A;  4OZE A;  1XXE A;  4OKG A;  2NPF A;  2O3Z A;  3QT5 A;  4K0K I;  4B3S E;  1HNX E;  4N3O A;  4B3T E;  4LF6 E;  2PO1 B;  4LF8 E;  4JI6 I;  1XMO E;  1I94 I;  4DV3 E;  2UXB I;  4URL A;  2UXD I;  2HFU A;  4HY1 A;  4DUZ I;  1KKH A;  2F1D A;  1Y4S A;  4DV2 I;  2Z5B A;  2OI2 A;  1Z0C A;  2HKJ A;  4DR6 I;  2Z5C B;  3H4L A;  1D6T A;  4UT4 A;  4X65 I;  1UDQ A;  3OTO E;  1FKA E;  2A2D A;  1PIE A;  3K1J A;  2O1U A;  4DR3 I;  2PO1 A;  3B82 A;  3M7N D;  1ZM4 A;  3P06 A;  3J81 C;  2C38 B;  4JYA I;  1XMQ I;  1Y4U A;  1H7S A;  4JI4 E;  4OO1 E;  4J3D A;  2UUC I;  4MU0 A;  4NXM I;  4IFD B;  1Y5Y A;  2O1W A;  3PS2 A;  3PYE A;  2UXC I;  3WU3 A;  3J7A G;  4X64 E;  1N0U A;  4IFD D;  4DV5 E;  1KTV A;  2ZM6 I;  2V34 A;  4IFD F;  1N36 E;  2JEB B;  2GO4 A;  1NHH A;  1ZXM A;  5FWK A;  4LF4 I;  3CDI A;  4AM3 A;  4GQU A;  4KHP E;  4KQV A;  1VIS A;  4MYT A;  1H72 C;  4JI5 I;  2F4V I;  1Z59 A;  1J5E I;  4JI0 I;  3JAM C;  2PNZ B;  1FNM A;  4OX9 E;  2EFG A;  4X62 I;  4IFD A;  3J80 C;  4I3H A;  4DUY E;  2BV3 A;  2Q2E B;  4AQY I;  2UU9 E;  1MX0 A;  3HUL A;  1N33 E;  1IBL E;  5JEA E;  4LF5 E;  4FW4 A;  4JI7 I;  5LMU I;  3QT7 A;  2BR2 B;  4IZK B;  2JEB A; 
#chains in the Genus database with same CATH homology
 3K85 A;  4B3M I;  4DV1 I;  4JG4 A;  1KIJ A;  2HFS A;  4DV7 E;  4JI1 E;  4JI3 E;  2X7I A;  3PRY A;  4DV6 E;  4B3S I;  1HNX I;  4LF6 I;  4B3T I;  4LF8 I;  1U2R A;  1XMO I;  4IZK A;  4GKJ E;  4EMD A;  1HNW E;  1XHK A;  1H74 A;  4YY3 E;  4DV0 E;  3ZZU A;  2PNM A;  5IWA E;  3OTO I;  4GKK E;  4UTG A;  1ZM9 A;  1EI1 A;  4DXL A;  4B3R E;  3PYG A;  1H7U A;  5A2Q C;  4JI4 I;  3WU5 A;  3D4J A;  1A6F A;  1USV A;  4DPU A;  3QT6 A;  2AJ4 A;  4X64 I;  4DV5 I;  1DAR A;  1N36 I;  4WUD A;  2HK3 A;  5LMN E;  5IT9 C;  4KHP I;  1B63 A;  2R42 A;  4DR7 E;  3B8H A;  1QZR A;  1HNZ E;  3K17 A;  4OX9 I;  3Q1Q A;  4LFC E;  4DR1 E;  4DUY I;  2UU9 I;  3T1Y E;  1N33 I;  1NZ0 A;  2ZBK B;  3WU4 A;  1IBL I;  4LF5 I;  1S4E A;  1PKP A;  4LFB E;  3J81 Q;  4DR5 E;  2VQE E;  3ZM7 A;  4JI2 E;  1NHJ A;  2X36 A;  5GMD A;  1H73 A;  4DPW A;  4FWD A;  4JI1 I;  2XEX A;  1PVG A;  4JI8 E;  2V2V A;  1XNQ E;  2IOP A;  4DV6 I;  4HXZ A;  4DPT A;  2CG9 A;  4DR2 E;  1N34 I;  1USU A;  1N32 E;  1Z0B A;  4FN5 A;  2HKE A;  1KVK A;  2VQF E;  4GKJ I;  2BM0 A;  3F0N A;  3JAM Q;  3HJC A;  1HNW I;  1RR9 A;  4YY3 I;  4DV0 I;  1MU5 A;  4FW9 A;  2HHH E;  3Q6M A;  1UEK A;  4RPF A;  4JYA E;  1OJ4 A;  4WUC A;  5IWA I;  4DPX A;  3V2U C;  4JV5 E;  4GKK I;  2DEI A;  3GON A;  4R1F A;  4B3R I;  1NHI A;  4FWH A;  4DV3 I;  4DPY A;  1Z0G A;  1MG7 A;  4MYU A;  3ZZ0 A;  4DU7 A;  5FLX C;  4LFA E;  4NXN E;  4P52 A;  5LMN I;  4X66 E;  4DR7 I;  1N0V C;  4Z7C A;  2BM1 A;  1IBK E;  1HNZ I;  1ZM2 A;  4PRV A;  4LFC I;  2O1V A;  4DR1 I;  1RRE A;  1B62 A;  1Z0E A;  2IOQ A;  3T1Y I;  2WW4 A;  2UUB E;  4DR4 E;  4IZJ B;  3ZKB A;  5BR8 E;  4WUB A;  3T1H E;  4LF9 E;  4LF7 E;  1FJG E;  4LFB I;  4P7A A;  4IZJ D;  4DR5 I;  4YHH E;  2VQE I;  3J7A M;  3ZZT A;  5A2Q Q;  4JI2 I;  4DV4 E;  1K47 A;  2UUA E;  4ED4 A;  1IBM E;  4JI8 I;  1XNQ I;  2CGE A;  3LPS A;  1WUU A;  3V5R A;  4DR2 I;  5IT9 Q;  4IZJ A;  3QT8 A;  4HAC B;  1N32 I;  2VQF I;  1FWL A;  2E5L E;  1XNR E;  1HR0 E;  3PYD A;  4M1K A;  2V2Z A;  1Z0V A;  2V2Q A;  3WU6 A;  2HHH I;  4K0K E;  4PRX A;  1EA6 A;  4JI6 E;  1I94 E;  4HYM A;  4JV5 I;  4DV7 I;  2UXB E;  3B78 A;  2UXD E;  4JI3 I;  4DUZ E;  4USM A;  1ELO A;  4DV2 E;  2Z5C A;  4HAC A;  2DEJ A;  2LJP A;  1Z5C A;  4DR6 E;  2VF3 A;  4Z7Y A;  2GQ0 A;  4ZVI A;  3CWV A;  3PYF A;  4X65 E;  1FI4 A;  1HK7 A;  2E1R A;  4DR3 E;  4LFA I;  3J80 Q;  4NXN I;  2O1T A;  5GME A;  4X66 I;  1ZM3 A;  1XMQ E;  4USK A;  1IBK I;  2UUC E;  4NXM E;  2Z5E A;  1BKN A;  1ZXN A;  2UXC E;  1S16 A;  1Z5B A;  3ZKD A;  2ZM6 E;  3Q6N A;  2UUB I;  3M6A A;  4DR4 I;  4LF4 E;  5BR8 I;  3T1H I;  4JI5 E;  4LF7 I;  4LF9 I;  2F4V E;  1FJG I;  1J5E E;  4JI0 E;  1Z0W A;  4YHH I;  4DU8 A;  2J7K A;  2CZ9 A;  4X62 E;  4FWG A;  4DV4 I;  5L3J A;  1Z0T A;  2V8P A;  2UUA I;  1FWK A;  4AQY E;  1N34 E;  1IBM I;  2PNL A;  4PU9 A;  5FLX Q;  4JI7 E;  5LMU E;  2GS8 A;  2Z5B B;  2A2C A;  4B3M E;  4DV1 E;  1Z5A A;  2E5L I;  4XTJ A;  3LNU A;  1XNR I;  2R3V A;  1HR0 I;  3LTO A;  2HK2 A;  1Y6Z A;  5LL6 R;  2ZIT A;  2NPF A;  3QT5 A;  4K0K I;  4B3S E;  1HNX E;  4N3O A;  4B3T E;  4LF6 E;  4LF8 E;  4JI6 I;  1XMO E;  1I94 I;  4DV3 E;  2UXB I;  4URL A;  2UXD I;  2HFU A;  4HY1 A;  4DUZ I;  1KKH A;  1Y4S A;  4DV2 I;  2Z5B A;  2OI2 A;  1Z0C A;  2HKJ A;  4DR6 I;  2Z5C B;  3H4L A;  1D6T A;  4UT4 A;  4X65 I;  3OTO E;  1FKA E;  2A2D A;  1PIE A;  3K1J A;  2O1U A;  4DR3 I;  3B82 A;  1ZM4 A;  3P06 A;  3J81 C;  4JYA I;  1XMQ I;  1Y4U A;  1H7S A;  4JI4 E;  2UUC I;  4NXM I;  2O1W A;  3PYE A;  2UXC I;  3WU3 A;  3J7A G;  4X64 E;  1N0U A;  4DV5 E;  1KTV A;  2ZM6 I;  2V34 A;  1N36 E;  1NHH A;  1ZXM A;  5FWK A;  4LF4 I;  4KHP E;  4KQV A;  1VIS A;  4MYT A;  1H72 C;  4JI5 I;  2F4V I;  1Z59 A;  1J5E I;  4JI0 I;  3JAM C;  1FNM A;  4OX9 E;  2EFG A;  4X62 I;  3J80 C;  4I3H A;  4DUY E;  2BV3 A;  2Q2E B;  4AQY I;  2UU9 E;  1MX0 A;  3HUL A;  1N33 E;  1IBL E;  4LF5 E;  4JI7 I;  5LMU I;  3QT7 A;  4IZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...