1XNRI

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrI00
1MG7A 2HHHI 3QT7A 1XHKA 4JI4E 1XNQI 2DEJA 4JI5I 1KIJA 3WU6A 2HK3A 3GONA 3Q1QA 2OI2A 1H73A 4ED4A 2J7KA 5LMNE 4YY3I 1FI4A 4Z7CA 4DV3E 5BR8I 4GKJI 4DPYA 4DV7I 1QZRA 4JI2E 1N33I 4DR2I 3PYGA 1K47A 1KTVA 3LNUA 4USKA 4JI8I 4ZVIA 2HFUA 3LTOA 1XMQI 3WU4A 4HYMA 1FJGI 4B3SI 3HULA 3J80Q 2VF3A 4I3HA 5LMUI 1U2RA 2BM0A 3T1HI 3J7AM 3QT5A 4FWHA 4LF8E 4AQYI 4X65E 2CZ9A 1NHJA 1ELOA 2R42A 5IWAI 4DU7A 4DV0E 1B63A 1Z0VA 2UUAE 1XMOI 5A2QQ 1ZXMA 3JAMC 5FLXQ 2HFSA 4UT4A 4M1KA 3J7AG 4MYUA 2EFGA 3K17A 1N36E 4JI3E 4LF5I 1A6FA 4B3ME 4JI2I 4DR4E 1N33E 1ZM9A 3ZZUA 4DR7I 4DUYE 2UXDE 2E5LE 1XMQE 4DUZI 2XEXA 4JV5I 4DR3I 4NXME 1H72C 3PYDA 1FJGE 4GKKE 1MX0A 3WU5A 4LF7E 3PYFA 4DPUA 4KHPI 1H74A 1ZXNA 4R1FA 1UEKA 4HACB 4DXLA 4LF8I 4FN5A 1WUUA 4DPTA 3T1YI 4X65I 1MU5A 4DV0I 2DEIA 2ZITA 5LL6R 4DV2E 1Z0CA 2UUBE 4DR1I 4B3RE 1HNWE 4JG4A 5FLXC 1N0UA 1PIEA 4DV1E 2UU9E 1Z5CA 2VQEI 4URLA 4JI0I 1HNZI 4B3TE 4B3MI 1XNRE 1S4EA 4YHHE 1ZM2A 1N32I 3ZM7A 2UXDI 1S16A 2E5LI 4X66I 1EA6A 2V2QA 4LF9I 4NXMI 4JI4I 4JI1E 3F0NA 1NHHA 4GKKI 4LFAE 4K0KI 4DPWA 4LF6I 4KHPE 3ZKDA 1B62A 2X36A 5L3JA 1Z0BA 2ZM6E 4WUCA 2V2ZA 2Q2EB 4Z7YA 1Z0WA 1IBLI 1BKNA 1Z5AA 4DR2E 3QT8A 2UUBI 3ZZ0A 4B3RI 4KQVA 4XTJA 1KKHA 3V2UC 4UTGA 4LFBE 2V8PA 4B3SE 1FKAE 4USMA 3K1JA 5A2QC 4YHHI 1PVGA 1Z0EA 1J5EI 3M6AA 4DR6E 3CWVA 4DV6I 3D4JA 2HKEA 4DR5I 4AQYE 1FWLA 4JYAI 1D6TA 1NHIA 1RREA 1HNXE 5IT9Q 2V34A 1NZ0A 2UUAI 2BM1A 1VISA 4X64I 3QT6A 2ZM6I 2F4VI 3J81C 2X7IA 4LF4E 4LFCE 4X62I 2HHHE 1Z5BA 1ZM3A 1DARA 1IBKE 1HR0I 1IBLE 4DR4I 4FWDA 4DUYI 2UXCE 2NPFA 4DUZE 4JV5E 2A2CA 4DR3E 3PYEA 4YY3E 5LMNI 3ZKBA 4LFBI 4P52A 4DU8A 4P7AA 1FNMA 1IBME 1J5EE 4WUBA 3WU3A 2UUCI 4HACA 1H7SA 4JI8E 4DR6I 4DV6E 4HY1A 3T1YE 1H7UA 4DV5I 2UXBE 4PU9A 4DV4I 4OX9E 2R3VA 2WW4A 3OTOE 5LMUE 4DR1E 5GMEA 2F4VE 1HNWI 1N0VC 4X62E 2BV3A 4DV1I 2UU9I 2GS8A 2VQFE 1IBKI 1HR0E 4B3TI 4JI0E 4NXNE 5IWAE 4DPXA 3JAMQ 1N32E 1XMOE 2UXCI 4JI6E 2LJPA 1N34E 1KVKA 1ZM4A 4RPFA 4PRVA 4X66E 4LF9E 4JI1I 2V2VA 1N36I 4JI3I 4LF5E 2AJ4A 4LFAI 4K0KE 4LF6E 1IBMI 4JI7I 4DR7E 2UUCE 3B82A 4FWGA 3LPSA 1I94I 1XNQE 4EMDA 4HXZA 4DV5E 2UXBI 4JI5E 2ZBKB 4DV4E 4OX9I 2A2DA 4LF7I 3OTOI 3B78A 4PRXA 3V5RA 4WUDA 3H4LA 4MYTA 1OJ4A 2HK2A 5IT9C 2VQFI 5BR8E 4DV3I 4GKJE 4NXNI 1Z0TA 4DV2I 4DV7E 2E1RA 4JI6I 3J81Q 1N34I 1PKPA 2HKJA 4FW9A 1FWKA 4DR5E 1EI1A 1RR9A 4JYAE 3J80C 5GMDA 1HNXI 1Z59A 2VQEE 1HNZE 1XNRI 3B8HA 1Z0GA 4JI7E 4X64E 3T1HE 1I94E 4LF4I 3ZZTA 4LFCI
chains in the Genus database with same CATH superfamily
1MG7A 3PS2A 2HHHI 3QT7A 1XHKA 4JI4E 1XNQI 2JEBA 2DEJA 4JI5I 1KIJA 2Z5BB 3WU6A 2NN6A 3PRYA 2HK3A 3GONA 2PNZA 3Q1QA 2O1VA 2O3ZA 2OI2A 1H73A 4ED4A 1YHCA 2PNMA 4FW5A 2J7KA 1USUA 5LMNE 4YY3I 3GLLA 1FI4A 4Z7CA 3HJCA 4DV3E 5BR8I 4GKJI 1E3HA 2C39B 4DPYA 4DV7I 1QZRA 4IS9A 4JI2E 1N33I 4DR2I 3PYGA 1K47A 1KTVA 3LNUA 4USKA 4JI8I 2PO2B 4ZVIA 2HFUA 4FW4A 3LTOA 1XMQI 3WU4A 4HYMA 1FJGI 4B3SI 2BA1D 2NN6F 3HULA 3J80Q 2VF3A 4I3HA 5LMUI 1U2RA 2BM0A 3T1HI 3J7AM 3QT5A 4MU3A 4MU1A 4LOMA 3P3EA 4FWHA 4LF8E 3Q6NA 4BA2A 4LCHA 4AQYI 4X65E 2CZ9A 1NHJA 1ELOA 2R42A 4OKGA 5IWAI 4DU7A 4DV0E 1B63A 1Z0VA 2UUAE 1XMOI 5A2QQ 1ZXMA 4IZKA 3GMEA 4FW7A 1R6LA 2AE8A 3JAMC 5FLXQ 1E3PA 2HFSA 4UT4A 4M1KA 1UDSA 2JEAA 3J7AG 4MYUA 2EFGA 3K17A 1N36E 4JI3E 4LF5I 4IFDD 1A6FA 5DRPA 4B3ME 4FW6A 5EL9A 5ELWA 2NN6E 1P42A 4JI2I 1ZM9A 4DR4E 1N33E 3ZZUA 4DR7I 4AIDA 3KRNA 4DUYE 2UXDE 2E5LE 1XMQE 3M85G 4DUZI 2XEXA 4JV5I 4DR3I 4NXME 5K36F 1H72C 3PYDA 4IFDA 2PNLA 1FJGE 4GKKE 1MX0A 3WU5A 3NZKA 4LF7E 3PYFA 4DPUA 3P3GA 4KHPI 1H74A 1ZXNA 4R1FA 1UEKA 3M7NG 2CGEA 4HACB 2C39A 4IFDE 4DXLA 4LF8I 4FN5A 1WUUA 4DPTA 3T1YI 4X65I 4MQYA 1MU5A 4DV0I 2DEIA 2ZITA 5LL6R 5C0XB 4DV2E 3B4TA 1YH8A 3CDIA 1Z0CA 4ISAA 2UUBE 4DR1I 4B3RE 1HNWE 1RHYA 4JG4A 5FLXC 3M85D 1N0UA 1PIEA 4DV1E 2UU9E 1Z5CA 5C0XD 4URLA 4JI0I 2VQEI 1HNZI 4B3TE 4B3MI 1XNRE 1S4EA 4YHHE 5DRQA 4OO1A 1ZM2A 4OO1B 1N32I 3ZM7A 4LCGA 1R6MA 2UXDI 1S16A 2WP8A 2E5LI 4X66I 1EA6A 2V2QA 1USVA 2O1WA 4LF9I 4NXMI 4JI4I 2F1DA 2JE6A 4JI1E 4OO1E 3F0NA 3DD6A 1NHHA 4GKKI 2IESA 2GO4A 4LFAE 4K0KI 4DPWA 4LF6I 4KHPE 3ZKDA 3CDJA 1Y4UA 4BA2B 1B62A 2X36A 5L3JA 4OO1C 1Z0BA 4LPFA 2ZM6E 2JT2A 4AIMA 3Q6MA 1Y4SA 4WUCA 2V2ZA 3P3CA 2Q2EB 2BA0G 4LCFA 4Z7YA 1Z0WA 1IBLI 1BKNA 5DROA 1Z5AA 2PO1B 4DR2E 2O1UA 3QT8A 2WNRB 2UUBI 4QNKA 3ZZ0A 1Y6ZA 4IZJD 4B3RI 1UDNA 4KQVA 2WP8B 4XTJA 1KKHA 2PO2A 4IFDF 3V2UC 4UTGA 4LFBE 2V8PA 4B3SE 1FKAE 3HKMA 4USMA 3K1JA 5A2QC 4YHHI 1PVGA 2WNRA 1Z0EA 5DNXA 1J5EI 2NN6D 3M6AA 4BA1A 4DR6E 3CWVA 4DV6I 3D4JA 5JEAC 2PO0B 2HKEA 4DR5I 3K85A 4AQYE 1FWLA 4JYAI 5DNLA 2NN6B 1NHIA 1RREA 1HNXE 1D6TA 5IT9Q 2V34A 1NZ0A 2UUAI 2NN6C 1Y60A 2BM1A 1VISA 4X64I 3QT6A 4OO1F 2ZM6I 2F4VI 2BR2A 3J81C 2X7IA 4LF4E 4LFCE 4X62I 2HHHE 4U3DA 2GO3A 1Z5BA 1ZM3A 1DARA 5JEAA 1IBKE 4QNJA 1HR0I 1IBLE 2BA1G 1UDQA 4DR4I 4NBQA 2C38A 4FWDA 4DUYI 2UXCE 2BR2B 4MDTA 2NPFA 4DUZE 3GCMA 1XXEA 4IFDC 4JV5E 2A2CA 4DR3E 2GQ0A 3PYEA 4YY3E 5LMNI 3ZKBA 4LFBI 4P52A 3PS3A 4DU8A 4P7AA 1FNMA 1IBME 1J5EE 4WUBA 3WU3A 2BA0D 2UUCI 4HACA 1H7SA 4JI8E 4DR6I 4DV6E 4HY1A 3T1YE 1H7UA 4DV5I 2UXBE 4PU9A 4DV4I 4OX9E 2R3VA 5JEAB 2WW4A 3OTOE 5LMUE 1OYRA 2VESA 4DR1E 5GMEA 1HK7A 1UDOA 2F4VE 1HNWI 1N0VC 4X62E 2BV3A 1OYPA 4DV1I 2CVEA 2UU9I 2GS8A 2VQFE 1IBKI 1HR0E 5K36C 4B3TI 4JI0E 4NXNE 5IWAE 4OZEA 4DPXA 1Y5YA 2JEAB 3JAMQ 1N32E 1XMOE 2UXCI 4JI6E 2LJPA 1N34E 1KVKA 1ZM4A 4RPFA 4PRVA 4X66E 3L7ZB 4LF9E 4AM3A 2Z5CB 4JI1I 2V2VA 2PO0A 3M7ND 1N36I 4JI3I 4LF5E 5C0XC 2AJ4A 4LFAI 4K0KE 4LF6E 1IBMI 5JEAE 2C38B 4JI7I 4DR7E 2UUCE 3B82A 4FWGA 3LPSA 5C0XE 1I94I 5K36D 2C37B 5K36A 1VI7A 1XNQE 4EMDA 4HXZA 3U1YA 5C0XF 4DV5E 2UXBI 2CG9A 3UHMA 4JI5E 4N3OA 4OO1D 5FWKA 2ZBKB 4DV4E 4OX9I 2A2DA 2Z5CA 3OTOI 4LF7I 3B78A 4IFDB 3PS1A 2J65A 3U1KA 3L7ZA 4PRXA 3V5RA 5K36E 4WUDA 3H4LA 4MYTA 2JEBB 2C37A 5K36B 1OJ4A 2HK2A 2IERA 5IT9C 4U3BA 5C0XA 1OYSA 4MU4A 2VQFI 5BR8E 4DV3I 2O1TA 4IZJB 4GKJE 4NXNI 4J3DA 1Z0TA 4BA1B 4DV2I 4DV7E 4IZKB 2E1RA 5JEAD 4JI6I 3J81Q 1N34I 4MU0A 1PKPA 5EKWA 2HKJA 4FW9A 2PNZB 4GQUA 1FWKA 3P06A 4DR5E 4FW3A 2JE6B 5DRRA 1EI1A 1RR9A 5JEAF 3J80C 5GMDA 4JYAE 1HNXI 1Z59A 2VQEE 1HNZE 1XNRI 3B8HA 3H1CA 1Z0GA 4JI7E 4X64E 2IOPA 2PO1A 2Z5BA 2Z5EA 3P76A 2IOQA 3T1HE 4IZJA 1I94E 4LF4I 3ZZTA 4LFCI
chains in the Genus database with same CATH topology
1MG7A 2HHHI 3QT7A 1XHKA 4JI4E 1XNQI 2DEJA 4JI5I 1KIJA 2Z5BB 3WU6A 3PRYA 2HK3A 3GONA 3Q1QA 2O1VA 2OI2A 1H73A 4ED4A 2PNMA 2J7KA 1USUA 5LMNE 4YY3I 1FI4A 4Z7CA 3HJCA 4DV3E 5BR8I 4GKJI 4DPYA 4DV7I 1QZRA 4JI2E 1N33I 4DR2I 3PYGA 1K47A 1KTVA 3LNUA 4USKA 4JI8I 4ZVIA 2HFUA 3LTOA 1XMQI 3WU4A 4HYMA 1FJGI 4B3SI 3HULA 3J80Q 2VF3A 4I3HA 5LMUI 1U2RA 2BM0A 3T1HI 3J7AM 3QT5A 4FWHA 4LF8E 3Q6NA 4AQYI 4X65E 2CZ9A 1NHJA 1ELOA 2R42A 5IWAI 4DU7A 4DV0E 1B63A 1Z0VA 2UUAE 1XMOI 5A2QQ 1ZXMA 4IZKA 3JAMC 5FLXQ 2HFSA 4UT4A 4M1KA 3J7AG 4MYUA 2EFGA 3K17A 1N36E 4JI3E 4LF5I 1A6FA 4B3ME 4JI2I 4DR4E 1N33E 1ZM9A 3ZZUA 4DR7I 4DUYE 2UXDE 2E5LE 1XMQE 4DUZI 2XEXA 4JV5I 4DR3I 4NXME 1H72C 3PYDA 2PNLA 1FJGE 4GKKE 1MX0A 3WU5A 4LF7E 3PYFA 4DPUA 4KHPI 1H74A 1ZXNA 4R1FA 1UEKA 2CGEA 4HACB 4DXLA 4LF8I 4FN5A 1WUUA 4DPTA 3T1YI 4X65I 1MU5A 4DV0I 2DEIA 2ZITA 5LL6R 4DV2E 1Z0CA 2UUBE 4DR1I 4B3RE 1HNWE 4JG4A 5FLXC 1N0UA 1PIEA 4DV1E 2UU9E 1Z5CA 1HNZI 2VQEI 4URLA 4JI0I 4B3TE 4B3MI 1XNRE 1S4EA 4YHHE 1ZM2A 1N32I 3ZM7A 2UXDI 1S16A 2E5LI 4X66I 1EA6A 2V2QA 1USVA 2O1WA 4LF9I 4NXMI 4JI4I 4JI1E 3F0NA 1NHHA 4GKKI 4LFAE 4K0KI 4DPWA 4LF6I 4KHPE 3ZKDA 1Y4UA 1B62A 2X36A 5L3JA 1Z0BA 2ZM6E 3Q6MA 1Y4SA 4WUCA 2V2ZA 2Q2EB 4Z7YA 1Z0WA 1IBLI 1BKNA 1Z5AA 4DR2E 2O1UA 3QT8A 2UUBI 3ZZ0A 1Y6ZA 4IZJD 4B3RI 4KQVA 4XTJA 1KKHA 3V2UC 4UTGA 4LFBE 2V8PA 4B3SE 1FKAE 4USMA 3K1JA 5A2QC 4YHHI 1PVGA 1Z0EA 1J5EI 3M6AA 4DR6E 3CWVA 4DV6I 3D4JA 2HKEA 4DR5I 3K85A 4AQYE 1FWLA 4JYAI 1D6TA 1NHIA 1RREA 1HNXE 5IT9Q 2V34A 1NZ0A 2UUAI 2BM1A 1VISA 4X64I 3QT6A 2ZM6I 2F4VI 3J81C 2X7IA 4LF4E 4LFCE 4X62I 2HHHE 1Z5BA 1ZM3A 1DARA 1IBKE 1HR0I 1IBLE 4DR4I 4FWDA 4DUYI 2UXCE 2NPFA 4DUZE 4JV5E 2A2CA 4DR3E 2GQ0A 3PYEA 4YY3E 5LMNI 3ZKBA 4LFBI 4P52A 4DU8A 4P7AA 1FNMA 1IBME 1J5EE 4WUBA 3WU3A 2UUCI 4HACA 1H7SA 4JI8E 4DR6I 4DV6E 4HY1A 3T1YE 1H7UA 4DV5I 2UXBE 4PU9A 4DV4I 4OX9E 2R3VA 2WW4A 3OTOE 5LMUE 4DR1E 5GMEA 1HK7A 2F4VE 1HNWI 1N0VC 4X62E 2BV3A 4DV1I 2UU9I 2GS8A 2VQFE 1IBKI 1HR0E 4B3TI 4JI0E 4NXNE 5IWAE 4DPXA 3JAMQ 1N32E 1XMOE 2UXCI 4JI6E 2LJPA 1N34E 1KVKA 1ZM4A 4RPFA 4PRVA 4X66E 4LF9E 2Z5CB 4JI1I 2V2VA 1N36I 4JI3I 4LF5E 2AJ4A 4LFAI 4K0KE 4LF6E 1IBMI 4JI7I 4DR7E 2UUCE 3B82A 4FWGA 3LPSA 1I94I 1XNQE 4EMDA 4HXZA 4DV5E 2UXBI 2CG9A 4JI5E 4N3OA 5FWKA 2ZBKB 4DV4E 4OX9I 2A2DA 2Z5CA 3OTOI 4LF7I 3B78A 4PRXA 3V5RA 4WUDA 3H4LA 4MYTA 1OJ4A 2HK2A 5IT9C 2VQFI 5BR8E 4DV3I 2O1TA 4IZJB 4GKJE 4NXNI 1Z0TA 4DV2I 4DV7E 4IZKB 2E1RA 4JI6I 3J81Q 1N34I 1PKPA 2HKJA 4FW9A 1FWKA 3P06A 4DR5E 1EI1A 1RR9A 4JYAE 3J80C 5GMDA 1HNXI 1Z59A 2VQEE 1HNZE 1XNRI 3B8HA 1Z0GA 4JI7E 4X64E 2IOPA 2Z5BA 2Z5EA 2IOQA 3T1HE 4IZJA 1I94E 4LF4I 3ZZTA 4LFCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG7 A;  2HHH I;  3QT7 A;  1XHK A;  4JI4 E;  1XNQ I;  2DEJ A;  4JI5 I;  1KIJ A;  3WU6 A;  2HK3 A;  3GON A;  3Q1Q A;  2OI2 A;  1H73 A;  4ED4 A;  2J7K A;  5LMN E;  4YY3 I;  1FI4 A;  4Z7C A;  4DV3 E;  5BR8 I;  4GKJ I;  4DPY A;  4DV7 I;  1QZR A;  4JI2 E;  1N33 I;  4DR2 I;  3PYG A;  1K47 A;  1KTV A;  3LNU A;  4USK A;  4JI8 I;  4ZVI A;  2HFU A;  3LTO A;  1XMQ I;  3WU4 A;  4HYM A;  1FJG I;  4B3S I;  3HUL A;  3J80 Q;  2VF3 A;  4I3H A;  5LMU I;  1U2R A;  2BM0 A;  3T1H I;  3J7A M;  3QT5 A;  4FWH A;  4LF8 E;  4AQY I;  4X65 E;  2CZ9 A;  1NHJ A;  1ELO A;  2R42 A;  5IWA I;  4DU7 A;  4DV0 E;  1B63 A;  1Z0V A;  2UUA E;  1XMO I;  5A2Q Q;  1ZXM A;  3JAM C;  5FLX Q;  2HFS A;  4UT4 A;  4M1K A;  3J7A G;  4MYU A;  2EFG A;  3K17 A;  1N36 E;  4JI3 E;  4LF5 I;  1A6F A;  4B3M E;  4JI2 I;  4DR4 E;  1N33 E;  1ZM9 A;  3ZZU A;  4DR7 I;  4DUY E;  2UXD E;  2E5L E;  1XMQ E;  4DUZ I;  2XEX A;  4JV5 I;  4DR3 I;  4NXM E;  1H72 C;  3PYD A;  1FJG E;  4GKK E;  1MX0 A;  3WU5 A;  4LF7 E;  3PYF A;  4DPU A;  4KHP I;  1H74 A;  1ZXN A;  4R1F A;  1UEK A;  4HAC B;  4DXL A;  4LF8 I;  4FN5 A;  1WUU A;  4DPT A;  3T1Y I;  4X65 I;  1MU5 A;  4DV0 I;  2DEI A;  2ZIT A;  5LL6 R;  4DV2 E;  1Z0C A;  2UUB E;  4DR1 I;  4B3R E;  1HNW E;  4JG4 A;  5FLX C;  1N0U A;  1PIE A;  4DV1 E;  2UU9 E;  1Z5C A;  2VQE I;  4URL A;  4JI0 I;  1HNZ I;  4B3T E;  4B3M I;  1XNR E;  1S4E A;  4YHH E;  1ZM2 A;  1N32 I;  3ZM7 A;  2UXD I;  1S16 A;  2E5L I;  4X66 I;  1EA6 A;  2V2Q A;  4LF9 I;  4NXM I;  4JI4 I;  4JI1 E;  3F0N A;  1NHH A;  4GKK I;  4LFA E;  4K0K I;  4DPW A;  4LF6 I;  4KHP E;  3ZKD A;  1B62 A;  2X36 A;  5L3J A;  1Z0B A;  2ZM6 E;  4WUC A;  2V2Z A;  2Q2E B;  4Z7Y A;  1Z0W A;  1IBL I;  1BKN A;  1Z5A A;  4DR2 E;  3QT8 A;  2UUB I;  3ZZ0 A;  4B3R I;  4KQV A;  4XTJ A;  1KKH A;  3V2U C;  4UTG A;  4LFB E;  2V8P A;  4B3S E;  1FKA E;  4USM A;  3K1J A;  5A2Q C;  4YHH I;  1PVG A;  1Z0E A;  1J5E I;  3M6A A;  4DR6 E;  3CWV A;  4DV6 I;  3D4J A;  2HKE A;  4DR5 I;  4AQY E;  1FWL A;  4JYA I;  1D6T A;  1NHI A;  1RRE A;  1HNX E;  5IT9 Q;  2V34 A;  1NZ0 A;  2UUA I;  2BM1 A;  1VIS A;  4X64 I;  3QT6 A;  2ZM6 I;  2F4V I;  3J81 C;  2X7I A;  4LF4 E;  4LFC E;  4X62 I;  2HHH E;  1Z5B A;  1ZM3 A;  1DAR A;  1IBK E;  1HR0 I;  1IBL E;  4DR4 I;  4FWD A;  4DUY I;  2UXC E;  2NPF A;  4DUZ E;  4JV5 E;  2A2C A;  4DR3 E;  3PYE A;  4YY3 E;  5LMN I;  3ZKB A;  4LFB I;  4P52 A;  4DU8 A;  4P7A A;  1FNM A;  1IBM E;  1J5E E;  4WUB A;  3WU3 A;  2UUC I;  4HAC A;  1H7S A;  4JI8 E;  4DR6 I;  4DV6 E;  4HY1 A;  3T1Y E;  1H7U A;  4DV5 I;  2UXB E;  4PU9 A;  4DV4 I;  4OX9 E;  2R3V A;  2WW4 A;  3OTO E;  5LMU E;  4DR1 E;  5GME A;  2F4V E;  1HNW I;  1N0V C;  4X62 E;  2BV3 A;  4DV1 I;  2UU9 I;  2GS8 A;  2VQF E;  1IBK I;  1HR0 E;  4B3T I;  4JI0 E;  4NXN E;  5IWA E;  4DPX A;  3JAM Q;  1N32 E;  1XMO E;  2UXC I;  4JI6 E;  2LJP A;  1N34 E;  1KVK A;  1ZM4 A;  4RPF A;  4PRV A;  4X66 E;  4LF9 E;  4JI1 I;  2V2V A;  1N36 I;  4JI3 I;  4LF5 E;  2AJ4 A;  4LFA I;  4K0K E;  4LF6 E;  1IBM I;  4JI7 I;  4DR7 E;  2UUC E;  3B82 A;  4FWG A;  3LPS A;  1I94 I;  1XNQ E;  4EMD A;  4HXZ A;  4DV5 E;  2UXB I;  4JI5 E;  2ZBK B;  4DV4 E;  4OX9 I;  2A2D A;  4LF7 I;  3OTO I;  3B78 A;  4PRX A;  3V5R A;  4WUD A;  3H4L A;  4MYT A;  1OJ4 A;  2HK2 A;  5IT9 C;  2VQF I;  5BR8 E;  4DV3 I;  4GKJ E;  4NXN I;  1Z0T A;  4DV2 I;  4DV7 E;  2E1R A;  4JI6 I;  3J81 Q;  1N34 I;  1PKP A;  2HKJ A;  4FW9 A;  1FWK A;  4DR5 E;  1EI1 A;  1RR9 A;  4JYA E;  3J80 C;  5GMD A;  1HNX I;  1Z59 A;  2VQE E;  1HNZ E;  1XNR I;  3B8H A;  1Z0G A;  4JI7 E;  4X64 E;  3T1H E;  1I94 E;  4LF4 I;  3ZZT A;  4LFC I; 
#chains in the Genus database with same CATH topology
 1MG7 A;  3PS2 A;  2HHH I;  3QT7 A;  1XHK A;  4JI4 E;  1XNQ I;  2JEB A;  2DEJ A;  4JI5 I;  1KIJ A;  2Z5B B;  3WU6 A;  2NN6 A;  3PRY A;  2HK3 A;  3GON A;  2PNZ A;  3Q1Q A;  2O1V A;  2O3Z A;  2OI2 A;  1H73 A;  4ED4 A;  1YHC A;  2PNM A;  4FW5 A;  2J7K A;  1USU A;  5LMN E;  4YY3 I;  3GLL A;  1FI4 A;  4Z7C A;  3HJC A;  4DV3 E;  5BR8 I;  4GKJ I;  1E3H A;  2C39 B;  4DPY A;  4DV7 I;  1QZR A;  4IS9 A;  4JI2 E;  1N33 I;  4DR2 I;  3PYG A;  1K47 A;  1KTV A;  3LNU A;  4USK A;  4JI8 I;  2PO2 B;  4ZVI A;  2HFU A;  4FW4 A;  3LTO A;  1XMQ I;  3WU4 A;  4HYM A;  1FJG I;  4B3S I;  2BA1 D;  2NN6 F;  3HUL A;  3J80 Q;  2VF3 A;  4I3H A;  5LMU I;  1U2R A;  2BM0 A;  3T1H I;  3J7A M;  3QT5 A;  4MU3 A;  4MU1 A;  4LOM A;  3P3E A;  4FWH A;  4LF8 E;  3Q6N A;  4BA2 A;  4LCH A;  4AQY I;  4X65 E;  2CZ9 A;  1NHJ A;  1ELO A;  2R42 A;  4OKG A;  5IWA I;  4DU7 A;  4DV0 E;  1B63 A;  1Z0V A;  2UUA E;  1XMO I;  5A2Q Q;  1ZXM A;  4IZK A;  3GME A;  4FW7 A;  1R6L A;  2AE8 A;  3JAM C;  5FLX Q;  1E3P A;  2HFS A;  4UT4 A;  4M1K A;  1UDS A;  2JEA A;  3J7A G;  4MYU A;  2EFG A;  3K17 A;  1N36 E;  4JI3 E;  4LF5 I;  4IFD D;  1A6F A;  5DRP A;  4B3M E;  4FW6 A;  5EL9 A;  5ELW A;  2NN6 E;  1P42 A;  4JI2 I;  1ZM9 A;  4DR4 E;  1N33 E;  3ZZU A;  4DR7 I;  4AID A;  3KRN A;  4DUY E;  2UXD E;  2E5L E;  1XMQ E;  3M85 G;  4DUZ I;  2XEX A;  4JV5 I;  4DR3 I;  4NXM E;  5K36 F;  1H72 C;  3PYD A;  4IFD A;  2PNL A;  1FJG E;  4GKK E;  1MX0 A;  3WU5 A;  3NZK A;  4LF7 E;  3PYF A;  4DPU A;  3P3G A;  4KHP I;  1H74 A;  1ZXN A;  4R1F A;  1UEK A;  3M7N G;  2CGE A;  4HAC B;  2C39 A;  4IFD E;  4DXL A;  4LF8 I;  4FN5 A;  1WUU A;  4DPT A;  3T1Y I;  4X65 I;  4MQY A;  1MU5 A;  4DV0 I;  2DEI A;  2ZIT A;  5LL6 R;  5C0X B;  4DV2 E;  3B4T A;  1YH8 A;  3CDI A;  1Z0C A;  4ISA A;  2UUB E;  4DR1 I;  4B3R E;  1HNW E;  1RHY A;  4JG4 A;  5FLX C;  3M85 D;  1N0U A;  1PIE A;  4DV1 E;  2UU9 E;  1Z5C A;  5C0X D;  4URL A;  4JI0 I;  2VQE I;  1HNZ I;  4B3T E;  4B3M I;  1XNR E;  1S4E A;  4YHH E;  5DRQ A;  4OO1 A;  1ZM2 A;  4OO1 B;  1N32 I;  3ZM7 A;  4LCG A;  1R6M A;  2UXD I;  1S16 A;  2WP8 A;  2E5L I;  4X66 I;  1EA6 A;  2V2Q A;  1USV A;  2O1W A;  4LF9 I;  4NXM I;  4JI4 I;  2F1D A;  2JE6 A;  4JI1 E;  4OO1 E;  3F0N A;  3DD6 A;  1NHH A;  4GKK I;  2IES A;  2GO4 A;  4LFA E;  4K0K I;  4DPW A;  4LF6 I;  4KHP E;  3ZKD A;  3CDJ A;  1Y4U A;  4BA2 B;  1B62 A;  2X36 A;  5L3J A;  4OO1 C;  1Z0B A;  4LPF A;  2ZM6 E;  2JT2 A;  4AIM A;  3Q6M A;  1Y4S A;  4WUC A;  2V2Z A;  3P3C A;  2Q2E B;  2BA0 G;  4LCF A;  4Z7Y A;  1Z0W A;  1IBL I;  1BKN A;  5DRO A;  1Z5A A;  2PO1 B;  4DR2 E;  2O1U A;  3QT8 A;  2WNR B;  2UUB I;  4QNK A;  3ZZ0 A;  1Y6Z A;  4IZJ D;  4B3R I;  1UDN A;  4KQV A;  2WP8 B;  4XTJ A;  1KKH A;  2PO2 A;  4IFD F;  3V2U C;  4UTG A;  4LFB E;  2V8P A;  4B3S E;  1FKA E;  3HKM A;  4USM A;  3K1J A;  5A2Q C;  4YHH I;  1PVG A;  2WNR A;  1Z0E A;  5DNX A;  1J5E I;  2NN6 D;  3M6A A;  4BA1 A;  4DR6 E;  3CWV A;  4DV6 I;  3D4J A;  5JEA C;  2PO0 B;  2HKE A;  4DR5 I;  3K85 A;  4AQY E;  1FWL A;  4JYA I;  5DNL A;  2NN6 B;  1NHI A;  1RRE A;  1HNX E;  1D6T A;  5IT9 Q;  2V34 A;  1NZ0 A;  2UUA I;  2NN6 C;  1Y60 A;  2BM1 A;  1VIS A;  4X64 I;  3QT6 A;  4OO1 F;  2ZM6 I;  2F4V I;  2BR2 A;  3J81 C;  2X7I A;  4LF4 E;  4LFC E;  4X62 I;  2HHH E;  4U3D A;  2GO3 A;  1Z5B A;  1ZM3 A;  1DAR A;  5JEA A;  1IBK E;  4QNJ A;  1HR0 I;  1IBL E;  2BA1 G;  1UDQ A;  4DR4 I;  4NBQ A;  2C38 A;  4FWD A;  4DUY I;  2UXC E;  2BR2 B;  4MDT A;  2NPF A;  4DUZ E;  3GCM A;  1XXE A;  4IFD C;  4JV5 E;  2A2C A;  4DR3 E;  2GQ0 A;  3PYE A;  4YY3 E;  5LMN I;  3ZKB A;  4LFB I;  4P52 A;  3PS3 A;  4DU8 A;  4P7A A;  1FNM A;  1IBM E;  1J5E E;  4WUB A;  3WU3 A;  2BA0 D;  2UUC I;  4HAC A;  1H7S A;  4JI8 E;  4DR6 I;  4DV6 E;  4HY1 A;  3T1Y E;  1H7U A;  4DV5 I;  2UXB E;  4PU9 A;  4DV4 I;  4OX9 E;  2R3V A;  5JEA B;  2WW4 A;  3OTO E;  5LMU E;  1OYR A;  2VES A;  4DR1 E;  5GME A;  1HK7 A;  1UDO A;  2F4V E;  1HNW I;  1N0V C;  4X62 E;  2BV3 A;  1OYP A;  4DV1 I;  2CVE A;  2UU9 I;  2GS8 A;  2VQF E;  1IBK I;  1HR0 E;  5K36 C;  4B3T I;  4JI0 E;  4NXN E;  5IWA E;  4OZE A;  4DPX A;  1Y5Y A;  2JEA B;  3JAM Q;  1N32 E;  1XMO E;  2UXC I;  4JI6 E;  2LJP A;  1N34 E;  1KVK A;  1ZM4 A;  4RPF A;  4PRV A;  4X66 E;  3L7Z B;  4LF9 E;  4AM3 A;  2Z5C B;  4JI1 I;  2V2V A;  2PO0 A;  3M7N D;  1N36 I;  4JI3 I;  4LF5 E;  5C0X C;  2AJ4 A;  4LFA I;  4K0K E;  4LF6 E;  1IBM I;  5JEA E;  2C38 B;  4JI7 I;  4DR7 E;  2UUC E;  3B82 A;  4FWG A;  3LPS A;  5C0X E;  1I94 I;  5K36 D;  2C37 B;  5K36 A;  1VI7 A;  1XNQ E;  4EMD A;  4HXZ A;  3U1Y A;  5C0X F;  4DV5 E;  2UXB I;  2CG9 A;  3UHM A;  4JI5 E;  4N3O A;  4OO1 D;  5FWK A;  2ZBK B;  4DV4 E;  4OX9 I;  2A2D A;  2Z5C A;  3OTO I;  4LF7 I;  3B78 A;  4IFD B;  3PS1 A;  2J65 A;  3U1K A;  3L7Z A;  4PRX A;  3V5R A;  5K36 E;  4WUD A;  3H4L A;  4MYT A;  2JEB B;  2C37 A;  5K36 B;  1OJ4 A;  2HK2 A;  2IER A;  5IT9 C;  4U3B A;  5C0X A;  1OYS A;  4MU4 A;  2VQF I;  5BR8 E;  4DV3 I;  2O1T A;  4IZJ B;  4GKJ E;  4NXN I;  4J3D A;  1Z0T A;  4BA1 B;  4DV2 I;  4DV7 E;  4IZK B;  2E1R A;  5JEA D;  4JI6 I;  3J81 Q;  1N34 I;  4MU0 A;  1PKP A;  5EKW A;  2HKJ A;  4FW9 A;  2PNZ B;  4GQU A;  1FWK A;  3P06 A;  4DR5 E;  4FW3 A;  2JE6 B;  5DRR A;  1EI1 A;  1RR9 A;  5JEA F;  3J80 C;  5GMD A;  4JYA E;  1HNX I;  1Z59 A;  2VQE E;  1HNZ E;  1XNR I;  3B8H A;  3H1C A;  1Z0G A;  4JI7 E;  4X64 E;  2IOP A;  2PO1 A;  2Z5B A;  2Z5E A;  3P76 A;  2IOQ A;  3T1H E;  4IZJ A;  1I94 E;  4LF4 I;  3ZZT A;  4LFC I; 
#chains in the Genus database with same CATH homology
 1MG7 A;  2HHH I;  3QT7 A;  1XHK A;  4JI4 E;  1XNQ I;  2DEJ A;  4JI5 I;  1KIJ A;  2Z5B B;  3WU6 A;  3PRY A;  2HK3 A;  3GON A;  3Q1Q A;  2O1V A;  2OI2 A;  1H73 A;  4ED4 A;  2PNM A;  2J7K A;  1USU A;  5LMN E;  4YY3 I;  1FI4 A;  4Z7C A;  3HJC A;  4DV3 E;  5BR8 I;  4GKJ I;  4DPY A;  4DV7 I;  1QZR A;  4JI2 E;  1N33 I;  4DR2 I;  3PYG A;  1K47 A;  1KTV A;  3LNU A;  4USK A;  4JI8 I;  4ZVI A;  2HFU A;  3LTO A;  1XMQ I;  3WU4 A;  4HYM A;  1FJG I;  4B3S I;  3HUL A;  3J80 Q;  2VF3 A;  4I3H A;  5LMU I;  1U2R A;  2BM0 A;  3T1H I;  3J7A M;  3QT5 A;  4FWH A;  4LF8 E;  3Q6N A;  4AQY I;  4X65 E;  2CZ9 A;  1NHJ A;  1ELO A;  2R42 A;  5IWA I;  4DU7 A;  4DV0 E;  1B63 A;  1Z0V A;  2UUA E;  1XMO I;  5A2Q Q;  1ZXM A;  4IZK A;  3JAM C;  5FLX Q;  2HFS A;  4UT4 A;  4M1K A;  3J7A G;  4MYU A;  2EFG A;  3K17 A;  1N36 E;  4JI3 E;  4LF5 I;  1A6F A;  4B3M E;  4JI2 I;  4DR4 E;  1N33 E;  1ZM9 A;  3ZZU A;  4DR7 I;  4DUY E;  2UXD E;  2E5L E;  1XMQ E;  4DUZ I;  2XEX A;  4JV5 I;  4DR3 I;  4NXM E;  1H72 C;  3PYD A;  2PNL A;  1FJG E;  4GKK E;  1MX0 A;  3WU5 A;  4LF7 E;  3PYF A;  4DPU A;  4KHP I;  1H74 A;  1ZXN A;  4R1F A;  1UEK A;  2CGE A;  4HAC B;  4DXL A;  4LF8 I;  4FN5 A;  1WUU A;  4DPT A;  3T1Y I;  4X65 I;  1MU5 A;  4DV0 I;  2DEI A;  2ZIT A;  5LL6 R;  4DV2 E;  1Z0C A;  2UUB E;  4DR1 I;  4B3R E;  1HNW E;  4JG4 A;  5FLX C;  1N0U A;  1PIE A;  4DV1 E;  2UU9 E;  1Z5C A;  1HNZ I;  2VQE I;  4URL A;  4JI0 I;  4B3T E;  4B3M I;  1XNR E;  1S4E A;  4YHH E;  1ZM2 A;  1N32 I;  3ZM7 A;  2UXD I;  1S16 A;  2E5L I;  4X66 I;  1EA6 A;  2V2Q A;  1USV A;  2O1W A;  4LF9 I;  4NXM I;  4JI4 I;  4JI1 E;  3F0N A;  1NHH A;  4GKK I;  4LFA E;  4K0K I;  4DPW A;  4LF6 I;  4KHP E;  3ZKD A;  1Y4U A;  1B62 A;  2X36 A;  5L3J A;  1Z0B A;  2ZM6 E;  3Q6M A;  1Y4S A;  4WUC A;  2V2Z A;  2Q2E B;  4Z7Y A;  1Z0W A;  1IBL I;  1BKN A;  1Z5A A;  4DR2 E;  2O1U A;  3QT8 A;  2UUB I;  3ZZ0 A;  1Y6Z A;  4IZJ D;  4B3R I;  4KQV A;  4XTJ A;  1KKH A;  3V2U C;  4UTG A;  4LFB E;  2V8P A;  4B3S E;  1FKA E;  4USM A;  3K1J A;  5A2Q C;  4YHH I;  1PVG A;  1Z0E A;  1J5E I;  3M6A A;  4DR6 E;  3CWV A;  4DV6 I;  3D4J A;  2HKE A;  4DR5 I;  3K85 A;  4AQY E;  1FWL A;  4JYA I;  1D6T A;  1NHI A;  1RRE A;  1HNX E;  5IT9 Q;  2V34 A;  1NZ0 A;  2UUA I;  2BM1 A;  1VIS A;  4X64 I;  3QT6 A;  2ZM6 I;  2F4V I;  3J81 C;  2X7I A;  4LF4 E;  4LFC E;  4X62 I;  2HHH E;  1Z5B A;  1ZM3 A;  1DAR A;  1IBK E;  1HR0 I;  1IBL E;  4DR4 I;  4FWD A;  4DUY I;  2UXC E;  2NPF A;  4DUZ E;  4JV5 E;  2A2C A;  4DR3 E;  2GQ0 A;  3PYE A;  4YY3 E;  5LMN I;  3ZKB A;  4LFB I;  4P52 A;  4DU8 A;  4P7A A;  1FNM A;  1IBM E;  1J5E E;  4WUB A;  3WU3 A;  2UUC I;  4HAC A;  1H7S A;  4JI8 E;  4DR6 I;  4DV6 E;  4HY1 A;  3T1Y E;  1H7U A;  4DV5 I;  2UXB E;  4PU9 A;  4DV4 I;  4OX9 E;  2R3V A;  2WW4 A;  3OTO E;  5LMU E;  4DR1 E;  5GME A;  1HK7 A;  2F4V E;  1HNW I;  1N0V C;  4X62 E;  2BV3 A;  4DV1 I;  2UU9 I;  2GS8 A;  2VQF E;  1IBK I;  1HR0 E;  4B3T I;  4JI0 E;  4NXN E;  5IWA E;  4DPX A;  3JAM Q;  1N32 E;  1XMO E;  2UXC I;  4JI6 E;  2LJP A;  1N34 E;  1KVK A;  1ZM4 A;  4RPF A;  4PRV A;  4X66 E;  4LF9 E;  2Z5C B;  4JI1 I;  2V2V A;  1N36 I;  4JI3 I;  4LF5 E;  2AJ4 A;  4LFA I;  4K0K E;  4LF6 E;  1IBM I;  4JI7 I;  4DR7 E;  2UUC E;  3B82 A;  4FWG A;  3LPS A;  1I94 I;  1XNQ E;  4EMD A;  4HXZ A;  4DV5 E;  2UXB I;  2CG9 A;  4JI5 E;  4N3O A;  5FWK A;  2ZBK B;  4DV4 E;  4OX9 I;  2A2D A;  2Z5C A;  3OTO I;  4LF7 I;  3B78 A;  4PRX A;  3V5R A;  4WUD A;  3H4L A;  4MYT A;  1OJ4 A;  2HK2 A;  5IT9 C;  2VQF I;  5BR8 E;  4DV3 I;  2O1T A;  4IZJ B;  4GKJ E;  4NXN I;  1Z0T A;  4DV2 I;  4DV7 E;  4IZK B;  2E1R A;  4JI6 I;  3J81 Q;  1N34 I;  1PKP A;  2HKJ A;  4FW9 A;  1FWK A;  3P06 A;  4DR5 E;  1EI1 A;  1RR9 A;  4JYA E;  3J80 C;  5GMD A;  1HNX I;  1Z59 A;  2VQE E;  1HNZ E;  1XNR I;  3B8H A;  1Z0G A;  4JI7 E;  4X64 E;  2IOP A;  2Z5B A;  2Z5E A;  2IOQ A;  3T1H E;  4IZJ A;  1I94 E;  4LF4 I;  3ZZT A;  4LFC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...