1XNRI

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule keywords 16S Ribosomal RNA
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrI00
1KVKA 4LF9I 1NZ0A 3QT6A 1B62A 4X66E 2DEJA 2EFGA 4DUYI 4LFAE 4JI4E 3ZZ0A 2A2DA 2UUAE 3LNUA 4LF6I 2NPFA 1PKPA 1KIJA 3LTOA 1N36I 2UUBE 2UU9E 3B82A 1HNWE 2UUCI 4JI1I 3WU4A 1HNXI 5A2QQ 3ZZUA 3PYGA 4DV6E 4DPWA 1Z5AA 5LMUE 1Z5CA 4AQYE 3H4LA 1N33E 4P52A 4DV4E 1FI4A 4LF7I 1XMQI 4X66I 2CZ9A 2OI2A 4FWGA 1Z0TA 4LFAI 4JI4I 4KHPE 2UUAI 2Q2EB 1DARA 2UUBI 2UU9I 4USMA 4B3ME 2UXCE 1HNWI 3PYDA 1ELOA 3CWVA 5GMDA 4LFBE 4DV0E 2R3VA 4PU9A 3D4JA 4MYUA 4JI5I 4JYAE 3Q1QA 2HK3A 1H74A 4DV3E 5LMUI 3J80C 4AQYI 4YHHE 2BM1A 1N33I 4DV4I 4DV1E 4JG4A 1IBLE 2LJPA 4KHPI 4DV5E 3OTOE 5IT9C 2F4VE 4B3MI 1Z0CA 1Z0EA 1Z0VA 2UXCI 2X36A 4DR7E 4OX9E 1MU5A 4Z7YA 1H7UA 4LFCI 5LMNE 4M1KA 4DU8A 4LFBI 4DV0I 1NHJA 2V2QA 5FLXQ 1S16A 4JYAI 3WU3A 1XMOE 1I94I 5GMEA 2VQFE 4LF4E 4DV3I 4YHHI 4JI3E 4WUCA 4HY1A 3WU6A 3F0NA 4UT4A 3HULA 4DV1I 1FWKA 2V34A 3T1HE 2VQEE 1IBLI 4PRVA 2V2ZA 5LL6R 3OTOI 4DV5I 4B3RI 2F4VI 4X65E 4DUZE 2ZITA 4JI0E 1HR0E 1FWLA 3QT7A 4DR7I 4FW9A 4EMDA 4OX9I 1BKNA 5LMNI 1PVGA 1XNQE 2HK2A 1FJGE 4USKA 1XMOI 4DR5E 5A2QC 4FN5A 1H72C 4JI3I 1NHHA 4LF5E 4FWDA 1N32E 3V2UC 3T1HI 2VQEI 3J7AG 2UXBE 1H73A 1J5EE 4WUDA 4DR2E 4X65I 4NXNE 4DUZI 4DV7E 1U2RA 5BR8E 1EA6A 4JI0I 3T1YE 4HACA 1HR0I 4JI8E 4DPTA 3GONA 3ZZTA 1XNQI 2HFSA 4DR3E 2HHHE 4DV6I 3J81Q 3JAMC 3B8HA 2UXDE 4DR5I 2AJ4A 4DR4E 2WW4A 3LPSA 3WU5A 4HYMA 1N32I 2UXBI 4DPYA 4HACB 1J5EI 4K0KE 1Z0GA 1N34E 4LF9E 1Z5BA 4DR2I 4NXNI 4DV7I 5BR8I 1VISA 1WUUA 4X62E 3T1YI 2ZM6E 2X7IA 1KKHA 4DR3I 2HHHI 3ZKDA 4DV2E 4JI1E 4NXME 2UXDI 4JI6E 1IBKE 4B3TE 1XNRE 5FLXC 4URLA 4ZVIA 3ZM7A 4DR4I 1A6FA 4KQVA 4P7AA 4DR1E 3V5RA 1EI1A 1ZXNA 4UTGA 2E5LE 1Z0BA 2ZBKB 1N34I 4K0KI 4LF8E 4LF7E 4DXLA 2BV3A 1XMQE 4X64E 2E1RA 4X62I 1ZXMA 1H7SA 3B78A 2ZM6I 3K17A 2BM0A 4DR6E 2DEIA 4GKKE 2VQFI 4LF4I 1KTVA 4DV2I 4JI7E 2GS8A 4NXMI 4JI6I 1ZM3A 1IBKI 1N0UA 4B3TI 4ED4A 1XNRI 1RREA 5L3JA 1K47A 5IWAE 1OJ4A 4JI5E 4R1FA 4JI2E 4PRXA 1RR9A 4DR1I 1HNZE 3M6AA 2E5LI 1ZM9A 4LF8I 2HKEA 4FWHA 4X64I 4YY3E 3K1JA 4HXZA 4JV5E 4DPXA 2HFUA 4Z7CA 2A2CA 4DR6I 1FJGI 2R42A 1Z0WA 1UEKA 4GKKI 3ZKBA 4XTJA 4RPFA 1XHKA 3JAMQ 4LFCE 4JI7I 3J80Q 4LF5I 1NHIA 1IBME 4B3SE 3J81C 4MYTA 5IWAI 1D6TA 1FKAE 4JI2I 4GKJE 1I94E 3QT8A 1HNZI 1PIEA 4DU7A 3PYEA 1MX0A 5IT9Q 3PYFA 3J7AM 4JI8I 1ZM2A 4DUYE 1FNMA 2VF3A 1Z59A 2V8PA 4YY3I 4LF6E 4JV5I 1N36E 4B3RE 4WUBA 1B63A 4DPUA 2UUCE 2XEXA 1ZM4A 1QZRA 1N0VC 1HNXE 1MG7A 3QT5A 1IBMI 2HKJA 4B3SI 2J7KA 4GKJI 2V2VA 4I3HA 1S4EA
chains in the Genus database with same CATH superfamily
5JEAD 1KVKA 3U1YA 4LF9I 1NZ0A 2O1UA 3QT6A 1B62A 1UDQA 4X66E 2DEJA 2Z5CB 2EFGA 4DUYI 2IOQA 4LFAE 4JI4E 3ZZ0A 2A2DA 2UUAE 3LNUA 4LF6I 2NPFA 4OO1F 1PKPA 2C37A 1Y6ZA 3K85A 1KIJA 3LTOA 1N36I 1E3HA 2UUBE 2UU9E 3B82A 1HNWE 4OZEA 3GLLA 1P42A 2UUCI 4JI1I 2GQ0A 3WU4A 1HNXI 5A2QQ 2BA0D 3ZZUA 5K36A 3PYGA 4DV6E 4DPWA 1Z5AA 5LMUE 3KRNA 1Z5CA 4AQYE 3H1CA 3H4LA 2WP8A 5ELWA 1N33E 4P52A 4IZKA 4DV4E 1FI4A 2BA0G 4LF7I 4OO1A 1XMQI 4X66I 2CZ9A 4IFDF 2OI2A 4IZJA 1YHCA 4FWGA 1Z0TA 4LFAI 4JI4I 4KHPE 2UUAI 2Q2EB 1DARA 3P06A 4U3DA 2UUBI 2UU9I 4USMA 4B3ME 4N3OA 5DROA 2GO3A 2UXCE 2F1DA 1HNWI 3HKMA 3PYDA 1ELOA 3CWVA 5GMDA 1UDSA 1HK7A 5DRRA 2BA1D 4LFBE 1RHYA 2PNZA 4DV0E 2R3VA 4PU9A 2WP8B 3D4JA 4MYUA 4JI5I 4JYAE 3Q1QA 4IZKB 2HK3A 1H74A 1UDNA 4GQUA 4DV3E 5LMUI 4AIDA 3J80C 4OO1B 4AQYI 4YHHE 2BM1A 3PS1A 2NN6F 4IZJB 1N33I 4IFDA 2BA1G 1OYSA 4DV4I 1Y5YA 4AIMA 2PO1A 4DV1E 4OO1C 4IS9A 2WNRA 4JG4A 1USUA 1IBLE 2LJPA 4KHPI 3OTOE 4LCHA 5JEAE 4DV5E 5C0XF 2JEAA 2Z5CA 5IT9C 2F4VE 4B3MI 1Z0CA 2PNZB 1Z0EA 1Z0VA 2UXCI 2X36A 4DR7E 4OX9E 1MU5A 3Q6NA 4Z7YA 1H7UA 4LFCI 4MU1A 5LMNE 4M1KA 4DU8A 4LFBI 4DV0I 1NHJA 2V2QA 5FLXQ 1S16A 4JYAI 4IFDB 2NN6A 3WU3A 1XMOE 1I94I 5GMEA 2PO1B 2VQFE 3B4TA 4LF4E 4DV3I 4YHHI 4JI3E 2WNRB 2PO0A 4MU0A 4IFDC 4WUCA 4HY1A 5DNLA 3WU6A 3F0NA 4UT4A 1OYPA 2C39A 3HULA 2JEAB 4DV1I 2CVEA 1FWKA 2V34A 1Y4UA 5C0XA 3T1HE 2VQEE 1VI7A 1IBLI 3L7ZA 4QNJA 4PRVA 2V2ZA 5LL6R 3OTOI 4DV5I 4B3RI 2F4VI 4X65E 4DUZE 2ZITA 2JEBB 4JI0E 1HR0E 1R6LA 4FW3A 1FWLA 3QT7A 4DR7I 2VESA 1USVA 4FW9A 4EMDA 4OX9I 2NN6B 1BKNA 5LMNI 1PVGA 1XNQE 2HK2A 1FJGE 4USKA 2PO0B 2NN6C 1XMOI 2C39B 4DR5E 5A2QC 4FN5A 2BR2A 4MDTA 5DRQA 5C0XB 1H72C 4JI3I 5K36D 1NHHA 4LF5E 3L7ZB 3NZKA 5JEAC 4FWDA 2AE8A 1N32E 3V2UC 5C0XC 3T1HI 2VQEI 3P3CA 3J7AG 2UXBE 2PO2A 1H73A 1J5EE 1OYRA 2O1VA 4OO1D 4WUDA 4DR2E 1E3PA 4X65I 4DUZI 4DV7E 1U2RA 4IZJD 5BR8E 4NXNE 3PS2A 1EA6A 4JI0I 3T1YE 4HACA 1HR0I 4JI8E 4DPTA 3GONA 3ZZTA 2GO4A 1XNQI 2HFSA 5DNXA 2JT2A 2BR2B 4DR3E 2HHHE 4DV6I 3J81Q 3JAMC 3U1KA 3B8HA 2IERA 2UXDE 4DR5I 4ISAA 2Z5BA 2O3ZA 2AJ4A 2PO2B 4DR4E 4OKGA 2WW4A 3LPSA 3WU5A 4HYMA 2IESA 1N32I 5JEAF 4FW6A 3M85D 1Y60A 2UXBI 4IFDD 2IOPA 4DPYA 4HACB 1J5EI 4MQYA 1Z0GA 1N34E 4LF9E 4LCFA 4K0KE 1Z5BA 4DR2I 4NXNI 4DV7I 5BR8I 5FWKA 1VISA 1WUUA 4X62E 3T1YI 2JEBA 3M85G 4QNKA 4LCGA 2ZM6E 3HJCA 2X7IA 1KKHA 2Z5BB 4DR3I 2HHHI 3ZKDA 3UHMA 4MU3A 4DV2E 4JI1E 4NXME 2UXDI 4MU4A 4JI6E 3M7ND 1IBKE 4B3TE 1XNRE 5FLXC 2NN6D 5JEAA 4URLA 4ZVIA 3ZM7A 4DR4I 1A6FA 4KQVA 4P7AA 4DR1E 3V5RA 1EI1A 3Q6MA 4BA1A 3GCMA 1ZXNA 3M7NG 5K36E 4UTGA 2E5LE 1Z0BA 2ZBKB 2CG9A 1N34I 2JE6A 4LF8E 4K0KI 5C0XD 4LF7E 2J65A 4DXLA 2BV3A 2Z5EA 1XMQE 4X64E 2E1RA 4X62I 5EKWA 1ZXMA 1R6MA 1H7SA 3B78A 2ZM6I 4OO1E 3K17A 2BM0A 4DR6E 2DEIA 3CDIA 2PNMA 4GKKE 2VQFI 5JEAB 4LF4I 1KTVA 4DV2I 4JI7E 2GS8A 4NXMI 4JI6I 1ZM3A 1IBKI 1N0UA 4B3TI 4ED4A 1XNRI 4BA1B 1RREA 5L3JA 1K47A 4LPFA 5IWAE 3P3EA 3PS3A 1OJ4A 4FW5A 4JI5E 4R1FA 4JI2E 4PRXA 1RR9A 2JE6B 4DR1I 1HNZE 1UDOA 4BA2A 3M6AA 2E5LI 1ZM9A 4LF8I 2C37B 2HKEA 2C38A 4FWHA 4X64I 4YY3E 3K1JA 1XXEA 4HXZA 4JV5E 4IFDE 4DPXA 2HFUA 4Z7CA 2A2CA 4FW7A 1Y4SA 4DR6I 1YH8A 1FJGI 2R42A 1Z0WA 3DD6A 4FW4A 1UEKA 4GKKI 3ZKBA 3GMEA 4XTJA 4RPFA 1XHKA 3JAMQ 4LFCE 4JI7I 5K36B 3J80Q 4BA2B 4LF5I 1NHIA 1IBME 4B3SE 5DRPA 3J81C 4MYTA 2CGEA 5IWAI 1D6TA 4J3DA 5K36C 1FKAE 4JI2I 4GKJE 1I94E 3QT8A 1HNZI 2C38B 1PIEA 2O1WA 3PRYA 4DU7A 3PYEA 4U3BA 2NN6E 1MX0A 5IT9Q 3PYFA 3J7AM 4JI8I 1ZM2A 4DUYE 1FNMA 2VF3A 1Z59A 2V8PA 4YY3I 4LF6E 3CDJA 4JV5I 1N36E 2PNLA 4B3RE 4NBQA 5EL9A 5C0XE 4WUBA 1B63A 4DPUA 2O1TA 2UUCE 2XEXA 1ZM4A 4AM3A 1QZRA 1N0VC 1HNXE 1MG7A 3P3GA 4LOMA 3P76A 3QT5A 1IBMI 2HKJA 4B3SI 2J7KA 4GKJI 2V2VA 4I3HA 5K36F 1S4EA
chains in the Genus database with same CATH topology
1KVKA 4LF9I 1NZ0A 2O1UA 3QT6A 1B62A 4X66E 2DEJA 2Z5CB 2EFGA 4DUYI 2IOQA 4LFAE 4JI4E 3ZZ0A 2A2DA 2UUAE 3LNUA 4LF6I 2NPFA 1PKPA 3K85A 1Y6ZA 1KIJA 3LTOA 1N36I 2UUBE 2UU9E 3B82A 1HNWE 2UUCI 4JI1I 2GQ0A 3WU4A 1HNXI 5A2QQ 3ZZUA 3PYGA 4DV6E 4DPWA 1Z5AA 5LMUE 1Z5CA 4AQYE 3H4LA 1N33E 4P52A 4IZKA 4DV4E 1FI4A 4LF7I 1XMQI 4X66I 2CZ9A 2OI2A 4IZJA 4FWGA 1Z0TA 4LFAI 4JI4I 4KHPE 2UUAI 2Q2EB 1DARA 3P06A 2UUBI 2UU9I 4USMA 4B3ME 4N3OA 2UXCE 1HNWI 3PYDA 1ELOA 3CWVA 5GMDA 1HK7A 4LFBE 4DV0E 2R3VA 4PU9A 3D4JA 4MYUA 4JI5I 4JYAE 3Q1QA 4IZKB 2HK3A 1H74A 4DV3E 5LMUI 3J80C 4AQYI 4YHHE 2BM1A 4IZJB 1N33I 4DV4I 4DV1E 4JG4A 1USUA 1IBLE 2LJPA 4KHPI 4DV5E 3OTOE 2Z5CA 5IT9C 2F4VE 4B3MI 1Z0CA 1Z0EA 1Z0VA 2UXCI 2X36A 4DR7E 4OX9E 1MU5A 3Q6NA 4Z7YA 1H7UA 4LFCI 5LMNE 4M1KA 4DU8A 4LFBI 4DV0I 1NHJA 2V2QA 5FLXQ 1S16A 4JYAI 3WU3A 1XMOE 1I94I 5GMEA 2VQFE 4LF4E 4DV3I 4YHHI 4JI3E 4WUCA 4HY1A 3WU6A 3F0NA 4UT4A 3HULA 4DV1I 1FWKA 2V34A 1Y4UA 3T1HE 2VQEE 1IBLI 4PRVA 2V2ZA 5LL6R 3OTOI 4DV5I 4B3RI 2F4VI 4X65E 4DUZE 2ZITA 4JI0E 1HR0E 1FWLA 3QT7A 4DR7I 1USVA 4FW9A 4EMDA 4OX9I 1BKNA 5LMNI 1PVGA 1XNQE 2HK2A 1FJGE 4USKA 1XMOI 4DR5E 5A2QC 4FN5A 1H72C 4JI3I 1NHHA 4LF5E 4FWDA 1N32E 3V2UC 3T1HI 2VQEI 3J7AG 2UXBE 1H73A 1J5EE 2O1VA 4WUDA 4DR2E 4X65I 4NXNE 4DUZI 4DV7E 1U2RA 4IZJD 5BR8E 1EA6A 4JI0I 3T1YE 4HACA 1HR0I 4JI8E 4DPTA 3GONA 3ZZTA 1XNQI 2HFSA 4DR3E 2HHHE 4DV6I 3J81Q 3JAMC 3B8HA 2UXDE 4DR5I 2Z5BA 2AJ4A 4DR4E 2WW4A 3LPSA 3WU5A 4HYMA 1N32I 2UXBI 2IOPA 4DPYA 4HACB 1J5EI 4K0KE 1Z0GA 1N34E 4LF9E 1Z5BA 4DR2I 4NXNI 4DV7I 5BR8I 5FWKA 1VISA 1WUUA 4X62E 3T1YI 2ZM6E 3HJCA 2X7IA 1KKHA 2Z5BB 4DR3I 2HHHI 3ZKDA 4DV2E 4JI1E 4NXME 2UXDI 4JI6E 1IBKE 4B3TE 1XNRE 5FLXC 4URLA 4ZVIA 3ZM7A 4DR4I 1A6FA 4KQVA 4P7AA 4DR1E 3V5RA 1EI1A 3Q6MA 1ZXNA 4UTGA 2E5LE 1Z0BA 2ZBKB 2CG9A 1N34I 4K0KI 4LF8E 4LF7E 4DXLA 2BV3A 1XMQE 2Z5EA 4X64E 2E1RA 4X62I 1ZXMA 1H7SA 3B78A 2ZM6I 3K17A 2BM0A 4DR6E 2DEIA 2PNMA 4GKKE 2VQFI 4LF4I 1KTVA 4DV2I 4JI7E 2GS8A 4NXMI 4JI6I 1ZM3A 1IBKI 1N0UA 4B3TI 4ED4A 1XNRI 1RREA 5L3JA 1K47A 5IWAE 1OJ4A 4JI5E 4R1FA 4JI2E 4PRXA 1RR9A 4DR1I 1HNZE 3M6AA 2E5LI 1ZM9A 4LF8I 2HKEA 4FWHA 4X64I 4YY3E 3K1JA 4HXZA 4JV5E 4DPXA 2HFUA 4Z7CA 2A2CA 1Y4SA 4DR6I 1FJGI 2R42A 1Z0WA 1UEKA 4GKKI 3ZKBA 4XTJA 4RPFA 1XHKA 3JAMQ 4LFCE 4JI7I 3J80Q 4LF5I 1NHIA 1IBME 4B3SE 3J81C 4MYTA 2CGEA 5IWAI 1D6TA 1FKAE 4JI2I 4GKJE 1I94E 3QT8A 1HNZI 1PIEA 2O1WA 3PRYA 4DU7A 3PYEA 1MX0A 5IT9Q 3PYFA 3J7AM 4JI8I 1ZM2A 4DUYE 1FNMA 2VF3A 1Z59A 2V8PA 4YY3I 4LF6E 4JV5I 1N36E 2PNLA 4B3RE 4WUBA 1B63A 4DPUA 2O1TA 2UUCE 2XEXA 1ZM4A 1QZRA 1N0VC 1HNXE 1MG7A 3QT5A 1IBMI 2HKJA 4B3SI 2J7KA 4GKJI 2V2VA 4I3HA 1S4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVK A;  4LF9 I;  1NZ0 A;  3QT6 A;  1B62 A;  4X66 E;  2DEJ A;  2EFG A;  4DUY I;  4LFA E;  4JI4 E;  3ZZ0 A;  2A2D A;  2UUA E;  3LNU A;  4LF6 I;  2NPF A;  1PKP A;  1KIJ A;  3LTO A;  1N36 I;  2UUB E;  2UU9 E;  3B82 A;  1HNW E;  2UUC I;  4JI1 I;  3WU4 A;  1HNX I;  5A2Q Q;  3ZZU A;  3PYG A;  4DV6 E;  4DPW A;  1Z5A A;  5LMU E;  1Z5C A;  4AQY E;  3H4L A;  1N33 E;  4P52 A;  4DV4 E;  1FI4 A;  4LF7 I;  1XMQ I;  4X66 I;  2CZ9 A;  2OI2 A;  4FWG A;  1Z0T A;  4LFA I;  4JI4 I;  4KHP E;  2UUA I;  2Q2E B;  1DAR A;  2UUB I;  2UU9 I;  4USM A;  4B3M E;  2UXC E;  1HNW I;  3PYD A;  1ELO A;  3CWV A;  5GMD A;  4LFB E;  4DV0 E;  2R3V A;  4PU9 A;  3D4J A;  4MYU A;  4JI5 I;  4JYA E;  3Q1Q A;  2HK3 A;  1H74 A;  4DV3 E;  5LMU I;  3J80 C;  4AQY I;  4YHH E;  2BM1 A;  1N33 I;  4DV4 I;  4DV1 E;  4JG4 A;  1IBL E;  2LJP A;  4KHP I;  4DV5 E;  3OTO E;  5IT9 C;  2F4V E;  4B3M I;  1Z0C A;  1Z0E A;  1Z0V A;  2UXC I;  2X36 A;  4DR7 E;  4OX9 E;  1MU5 A;  4Z7Y A;  1H7U A;  4LFC I;  5LMN E;  4M1K A;  4DU8 A;  4LFB I;  4DV0 I;  1NHJ A;  2V2Q A;  5FLX Q;  1S16 A;  4JYA I;  3WU3 A;  1XMO E;  1I94 I;  5GME A;  2VQF E;  4LF4 E;  4DV3 I;  4YHH I;  4JI3 E;  4WUC A;  4HY1 A;  3WU6 A;  3F0N A;  4UT4 A;  3HUL A;  4DV1 I;  1FWK A;  2V34 A;  3T1H E;  2VQE E;  1IBL I;  4PRV A;  2V2Z A;  5LL6 R;  3OTO I;  4DV5 I;  4B3R I;  2F4V I;  4X65 E;  4DUZ E;  2ZIT A;  4JI0 E;  1HR0 E;  1FWL A;  3QT7 A;  4DR7 I;  4FW9 A;  4EMD A;  4OX9 I;  1BKN A;  5LMN I;  1PVG A;  1XNQ E;  2HK2 A;  1FJG E;  4USK A;  1XMO I;  4DR5 E;  5A2Q C;  4FN5 A;  1H72 C;  4JI3 I;  1NHH A;  4LF5 E;  4FWD A;  1N32 E;  3V2U C;  3T1H I;  2VQE I;  3J7A G;  2UXB E;  1H73 A;  1J5E E;  4WUD A;  4DR2 E;  4X65 I;  4NXN E;  4DUZ I;  4DV7 E;  1U2R A;  5BR8 E;  1EA6 A;  4JI0 I;  3T1Y E;  4HAC A;  1HR0 I;  4JI8 E;  4DPT A;  3GON A;  3ZZT A;  1XNQ I;  2HFS A;  4DR3 E;  2HHH E;  4DV6 I;  3J81 Q;  3JAM C;  3B8H A;  2UXD E;  4DR5 I;  2AJ4 A;  4DR4 E;  2WW4 A;  3LPS A;  3WU5 A;  4HYM A;  1N32 I;  2UXB I;  4DPY A;  4HAC B;  1J5E I;  4K0K E;  1Z0G A;  1N34 E;  4LF9 E;  1Z5B A;  4DR2 I;  4NXN I;  4DV7 I;  5BR8 I;  1VIS A;  1WUU A;  4X62 E;  3T1Y I;  2ZM6 E;  2X7I A;  1KKH A;  4DR3 I;  2HHH I;  3ZKD A;  4DV2 E;  4JI1 E;  4NXM E;  2UXD I;  4JI6 E;  1IBK E;  4B3T E;  1XNR E;  5FLX C;  4URL A;  4ZVI A;  3ZM7 A;  4DR4 I;  1A6F A;  4KQV A;  4P7A A;  4DR1 E;  3V5R A;  1EI1 A;  1ZXN A;  4UTG A;  2E5L E;  1Z0B A;  2ZBK B;  1N34 I;  4K0K I;  4LF8 E;  4LF7 E;  4DXL A;  2BV3 A;  1XMQ E;  4X64 E;  2E1R A;  4X62 I;  1ZXM A;  1H7S A;  3B78 A;  2ZM6 I;  3K17 A;  2BM0 A;  4DR6 E;  2DEI A;  4GKK E;  2VQF I;  4LF4 I;  1KTV A;  4DV2 I;  4JI7 E;  2GS8 A;  4NXM I;  4JI6 I;  1ZM3 A;  1IBK I;  1N0U A;  4B3T I;  4ED4 A;  1XNR I;  1RRE A;  5L3J A;  1K47 A;  5IWA E;  1OJ4 A;  4JI5 E;  4R1F A;  4JI2 E;  4PRX A;  1RR9 A;  4DR1 I;  1HNZ E;  3M6A A;  2E5L I;  1ZM9 A;  4LF8 I;  2HKE A;  4FWH A;  4X64 I;  4YY3 E;  3K1J A;  4HXZ A;  4JV5 E;  4DPX A;  2HFU A;  4Z7C A;  2A2C A;  4DR6 I;  1FJG I;  2R42 A;  1Z0W A;  1UEK A;  4GKK I;  3ZKB A;  4XTJ A;  4RPF A;  1XHK A;  3JAM Q;  4LFC E;  4JI7 I;  3J80 Q;  4LF5 I;  1NHI A;  1IBM E;  4B3S E;  3J81 C;  4MYT A;  5IWA I;  1D6T A;  1FKA E;  4JI2 I;  4GKJ E;  1I94 E;  3QT8 A;  1HNZ I;  1PIE A;  4DU7 A;  3PYE A;  1MX0 A;  5IT9 Q;  3PYF A;  3J7A M;  4JI8 I;  1ZM2 A;  4DUY E;  1FNM A;  2VF3 A;  1Z59 A;  2V8P A;  4YY3 I;  4LF6 E;  4JV5 I;  1N36 E;  4B3R E;  4WUB A;  1B63 A;  4DPU A;  2UUC E;  2XEX A;  1ZM4 A;  1QZR A;  1N0V C;  1HNX E;  1MG7 A;  3QT5 A;  1IBM I;  2HKJ A;  4B3S I;  2J7K A;  4GKJ I;  2V2V A;  4I3H A;  1S4E A; 
#chains in the Genus database with same CATH topology
 5JEA D;  1KVK A;  3U1Y A;  4LF9 I;  1NZ0 A;  2O1U A;  3QT6 A;  1B62 A;  1UDQ A;  4X66 E;  2DEJ A;  2Z5C B;  2EFG A;  4DUY I;  2IOQ A;  4LFA E;  4JI4 E;  3ZZ0 A;  2A2D A;  2UUA E;  3LNU A;  4LF6 I;  2NPF A;  4OO1 F;  1PKP A;  2C37 A;  1Y6Z A;  3K85 A;  1KIJ A;  3LTO A;  1N36 I;  1E3H A;  2UUB E;  2UU9 E;  3B82 A;  1HNW E;  4OZE A;  3GLL A;  1P42 A;  2UUC I;  4JI1 I;  2GQ0 A;  3WU4 A;  1HNX I;  5A2Q Q;  2BA0 D;  3ZZU A;  5K36 A;  3PYG A;  4DV6 E;  4DPW A;  1Z5A A;  5LMU E;  3KRN A;  1Z5C A;  4AQY E;  3H1C A;  3H4L A;  2WP8 A;  5ELW A;  1N33 E;  4P52 A;  4IZK A;  4DV4 E;  1FI4 A;  2BA0 G;  4LF7 I;  4OO1 A;  1XMQ I;  4X66 I;  2CZ9 A;  4IFD F;  2OI2 A;  4IZJ A;  1YHC A;  4FWG A;  1Z0T A;  4LFA I;  4JI4 I;  4KHP E;  2UUA I;  2Q2E B;  1DAR A;  3P06 A;  4U3D A;  2UUB I;  2UU9 I;  4USM A;  4B3M E;  4N3O A;  5DRO A;  2GO3 A;  2UXC E;  2F1D A;  1HNW I;  3HKM A;  3PYD A;  1ELO A;  3CWV A;  5GMD A;  1UDS A;  1HK7 A;  5DRR A;  2BA1 D;  4LFB E;  1RHY A;  2PNZ A;  4DV0 E;  2R3V A;  4PU9 A;  2WP8 B;  3D4J A;  4MYU A;  4JI5 I;  4JYA E;  3Q1Q A;  4IZK B;  2HK3 A;  1H74 A;  1UDN A;  4GQU A;  4DV3 E;  5LMU I;  4AID A;  3J80 C;  4OO1 B;  4AQY I;  4YHH E;  2BM1 A;  3PS1 A;  2NN6 F;  4IZJ B;  1N33 I;  4IFD A;  2BA1 G;  1OYS A;  4DV4 I;  1Y5Y A;  4AIM A;  2PO1 A;  4DV1 E;  4OO1 C;  4IS9 A;  2WNR A;  4JG4 A;  1USU A;  1IBL E;  2LJP A;  4KHP I;  3OTO E;  4LCH A;  5JEA E;  4DV5 E;  5C0X F;  2JEA A;  2Z5C A;  5IT9 C;  2F4V E;  4B3M I;  1Z0C A;  2PNZ B;  1Z0E A;  1Z0V A;  2UXC I;  2X36 A;  4DR7 E;  4OX9 E;  1MU5 A;  3Q6N A;  4Z7Y A;  1H7U A;  4LFC I;  4MU1 A;  5LMN E;  4M1K A;  4DU8 A;  4LFB I;  4DV0 I;  1NHJ A;  2V2Q A;  5FLX Q;  1S16 A;  4JYA I;  4IFD B;  2NN6 A;  3WU3 A;  1XMO E;  1I94 I;  5GME A;  2PO1 B;  2VQF E;  3B4T A;  4LF4 E;  4DV3 I;  4YHH I;  4JI3 E;  2WNR B;  2PO0 A;  4MU0 A;  4IFD C;  4WUC A;  4HY1 A;  5DNL A;  3WU6 A;  3F0N A;  4UT4 A;  1OYP A;  2C39 A;  3HUL A;  2JEA B;  4DV1 I;  2CVE A;  1FWK A;  2V34 A;  1Y4U A;  5C0X A;  3T1H E;  2VQE E;  1VI7 A;  1IBL I;  3L7Z A;  4QNJ A;  4PRV A;  2V2Z A;  5LL6 R;  3OTO I;  4DV5 I;  4B3R I;  2F4V I;  4X65 E;  4DUZ E;  2ZIT A;  2JEB B;  4JI0 E;  1HR0 E;  1R6L A;  4FW3 A;  1FWL A;  3QT7 A;  4DR7 I;  2VES A;  1USV A;  4FW9 A;  4EMD A;  4OX9 I;  2NN6 B;  1BKN A;  5LMN I;  1PVG A;  1XNQ E;  2HK2 A;  1FJG E;  4USK A;  2PO0 B;  2NN6 C;  1XMO I;  2C39 B;  4DR5 E;  5A2Q C;  4FN5 A;  2BR2 A;  4MDT A;  5DRQ A;  5C0X B;  1H72 C;  4JI3 I;  5K36 D;  1NHH A;  4LF5 E;  3L7Z B;  3NZK A;  5JEA C;  4FWD A;  2AE8 A;  1N32 E;  3V2U C;  5C0X C;  3T1H I;  2VQE I;  3P3C A;  3J7A G;  2UXB E;  2PO2 A;  1H73 A;  1J5E E;  1OYR A;  2O1V A;  4OO1 D;  4WUD A;  4DR2 E;  1E3P A;  4X65 I;  4DUZ I;  4DV7 E;  1U2R A;  4IZJ D;  5BR8 E;  4NXN E;  3PS2 A;  1EA6 A;  4JI0 I;  3T1Y E;  4HAC A;  1HR0 I;  4JI8 E;  4DPT A;  3GON A;  3ZZT A;  2GO4 A;  1XNQ I;  2HFS A;  5DNX A;  2JT2 A;  2BR2 B;  4DR3 E;  2HHH E;  4DV6 I;  3J81 Q;  3JAM C;  3U1K A;  3B8H A;  2IER A;  2UXD E;  4DR5 I;  4ISA A;  2Z5B A;  2O3Z A;  2AJ4 A;  2PO2 B;  4DR4 E;  4OKG A;  2WW4 A;  3LPS A;  3WU5 A;  4HYM A;  2IES A;  1N32 I;  5JEA F;  4FW6 A;  3M85 D;  1Y60 A;  2UXB I;  4IFD D;  2IOP A;  4DPY A;  4HAC B;  1J5E I;  4MQY A;  1Z0G A;  1N34 E;  4LF9 E;  4LCF A;  4K0K E;  1Z5B A;  4DR2 I;  4NXN I;  4DV7 I;  5BR8 I;  5FWK A;  1VIS A;  1WUU A;  4X62 E;  3T1Y I;  2JEB A;  3M85 G;  4QNK A;  4LCG A;  2ZM6 E;  3HJC A;  2X7I A;  1KKH A;  2Z5B B;  4DR3 I;  2HHH I;  3ZKD A;  3UHM A;  4MU3 A;  4DV2 E;  4JI1 E;  4NXM E;  2UXD I;  4MU4 A;  4JI6 E;  3M7N D;  1IBK E;  4B3T E;  1XNR E;  5FLX C;  2NN6 D;  5JEA A;  4URL A;  4ZVI A;  3ZM7 A;  4DR4 I;  1A6F A;  4KQV A;  4P7A A;  4DR1 E;  3V5R A;  1EI1 A;  3Q6M A;  4BA1 A;  3GCM A;  1ZXN A;  3M7N G;  5K36 E;  4UTG A;  2E5L E;  1Z0B A;  2ZBK B;  2CG9 A;  1N34 I;  2JE6 A;  4LF8 E;  4K0K I;  5C0X D;  4LF7 E;  2J65 A;  4DXL A;  2BV3 A;  2Z5E A;  1XMQ E;  4X64 E;  2E1R A;  4X62 I;  5EKW A;  1ZXM A;  1R6M A;  1H7S A;  3B78 A;  2ZM6 I;  4OO1 E;  3K17 A;  2BM0 A;  4DR6 E;  2DEI A;  3CDI A;  2PNM A;  4GKK E;  2VQF I;  5JEA B;  4LF4 I;  1KTV A;  4DV2 I;  4JI7 E;  2GS8 A;  4NXM I;  4JI6 I;  1ZM3 A;  1IBK I;  1N0U A;  4B3T I;  4ED4 A;  1XNR I;  4BA1 B;  1RRE A;  5L3J A;  1K47 A;  4LPF A;  5IWA E;  3P3E A;  3PS3 A;  1OJ4 A;  4FW5 A;  4JI5 E;  4R1F A;  4JI2 E;  4PRX A;  1RR9 A;  2JE6 B;  4DR1 I;  1HNZ E;  1UDO A;  4BA2 A;  3M6A A;  2E5L I;  1ZM9 A;  4LF8 I;  2C37 B;  2HKE A;  2C38 A;  4FWH A;  4X64 I;  4YY3 E;  3K1J A;  1XXE A;  4HXZ A;  4JV5 E;  4IFD E;  4DPX A;  2HFU A;  4Z7C A;  2A2C A;  4FW7 A;  1Y4S A;  4DR6 I;  1YH8 A;  1FJG I;  2R42 A;  1Z0W A;  3DD6 A;  4FW4 A;  1UEK A;  4GKK I;  3ZKB A;  3GME A;  4XTJ A;  4RPF A;  1XHK A;  3JAM Q;  4LFC E;  4JI7 I;  5K36 B;  3J80 Q;  4BA2 B;  4LF5 I;  1NHI A;  1IBM E;  4B3S E;  5DRP A;  3J81 C;  4MYT A;  2CGE A;  5IWA I;  1D6T A;  4J3D A;  5K36 C;  1FKA E;  4JI2 I;  4GKJ E;  1I94 E;  3QT8 A;  1HNZ I;  2C38 B;  1PIE A;  2O1W A;  3PRY A;  4DU7 A;  3PYE A;  4U3B A;  2NN6 E;  1MX0 A;  5IT9 Q;  3PYF A;  3J7A M;  4JI8 I;  1ZM2 A;  4DUY E;  1FNM A;  2VF3 A;  1Z59 A;  2V8P A;  4YY3 I;  4LF6 E;  3CDJ A;  4JV5 I;  1N36 E;  2PNL A;  4B3R E;  4NBQ A;  5EL9 A;  5C0X E;  4WUB A;  1B63 A;  4DPU A;  2O1T A;  2UUC E;  2XEX A;  1ZM4 A;  4AM3 A;  1QZR A;  1N0V C;  1HNX E;  1MG7 A;  3P3G A;  4LOM A;  3P76 A;  3QT5 A;  1IBM I;  2HKJ A;  4B3S I;  2J7K A;  4GKJ I;  2V2V A;  4I3H A;  5K36 F;  1S4E A; 
#chains in the Genus database with same CATH homology
 1KVK A;  4LF9 I;  1NZ0 A;  2O1U A;  3QT6 A;  1B62 A;  4X66 E;  2DEJ A;  2Z5C B;  2EFG A;  4DUY I;  2IOQ A;  4LFA E;  4JI4 E;  3ZZ0 A;  2A2D A;  2UUA E;  3LNU A;  4LF6 I;  2NPF A;  1PKP A;  3K85 A;  1Y6Z A;  1KIJ A;  3LTO A;  1N36 I;  2UUB E;  2UU9 E;  3B82 A;  1HNW E;  2UUC I;  4JI1 I;  2GQ0 A;  3WU4 A;  1HNX I;  5A2Q Q;  3ZZU A;  3PYG A;  4DV6 E;  4DPW A;  1Z5A A;  5LMU E;  1Z5C A;  4AQY E;  3H4L A;  1N33 E;  4P52 A;  4IZK A;  4DV4 E;  1FI4 A;  4LF7 I;  1XMQ I;  4X66 I;  2CZ9 A;  2OI2 A;  4IZJ A;  4FWG A;  1Z0T A;  4LFA I;  4JI4 I;  4KHP E;  2UUA I;  2Q2E B;  1DAR A;  3P06 A;  2UUB I;  2UU9 I;  4USM A;  4B3M E;  4N3O A;  2UXC E;  1HNW I;  3PYD A;  1ELO A;  3CWV A;  5GMD A;  1HK7 A;  4LFB E;  4DV0 E;  2R3V A;  4PU9 A;  3D4J A;  4MYU A;  4JI5 I;  4JYA E;  3Q1Q A;  4IZK B;  2HK3 A;  1H74 A;  4DV3 E;  5LMU I;  3J80 C;  4AQY I;  4YHH E;  2BM1 A;  4IZJ B;  1N33 I;  4DV4 I;  4DV1 E;  4JG4 A;  1USU A;  1IBL E;  2LJP A;  4KHP I;  4DV5 E;  3OTO E;  2Z5C A;  5IT9 C;  2F4V E;  4B3M I;  1Z0C A;  1Z0E A;  1Z0V A;  2UXC I;  2X36 A;  4DR7 E;  4OX9 E;  1MU5 A;  3Q6N A;  4Z7Y A;  1H7U A;  4LFC I;  5LMN E;  4M1K A;  4DU8 A;  4LFB I;  4DV0 I;  1NHJ A;  2V2Q A;  5FLX Q;  1S16 A;  4JYA I;  3WU3 A;  1XMO E;  1I94 I;  5GME A;  2VQF E;  4LF4 E;  4DV3 I;  4YHH I;  4JI3 E;  4WUC A;  4HY1 A;  3WU6 A;  3F0N A;  4UT4 A;  3HUL A;  4DV1 I;  1FWK A;  2V34 A;  1Y4U A;  3T1H E;  2VQE E;  1IBL I;  4PRV A;  2V2Z A;  5LL6 R;  3OTO I;  4DV5 I;  4B3R I;  2F4V I;  4X65 E;  4DUZ E;  2ZIT A;  4JI0 E;  1HR0 E;  1FWL A;  3QT7 A;  4DR7 I;  1USV A;  4FW9 A;  4EMD A;  4OX9 I;  1BKN A;  5LMN I;  1PVG A;  1XNQ E;  2HK2 A;  1FJG E;  4USK A;  1XMO I;  4DR5 E;  5A2Q C;  4FN5 A;  1H72 C;  4JI3 I;  1NHH A;  4LF5 E;  4FWD A;  1N32 E;  3V2U C;  3T1H I;  2VQE I;  3J7A G;  2UXB E;  1H73 A;  1J5E E;  2O1V A;  4WUD A;  4DR2 E;  4X65 I;  4NXN E;  4DUZ I;  4DV7 E;  1U2R A;  4IZJ D;  5BR8 E;  1EA6 A;  4JI0 I;  3T1Y E;  4HAC A;  1HR0 I;  4JI8 E;  4DPT A;  3GON A;  3ZZT A;  1XNQ I;  2HFS A;  4DR3 E;  2HHH E;  4DV6 I;  3J81 Q;  3JAM C;  3B8H A;  2UXD E;  4DR5 I;  2Z5B A;  2AJ4 A;  4DR4 E;  2WW4 A;  3LPS A;  3WU5 A;  4HYM A;  1N32 I;  2UXB I;  2IOP A;  4DPY A;  4HAC B;  1J5E I;  4K0K E;  1Z0G A;  1N34 E;  4LF9 E;  1Z5B A;  4DR2 I;  4NXN I;  4DV7 I;  5BR8 I;  5FWK A;  1VIS A;  1WUU A;  4X62 E;  3T1Y I;  2ZM6 E;  3HJC A;  2X7I A;  1KKH A;  2Z5B B;  4DR3 I;  2HHH I;  3ZKD A;  4DV2 E;  4JI1 E;  4NXM E;  2UXD I;  4JI6 E;  1IBK E;  4B3T E;  1XNR E;  5FLX C;  4URL A;  4ZVI A;  3ZM7 A;  4DR4 I;  1A6F A;  4KQV A;  4P7A A;  4DR1 E;  3V5R A;  1EI1 A;  3Q6M A;  1ZXN A;  4UTG A;  2E5L E;  1Z0B A;  2ZBK B;  2CG9 A;  1N34 I;  4K0K I;  4LF8 E;  4LF7 E;  4DXL A;  2BV3 A;  1XMQ E;  2Z5E A;  4X64 E;  2E1R A;  4X62 I;  1ZXM A;  1H7S A;  3B78 A;  2ZM6 I;  3K17 A;  2BM0 A;  4DR6 E;  2DEI A;  2PNM A;  4GKK E;  2VQF I;  4LF4 I;  1KTV A;  4DV2 I;  4JI7 E;  2GS8 A;  4NXM I;  4JI6 I;  1ZM3 A;  1IBK I;  1N0U A;  4B3T I;  4ED4 A;  1XNR I;  1RRE A;  5L3J A;  1K47 A;  5IWA E;  1OJ4 A;  4JI5 E;  4R1F A;  4JI2 E;  4PRX A;  1RR9 A;  4DR1 I;  1HNZ E;  3M6A A;  2E5L I;  1ZM9 A;  4LF8 I;  2HKE A;  4FWH A;  4X64 I;  4YY3 E;  3K1J A;  4HXZ A;  4JV5 E;  4DPX A;  2HFU A;  4Z7C A;  2A2C A;  1Y4S A;  4DR6 I;  1FJG I;  2R42 A;  1Z0W A;  1UEK A;  4GKK I;  3ZKB A;  4XTJ A;  4RPF A;  1XHK A;  3JAM Q;  4LFC E;  4JI7 I;  3J80 Q;  4LF5 I;  1NHI A;  1IBM E;  4B3S E;  3J81 C;  4MYT A;  2CGE A;  5IWA I;  1D6T A;  1FKA E;  4JI2 I;  4GKJ E;  1I94 E;  3QT8 A;  1HNZ I;  1PIE A;  2O1W A;  3PRY A;  4DU7 A;  3PYE A;  1MX0 A;  5IT9 Q;  3PYF A;  3J7A M;  4JI8 I;  1ZM2 A;  4DUY E;  1FNM A;  2VF3 A;  1Z59 A;  2V8P A;  4YY3 I;  4LF6 E;  4JV5 I;  1N36 E;  2PNL A;  4B3R E;  4WUB A;  1B63 A;  4DPU A;  2O1T A;  2UUC E;  2XEX A;  1ZM4 A;  1QZR A;  1N0V C;  1HNX E;  1MG7 A;  3QT5 A;  1IBM I;  2HKJ A;  4B3S I;  2J7K A;  4GKJ I;  2V2V A;  4I3H A;  1S4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...