1XNRI

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnrI00
4DPYA 4DV6I 1IBLI 2UXCE 1FJGE 1H7UA 1KVKA 3LNUA 4JI8E 1N36I 5IT9Q 4RPFA 4DR2E 4X66I 2UUBE 2UUCE 1FJGI 5FLXC 2BV3A 3Q1QA 4FWHA 4JI8I 3T1HE 1XMOI 4OX9E 1N32E 3T1YE 4DR2I 2UUBI 4OX9I 2GS8A 3T1YI 1XNRE 3J7AG 1VISA 4MYUA 4EMDA 4DR1E 4ED4A 4JI7I 1XNRI 1Z59A 2BM0A 4P52A 4DR1I 3WU3A 2HK2A 3B8HA 1ZM3A 4PRXA 4JI3I 1HNXE 4PU9A 4DUZE 1BKNA 1XNQI 4JI4E 4DV1E 3K17A 4NXME 4JI5I 3B78A 1HNXI 4DUZI 4DR5E 2R42A 1I94E 1NHJA 4JI4I 4DV1I 5IT9C 1D6TA 4I3HA 2HFUA 4LF7I 1PIEA 1QZRA 3K1JA 4DR5I 3QT6A 1I94I 1DARA 4AQYE 3LTOA 4B3RE 4AQYI 2R3VA 4LFCE 3V2UC 2ZM6I 4LF5E 4JI2E 4USKA 1HNZE 4HXZA 4YHHE 4JI6E 4DV4E 4X62E 4JI2I 1H72C 1HNZI 4WUDA 1ZXMA 2EFGA 4JI6I 3QT8A 4DUYE 4DV4I 4UTGA 1B63A 4X62I 3J80C 4DR6I 4DPTA 5A2QC 4JV5E 4B3SE 1XHKA 1HNWI 1N33E 4B3SI 3ZZTA 1N33I 2UXCI 5IWAE 4PRVA 4YY3E 4LFBE 1H73A 1NZ0A 2UUCI 4DV3E 1IBME 1WUUA 3HULA 4DV0E 3T1HI 2A2DA 3WU6A 4YY3I 1N32I 5BR8E 1Z5BA 3OTOE 5GMEA 4LF9E 4DV2E 4FN5A 3PYDA 4DV0I 2VQFE 1KKHA 2LJPA 2UU9E 3OTOI 4LF9I 4X64E 4DV2I 1HR0E 2WW4A 2VQFI 2ZBKB 3J80Q 1ELOA 4UT4A 3J81C 4X64I 2NPFA 2X7IA 1Z0BA 5A2QQ 1HR0I 1ZXNA 1Z0VA 4DU7A 5L3JA 2A2CA 1KTVA 4JG4A 4URLA 1ZM9A 4DV5E 3QT5A 1N0UA 4NXMI 3V5RA 3JAMQ 4JI1E 4FW9A 4DV5I 4JYAE 3J7AM 1Z5AA 4DPWA 1Z0CA 2E5LE 4WUCA 2V2QA 1S4EA 4LF8E 3ZKDA 2X36A 4LF4E 1FKAE 2BM1A 5LMUE 2UXDE 4B3RI 4WUBA 4DR3E 1NHHA 4LFCI 4LF8I 1K47A 4LF5I 2OI2A 5LMUI 4YHHI 2UXDI 4XTJA 2HKEA 2HK3A 3J81Q 1FWKA 2J7KA 4P7AA 1A6FA 2VF3A 4B3TE 1EI1A 4DUYI 2UXBE 1RREA 4USMA 3D4JA 5LMNE 4B3TI 3LPSA 2HFSA 4HYMA 2UUAE 2UXBI 4JV5I 1FNMA 4FWDA 2HKJA 1FI4A 4GKKE 4DXLA 5LMNI 3ZZ0A 2UUAI 2V34A 1PKPA 3JAMC 4DR4E 1PVGA 4GKKI 1MU5A 4FWGA 4LFAE 4X66E 4LF6E 5IWAI 4DR4I 1XMOE 4LFBI 2V8PA 2VQEE 4LFAI 2DEJA 4DV3I 1IBMI 4LF6I 2HHHE 3PYGA 4DR7E 1H74A 4X65E 5BR8I 2VQEI 4B3ME 1Z5CA 2HHHI 1EA6A 4DR7I 4X65I 1UEKA 4JI7E 4Z7YA 2UU9I 1Z0WA 1H7SA 2V2VA 1U2RA 1ZM4A 4B3MI 1Z0EA 3PYFA 2Q2EB 4K0KE 4M1KA 4JI3E 3ZM7A 4DV7E 1FWLA 2AJ4A 1MG7A 4MYTA 1N34E 1B62A 4JI0E 4K0KI 1OJ4A 1XNQE 4HACA 4JI5E 4DV7I 4KQVA 5GMDA 1XMQE 3PYEA 1KIJA 1N34I 1ZM2A 4JI0I 4Z7CA 1IBKE 3ZKBA 3CWVA 5LL6R 4LF7E 2XEXA 4JI1I 1XMQI 4JYAI 1Z0GA 2CZ9A 1IBKI 5FLXQ 2DEIA 2E5LI 2E1RA 3WU4A 3WU5A 1S16A 4DPXA 3ZZUA 1J5EE 4NXNE 2ZM6E 4LF4I 3M6AA 4HACB 4R1FA 1N0VC 3H4LA 4DR3I 3B82A 1J5EI 4NXNI 1Z0TA 4KHPE 4GKJE 3GONA 3QT7A 1NHIA 4ZVIA 2F4VE 3F0NA 1RR9A 4KHPI 4DPUA 4GKJI 4DU8A 4DR6E 2V2ZA 2ZITA 2F4VI 4DV6E 1HNWE 1IBLE 4HY1A 1MX0A 1N36E
chains in the Genus database with same CATH superfamily
4U3DA 4DPYA 4DV6I 1IBLI 5DROA 1FJGE 2UXCE 1H7UA 2WNRB 1KVKA 2C39A 3LNUA 4JI8E 3H1CA 1N36I 5IT9Q 4RPFA 4DR2E 4X66I 2UUBE 2UUCE 2PO1A 5FLXC 1FJGI 3P3GA 2BV3A 3Q1QA 4FWHA 3PS1A 4JI8I 3T1HE 1XMOI 4OX9E 1N32E 3M85D 3T1YE 4DR2I 2UUBI 4LF7I 2PNZA 4MDTA 4LCHA 4OX9I 2GS8A 3T1YI 1XNRE 3CDIA 3J7AG 3NZKA 1VISA 4MYUA 2C39B 4EMDA 4DR1E 1OYRA 4ED4A 4JI7I 4MU3A 1XNRI 1P42A 1Z59A 2PO1B 2BM0A 4IZJA 4P52A 5JEAE 4DR1I 5C0XC 3WU3A 2O1UA 2HK2A 4IS9A 3B8HA 1ZM3A 5FWKA 4PRXA 4JI3I 1OYPA 2PNZB 1UDSA 1HNXE 4PU9A 4DUZE 2PNLA 1BKNA 5JEAF 1XNQI 4JI4E 4DV1E 3K17A 4NXME 4JI5I 2CGEA 3B78A 1HNXI 4DUZI 4DR5E 2R42A 2Z5BA 1I94E 1NHJA 4JI4I 4DV1I 5IT9C 5DRQA 1D6TA 4I3HA 2HFUA 3GLLA 2BA0D 4IZJB 1PIEA 1QZRA 3GCMA 3U1YA 5DRPA 4AIDA 3K1JA 4NBQA 4DR5I 1E3PA 3QT6A 2NN6E 1I94I 1DARA 4AQYE 2C37A 3LTOA 3PS2A 1R6MA 2GO4A 4B3RE 4AQYI 2R3VA 4LFCE 3V2UC 2ZM6I 4LF5E 2NN6F 4JI2E 4USKA 4OO1A 1HNZE 4HXZA 1R6LA 4IZJD 2CVEA 4YHHE 4JI6E 2Z5BB 4U3BA 4DV4E 3L7ZA 4X62E 4JI2I 1H72C 1HNZI 4WUDA 1ZXMA 2EFGA 4JI6I 3QT8A 4DUYE 4DV4I 4UTGA 1B63A 1Y6ZA 4X62I 3J80C 4LCGA 5JEAC 4DR6I 4OO1E 4DPTA 1VI7A 5A2QC 4ISAA 4JV5E 4B3SE 1XHKA 1HNWI 1N33E 2J65A 3L7ZB 2F1DA 4B3SI 4OO1F 4FW6A 5C0XD 3ZZTA 1N33I 2UXCI 3Q6MA 1UDOA 3B4TA 5IWAE 4PRVA 4YY3E 1E3HA 4LFBE 1H73A 1NZ0A 2UUCI 5JEAA 2NN6C 4DV3E 1IBME 1WUUA 3HULA 4DV0E 3T1HI 2A2DA 3WU6A 4YY3I 1N32I 5BR8E 3P76A 1Z5BA 1Y60A 5GMEA 3OTOE 4LF9E 2PO0A 4DV2E 4FN5A 3PYDA 4DV0I 2VQFE 1KKHA 2LJPA 2UU9E 3OTOI 4LF9I 4X64E 5K36F 4AIMA 4DV2I 1HR0E 2WW4A 2VQFI 2ZBKB 1UDNA 3J80Q 3Q6NA 1ELOA 4UT4A 3J81C 4X64I 2NPFA 2X7IA 5JEAB 4OKGA 1Z0BA 5A2QQ 1HR0I 4LCFA 1ZXNA 2NN6A 4IFDE 3M85G 1Z0VA 4DU7A 5L3JA 2PO0B 2A2CA 3M7ND 4OO1C 1KTVA 4JG4A 4URLA 2AE8A 1ZM9A 1YHCA 4DV5E 3QT5A 1N0UA 4NXMI 4IFDF 3V5RA 3JAMQ 2JT2A 5JEAD 4JI1E 4FW9A 4DV5I 4JYAE 3J7AM 1USVA 3HJCA 1Z5AA 1UDQA 2O1VA 4DPWA 1Z0CA 2E5LE 4AM3A 4WUCA 2NN6B 2PNMA 3GMEA 2V2QA 3UHMA 1S4EA 3KRNA 4LF8E 3ZKDA 2X36A 4LF4E 1FKAE 2BM1A 5LMUE 5K36C 2UXDE 4B3RI 4J3DA 4WUBA 4DR3E 1NHHA 4LFCI 4LF8I 1K47A 4LF5I 2OI2A 5LMUI 4YHHI 1YH8A 4XTJA 2UXDI 5DRRA 2HKEA 5EL9A 2NN6D 5ELWA 2HK3A 2BA0G 3J81Q 1FWKA 2J7KA 2C37B 4P7AA 1A6FA 2VF3A 4BA1A 4B3TE 1EI1A 4FW7A 2IOPA 4DUYI 2O3ZA 2UXBE 2WNRA 4N3OA 1RREA 4FW5A 2IOQA 4MU4A 4BA2A 2C38A 2O1TA 3HKMA 4USMA 3D4JA 2BA1G 4OO1B 5LMNE 4B3TI 3LPSA 2HFSA 4HYMA 2UUAE 4IFDC 2UXBI 1HK7A 4JV5I 5K36A 1FNMA 4FWDA 2JEAA 2HKJA 1FI4A 4GKKE 4DXLA 5LMNI 3ZZ0A 2UUAI 2V34A 1PKPA 3JAMC 4DR4E 1PVGA 4GKKI 1MU5A 4BA1B 1OYSA 4FWGA 4LFAE 4X66E 4OO1D 3DD6A 4LF6E 2JE6A 2Z5CA 5IWAI 4DR4I 4BA2B 1XMOE 5K36E 2C38B 4LFBI 2V8PA 2IESA 3P3EA 1Y4SA 2VQEE 4LFAI 2DEJA 4DV3I 1IBMI 4LF6I 4GQUA 2HHHE 4IFDA 3PYGA 5K36B 4DR7E 1H74A 4X65E 2JEAB 5BR8I 4QNKA 2PO2A 4IZKA 2VQEI 4B3ME 1Z5CA 2HHHI 1EA6A 4OZEA 4DR7I 1UEKA 4X65I 5DNLA 4JI7E 4Z7YA 2UU9I 1Z0WA 1H7SA 2V2VA 1U2RA 1ZM4A 4B3MI 2JE6B 2Z5CB 1Z0EA 5K36D 3PYFA 5DNXA 2Q2EB 3PS3A 4K0KE 4LPFA 2JEBA 4IFDB 4LOMA 1XXEA 4M1KA 4JI3E 3ZM7A 4FW4A 4DV7E 1FWLA 2AJ4A 1MG7A 2PO2B 4MYTA 4IZKB 3U1KA 1N34E 1RHYA 1B62A 4JI0E 4K0KI 1OJ4A 1XNQE 4MQYA 2BR2A 4HACA 2WP8A 3P06A 4DV7I 4JI5E 4KQVA 4MU1A 5GMDA 5EKWA 1XMQE 3PYEA 1KIJA 1N34I 1ZM2A 4JI0I 4Z7CA 2GO3A 1IBKE 3ZKBA 3CWVA 5LL6R 4LF7E 3CDJA 2XEXA 4JI1I 2GQ0A 3P3CA 4IFDD 1XMQI 4JYAI 1Z0GA 2CZ9A 1IBKI 5FLXQ 2JEBB 2DEIA 2O1WA 2E5LI 4QNJA 2E1RA 3WU4A 3WU5A 1S16A 2CG9A 4DPXA 3ZZUA 5C0XA 3M7NG 1J5EE 4NXNE 2BR2B 2ZM6E 1Y5YA 4LF4I 3M6AA 4HACB 4R1FA 2WP8B 2BA1D 1N0VC 2VESA 4FW3A 3H4LA 4DR3I 3B82A 1J5EI 4NXNI 2IERA 3K85A 1Z0TA 4KHPE 4GKJE 3GONA 3QT7A 1NHIA 4ZVIA 2F4VE 3F0NA 1RR9A 5C0XE 4KHPI 4DPUA 4GKJI 4DU8A 4DR6E 2V2ZA 2Z5EA 2ZITA 5C0XB 2F4VI 3PRYA 1Y4UA 4DV6E 1HNWE 1USUA 1IBLE 5C0XF 4MU0A 4HY1A 1MX0A 1N36E
chains in the Genus database with same CATH topology
4DPYA 4DV6I 1IBLI 2UXCE 1FJGE 1H7UA 1KVKA 3LNUA 4JI8E 1N36I 5IT9Q 4RPFA 4DR2E 4X66I 2UUBE 2UUCE 1FJGI 5FLXC 2BV3A 3Q1QA 4FWHA 4JI8I 3T1HE 1XMOI 4OX9E 1N32E 3T1YE 4DR2I 2UUBI 4OX9I 2GS8A 3T1YI 1XNRE 3J7AG 1VISA 4MYUA 4EMDA 4DR1E 4ED4A 4JI7I 1XNRI 1Z59A 2BM0A 4IZJA 4P52A 4DR1I 3WU3A 2O1UA 2HK2A 3B8HA 1ZM3A 5FWKA 4PRXA 4JI3I 1HNXE 4PU9A 4DUZE 2PNLA 1BKNA 1XNQI 4JI4E 4DV1E 3K17A 4NXME 4JI5I 2CGEA 3B78A 1HNXI 4DUZI 4DR5E 2R42A 2Z5BA 1I94E 1NHJA 4JI4I 4DV1I 5IT9C 1D6TA 4I3HA 2HFUA 4LF7I 4IZJB 1PIEA 1QZRA 3K1JA 4DR5I 3QT6A 1I94I 1DARA 4AQYE 3LTOA 4B3RE 4AQYI 2R3VA 4LFCE 3V2UC 2ZM6I 4LF5E 4JI2E 4USKA 1HNZE 4HXZA 4IZJD 4YHHE 4JI6E 2Z5BB 4DV4E 4X62E 4JI2I 1H72C 1HNZI 4WUDA 1ZXMA 2EFGA 4JI6I 3QT8A 4DUYE 4DV4I 4UTGA 1B63A 1Y6ZA 4X62I 3J80C 4DR6I 4DPTA 5A2QC 4JV5E 4B3SE 1XHKA 1HNWI 1N33E 4B3SI 3ZZTA 1N33I 2UXCI 3Q6MA 5IWAE 4PRVA 4YY3E 4LFBE 1H73A 1NZ0A 2UUCI 4DV3E 1IBME 1WUUA 3HULA 4DV0E 3T1HI 2A2DA 3WU6A 4YY3I 1N32I 5BR8E 1Z5BA 3OTOE 5GMEA 4LF9E 4DV2E 4FN5A 3PYDA 4DV0I 2VQFE 1KKHA 2LJPA 2UU9E 3OTOI 4LF9I 4X64E 4DV2I 1HR0E 2WW4A 2VQFI 2ZBKB 3J80Q 3Q6NA 1ELOA 4UT4A 3J81C 4X64I 2NPFA 2X7IA 1Z0BA 5A2QQ 1HR0I 1ZXNA 1Z0VA 4DU7A 5L3JA 2A2CA 1KTVA 4JG4A 4URLA 1ZM9A 4DV5E 3QT5A 1N0UA 4NXMI 3V5RA 3JAMQ 4JI1E 4FW9A 4DV5I 4JYAE 3J7AM 1USVA 3HJCA 1Z5AA 2O1VA 4DPWA 1Z0CA 2E5LE 4WUCA 2PNMA 2V2QA 1S4EA 4LF8E 3ZKDA 2X36A 4LF4E 1FKAE 2BM1A 5LMUE 2UXDE 4B3RI 4WUBA 4DR3E 1NHHA 4LFCI 4LF8I 1K47A 4LF5I 2OI2A 5LMUI 4YHHI 2UXDI 4XTJA 2HKEA 2HK3A 3J81Q 1FWKA 2J7KA 4P7AA 1A6FA 2VF3A 4B3TE 1EI1A 2IOPA 4DUYI 2UXBE 4N3OA 1RREA 2IOQA 2O1TA 4USMA 3D4JA 5LMNE 4B3TI 3LPSA 2HFSA 4HYMA 2UUAE 2UXBI 1HK7A 4JV5I 1FNMA 4FWDA 2HKJA 1FI4A 4GKKE 4DXLA 5LMNI 3ZZ0A 2UUAI 2V34A 1PKPA 3JAMC 4DR4E 1PVGA 4GKKI 1MU5A 4FWGA 4LFAE 4X66E 4LF6E 2Z5CA 5IWAI 4DR4I 1XMOE 4LFBI 2V8PA 1Y4SA 2VQEE 4LFAI 2DEJA 4DV3I 1IBMI 4LF6I 2HHHE 3PYGA 4DR7E 1H74A 4X65E 5BR8I 4IZKA 2VQEI 4B3ME 1Z5CA 2HHHI 1EA6A 4DR7I 4X65I 1UEKA 4JI7E 4Z7YA 2UU9I 1Z0WA 1H7SA 2V2VA 1U2RA 1ZM4A 4B3MI 2Z5CB 1Z0EA 3PYFA 2Q2EB 4K0KE 4M1KA 4JI3E 3ZM7A 4DV7E 1FWLA 2AJ4A 1MG7A 4MYTA 4IZKB 1N34E 1B62A 4JI0E 4K0KI 1OJ4A 1XNQE 4HACA 3P06A 4JI5E 4DV7I 4KQVA 5GMDA 1XMQE 3PYEA 1KIJA 1N34I 1ZM2A 4JI0I 4Z7CA 1IBKE 3ZKBA 3CWVA 5LL6R 4LF7E 2XEXA 4JI1I 2GQ0A 1XMQI 4JYAI 1Z0GA 2CZ9A 1IBKI 5FLXQ 2DEIA 2O1WA 2E5LI 2E1RA 3WU4A 3WU5A 1S16A 2CG9A 4DPXA 3ZZUA 1J5EE 4NXNE 2ZM6E 4LF4I 3M6AA 4HACB 4R1FA 1N0VC 3H4LA 4DR3I 3B82A 1J5EI 4NXNI 3K85A 1Z0TA 4KHPE 4GKJE 3GONA 3QT7A 1NHIA 4ZVIA 2F4VE 3F0NA 1RR9A 4KHPI 4DPUA 4GKJI 4DU8A 4DR6E 2V2ZA 2Z5EA 2ZITA 2F4VI 3PRYA 1Y4UA 4DV6E 1HNWE 1USUA 1IBLE 4HY1A 1MX0A 1N36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPY A;  4DV6 I;  1IBL I;  2UXC E;  1FJG E;  1H7U A;  1KVK A;  3LNU A;  4JI8 E;  1N36 I;  5IT9 Q;  4RPF A;  4DR2 E;  4X66 I;  2UUB E;  2UUC E;  1FJG I;  5FLX C;  2BV3 A;  3Q1Q A;  4FWH A;  4JI8 I;  3T1H E;  1XMO I;  4OX9 E;  1N32 E;  3T1Y E;  4DR2 I;  2UUB I;  4OX9 I;  2GS8 A;  3T1Y I;  1XNR E;  3J7A G;  1VIS A;  4MYU A;  4EMD A;  4DR1 E;  4ED4 A;  4JI7 I;  1XNR I;  1Z59 A;  2BM0 A;  4P52 A;  4DR1 I;  3WU3 A;  2HK2 A;  3B8H A;  1ZM3 A;  4PRX A;  4JI3 I;  1HNX E;  4PU9 A;  4DUZ E;  1BKN A;  1XNQ I;  4JI4 E;  4DV1 E;  3K17 A;  4NXM E;  4JI5 I;  3B78 A;  1HNX I;  4DUZ I;  4DR5 E;  2R42 A;  1I94 E;  1NHJ A;  4JI4 I;  4DV1 I;  5IT9 C;  1D6T A;  4I3H A;  2HFU A;  4LF7 I;  1PIE A;  1QZR A;  3K1J A;  4DR5 I;  3QT6 A;  1I94 I;  1DAR A;  4AQY E;  3LTO A;  4B3R E;  4AQY I;  2R3V A;  4LFC E;  3V2U C;  2ZM6 I;  4LF5 E;  4JI2 E;  4USK A;  1HNZ E;  4HXZ A;  4YHH E;  4JI6 E;  4DV4 E;  4X62 E;  4JI2 I;  1H72 C;  1HNZ I;  4WUD A;  1ZXM A;  2EFG A;  4JI6 I;  3QT8 A;  4DUY E;  4DV4 I;  4UTG A;  1B63 A;  4X62 I;  3J80 C;  4DR6 I;  4DPT A;  5A2Q C;  4JV5 E;  4B3S E;  1XHK A;  1HNW I;  1N33 E;  4B3S I;  3ZZT A;  1N33 I;  2UXC I;  5IWA E;  4PRV A;  4YY3 E;  4LFB E;  1H73 A;  1NZ0 A;  2UUC I;  4DV3 E;  1IBM E;  1WUU A;  3HUL A;  4DV0 E;  3T1H I;  2A2D A;  3WU6 A;  4YY3 I;  1N32 I;  5BR8 E;  1Z5B A;  3OTO E;  5GME A;  4LF9 E;  4DV2 E;  4FN5 A;  3PYD A;  4DV0 I;  2VQF E;  1KKH A;  2LJP A;  2UU9 E;  3OTO I;  4LF9 I;  4X64 E;  4DV2 I;  1HR0 E;  2WW4 A;  2VQF I;  2ZBK B;  3J80 Q;  1ELO A;  4UT4 A;  3J81 C;  4X64 I;  2NPF A;  2X7I A;  1Z0B A;  5A2Q Q;  1HR0 I;  1ZXN A;  1Z0V A;  4DU7 A;  5L3J A;  2A2C A;  1KTV A;  4JG4 A;  4URL A;  1ZM9 A;  4DV5 E;  3QT5 A;  1N0U A;  4NXM I;  3V5R A;  3JAM Q;  4JI1 E;  4FW9 A;  4DV5 I;  4JYA E;  3J7A M;  1Z5A A;  4DPW A;  1Z0C A;  2E5L E;  4WUC A;  2V2Q A;  1S4E A;  4LF8 E;  3ZKD A;  2X36 A;  4LF4 E;  1FKA E;  2BM1 A;  5LMU E;  2UXD E;  4B3R I;  4WUB A;  4DR3 E;  1NHH A;  4LFC I;  4LF8 I;  1K47 A;  4LF5 I;  2OI2 A;  5LMU I;  4YHH I;  2UXD I;  4XTJ A;  2HKE A;  2HK3 A;  3J81 Q;  1FWK A;  2J7K A;  4P7A A;  1A6F A;  2VF3 A;  4B3T E;  1EI1 A;  4DUY I;  2UXB E;  1RRE A;  4USM A;  3D4J A;  5LMN E;  4B3T I;  3LPS A;  2HFS A;  4HYM A;  2UUA E;  2UXB I;  4JV5 I;  1FNM A;  4FWD A;  2HKJ A;  1FI4 A;  4GKK E;  4DXL A;  5LMN I;  3ZZ0 A;  2UUA I;  2V34 A;  1PKP A;  3JAM C;  4DR4 E;  1PVG A;  4GKK I;  1MU5 A;  4FWG A;  4LFA E;  4X66 E;  4LF6 E;  5IWA I;  4DR4 I;  1XMO E;  4LFB I;  2V8P A;  2VQE E;  4LFA I;  2DEJ A;  4DV3 I;  1IBM I;  4LF6 I;  2HHH E;  3PYG A;  4DR7 E;  1H74 A;  4X65 E;  5BR8 I;  2VQE I;  4B3M E;  1Z5C A;  2HHH I;  1EA6 A;  4DR7 I;  4X65 I;  1UEK A;  4JI7 E;  4Z7Y A;  2UU9 I;  1Z0W A;  1H7S A;  2V2V A;  1U2R A;  1ZM4 A;  4B3M I;  1Z0E A;  3PYF A;  2Q2E B;  4K0K E;  4M1K A;  4JI3 E;  3ZM7 A;  4DV7 E;  1FWL A;  2AJ4 A;  1MG7 A;  4MYT A;  1N34 E;  1B62 A;  4JI0 E;  4K0K I;  1OJ4 A;  1XNQ E;  4HAC A;  4JI5 E;  4DV7 I;  4KQV A;  5GMD A;  1XMQ E;  3PYE A;  1KIJ A;  1N34 I;  1ZM2 A;  4JI0 I;  4Z7C A;  1IBK E;  3ZKB A;  3CWV A;  5LL6 R;  4LF7 E;  2XEX A;  4JI1 I;  1XMQ I;  4JYA I;  1Z0G A;  2CZ9 A;  1IBK I;  5FLX Q;  2DEI A;  2E5L I;  2E1R A;  3WU4 A;  3WU5 A;  1S16 A;  4DPX A;  3ZZU A;  1J5E E;  4NXN E;  2ZM6 E;  4LF4 I;  3M6A A;  4HAC B;  4R1F A;  1N0V C;  3H4L A;  4DR3 I;  3B82 A;  1J5E I;  4NXN I;  1Z0T A;  4KHP E;  4GKJ E;  3GON A;  3QT7 A;  1NHI A;  4ZVI A;  2F4V E;  3F0N A;  1RR9 A;  4KHP I;  4DPU A;  4GKJ I;  4DU8 A;  4DR6 E;  2V2Z A;  2ZIT A;  2F4V I;  4DV6 E;  1HNW E;  1IBL E;  4HY1 A;  1MX0 A;  1N36 E; 
#chains in the Genus database with same CATH topology
 4U3D A;  4DPY A;  4DV6 I;  1IBL I;  5DRO A;  1FJG E;  2UXC E;  1H7U A;  2WNR B;  1KVK A;  2C39 A;  3LNU A;  4JI8 E;  3H1C A;  1N36 I;  5IT9 Q;  4RPF A;  4DR2 E;  4X66 I;  2UUB E;  2UUC E;  2PO1 A;  5FLX C;  1FJG I;  3P3G A;  2BV3 A;  3Q1Q A;  4FWH A;  3PS1 A;  4JI8 I;  3T1H E;  1XMO I;  4OX9 E;  1N32 E;  3M85 D;  3T1Y E;  4DR2 I;  2UUB I;  4LF7 I;  2PNZ A;  4MDT A;  4LCH A;  4OX9 I;  2GS8 A;  3T1Y I;  1XNR E;  3CDI A;  3J7A G;  3NZK A;  1VIS A;  4MYU A;  2C39 B;  4EMD A;  4DR1 E;  1OYR A;  4ED4 A;  4JI7 I;  4MU3 A;  1XNR I;  1P42 A;  1Z59 A;  2PO1 B;  2BM0 A;  4IZJ A;  4P52 A;  5JEA E;  4DR1 I;  5C0X C;  3WU3 A;  2O1U A;  2HK2 A;  4IS9 A;  3B8H A;  1ZM3 A;  5FWK A;  4PRX A;  4JI3 I;  1OYP A;  2PNZ B;  1UDS A;  1HNX E;  4PU9 A;  4DUZ E;  2PNL A;  1BKN A;  5JEA F;  1XNQ I;  4JI4 E;  4DV1 E;  3K17 A;  4NXM E;  4JI5 I;  2CGE A;  3B78 A;  1HNX I;  4DUZ I;  4DR5 E;  2R42 A;  2Z5B A;  1I94 E;  1NHJ A;  4JI4 I;  4DV1 I;  5IT9 C;  5DRQ A;  1D6T A;  4I3H A;  2HFU A;  3GLL A;  2BA0 D;  4IZJ B;  1PIE A;  1QZR A;  3GCM A;  3U1Y A;  5DRP A;  4AID A;  3K1J A;  4NBQ A;  4DR5 I;  1E3P A;  3QT6 A;  2NN6 E;  1I94 I;  1DAR A;  4AQY E;  2C37 A;  3LTO A;  3PS2 A;  1R6M A;  2GO4 A;  4B3R E;  4AQY I;  2R3V A;  4LFC E;  3V2U C;  2ZM6 I;  4LF5 E;  2NN6 F;  4JI2 E;  4USK A;  4OO1 A;  1HNZ E;  4HXZ A;  1R6L A;  4IZJ D;  2CVE A;  4YHH E;  4JI6 E;  2Z5B B;  4U3B A;  4DV4 E;  3L7Z A;  4X62 E;  4JI2 I;  1H72 C;  1HNZ I;  4WUD A;  1ZXM A;  2EFG A;  4JI6 I;  3QT8 A;  4DUY E;  4DV4 I;  4UTG A;  1B63 A;  1Y6Z A;  4X62 I;  3J80 C;  4LCG A;  5JEA C;  4DR6 I;  4OO1 E;  4DPT A;  1VI7 A;  5A2Q C;  4ISA A;  4JV5 E;  4B3S E;  1XHK A;  1HNW I;  1N33 E;  2J65 A;  3L7Z B;  2F1D A;  4B3S I;  4OO1 F;  4FW6 A;  5C0X D;  3ZZT A;  1N33 I;  2UXC I;  3Q6M A;  1UDO A;  3B4T A;  5IWA E;  4PRV A;  4YY3 E;  1E3H A;  4LFB E;  1H73 A;  1NZ0 A;  2UUC I;  5JEA A;  2NN6 C;  4DV3 E;  1IBM E;  1WUU A;  3HUL A;  4DV0 E;  3T1H I;  2A2D A;  3WU6 A;  4YY3 I;  1N32 I;  5BR8 E;  3P76 A;  1Z5B A;  1Y60 A;  5GME A;  3OTO E;  4LF9 E;  2PO0 A;  4DV2 E;  4FN5 A;  3PYD A;  4DV0 I;  2VQF E;  1KKH A;  2LJP A;  2UU9 E;  3OTO I;  4LF9 I;  4X64 E;  5K36 F;  4AIM A;  4DV2 I;  1HR0 E;  2WW4 A;  2VQF I;  2ZBK B;  1UDN A;  3J80 Q;  3Q6N A;  1ELO A;  4UT4 A;  3J81 C;  4X64 I;  2NPF A;  2X7I A;  5JEA B;  4OKG A;  1Z0B A;  5A2Q Q;  1HR0 I;  4LCF A;  1ZXN A;  2NN6 A;  4IFD E;  3M85 G;  1Z0V A;  4DU7 A;  5L3J A;  2PO0 B;  2A2C A;  3M7N D;  4OO1 C;  1KTV A;  4JG4 A;  4URL A;  2AE8 A;  1ZM9 A;  1YHC A;  4DV5 E;  3QT5 A;  1N0U A;  4NXM I;  4IFD F;  3V5R A;  3JAM Q;  2JT2 A;  5JEA D;  4JI1 E;  4FW9 A;  4DV5 I;  4JYA E;  3J7A M;  1USV A;  3HJC A;  1Z5A A;  1UDQ A;  2O1V A;  4DPW A;  1Z0C A;  2E5L E;  4AM3 A;  4WUC A;  2NN6 B;  2PNM A;  3GME A;  2V2Q A;  3UHM A;  1S4E A;  3KRN A;  4LF8 E;  3ZKD A;  2X36 A;  4LF4 E;  1FKA E;  2BM1 A;  5LMU E;  5K36 C;  2UXD E;  4B3R I;  4J3D A;  4WUB A;  4DR3 E;  1NHH A;  4LFC I;  4LF8 I;  1K47 A;  4LF5 I;  2OI2 A;  5LMU I;  4YHH I;  1YH8 A;  4XTJ A;  2UXD I;  5DRR A;  2HKE A;  5EL9 A;  2NN6 D;  5ELW A;  2HK3 A;  2BA0 G;  3J81 Q;  1FWK A;  2J7K A;  2C37 B;  4P7A A;  1A6F A;  2VF3 A;  4BA1 A;  4B3T E;  1EI1 A;  4FW7 A;  2IOP A;  4DUY I;  2O3Z A;  2UXB E;  2WNR A;  4N3O A;  1RRE A;  4FW5 A;  2IOQ A;  4MU4 A;  4BA2 A;  2C38 A;  2O1T A;  3HKM A;  4USM A;  3D4J A;  2BA1 G;  4OO1 B;  5LMN E;  4B3T I;  3LPS A;  2HFS A;  4HYM A;  2UUA E;  4IFD C;  2UXB I;  1HK7 A;  4JV5 I;  5K36 A;  1FNM A;  4FWD A;  2JEA A;  2HKJ A;  1FI4 A;  4GKK E;  4DXL A;  5LMN I;  3ZZ0 A;  2UUA I;  2V34 A;  1PKP A;  3JAM C;  4DR4 E;  1PVG A;  4GKK I;  1MU5 A;  4BA1 B;  1OYS A;  4FWG A;  4LFA E;  4X66 E;  4OO1 D;  3DD6 A;  4LF6 E;  2JE6 A;  2Z5C A;  5IWA I;  4DR4 I;  4BA2 B;  1XMO E;  5K36 E;  2C38 B;  4LFB I;  2V8P A;  2IES A;  3P3E A;  1Y4S A;  2VQE E;  4LFA I;  2DEJ A;  4DV3 I;  1IBM I;  4LF6 I;  4GQU A;  2HHH E;  4IFD A;  3PYG A;  5K36 B;  4DR7 E;  1H74 A;  4X65 E;  2JEA B;  5BR8 I;  4QNK A;  2PO2 A;  4IZK A;  2VQE I;  4B3M E;  1Z5C A;  2HHH I;  1EA6 A;  4OZE A;  4DR7 I;  1UEK A;  4X65 I;  5DNL A;  4JI7 E;  4Z7Y A;  2UU9 I;  1Z0W A;  1H7S A;  2V2V A;  1U2R A;  1ZM4 A;  4B3M I;  2JE6 B;  2Z5C B;  1Z0E A;  5K36 D;  3PYF A;  5DNX A;  2Q2E B;  3PS3 A;  4K0K E;  4LPF A;  2JEB A;  4IFD B;  4LOM A;  1XXE A;  4M1K A;  4JI3 E;  3ZM7 A;  4FW4 A;  4DV7 E;  1FWL A;  2AJ4 A;  1MG7 A;  2PO2 B;  4MYT A;  4IZK B;  3U1K A;  1N34 E;  1RHY A;  1B62 A;  4JI0 E;  4K0K I;  1OJ4 A;  1XNQ E;  4MQY A;  2BR2 A;  4HAC A;  2WP8 A;  3P06 A;  4DV7 I;  4JI5 E;  4KQV A;  4MU1 A;  5GMD A;  5EKW A;  1XMQ E;  3PYE A;  1KIJ A;  1N34 I;  1ZM2 A;  4JI0 I;  4Z7C A;  2GO3 A;  1IBK E;  3ZKB A;  3CWV A;  5LL6 R;  4LF7 E;  3CDJ A;  2XEX A;  4JI1 I;  2GQ0 A;  3P3C A;  4IFD D;  1XMQ I;  4JYA I;  1Z0G A;  2CZ9 A;  1IBK I;  5FLX Q;  2JEB B;  2DEI A;  2O1W A;  2E5L I;  4QNJ A;  2E1R A;  3WU4 A;  3WU5 A;  1S16 A;  2CG9 A;  4DPX A;  3ZZU A;  5C0X A;  3M7N G;  1J5E E;  4NXN E;  2BR2 B;  2ZM6 E;  1Y5Y A;  4LF4 I;  3M6A A;  4HAC B;  4R1F A;  2WP8 B;  2BA1 D;  1N0V C;  2VES A;  4FW3 A;  3H4L A;  4DR3 I;  3B82 A;  1J5E I;  4NXN I;  2IER A;  3K85 A;  1Z0T A;  4KHP E;  4GKJ E;  3GON A;  3QT7 A;  1NHI A;  4ZVI A;  2F4V E;  3F0N A;  1RR9 A;  5C0X E;  4KHP I;  4DPU A;  4GKJ I;  4DU8 A;  4DR6 E;  2V2Z A;  2Z5E A;  2ZIT A;  5C0X B;  2F4V I;  3PRY A;  1Y4U A;  4DV6 E;  1HNW E;  1USU A;  1IBL E;  5C0X F;  4MU0 A;  4HY1 A;  1MX0 A;  1N36 E; 
#chains in the Genus database with same CATH homology
 4DPY A;  4DV6 I;  1IBL I;  2UXC E;  1FJG E;  1H7U A;  1KVK A;  3LNU A;  4JI8 E;  1N36 I;  5IT9 Q;  4RPF A;  4DR2 E;  4X66 I;  2UUB E;  2UUC E;  1FJG I;  5FLX C;  2BV3 A;  3Q1Q A;  4FWH A;  4JI8 I;  3T1H E;  1XMO I;  4OX9 E;  1N32 E;  3T1Y E;  4DR2 I;  2UUB I;  4OX9 I;  2GS8 A;  3T1Y I;  1XNR E;  3J7A G;  1VIS A;  4MYU A;  4EMD A;  4DR1 E;  4ED4 A;  4JI7 I;  1XNR I;  1Z59 A;  2BM0 A;  4IZJ A;  4P52 A;  4DR1 I;  3WU3 A;  2O1U A;  2HK2 A;  3B8H A;  1ZM3 A;  5FWK A;  4PRX A;  4JI3 I;  1HNX E;  4PU9 A;  4DUZ E;  2PNL A;  1BKN A;  1XNQ I;  4JI4 E;  4DV1 E;  3K17 A;  4NXM E;  4JI5 I;  2CGE A;  3B78 A;  1HNX I;  4DUZ I;  4DR5 E;  2R42 A;  2Z5B A;  1I94 E;  1NHJ A;  4JI4 I;  4DV1 I;  5IT9 C;  1D6T A;  4I3H A;  2HFU A;  4LF7 I;  4IZJ B;  1PIE A;  1QZR A;  3K1J A;  4DR5 I;  3QT6 A;  1I94 I;  1DAR A;  4AQY E;  3LTO A;  4B3R E;  4AQY I;  2R3V A;  4LFC E;  3V2U C;  2ZM6 I;  4LF5 E;  4JI2 E;  4USK A;  1HNZ E;  4HXZ A;  4IZJ D;  4YHH E;  4JI6 E;  2Z5B B;  4DV4 E;  4X62 E;  4JI2 I;  1H72 C;  1HNZ I;  4WUD A;  1ZXM A;  2EFG A;  4JI6 I;  3QT8 A;  4DUY E;  4DV4 I;  4UTG A;  1B63 A;  1Y6Z A;  4X62 I;  3J80 C;  4DR6 I;  4DPT A;  5A2Q C;  4JV5 E;  4B3S E;  1XHK A;  1HNW I;  1N33 E;  4B3S I;  3ZZT A;  1N33 I;  2UXC I;  3Q6M A;  5IWA E;  4PRV A;  4YY3 E;  4LFB E;  1H73 A;  1NZ0 A;  2UUC I;  4DV3 E;  1IBM E;  1WUU A;  3HUL A;  4DV0 E;  3T1H I;  2A2D A;  3WU6 A;  4YY3 I;  1N32 I;  5BR8 E;  1Z5B A;  3OTO E;  5GME A;  4LF9 E;  4DV2 E;  4FN5 A;  3PYD A;  4DV0 I;  2VQF E;  1KKH A;  2LJP A;  2UU9 E;  3OTO I;  4LF9 I;  4X64 E;  4DV2 I;  1HR0 E;  2WW4 A;  2VQF I;  2ZBK B;  3J80 Q;  3Q6N A;  1ELO A;  4UT4 A;  3J81 C;  4X64 I;  2NPF A;  2X7I A;  1Z0B A;  5A2Q Q;  1HR0 I;  1ZXN A;  1Z0V A;  4DU7 A;  5L3J A;  2A2C A;  1KTV A;  4JG4 A;  4URL A;  1ZM9 A;  4DV5 E;  3QT5 A;  1N0U A;  4NXM I;  3V5R A;  3JAM Q;  4JI1 E;  4FW9 A;  4DV5 I;  4JYA E;  3J7A M;  1USV A;  3HJC A;  1Z5A A;  2O1V A;  4DPW A;  1Z0C A;  2E5L E;  4WUC A;  2PNM A;  2V2Q A;  1S4E A;  4LF8 E;  3ZKD A;  2X36 A;  4LF4 E;  1FKA E;  2BM1 A;  5LMU E;  2UXD E;  4B3R I;  4WUB A;  4DR3 E;  1NHH A;  4LFC I;  4LF8 I;  1K47 A;  4LF5 I;  2OI2 A;  5LMU I;  4YHH I;  2UXD I;  4XTJ A;  2HKE A;  2HK3 A;  3J81 Q;  1FWK A;  2J7K A;  4P7A A;  1A6F A;  2VF3 A;  4B3T E;  1EI1 A;  2IOP A;  4DUY I;  2UXB E;  4N3O A;  1RRE A;  2IOQ A;  2O1T A;  4USM A;  3D4J A;  5LMN E;  4B3T I;  3LPS A;  2HFS A;  4HYM A;  2UUA E;  2UXB I;  1HK7 A;  4JV5 I;  1FNM A;  4FWD A;  2HKJ A;  1FI4 A;  4GKK E;  4DXL A;  5LMN I;  3ZZ0 A;  2UUA I;  2V34 A;  1PKP A;  3JAM C;  4DR4 E;  1PVG A;  4GKK I;  1MU5 A;  4FWG A;  4LFA E;  4X66 E;  4LF6 E;  2Z5C A;  5IWA I;  4DR4 I;  1XMO E;  4LFB I;  2V8P A;  1Y4S A;  2VQE E;  4LFA I;  2DEJ A;  4DV3 I;  1IBM I;  4LF6 I;  2HHH E;  3PYG A;  4DR7 E;  1H74 A;  4X65 E;  5BR8 I;  4IZK A;  2VQE I;  4B3M E;  1Z5C A;  2HHH I;  1EA6 A;  4DR7 I;  4X65 I;  1UEK A;  4JI7 E;  4Z7Y A;  2UU9 I;  1Z0W A;  1H7S A;  2V2V A;  1U2R A;  1ZM4 A;  4B3M I;  2Z5C B;  1Z0E A;  3PYF A;  2Q2E B;  4K0K E;  4M1K A;  4JI3 E;  3ZM7 A;  4DV7 E;  1FWL A;  2AJ4 A;  1MG7 A;  4MYT A;  4IZK B;  1N34 E;  1B62 A;  4JI0 E;  4K0K I;  1OJ4 A;  1XNQ E;  4HAC A;  3P06 A;  4JI5 E;  4DV7 I;  4KQV A;  5GMD A;  1XMQ E;  3PYE A;  1KIJ A;  1N34 I;  1ZM2 A;  4JI0 I;  4Z7C A;  1IBK E;  3ZKB A;  3CWV A;  5LL6 R;  4LF7 E;  2XEX A;  4JI1 I;  2GQ0 A;  1XMQ I;  4JYA I;  1Z0G A;  2CZ9 A;  1IBK I;  5FLX Q;  2DEI A;  2O1W A;  2E5L I;  2E1R A;  3WU4 A;  3WU5 A;  1S16 A;  2CG9 A;  4DPX A;  3ZZU A;  1J5E E;  4NXN E;  2ZM6 E;  4LF4 I;  3M6A A;  4HAC B;  4R1F A;  1N0V C;  3H4L A;  4DR3 I;  3B82 A;  1J5E I;  4NXN I;  3K85 A;  1Z0T A;  4KHP E;  4GKJ E;  3GON A;  3QT7 A;  1NHI A;  4ZVI A;  2F4V E;  3F0N A;  1RR9 A;  4KHP I;  4DPU A;  4GKJ I;  4DU8 A;  4DR6 E;  2V2Z A;  2Z5E A;  2ZIT A;  2F4V I;  3PRY A;  1Y4U A;  4DV6 E;  1HNW E;  1USU A;  1IBL E;  4HY1 A;  1MX0 A;  1N36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...