1XNRK

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xnrK00
4LF5K 4B3MK 4DR4K 4DR6K 1FJGK 1XNRK 5IWAK 4LF4K 3OTOK 5LMNK 4V19S 4JI4K 5LL6Z 4AQYK 4DV4K 1HNXK 4X65K 4KHPK 4DV6K 3J7YP 4DV0K 1N36K 1N32K 4DV3K 3J81O 1IBKK 5AJ3K 4LF9K 4DV1K 3T1YK 4DV2K 2UU9K 4DV5K 4B3RK 4B3SK 1HNWK 1XNQK 4JV5K 2UXCK 4JI2K 4GKJK 3J7AP 2E5LK 3T1HK 4JI3K 4DR2K 4B3TK 1IBMK 2UXDK 4JI0K 3J80O 4NXMK 1XMQK 5A2QO 2VQFK 5LMUK 5FLXO 4K0KK 5BR8K 4DR1K 4OX9K 2F4VK 4X66K 2HHHK 4DR5K 4LFCK 4NXNK 4JI1K 4CW7B 4JYAK 4X62K 2ZM6K 1I94K 4DR7K 1N33K 4DUZK 1XMOK 2VQEK 1HR0K 4JI7K 1IBLK 4DV7K 5IT9O 4LF8K 4DR3K 4LF6K 1HNZK 4YHHK 4CVNE 4DUYK 4X64K 2UUBK 2UUAK 4LF7K 4JI6K 4YY3K 4LFAK 4JI8K 4LFBK 1J5EK 4JI5K 3JAMO 2UXBK 1N34K 4GKKK 2UUCK
chains in the Genus database with same CATH superfamily
3EN9A 2VWBA 3O4NA 4M7YA 5FROA 4DSLA 3QMLA 1KD1O 4NCBA 1BCMA 4M42A 3AVCA 4V19S 1LCUA 3MN5A 3DM2A 3VEZA 4BR7A 4Q5VA 4H5RA 1Q86O 3CG7A 3QIPA 3FFKB 1TKXA 4W5OA 4WQ5C 3LWMA 2PYLA 1NK5A 3LDQA 4Z4CA 4CF1A 3J7YP 2FLOA 2H3GX 2VGMA 1N36K 4F4KA 4M3YA 4PKGA 3S3MA 1OH6A 5AJ3K 1Z05A 1D4XA 4BY9C 1U49A 2XRIA 3D0PA 1NK9A 5J1EA 5AZJB 3ENBA 4E1MA 2ASOA 1IKWA 1QSYA 2IVNA 2QWRA 4RG8A 2RE2A 3DLGA 2O8BB 4JI3K 3CFRA 1RDUA 1HYZA 1TKZA 4B9NA 1RTHA 4FM2A 4CJFA 3K0SA 1KFDA 3O3GA 1QVGM 5AQXA 1QSSA 3N4QA 3V9UA 4DQRA 2P9PB 3FZHA 3HOSA 4NXNK 2NNWA 1JLAA 4YOWA 1Z6RA 4BVOA 1QQOA 4WFNL 1K9MO 3CM5A 3DJCA 3D2FA 3LAMA 1JL1A 4Z0UA 3OA9A 3QBWA 4OPHA 4CFAA 3H3NO 4EP5A 4E89A 2AJQA 2VG6A 3BGRA 4CVNE 1F21A 4WFAL 5KRSA 1UA0A 3CFOA 3Q7CA 1BIUA 4IOXA 1RDAA 1N6QA 3QFPA 3DLHA 4OKJA 4LF7K 3A2FA 3AVJA 5DK5A 1NJXA 1XQSC 3P5JA 1J5EK 2PZSA 1DT9A 3KK2A 4L3QA 4XH5A 1ZBHA 2ZD1A 3CCMN 4CZLA 3VF6A 4B3MK 4Y1CA 1XC9A 2ASMA 4JRPA 4GW6A 4YNQA 4LF4K 3VENA 1YITN 3EL2A 3MCPA 3WNEA 4X65K 2ATQA 4IJAA 2V7YA 1VSEA 1Q82O 4J8FA 3THWB 4K8ZA 4OVLA 1RT1A 1X9WA 4FWOA 1GOBA 5C25A 3MEGA 2B4JA 2E8AA 2V51B 1CXUA 3ZEUA 1YTUA 3I8BA 3VQ9A 5JLHA 2XHBA 3LP1A 4CEBA 2IAJA 1RGIA 3HZ6A 1XHXA 1I39A 2Q3SA 4BR4A 2KFNA 4XEIA 5LJWA 3KKSA 3RMCA 3J7AP 4KH6A 3Q7BA 5AQPA 3CMEN 4MO5A 4ELVA 1RT5A 1BCOA 4M45A 4ELUA 4DR2K 4B08A 4B3TK 4OLBA 3NF8A 1T03A 4BR5A 5AQRA 3J80O 3TARA 1Q9YA 4K0KK 3KWGA 1KSPA 1Y64A 2Z1HA 3NF7A 1WUAA 3F5TA 4DR5K 5AR0A 1L5UA 3DLLL 1RDCA 2HB5A 3KHYA 4IFYA 4C1NK 3NGYA 3LDSA 3VA3A 4MLHA 1C1CA 1WSIA 1HR0K 1MDUB 4C8OA 3KZBA 4CEDA 3K57A 4JKBA 1HRHA 4GVEA 2RPIA 3OYLA 4BROA 2QI2A 1NK7A 1TYQB 1OH8A 4BRCA 2NLXA 2O8FB 1U2VA 5HRSA 3SNNA 3TAEA 4DU1A 4CJWA 4LFAK 1OH7A 4WF9L 3DXMA 3R3LA 1IG8A 2ZGYA 1EX4A 3VA0A 3VEXA 3W0LA 3MXMA 3LP3A 3IS9A 1KAXA 4JEPA 1KFSA 1T6DA 1K73O 4DF8A 3CYMA 2HVIA 2YJFA 4IKFA 3RSEB 2QW9A 3CD6N 3P31A 2V52B 4FWLA 3CC4N 3G25A 1MU2A 3L4IA 1XUPO 4WE1A 1S22A 3M5RA 2PBDA 3QETA 2A41A 3FR0A 2BUPA 5BPNA 3AAQA 2B5JA 2D0OA 1NNEA 4DF4A 1BOTO 3MN6A 2YHBA 4H5TA 3PV8A 3VOVA 4B3RK 1YJ9N 1WBBA 4L8RB 1TL3A 1C0FA 2YJEA 5GAHP 4CI6A 4LY7A 4ZTFA 1JLEA 3OYNA 1NK4A 1D8YA 1HNVA 1LAVA 4YOUA 1W2BM 3JYTA 4CGIA 2HF4A 2P9IA 3OBWA 4BC5A 3TANA 5JVGL 1ZC6A 4FZXC 3AVNA 5AQSA 2G8UA 3L4QA 4KTZA 2HVHA 3C6UA 1C1BA 3E01A 3AVIA 1LW0A 4WCEL 4DTMA 4HCCA 1BA1A 1BG3A 3C7NB 4FM0A 4R79A 3S41A 1M1KO 3WNFA 2ZM6K 1WBDA 1X3NA 3NF9A 5BRDA 3E9OA 4FOEA 4H0OA 3E9PA 2IIRA 1XMOK 4AHRA 3VGKA 4BG8A 2ITGA 2P5OA 5HOOA 2HHQA 1T05A 2OPPA 1IH7A 3OS0A 4FYDA 4RW7A 2XY7A 3ATUA 3ZT4A 1DTTA 4A2AA 3CQXA 1GLDG 2HHXA 1U6ZA 1Q81O 4M3WA 1EXQA 3HI0A 2UUCK 4CJRA 5KRTA 5ADXH 3KVGA 1OVYA 3OYIA 4K8XA 1ASVA 4H4OA 3HPGA 5KQDA 2JWLA 1TVRA 1RDBA 3U9ZA 3ID6A 4KHUA 4YFUA 2E2OA 4JKHA 3SQ4A 4BQZA 3HT3A 2G8KA 4J2AA 4DTUA 3CJ1A 4KAZA 1SZ2A 4K43A 5BN8A 5BRHA 1J5OA 4CJSA 4Y1DA 2WOMA 2HNYA 3CQ8A 2LSNA 4B8AB 1LWFA 4DV5K 5CY4A 4DSKA 1HJRA 4GV3A 4BWMA 2GEMA 4PA1A 1NK6A 1KRPA 1K8KA 4EZ6A 2P9KA 4CZMA 4B9SA 4A5BA 3CCJN 1UWBA 1NJWA 4M7XA 3PIPL 4DHYA 2IGIA 4JLHA 4JI0K 4MFBA 3G10A 3L8BA 1NGCA 5M1OA 3WQTA 3WXMB 5C10A 1HQEA 1SUQA 3O1BA 3NH1A 1VQPN 1JKHA 2FSKA 1D5AA 2NRWA 3THYB 3TI0A 4I9QA 5BPMA 2VG5A 4DR7K 2QM1A 1QQCA 3M8PA 1NJIO 4LF8K 4LC9B 2GWJA 4FLXA 3F73A 2BDPA 1SAZA 1RCHA 4TSXA 1S5JA 3EE9A 4CJ4A 4KI6A 3ZSWA 3OHRA 2ASPA 5ADXA 4CF2A 1R59O 4JKGB 1NGBA 4O5BA 2W40A 1ZBIA 1N34K 1TKTA 3C6TA 3ATVA 1E4FT 3L3VA 4DSFA 4H0TB 3LAKA 5TKYA 1NLVA 5LMNK 4LD0A 4CGJA 3ZX0A 3RR7A 3CI5A 4ICLA 1RTDA 4CCHA 1CZAN 2E6MA 2FSNA 4C8NA 5T7BA 4CJTA 3BEXA 3CIPA 3UKUA 2Q0RA 4JKCA 4FZYA 2YKMA 1NG9A 2HOEA 3V9ZA 3SYZA 1S9GA 3NDKA 3AA2A 3AVAA 1BWFO 3DXMB 1C6VA 4AHUA 2PAVA 3ID8A 4M41A 2UU9K 4A62A 1JLGA 1RBRA 4JKFA 1N8RO 3KD5E 3A5NC 4O0JA 1C0GA 1Q18A 1EWQA 3TU5A 5J2QA 2BE2A 3ULDA 2Y1JA 5K14A 1X9SA 5GIOA 4JS5A 2HMIA 1QVFM 3TAPA 4PWDA 5CZ2A 2IOCA 3OYJA 3RMBA 1XMQK 2OA8A 3GE1A 3LDOA 1GOAA 4MDBA 2QWLA 3MN7A 3HPHA 1HYSA 4CW7B 5BN9A 3NH2A 3IAYA 3GG4A 1VQKN 1FXXA 4XH1A 3KLGA 4KHQA 4CHZA 1HUXA 4CHQA 5IT9O 4ZHRA 4KTQA 5FRMA 4CBWA 1NJZA 4FLVA 4IJNA 2NZTA 4MO4A 3ZYYX 4Z4GA 5JS1A 4PKHA 3VF4A 2GWKA 3VQCA 5E41A 2ZWHA 3CJCA 4YDUA 5HL7L 5DM7L 5KPTA 4H0PA 4IO8A 3O3HA 2F9WA 5AZIA 3M8QA 1Q8IA 4JI5K 5JLFA 4OKKA 1GLCG 2P1JA 3U3YA 1QZ6A 3HSTB 3V1RA 4FK4A 3CCSN 2HHUA 3LDLA 3ENHA 4OGEA 3N4PA 4DTPA 2P9LA 1WSFA 1LWCA 1ILYA 4FWPA 3DOLA 2FF6A 4H5NA 1KC8O 2XY8A 2FXUA 3CCEN 3SBTA 4KPYA 3WEEA 1RTIA 1LWEA 3OS2A 1VQ4N 3ULEB 4CFDA 2BANA 5CE3A 4BWJA 3FE1A 3QBXA 3O8MA 4DLEA 2ITMA 4KREA 2ZF5O 2O8CA 4BR0A 2RN2A 2D4WA 4BRNA 1B9FA 3SAGA 3ZETA 3CF5L 4QCLA 1UA1A 3QNOA 2HF3A 4CK2A 4CJPA 1XHZA 1L3TA 4FVMA 4B9VA 3HM9A 1VQON 1HPZA 5EX5A 2YKNA 3TTDA 3RMDA 2E6LA 3PX6A 3LDPA 4X66K 1HKCA 1S9EA 3RTVA 2O8EA 3AO5A 4ISEA 1O1WA 3J8AA 4FPAA 4W5QA 2R7YA 4N76A 1QQNA 4FWRA 3O9SA 2Q97A 3L2VA 2GELA 1K8KB 2IS3A 3VEYA 3HVTA 4CIGA 1TKDA 4G9ZA 1VHXA 3MMVA 4H4MA 4LSNA 4DTOA 1WNSA 4CJEA 3GOIA 3LPUA 3AGRA 4NO7A 4B1YB 1YVNA 3F9MA 3SQ1A 4CD3A 4BACA 1EETA 1X3MA 2A3ZA 2QTDA 4K42A 4XH4A 3VF2A 3VQ8A 3HO1A 3KK3A 5KPZA 4Q0BA 3FZLA 4B1UB 1P8ZA 1S1VA 3HOTA 1BU6O 4ZTJA 1YXQA 3V9XA 4AM6A 1NK8A 1K8AO 2WFBA 4CEOA 4IO9L 4CJLA 1JJ2M 3AO3A 1YIJN 4E1NA 4E7HA 4E7KA 1BL3A 2VWJA 4CEQA 2ZJRL 2EHGA 3THXB 5AQYA 1HNXK 5HROA 3CC2N 3SMSA 3DXKA 3DRPA 1C0MA 3GL1A 4B9UA 2WONA 4CJKA 3VQ5A 4KHSA 3HK2A 1VAZA 1J54A 1EP4A 2YX6A 3ZSRA 1TAUA 4I7FA 1KLNA 4LF9K 4CK1A 2I7NA 3EKSA 5GIPA 2QWQA 4H8KA 3T1YK 4I6MA 2DPNA 4EHTA 3VTIA 4ELTA 1JLFA 4H0VB 4IBNA 3DLKA 3P83D 3C0BA 1S3XA 4A59A 1ZXOA 2KKZA 2GTDA 3DLRA 1U4BA 4NYFA 3D45A 5CYMA 5E26A 3MXJA 3VQ7A 3V1OA 4FJ5A 1TUYA 1L3UA 4ISFA 4DS4A 3KD1E 2Q1NA 3KLEA 4MDAA 4RW4A 4CBXA 1ATNA 4JKAA 2E1ZA 3BUZB 1BGXT 2HHTA 3HP6A 1NJYA 1WAFA 3IRXA 1TUUA 3L3UA 3HYFA 4O44A 5C42A 5BR8K 1VQLN 1VSIA 2CH5A 4OGCA 3VQ6A 3RMAA 3ZSZA 2CGKA 5KGWA 4KI4A 4I2PA 4X62K 5I3UA 1E4GT 2KTQA 2F7TA 3LZJA 4YDUC 4DUZK 5SZTA 1ATSA 3OYEA 4JRQA 4E7JA 1HPMA 3CMAN 4BRPA 5D3GA 4Z4FA 1KXPA 4WQ4A 5J2NA 3OYDA 4X64K 3QEVA 1BI4B 2FSJA 1C0UA 4IG3A 3CJBA 3JSMA 3CXCM 3PSFA 4HHTA 4JI6K 1NGIA 4CECA 4FK0A 4DTRA 2KFZA 2X6SA 3SLCA 1VQ9N 3DWLA 4KRFA 2ZGZA 5F1XA 2P9UA 2BGGA 3NVKA 3U8XA 1VSKA 3UKRB 4Y0WA 4BVPA 4CFBA 2HNDA 2O8DA 3TWHA 3ZT2A 4DR6K 1TK5A 1XNRK 2E1YA 2ZE2A 4CHNA 4N41A 1NMDA 3RWUA 5AQWA 4FJHA 1B92A 3TTCA 3G6EN 3UE5A 5JS2A 1RBTA 4YOTA 4F2RA 4M63C 1UAXA 3B8AX 3O3FA 3L2WA 4E7LA 2KW4A 3EKUA 2NRTA 4JNEA 3S9HA 3AO2A 3MK6A 2NUBA 1WSEA 3VQAA 4MQ3A 1WB9A 5AZIB 3QIOA 3OY9A 1DLOA 4PY5A 3HBTA 4CJ7A 3PUFA 4CD1A 2QWNA 4N47A 4CE9A 1S1UA 4B3SK 2UXCK 1LOTB 4FWQA 2FF3B 2W41A 3FZKA 4JHDB 3K5OA 2D1KA 3OYGA 4FXDA 5HRRA 2A42A 3MCAB 3KTQA 3H46O 1IBMK 1VSDA 5HLFA 1VRUA 4DTXA 1VSMA 2X78A 4RW8A 5FLXO 1Q9XA 2A5XA 3S3OA 1SL1A 4LSLA 4O0IA 2DFEA 2Y1IA 1NKBA 5M1FA 5BPLA 3OJUA 3VESA 4DTNA 4HUFA 4NLBA 1WSHA 2A6AA 4JK9A 4F3OA 4JKEA 4DV7K 2YI1A 1CZBA 4BC3A 5AQKA 1JLBA 3KJVA 1YI2N 4OKEA 3AVFA 4CJ3A 3BZKA 3DOKA 3CJAA 4O55A 4FWNA 3CPWM 2OTLN 3V1QA 2E2NA 1DGKN 2PFUA 3VPZA 4DLGA 3VGMA 1DEJA 2IVOA 3NAEA 1M90O 3MX2A 4I9LA 3O80A 4CEZA 5AQLA 4GY2B 1RT7A 1JLQA 4JD2A 3ZSXA 4UQGA 4FJNA 3OVNA 5B8HA 2QWOA 1LV5A 1NOYA 2E2QA 1S72N 4FJ9A 4YORA 3FZMA 5BR9A 4KFBA 2OPQA 4FJ8A 4B1XB 1HKBA 1E3MA 1NGGA 3OYAA 4AILC 1IKYA 4RW9A 3LP0A 3DI6A 2YHWA 4FJ7A 2HBJA 4CESA 1VQ6N 3O9UA 1QZ5A 2P9SA 3SCXA 3MDQA 1NOZA 1LAWA 2VWKA 3SJJA 2QKKA 3MECA 2IVPA 4FJKA 1JCEA 3KIOA 3D7EO 3EYZA 4J2BA 4BREA 1GLLO 2GUPA 2UYTA 3D2FB 4EP4A 1H1VA 3D6RA 2QXFA 4JI2K 2D0BA 2P5GA 3K9KA 3SUOA 2D0AA 3IDHA 3ZX3A 3KLFA 3WXJA 5BREA 3VQQA 3DXKB 4BG9A 2UXDK 5AQIA 5A2QO 2JWKA 3O4QA 3RR8A 1IKVA 3DYAA 4CIFA 4JK8A 4DR1K 2Z1JA 3R9PA 3CERA 4WQ4C 4FSVA 4EZ9A 4PQUA 2HHSA 1A5XA 3CJ7A 4QAGA 4FCYA 4GV6A 3CCVN 1ZBFA 1O13A 5AZJA 1N33K 4W5RA 3ZCMA 4CHYA 1SKWA 2NRHA 4DFPA 4BRFA 3WUHA 1TL1A 3K59A 3G71N 1YTAA 1EQYA 3TR8A 4YHHK 2AA4A 2XY5A 2IC3A 3MEEA 2O4GA 4CF8A 1SL0A 2O8BA 2YNGA 2OTJN 4ILJA 1BQMA 2PY5A 4BRHA 3MWTA 3ZEUB 3IFRA 3BZCA 4BDPA 4KO0A 3TSQA 1U47A 4GKKK 2P9PA 4H5WA 4FWMA 1YT3A 4K25A 4UY8O 4IOCL 3IMXA 4BRAA 3EE8A 3I8DA 4JI4K 1KVCA 3W3DA 1B9DA 1U45A 5CYQA 4RWTA 3QDKA 3ASMA 4ID5A 4FZZA 4DQPA 1JXEA 2NRZA 3AARA 5F2RA 4E19A 3HXMA 1SKSA 4HUEA 5SWMA 3NFAA 3MX5A 4HWIA 1RBVA 3LWLA 1Z25A 4Z4IA 2FBYA 1VQ8N 5FPDA 4OJRA 4A61A 3FGUA 1XNQK 1YJWN 1W7AA 3R8EA 3DRRA 3MAQA 3V9SA 5C0YA 1VSHA 1VQMN 3NVMA 3P38A 5EVZA 4JK7A 3T1HK 1Q7YO 4DMNA 1RT3A 3BF3A 4DKWA 1U2VB 4LH4A 2RF2A 3FZFA 3LZIA 2Z1GA 4FLTA 3OYFA 4CK3A 1N5YA 2VQFK 3LP2A 3QINA 4DFMA 2AP1A 5JMVA 4OPKA 4H0YB 2W42A 4N5SA 4CZJA 1C0TA 3A0IX 4JI7K 2ZJQL 3BDPA 4J2DA 3VERA 3SAFA 2YV0X 3AVGA 5M1KA 5AQOA 3NF6A 4DUYK 2G8FA 1RDDA 2QWPA 4C8MA 1GLEG 4DQQA 1EKEA 4JKDA 2G8HA 2QXLA 4RCHA 4BRLA 1GLFO 3OS1A 3T7ZA 4KHNA 5J2PA 3BY5A 3AGKA 4NLCA 3KLIA 1JCGA 4QS7A 3PY8A 4DS5A 2UXBK 3QEIA 3ISNC 3ZT0A 4GNIA 4DR4K 3QB0A 3VETA 5EY4A 3LM9A 1KQSM 3O9RA 2EX3A 3H3OB 3C6AA 3V81A 1BISA 4IOAL 4AHCA 4AQYK 3OYKA 5KPRA 3QESA 1UOCA 3CPEA 3LALA 2P9IB 4PUOA 3L2UA 2DY4A 5H1SQ 2P9NA 1TYQA 4DV0K 4DU3A 5GAEP 4BRMA 4FJLA 1VSFA 3B6PA 1HKGA 1FW6A 1HQUA 3NH0A 2QA4N 4B8CA 1G15A 1T7PA 1FK9A 3PSIA 2KQ2A 3TABA 4NCAA 4GKJK 3AA5X 1DTQA 4E7IA 4KHYA 3RSEA 3U3GA 5I42A 4ILGB 1IV0A 4J2EA 1J53A 1ZBLA 3CETA 1RBUA 5DMRA 2HSTA 3H1VX 5AQVA 2JGUA 1CLQA 1MWMA 2A1RA 4LH5A 1YAGA 1GLJO 3NHGA 3AVLA 4JYAK 3F9KA 4BRIA 3SUNA 4IG0A 1WSJA 2B6AA 2QWMA 4DSIA 3DMJA 4CGGA 2VG7A 2ZJPL 3EZ5A 3VQBA 3CCLN 3SV4A 2KZMA 4OPJA 4DR3K 4DCHA 1V4TA 3ZSYA 3I55N 3V9WA 3LPTA 1W9HA 2F9TA 3VEWA 3CM6A 3WT0A 3I0RA 3KK7A 2Q36A 1SS6A 2DTUA 3NBPA 4Z94A 1SL2A 3G4SN 5HBMA 4YY3K 3VEOA 1VQNN 4BDYA 5EU7A 3WNHA 3CCQN 5HRPA 3A5OC 4GMJB 5GAGP 2OYQA 4BRGA 4ID1A 1OKJA 3C7NA 1FJGK 3DAWA 5M1QA 2P9KB 1L3SA 3L2QA 1XI1A 4FK2A 3AO4A 3B6OA 4KV8A 2E2PA 1JCFA 4BQLA 4CZIA 5FPEA 1LW2A 3NCIA 3CCUN 3VQEA 4CIEA 1RT2A 4CZFA 5LJVA 1X9MA 1NK0A 3CHWA 1XC3A 3L2RA 4IDKA 3O4WA 3AA4A 2NRXA 4BE1A 4HTUA 1TK0A 2Q0UA 1NGFA 2FC0A 1QHTA 4BC2A 3ALYA 5FPNA 2VCPA 4E3SA 3VQPA 3ZT1A 2HW3A 1U48A 3ENOA 3QICA 4CJUA 4DFKA 3SQ0A 1K6YA 1OVQA 4KHWA 5AFUH 3I0SA 2GX9A 2G8WA 4FW2A 3RVCA 2I5JA 5M1PA 3CCRN 3J7ZO 3HPOA 5ELZA 3DLBA 1BHLA 4B3OA 4A2BA 3O5BA 4F2SA 4KH5A 4FL9A 4PL7A 3K58A 3WXIA 3TAFA 3SPYA 4AHSA 3DRSA 1GOCA 3K5LA 4M3XA 1RT6A 3NGIA 3S3NA 3D2EA 4FPBA 3VQ4A 4JI1K 1SV5A 4WYBA 4B9LA 1ASUA 1U04A 1VRTA 3QLHA 5AQGA 5AQMA 4CZEA 4M3TA 2VQEK 3M8RA 1IBLK 2HBMA 2WUSA 4JAXA 1ASWA 1HNZK 2CGLA 4OLAA 3LDNA 2RKIA 4DG1A 4BE2A 3M3ZA 4FWSA 1HNIA 1RILA 3UKUB 3ZT3A 3HP9A 4A57A 3JS6A 1ZBSA 4O8UA 3HM8A 1T44A 4G1QA 3EO3A 3SQ2A 5AQUA 3AY9A 4E0DA 1S6PA 2ETJA 3A5LC 3QEWA 1NGDA 2GUIA 4H0XB 5C12A 5IWAK 1A5VA 5HRNA 1X9JA 5KI6A 3THYA 4FO0A 2Q31A 3HJFA 2FBVA 2G8VA 3TTFA 3TSPA 2HMPA 5GINA 4YOYA 1WN7A 3PX4A 2PYJA 5EOYA 4IEEA 1MA9B 4GV9A 1KTQA 4DQ8A 4DV6K 3G0ZA 2QEXN 5GADP 3MXIA 2FBTA 3GDQA 4CHOA 1JLCA 3SMPA 1HMVA 1N32K 1S6QA 1NU0A 5AFUA 4DQIA 3KKRA 4JKGA 4B1WB 1S1TA 3R6MA 5J2MA 3SUPA 1NWKA 3PO5A 3QEXA 5C2DA 4DSEA 4CFCA 2E5LK 1A5WA 4DWIA 4KTWA 3UIQA 2D5RA 4JN4A 1VSJA 2E88A 3OYCA 4I2QA 4K41A 1TGOA 3O6WA 1QTMA 4CBUA 1KVBA 2WBNA 3SK3A 5LMUK 2P9NB 1HX1A 4F9OA 3LM2A 4W5NA 2HHVA 4FJGA 3V6DA 3THVA 4M3ZA 3CJ9A 2HHHK 1ZYQA 4ILHA 1NKEA 1NBWA 2OPRA 1KLMA 1VK0A 2F8SA 3H1QA 3HL8A 4CEFA 1CXQA 2A1SA 1IKXA 2P9LB 3WQUA 3OYMA 3A5MC 4HUGA 2YNFA 4FJJA 4C23A 4BC4A 1IG9A 5FPMA 2NRVA 3IUCA 3VEVA 4Z4HA 3VTHA 3WEEB 5F0XA 5MLCQ 3O08A 3WXKA 1NGJA 4JI8K 1HYVA 4LFBK 3WNGA 4KB0A 3L0QA 3JAMO 2O8CB 2D0CA 3PLAA 2HHWA 3ZETB 1T3VA 1NGHA 3CC7N 3AAPA 4FWKA 4O4GA 3C6HA 4ISGA 5LL6Z 1NM1A 1DKGD 4FLUA 2P51A 3DLEA 1WLJA 3NE6A 4XIUA 1BO5O 3NGZA 3E1YA 3KLHA 2X6NA 3OYHA 3HVRA 4KBOA 2VGNA 3J81O 3TPQA 5AQNA 1IBKK 2O8EB 2HBKA 2I7PA 5KTQA 4JS4A 4B1ZA 4DV2K 1JXBA 4CHPA 5JICA 3R1XA 4IWVA 4EAHD 4EFHA 3E9LA 3IG1A 2BTFA 4QOZB 1ESVA 1FKPA 3P39A 3EY1A 1BQNA 3ZSQA 2YHAA 1IJJA 1VSLA 3E66A 1NGAA 4PKIA 4DB3A 3V4IA 2OZSA 4FLWA 1WAJA 1J9AA 2NRRA 5KQ8A 4Z4EA 1BA0A 3VGLA 4FW1A 3LANA 3VN5A 4DU4A 5HP1A 1T8EA 1MWKA 5CHIA 1Y97A 4KH4A 3BP8A 2BH1A 2YCHA 1T6CA 1REVA 3ULEA 4CEAA 4C8KA 4CJQA 4MLEA 3QEPA 3H08A 2XY6A 1WSGA 1RDWX 2F8TA 4EHUA 3T69A 1D9FA 1RTJA 2ZQBA 2Q2RA 3AVKA 3GBTA 4IFEA 3EZWA 4IXCA 5C24A 1YJNN 4IFVA 2QKBA 4OO1J 4I6MB 1W0HA 3K5MA 2KLAA 4FVUA 3K5NA 2DFHA 2OANA 3SBGA 4CERA 4CJ5A 3H6EA 2DFFA 3I56N 3RRGA 3QFUA 1Z26A 3ZLJA 3D2EB 4DSJA 4LF5K 1NMNA 3AO1A 3M8SA 3M6GA 4FJXA 3HSCA 1BDGA 2JLEA 3C65A 3P4IA 4IDHA 3RRHA 1X1PA 4BGBA 4BE0A 1KVAA 4KHPK 2YHXA 2OCEA 4BGAA 3SUQA 2GBZA 4BR2A 3M1FA 1IO2A 4PL8A 2KZZA 4RW6A 5JVHL 2YNIA 2X74A 1BIZA 3U9DA 1L3VA 1YVUA 3PIOL 3BF1A 3L6QA 1XWLA 3OYBA 3AVBA 2QK9A 1YF5L 4E1JA 3LL3A 2WC9A 3JXUA 3KK1A 4CGFA 4WQ5A 5FDLA 3MEDA 4IZ9A 3OW2M 3T19A 1W97L 3P1GA 4GVMA 4CEEA 2HBLA 5AQFA 4JV5K 3TAQA 3AVHA 2WTUA 3CFPA 1QE1A 4DTSA 4AHTA 3ZX2A 2O4IA 2GV9A 3THXA 4BRKA 5FRNA 5I9EB 1VQ5N 1QS4A 2W6KA 3SI6A 1NGEA 4YOVA 2Z1IA 1S1XA 1QHAA 3PO4A 3AVMA 2P9UB 3TSUA 1R0AA 4OX9K 4CGHA 4AM7A 4CZHA 4HVJA 1J6ZA 2O8DB 4U7BA 3TAMA 4HTLA 3IKMA 3I33A 5BRFA 1KAYA 1I94K 2CH6A 3T1AA 4CF9A 2D0PA 1C1AA 4CF0A 1D9DA 3CQYA 4CZGA 3K2PA 3T3FA 4C8LA 4FM1A 1P90A 1ATRA 3UB5A 1TK8A 4RTFD 5EXWA 3SJHA 2XO7A 3KWIA 1TAQA 3THWA 4EIAA 2YHYA 1VQ7N 5C15A 3O9QA 3OBYA 2UUBK 2VYPA 2G8IA 4QS9A 4BRQA 4O8KA 5AQZA 3PX0A 5DM6L 2OZMA 2E20A 1RT4A 5AQQA 1QQMA 4F8RA 4B9TA 1ZBUA 4B9MA 5KGXA 1ITGA 4FOIA 1KAZA 3MN9A 3SV3A 3OTOK 2YNHA 2HNZA 1JL2A 1WOQA 1V4SA 3HRGA 5CZ1A 4DV4K 3A8YA 4BRDA 4FJMA 3AV9A 3SZ2A 1OH5A 3SAHA 4WFBL 3C94A 3C95A 1I3AA 3QO9A 2KHOA 2IDOA 3F2KA 3ITHA 4DV3K 4NB4A 1BI4A 4KKOA 4AF1A 4DV1K 5TKWA 4OPAA 3OJSA 1CZ9A 4N56A 3NMUA 5E84A 1NKCA 4PHTX 1SQKA 1EO1A 4IEIA 3K9JA 4FJIA 2FBXA 3ZSOA 1KCFA 3UKRA 1HNWK 4B9QA 4F3TA 2J4RA 2W6LA 3HTVA 1S1WA 5AQTA 5CR4A 1EWRA 5AQHA 4M3UA 4DTJA 2F96A 3AA3A 4BR9A 2CGJA 3U6FA 3ZSVA 2O8FA 1G99A 1GLAG 3FFIA 4H03B 4NXMK 4U67L 4W5TA 2V7ZA 1RNHA 1TV6A 3O1WA 1RFQA 4JD2B 2F4VK 1HJOA 2EWSA 4FLYA 3EEQA 3H45C 1QSLA 4LFCK 3O9TA 4KB1A 4DQSA 4NCGA 4HCBA 4A5AA 3QNNA 1FKOA 2OPSA 3VQDA 4AH9A 1GLBG 3QERA 4LF6K 4AHVA 4C1NI 4O5FA 1YUWA 2RHKA 1RBSA 4JHDA 4BDZA 4FLZA 2A40A 1HLUA 5C2FA 1BUPA 3SPZA 2P9SB 4B1VA 4H5VA 4DFJA 3TAGA 1YHQN 3FLCO 5M1NA 5AQJA 4YOXA 4CGDA 2UUAK 3VMFB 4QS8A 4NYNA 3MWPA 3WXLA 4R5PA 4CZKA 4M3RA 1SKRA 2E4LA 3U4LA 4CJVA 5LY3A
chains in the Genus database with same CATH topology
4LF5K 4B3MK 4DR4K 4DR6K 1FJGK 1XNRK 5IWAK 4LF4K 3OTOK 5LMNK 4V19S 4JI4K 5LL6Z 4AQYK 4DV4K 1HNXK 4X65K 4KHPK 4DV6K 3J7YP 4DV0K 1N36K 1N32K 4DV3K 3J81O 1IBKK 5AJ3K 4LF9K 4DV1K 3T1YK 4DV2K 2UU9K 4DV5K 4B3RK 4B3SK 1HNWK 1XNQK 4JV5K 2UXCK 4JI2K 4GKJK 3J7AP 2E5LK 3T1HK 4JI3K 4DR2K 4B3TK 1IBMK 2UXDK 4JI0K 3J80O 4NXMK 1XMQK 5A2QO 2VQFK 5LMUK 5FLXO 4K0KK 5BR8K 4DR1K 4OX9K 2F4VK 4X66K 2HHHK 4DR5K 4LFCK 4NXNK 4JI1K 4CW7B 4JYAK 4X62K 2ZM6K 1I94K 4DR7K 1N33K 4DUZK 1XMOK 2VQEK 1HR0K 4JI7K 1IBLK 4DV7K 5IT9O 4LF8K 4DR3K 4LF6K 1HNZK 4YHHK 4CVNE 4DUYK 4X64K 2UUBK 2UUAK 4LF7K 4JI6K 4YY3K 4LFAK 4JI8K 4LFBK 1J5EK 4JI5K 3JAMO 2UXBK 1N34K 4GKKK 2UUCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 K;  4B3M K;  4DR4 K;  4DR6 K;  1FJG K;  1XNR K;  5IWA K;  4LF4 K;  3OTO K;  5LMN K;  4V19 S;  4JI4 K;  5LL6 Z;  4AQY K;  4DV4 K;  1HNX K;  4X65 K;  4KHP K;  4DV6 K;  3J7Y P;  4DV0 K;  1N36 K;  1N32 K;  4DV3 K;  3J81 O;  1IBK K;  5AJ3 K;  4LF9 K;  4DV1 K;  3T1Y K;  4DV2 K;  2UU9 K;  4DV5 K;  4B3R K;  4B3S K;  1HNW K;  1XNQ K;  4JV5 K;  2UXC K;  4JI2 K;  4GKJ K;  3J7A P;  2E5L K;  3T1H K;  4JI3 K;  4DR2 K;  4B3T K;  1IBM K;  2UXD K;  4JI0 K;  3J80 O;  4NXM K;  1XMQ K;  5A2Q O;  2VQF K;  5LMU K;  5FLX O;  4K0K K;  5BR8 K;  4DR1 K;  4OX9 K;  2F4V K;  4X66 K;  2HHH K;  4DR5 K;  4LFC K;  4NXN K;  4JI1 K;  4CW7 B;  4JYA K;  4X62 K;  2ZM6 K;  1I94 K;  4DR7 K;  1N33 K;  4DUZ K;  1XMO K;  2VQE K;  1HR0 K;  4JI7 K;  1IBL K;  4DV7 K;  5IT9 O;  4LF8 K;  4DR3 K;  4LF6 K;  1HNZ K;  4YHH K;  4CVN E;  4DUY K;  4X64 K;  2UUB K;  2UUA K;  4LF7 K;  4JI6 K;  4YY3 K;  4LFA K;  4JI8 K;  4LFB K;  1J5E K;  4JI5 K;  3JAM O;  2UXB K;  1N34 K;  4GKK K;  2UUC K; 
#chains in the Genus database with same CATH topology
 3EN9 A;  2VWB A;  3O4N A;  4M7Y A;  5FRO A;  4DSL A;  3QML A;  1KD1 O;  4NCB A;  1BCM A;  4M42 A;  3AVC A;  4V19 S;  1LCU A;  3MN5 A;  3DM2 A;  3VEZ A;  4BR7 A;  4Q5V A;  4H5R A;  1Q86 O;  3CG7 A;  3QIP A;  3FFK B;  1TKX A;  4W5O A;  4WQ5 C;  3LWM A;  2PYL A;  1NK5 A;  3LDQ A;  4Z4C A;  4CF1 A;  3J7Y P;  2FLO A;  2H3G X;  2VGM A;  1N36 K;  4F4K A;  4M3Y A;  4PKG A;  3S3M A;  1OH6 A;  5AJ3 K;  1Z05 A;  1D4X A;  4BY9 C;  1U49 A;  2XRI A;  3D0P A;  1NK9 A;  5J1E A;  5AZJ B;  3ENB A;  4E1M A;  2ASO A;  1IKW A;  1QSY A;  2IVN A;  2QWR A;  4RG8 A;  2RE2 A;  3DLG A;  2O8B B;  4JI3 K;  3CFR A;  1RDU A;  1HYZ A;  1TKZ A;  4B9N A;  1RTH A;  4FM2 A;  4CJF A;  3K0S A;  1KFD A;  3O3G A;  1QVG M;  5AQX A;  1QSS A;  3N4Q A;  3V9U A;  4DQR A;  2P9P B;  3FZH A;  3HOS A;  4NXN K;  2NNW A;  1JLA A;  4YOW A;  1Z6R A;  4BVO A;  1QQO A;  4WFN L;  1K9M O;  3CM5 A;  3DJC A;  3D2F A;  3LAM A;  1JL1 A;  4Z0U A;  3OA9 A;  3QBW A;  4OPH A;  4CFA A;  3H3N O;  4EP5 A;  4E89 A;  2AJQ A;  2VG6 A;  3BGR A;  4CVN E;  1F21 A;  4WFA L;  5KRS A;  1UA0 A;  3CFO A;  3Q7C A;  1BIU A;  4IOX A;  1RDA A;  1N6Q A;  3QFP A;  3DLH A;  4OKJ A;  4LF7 K;  3A2F A;  3AVJ A;  5DK5 A;  1NJX A;  1XQS C;  3P5J A;  1J5E K;  2PZS A;  1DT9 A;  3KK2 A;  4L3Q A;  4XH5 A;  1ZBH A;  2ZD1 A;  3CCM N;  4CZL A;  3VF6 A;  4B3M K;  4Y1C A;  1XC9 A;  2ASM A;  4JRP A;  4GW6 A;  4YNQ A;  4LF4 K;  3VEN A;  1YIT N;  3EL2 A;  3MCP A;  3WNE A;  4X65 K;  2ATQ A;  4IJA A;  2V7Y A;  1VSE A;  1Q82 O;  4J8F A;  3THW B;  4K8Z A;  4OVL A;  1RT1 A;  1X9W A;  4FWO A;  1GOB A;  5C25 A;  3MEG A;  2B4J A;  2E8A A;  2V51 B;  1CXU A;  3ZEU A;  1YTU A;  3I8B A;  3VQ9 A;  5JLH A;  2XHB A;  3LP1 A;  4CEB A;  2IAJ A;  1RGI A;  3HZ6 A;  1XHX A;  1I39 A;  2Q3S A;  4BR4 A;  2KFN A;  4XEI A;  5LJW A;  3KKS A;  3RMC A;  3J7A P;  4KH6 A;  3Q7B A;  5AQP A;  3CME N;  4MO5 A;  4ELV A;  1RT5 A;  1BCO A;  4M45 A;  4ELU A;  4DR2 K;  4B08 A;  4B3T K;  4OLB A;  3NF8 A;  1T03 A;  4BR5 A;  5AQR A;  3J80 O;  3TAR A;  1Q9Y A;  4K0K K;  3KWG A;  1KSP A;  1Y64 A;  2Z1H A;  3NF7 A;  1WUA A;  3F5T A;  4DR5 K;  5AR0 A;  1L5U A;  3DLL L;  1RDC A;  2HB5 A;  3KHY A;  4IFY A;  4C1N K;  3NGY A;  3LDS A;  3VA3 A;  4MLH A;  1C1C A;  1WSI A;  1HR0 K;  1MDU B;  4C8O A;  3KZB A;  4CED A;  3K57 A;  4JKB A;  1HRH A;  4GVE A;  2RPI A;  3OYL A;  4BRO A;  2QI2 A;  1NK7 A;  1TYQ B;  1OH8 A;  4BRC A;  2NLX A;  2O8F B;  1U2V A;  5HRS A;  3SNN A;  3TAE A;  4DU1 A;  4CJW A;  4LFA K;  1OH7 A;  4WF9 L;  3DXM A;  3R3L A;  1IG8 A;  2ZGY A;  1EX4 A;  3VA0 A;  3VEX A;  3W0L A;  3MXM A;  3LP3 A;  3IS9 A;  1KAX A;  4JEP A;  1KFS A;  1T6D A;  1K73 O;  4DF8 A;  3CYM A;  2HVI A;  2YJF A;  4IKF A;  3RSE B;  2QW9 A;  3CD6 N;  3P31 A;  2V52 B;  4FWL A;  3CC4 N;  3G25 A;  1MU2 A;  3L4I A;  1XUP O;  4WE1 A;  1S22 A;  3M5R A;  2PBD A;  3QET A;  2A41 A;  3FR0 A;  2BUP A;  5BPN A;  3AAQ A;  2B5J A;  2D0O A;  1NNE A;  4DF4 A;  1BOT O;  3MN6 A;  2YHB A;  4H5T A;  3PV8 A;  3VOV A;  4B3R K;  1YJ9 N;  1WBB A;  4L8R B;  1TL3 A;  1C0F A;  2YJE A;  5GAH P;  4CI6 A;  4LY7 A;  4ZTF A;  1JLE A;  3OYN A;  1NK4 A;  1D8Y A;  1HNV A;  1LAV A;  4YOU A;  1W2B M;  3JYT A;  4CGI A;  2HF4 A;  2P9I A;  3OBW A;  4BC5 A;  3TAN A;  5JVG L;  1ZC6 A;  4FZX C;  3AVN A;  5AQS A;  2G8U A;  3L4Q A;  4KTZ A;  2HVH A;  3C6U A;  1C1B A;  3E01 A;  3AVI A;  1LW0 A;  4WCE L;  4DTM A;  4HCC A;  1BA1 A;  1BG3 A;  3C7N B;  4FM0 A;  4R79 A;  3S41 A;  1M1K O;  3WNF A;  2ZM6 K;  1WBD A;  1X3N A;  3NF9 A;  5BRD A;  3E9O A;  4FOE A;  4H0O A;  3E9P A;  2IIR A;  1XMO K;  4AHR A;  3VGK A;  4BG8 A;  2ITG A;  2P5O A;  5HOO A;  2HHQ A;  1T05 A;  2OPP A;  1IH7 A;  3OS0 A;  4FYD A;  4RW7 A;  2XY7 A;  3ATU A;  3ZT4 A;  1DTT A;  4A2A A;  3CQX A;  1GLD G;  2HHX A;  1U6Z A;  1Q81 O;  4M3W A;  1EXQ A;  3HI0 A;  2UUC K;  4CJR A;  5KRT A;  5ADX H;  3KVG A;  1OVY A;  3OYI A;  4K8X A;  1ASV A;  4H4O A;  3HPG A;  5KQD A;  2JWL A;  1TVR A;  1RDB A;  3U9Z A;  3ID6 A;  4KHU A;  4YFU A;  2E2O A;  4JKH A;  3SQ4 A;  4BQZ A;  3HT3 A;  2G8K A;  4J2A A;  4DTU A;  3CJ1 A;  4KAZ A;  1SZ2 A;  4K43 A;  5BN8 A;  5BRH A;  1J5O A;  4CJS A;  4Y1D A;  2WOM A;  2HNY A;  3CQ8 A;  2LSN A;  4B8A B;  1LWF A;  4DV5 K;  5CY4 A;  4DSK A;  1HJR A;  4GV3 A;  4BWM A;  2GEM A;  4PA1 A;  1NK6 A;  1KRP A;  1K8K A;  4EZ6 A;  2P9K A;  4CZM A;  4B9S A;  4A5B A;  3CCJ N;  1UWB A;  1NJW A;  4M7X A;  3PIP L;  4DHY A;  2IGI A;  4JLH A;  4JI0 K;  4MFB A;  3G10 A;  3L8B A;  1NGC A;  5M1O A;  3WQT A;  3WXM B;  5C10 A;  1HQE A;  1SUQ A;  3O1B A;  3NH1 A;  1VQP N;  1JKH A;  2FSK A;  1D5A A;  2NRW A;  3THY B;  3TI0 A;  4I9Q A;  5BPM A;  2VG5 A;  4DR7 K;  2QM1 A;  1QQC A;  3M8P A;  1NJI O;  4LF8 K;  4LC9 B;  2GWJ A;  4FLX A;  3F73 A;  2BDP A;  1SAZ A;  1RCH A;  4TSX A;  1S5J A;  3EE9 A;  4CJ4 A;  4KI6 A;  3ZSW A;  3OHR A;  2ASP A;  5ADX A;  4CF2 A;  1R59 O;  4JKG B;  1NGB A;  4O5B A;  2W40 A;  1ZBI A;  1N34 K;  1TKT A;  3C6T A;  3ATV A;  1E4F T;  3L3V A;  4DSF A;  4H0T B;  3LAK A;  5TKY A;  1NLV A;  5LMN K;  4LD0 A;  4CGJ A;  3ZX0 A;  3RR7 A;  3CI5 A;  4ICL A;  1RTD A;  4CCH A;  1CZA N;  2E6M A;  2FSN A;  4C8N A;  5T7B A;  4CJT A;  3BEX A;  3CIP A;  3UKU A;  2Q0R A;  4JKC A;  4FZY A;  2YKM A;  1NG9 A;  2HOE A;  3V9Z A;  3SYZ A;  1S9G A;  3NDK A;  3AA2 A;  3AVA A;  1BWF O;  3DXM B;  1C6V A;  4AHU A;  2PAV A;  3ID8 A;  4M41 A;  2UU9 K;  4A62 A;  1JLG A;  1RBR A;  4JKF A;  1N8R O;  3KD5 E;  3A5N C;  4O0J A;  1C0G A;  1Q18 A;  1EWQ A;  3TU5 A;  5J2Q A;  2BE2 A;  3ULD A;  2Y1J A;  5K14 A;  1X9S A;  5GIO A;  4JS5 A;  2HMI A;  1QVF M;  3TAP A;  4PWD A;  5CZ2 A;  2IOC A;  3OYJ A;  3RMB A;  1XMQ K;  2OA8 A;  3GE1 A;  3LDO A;  1GOA A;  4MDB A;  2QWL A;  3MN7 A;  3HPH A;  1HYS A;  4CW7 B;  5BN9 A;  3NH2 A;  3IAY A;  3GG4 A;  1VQK N;  1FXX A;  4XH1 A;  3KLG A;  4KHQ A;  4CHZ A;  1HUX A;  4CHQ A;  5IT9 O;  4ZHR A;  4KTQ A;  5FRM A;  4CBW A;  1NJZ A;  4FLV A;  4IJN A;  2NZT A;  4MO4 A;  3ZYY X;  4Z4G A;  5JS1 A;  4PKH A;  3VF4 A;  2GWK A;  3VQC A;  5E41 A;  2ZWH A;  3CJC A;  4YDU A;  5HL7 L;  5DM7 L;  5KPT A;  4H0P A;  4IO8 A;  3O3H A;  2F9W A;  5AZI A;  3M8Q A;  1Q8I A;  4JI5 K;  5JLF A;  4OKK A;  1GLC G;  2P1J A;  3U3Y A;  1QZ6 A;  3HST B;  3V1R A;  4FK4 A;  3CCS N;  2HHU A;  3LDL A;  3ENH A;  4OGE A;  3N4P A;  4DTP A;  2P9L A;  1WSF A;  1LWC A;  1ILY A;  4FWP A;  3DOL A;  2FF6 A;  4H5N A;  1KC8 O;  2XY8 A;  2FXU A;  3CCE N;  3SBT A;  4KPY A;  3WEE A;  1RTI A;  1LWE A;  3OS2 A;  1VQ4 N;  3ULE B;  4CFD A;  2BAN A;  5CE3 A;  4BWJ A;  3FE1 A;  3QBX A;  3O8M A;  4DLE A;  2ITM A;  4KRE A;  2ZF5 O;  2O8C A;  4BR0 A;  2RN2 A;  2D4W A;  4BRN A;  1B9F A;  3SAG A;  3ZET A;  3CF5 L;  4QCL A;  1UA1 A;  3QNO A;  2HF3 A;  4CK2 A;  4CJP A;  1XHZ A;  1L3T A;  4FVM A;  4B9V A;  3HM9 A;  1VQO N;  1HPZ A;  5EX5 A;  2YKN A;  3TTD A;  3RMD A;  2E6L A;  3PX6 A;  3LDP A;  4X66 K;  1HKC A;  1S9E A;  3RTV A;  2O8E A;  3AO5 A;  4ISE A;  1O1W A;  3J8A A;  4FPA A;  4W5Q A;  2R7Y A;  4N76 A;  1QQN A;  4FWR A;  3O9S A;  2Q97 A;  3L2V A;  2GEL A;  1K8K B;  2IS3 A;  3VEY A;  3HVT A;  4CIG A;  1TKD A;  4G9Z A;  1VHX A;  3MMV A;  4H4M A;  4LSN A;  4DTO A;  1WNS A;  4CJE A;  3GOI A;  3LPU A;  3AGR A;  4NO7 A;  4B1Y B;  1YVN A;  3F9M A;  3SQ1 A;  4CD3 A;  4BAC A;  1EET A;  1X3M A;  2A3Z A;  2QTD A;  4K42 A;  4XH4 A;  3VF2 A;  3VQ8 A;  3HO1 A;  3KK3 A;  5KPZ A;  4Q0B A;  3FZL A;  4B1U B;  1P8Z A;  1S1V A;  3HOT A;  1BU6 O;  4ZTJ A;  1YXQ A;  3V9X A;  4AM6 A;  1NK8 A;  1K8A O;  2WFB A;  4CEO A;  4IO9 L;  4CJL A;  1JJ2 M;  3AO3 A;  1YIJ N;  4E1N A;  4E7H A;  4E7K A;  1BL3 A;  2VWJ A;  4CEQ A;  2ZJR L;  2EHG A;  3THX B;  5AQY A;  1HNX K;  5HRO A;  3CC2 N;  3SMS A;  3DXK A;  3DRP A;  1C0M A;  3GL1 A;  4B9U A;  2WON A;  4CJK A;  3VQ5 A;  4KHS A;  3HK2 A;  1VAZ A;  1J54 A;  1EP4 A;  2YX6 A;  3ZSR A;  1TAU A;  4I7F A;  1KLN A;  4LF9 K;  4CK1 A;  2I7N A;  3EKS A;  5GIP A;  2QWQ A;  4H8K A;  3T1Y K;  4I6M A;  2DPN A;  4EHT A;  3VTI A;  4ELT A;  1JLF A;  4H0V B;  4IBN A;  3DLK A;  3P83 D;  3C0B A;  1S3X A;  4A59 A;  1ZXO A;  2KKZ A;  2GTD A;  3DLR A;  1U4B A;  4NYF A;  3D45 A;  5CYM A;  5E26 A;  3MXJ A;  3VQ7 A;  3V1O A;  4FJ5 A;  1TUY A;  1L3U A;  4ISF A;  4DS4 A;  3KD1 E;  2Q1N A;  3KLE A;  4MDA A;  4RW4 A;  4CBX A;  1ATN A;  4JKA A;  2E1Z A;  3BUZ B;  1BGX T;  2HHT A;  3HP6 A;  1NJY A;  1WAF A;  3IRX A;  1TUU A;  3L3U A;  3HYF A;  4O44 A;  5C42 A;  5BR8 K;  1VQL N;  1VSI A;  2CH5 A;  4OGC A;  3VQ6 A;  3RMA A;  3ZSZ A;  2CGK A;  5KGW A;  4KI4 A;  4I2P A;  4X62 K;  5I3U A;  1E4G T;  2KTQ A;  2F7T A;  3LZJ A;  4YDU C;  4DUZ K;  5SZT A;  1ATS A;  3OYE A;  4JRQ A;  4E7J A;  1HPM A;  3CMA N;  4BRP A;  5D3G A;  4Z4F A;  1KXP A;  4WQ4 A;  5J2N A;  3OYD A;  4X64 K;  3QEV A;  1BI4 B;  2FSJ A;  1C0U A;  4IG3 A;  3CJB A;  3JSM A;  3CXC M;  3PSF A;  4HHT A;  4JI6 K;  1NGI A;  4CEC A;  4FK0 A;  4DTR A;  2KFZ A;  2X6S A;  3SLC A;  1VQ9 N;  3DWL A;  4KRF A;  2ZGZ A;  5F1X A;  2P9U A;  2BGG A;  3NVK A;  3U8X A;  1VSK A;  3UKR B;  4Y0W A;  4BVP A;  4CFB A;  2HND A;  2O8D A;  3TWH A;  3ZT2 A;  4DR6 K;  1TK5 A;  1XNR K;  2E1Y A;  2ZE2 A;  4CHN A;  4N41 A;  1NMD A;  3RWU A;  5AQW A;  4FJH A;  1B92 A;  3TTC A;  3G6E N;  3UE5 A;  5JS2 A;  1RBT A;  4YOT A;  4F2R A;  4M63 C;  1UAX A;  3B8A X;  3O3F A;  3L2W A;  4E7L A;  2KW4 A;  3EKU A;  2NRT A;  4JNE A;  3S9H A;  3AO2 A;  3MK6 A;  2NUB A;  1WSE A;  3VQA A;  4MQ3 A;  1WB9 A;  5AZI B;  3QIO A;  3OY9 A;  1DLO A;  4PY5 A;  3HBT A;  4CJ7 A;  3PUF A;  4CD1 A;  2QWN A;  4N47 A;  4CE9 A;  1S1U A;  4B3S K;  2UXC K;  1LOT B;  4FWQ A;  2FF3 B;  2W41 A;  3FZK A;  4JHD B;  3K5O A;  2D1K A;  3OYG A;  4FXD A;  5HRR A;  2A42 A;  3MCA B;  3KTQ A;  3H46 O;  1IBM K;  1VSD A;  5HLF A;  1VRU A;  4DTX A;  1VSM A;  2X78 A;  4RW8 A;  5FLX O;  1Q9X A;  2A5X A;  3S3O A;  1SL1 A;  4LSL A;  4O0I A;  2DFE A;  2Y1I A;  1NKB A;  5M1F A;  5BPL A;  3OJU A;  3VES A;  4DTN A;  4HUF A;  4NLB A;  1WSH A;  2A6A A;  4JK9 A;  4F3O A;  4JKE A;  4DV7 K;  2YI1 A;  1CZB A;  4BC3 A;  5AQK A;  1JLB A;  3KJV A;  1YI2 N;  4OKE A;  3AVF A;  4CJ3 A;  3BZK A;  3DOK A;  3CJA A;  4O55 A;  4FWN A;  3CPW M;  2OTL N;  3V1Q A;  2E2N A;  1DGK N;  2PFU A;  3VPZ A;  4DLG A;  3VGM A;  1DEJ A;  2IVO A;  3NAE A;  1M90 O;  3MX2 A;  4I9L A;  3O80 A;  4CEZ A;  5AQL A;  4GY2 B;  1RT7 A;  1JLQ A;  4JD2 A;  3ZSX A;  4UQG A;  4FJN A;  3OVN A;  5B8H A;  2QWO A;  1LV5 A;  1NOY A;  2E2Q A;  1S72 N;  4FJ9 A;  4YOR A;  3FZM A;  5BR9 A;  4KFB A;  2OPQ A;  4FJ8 A;  4B1X B;  1HKB A;  1E3M A;  1NGG A;  3OYA A;  4AIL C;  1IKY A;  4RW9 A;  3LP0 A;  3DI6 A;  2YHW A;  4FJ7 A;  2HBJ A;  4CES A;  1VQ6 N;  3O9U A;  1QZ5 A;  2P9S A;  3SCX A;  3MDQ A;  1NOZ A;  1LAW A;  2VWK A;  3SJJ A;  2QKK A;  3MEC A;  2IVP A;  4FJK A;  1JCE A;  3KIO A;  3D7E O;  3EYZ A;  4J2B A;  4BRE A;  1GLL O;  2GUP A;  2UYT A;  3D2F B;  4EP4 A;  1H1V A;  3D6R A;  2QXF A;  4JI2 K;  2D0B A;  2P5G A;  3K9K A;  3SUO A;  2D0A A;  3IDH A;  3ZX3 A;  3KLF A;  3WXJ A;  5BRE A;  3VQQ A;  3DXK B;  4BG9 A;  2UXD K;  5AQI A;  5A2Q O;  2JWK A;  3O4Q A;  3RR8 A;  1IKV A;  3DYA A;  4CIF A;  4JK8 A;  4DR1 K;  2Z1J A;  3R9P A;  3CER A;  4WQ4 C;  4FSV A;  4EZ9 A;  4PQU A;  2HHS A;  1A5X A;  3CJ7 A;  4QAG A;  4FCY A;  4GV6 A;  3CCV N;  1ZBF A;  1O13 A;  5AZJ A;  1N33 K;  4W5R A;  3ZCM A;  4CHY A;  1SKW A;  2NRH A;  4DFP A;  4BRF A;  3WUH A;  1TL1 A;  3K59 A;  3G71 N;  1YTA A;  1EQY A;  3TR8 A;  4YHH K;  2AA4 A;  2XY5 A;  2IC3 A;  3MEE A;  2O4G A;  4CF8 A;  1SL0 A;  2O8B A;  2YNG A;  2OTJ N;  4ILJ A;  1BQM A;  2PY5 A;  4BRH A;  3MWT A;  3ZEU B;  3IFR A;  3BZC A;  4BDP A;  4KO0 A;  3TSQ A;  1U47 A;  4GKK K;  2P9P A;  4H5W A;  4FWM A;  1YT3 A;  4K25 A;  4UY8 O;  4IOC L;  3IMX A;  4BRA A;  3EE8 A;  3I8D A;  4JI4 K;  1KVC A;  3W3D A;  1B9D A;  1U45 A;  5CYQ A;  4RWT A;  3QDK A;  3ASM A;  4ID5 A;  4FZZ A;  4DQP A;  1JXE A;  2NRZ A;  3AAR A;  5F2R A;  4E19 A;  3HXM A;  1SKS A;  4HUE A;  5SWM A;  3NFA A;  3MX5 A;  4HWI A;  1RBV A;  3LWL A;  1Z25 A;  4Z4I A;  2FBY A;  1VQ8 N;  5FPD A;  4OJR A;  4A61 A;  3FGU A;  1XNQ K;  1YJW N;  1W7A A;  3R8E A;  3DRR A;  3MAQ A;  3V9S A;  5C0Y A;  1VSH A;  1VQM N;  3NVM A;  3P38 A;  5EVZ A;  4JK7 A;  3T1H K;  1Q7Y O;  4DMN A;  1RT3 A;  3BF3 A;  4DKW A;  1U2V B;  4LH4 A;  2RF2 A;  3FZF A;  3LZI A;  2Z1G A;  4FLT A;  3OYF A;  4CK3 A;  1N5Y A;  2VQF K;  3LP2 A;  3QIN A;  4DFM A;  2AP1 A;  5JMV A;  4OPK A;  4H0Y B;  2W42 A;  4N5S A;  4CZJ A;  1C0T A;  3A0I X;  4JI7 K;  2ZJQ L;  3BDP A;  4J2D A;  3VER A;  3SAF A;  2YV0 X;  3AVG A;  5M1K A;  5AQO A;  3NF6 A;  4DUY K;  2G8F A;  1RDD A;  2QWP A;  4C8M A;  1GLE G;  4DQQ A;  1EKE A;  4JKD A;  2G8H A;  2QXL A;  4RCH A;  4BRL A;  1GLF O;  3OS1 A;  3T7Z A;  4KHN A;  5J2P A;  3BY5 A;  3AGK A;  4NLC A;  3KLI A;  1JCG A;  4QS7 A;  3PY8 A;  4DS5 A;  2UXB K;  3QEI A;  3ISN C;  3ZT0 A;  4GNI A;  4DR4 K;  3QB0 A;  3VET A;  5EY4 A;  3LM9 A;  1KQS M;  3O9R A;  2EX3 A;  3H3O B;  3C6A A;  3V81 A;  1BIS A;  4IOA L;  4AHC A;  4AQY K;  3OYK A;  5KPR A;  3QES A;  1UOC A;  3CPE A;  3LAL A;  2P9I B;  4PUO A;  3L2U A;  2DY4 A;  5H1S Q;  2P9N A;  1TYQ A;  4DV0 K;  4DU3 A;  5GAE P;  4BRM A;  4FJL A;  1VSF A;  3B6P A;  1HKG A;  1FW6 A;  1HQU A;  3NH0 A;  2QA4 N;  4B8C A;  1G15 A;  1T7P A;  1FK9 A;  3PSI A;  2KQ2 A;  3TAB A;  4NCA A;  4GKJ K;  3AA5 X;  1DTQ A;  4E7I A;  4KHY A;  3RSE A;  3U3G A;  5I42 A;  4ILG B;  1IV0 A;  4J2E A;  1J53 A;  1ZBL A;  3CET A;  1RBU A;  5DMR A;  2HST A;  3H1V X;  5AQV A;  2JGU A;  1CLQ A;  1MWM A;  2A1R A;  4LH5 A;  1YAG A;  1GLJ O;  3NHG A;  3AVL A;  4JYA K;  3F9K A;  4BRI A;  3SUN A;  4IG0 A;  1WSJ A;  2B6A A;  2QWM A;  4DSI A;  3DMJ A;  4CGG A;  2VG7 A;  2ZJP L;  3EZ5 A;  3VQB A;  3CCL N;  3SV4 A;  2KZM A;  4OPJ A;  4DR3 K;  4DCH A;  1V4T A;  3ZSY A;  3I55 N;  3V9W A;  3LPT A;  1W9H A;  2F9T A;  3VEW A;  3CM6 A;  3WT0 A;  3I0R A;  3KK7 A;  2Q36 A;  1SS6 A;  2DTU A;  3NBP A;  4Z94 A;  1SL2 A;  3G4S N;  5HBM A;  4YY3 K;  3VEO A;  1VQN N;  4BDY A;  5EU7 A;  3WNH A;  3CCQ N;  5HRP A;  3A5O C;  4GMJ B;  5GAG P;  2OYQ A;  4BRG A;  4ID1 A;  1OKJ A;  3C7N A;  1FJG K;  3DAW A;  5M1Q A;  2P9K B;  1L3S A;  3L2Q A;  1XI1 A;  4FK2 A;  3AO4 A;  3B6O A;  4KV8 A;  2E2P A;  1JCF A;  4BQL A;  4CZI A;  5FPE A;  1LW2 A;  3NCI A;  3CCU N;  3VQE A;  4CIE A;  1RT2 A;  4CZF A;  5LJV A;  1X9M A;  1NK0 A;  3CHW A;  1XC3 A;  3L2R A;  4IDK A;  3O4W A;  3AA4 A;  2NRX A;  4BE1 A;  4HTU A;  1TK0 A;  2Q0U A;  1NGF A;  2FC0 A;  1QHT A;  4BC2 A;  3ALY A;  5FPN A;  2VCP A;  4E3S A;  3VQP A;  3ZT1 A;  2HW3 A;  1U48 A;  3ENO A;  3QIC A;  4CJU A;  4DFK A;  3SQ0 A;  1K6Y A;  1OVQ A;  4KHW A;  5AFU H;  3I0S A;  2GX9 A;  2G8W A;  4FW2 A;  3RVC A;  2I5J A;  5M1P A;  3CCR N;  3J7Z O;  3HPO A;  5ELZ A;  3DLB A;  1BHL A;  4B3O A;  4A2B A;  3O5B A;  4F2S A;  4KH5 A;  4FL9 A;  4PL7 A;  3K58 A;  3WXI A;  3TAF A;  3SPY A;  4AHS A;  3DRS A;  1GOC A;  3K5L A;  4M3X A;  1RT6 A;  3NGI A;  3S3N A;  3D2E A;  4FPB A;  3VQ4 A;  4JI1 K;  1SV5 A;  4WYB A;  4B9L A;  1ASU A;  1U04 A;  1VRT A;  3QLH A;  5AQG A;  5AQM A;  4CZE A;  4M3T A;  2VQE K;  3M8R A;  1IBL K;  2HBM A;  2WUS A;  4JAX A;  1ASW A;  1HNZ K;  2CGL A;  4OLA A;  3LDN A;  2RKI A;  4DG1 A;  4BE2 A;  3M3Z A;  4FWS A;  1HNI A;  1RIL A;  3UKU B;  3ZT3 A;  3HP9 A;  4A57 A;  3JS6 A;  1ZBS A;  4O8U A;  3HM8 A;  1T44 A;  4G1Q A;  3EO3 A;  3SQ2 A;  5AQU A;  3AY9 A;  4E0D A;  1S6P A;  2ETJ A;  3A5L C;  3QEW A;  1NGD A;  2GUI A;  4H0X B;  5C12 A;  5IWA K;  1A5V A;  5HRN A;  1X9J A;  5KI6 A;  3THY A;  4FO0 A;  2Q31 A;  3HJF A;  2FBV A;  2G8V A;  3TTF A;  3TSP A;  2HMP A;  5GIN A;  4YOY A;  1WN7 A;  3PX4 A;  2PYJ A;  5EOY A;  4IEE A;  1MA9 B;  4GV9 A;  1KTQ A;  4DQ8 A;  4DV6 K;  3G0Z A;  2QEX N;  5GAD P;  3MXI A;  2FBT A;  3GDQ A;  4CHO A;  1JLC A;  3SMP A;  1HMV A;  1N32 K;  1S6Q A;  1NU0 A;  5AFU A;  4DQI A;  3KKR A;  4JKG A;  4B1W B;  1S1T A;  3R6M A;  5J2M A;  3SUP A;  1NWK A;  3PO5 A;  3QEX A;  5C2D A;  4DSE A;  4CFC A;  2E5L K;  1A5W A;  4DWI A;  4KTW A;  3UIQ A;  2D5R A;  4JN4 A;  1VSJ A;  2E88 A;  3OYC A;  4I2Q A;  4K41 A;  1TGO A;  3O6W A;  1QTM A;  4CBU A;  1KVB A;  2WBN A;  3SK3 A;  5LMU K;  2P9N B;  1HX1 A;  4F9O A;  3LM2 A;  4W5N A;  2HHV A;  4FJG A;  3V6D A;  3THV A;  4M3Z A;  3CJ9 A;  2HHH K;  1ZYQ A;  4ILH A;  1NKE A;  1NBW A;  2OPR A;  1KLM A;  1VK0 A;  2F8S A;  3H1Q A;  3HL8 A;  4CEF A;  1CXQ A;  2A1S A;  1IKX A;  2P9L B;  3WQU A;  3OYM A;  3A5M C;  4HUG A;  2YNF A;  4FJJ A;  4C23 A;  4BC4 A;  1IG9 A;  5FPM A;  2NRV A;  3IUC A;  3VEV A;  4Z4H A;  3VTH A;  3WEE B;  5F0X A;  5MLC Q;  3O08 A;  3WXK A;  1NGJ A;  4JI8 K;  1HYV A;  4LFB K;  3WNG A;  4KB0 A;  3L0Q A;  3JAM O;  2O8C B;  2D0C A;  3PLA A;  2HHW A;  3ZET B;  1T3V A;  1NGH A;  3CC7 N;  3AAP A;  4FWK A;  4O4G A;  3C6H A;  4ISG A;  5LL6 Z;  1NM1 A;  1DKG D;  4FLU A;  2P51 A;  3DLE A;  1WLJ A;  3NE6 A;  4XIU A;  1BO5 O;  3NGZ A;  3E1Y A;  3KLH A;  2X6N A;  3OYH A;  3HVR A;  4KBO A;  2VGN A;  3J81 O;  3TPQ A;  5AQN A;  1IBK K;  2O8E B;  2HBK A;  2I7P A;  5KTQ A;  4JS4 A;  4B1Z A;  4DV2 K;  1JXB A;  4CHP A;  5JIC A;  3R1X A;  4IWV A;  4EAH D;  4EFH A;  3E9L A;  3IG1 A;  2BTF A;  4QOZ B;  1ESV A;  1FKP A;  3P39 A;  3EY1 A;  1BQN A;  3ZSQ A;  2YHA A;  1IJJ A;  1VSL A;  3E66 A;  1NGA A;  4PKI A;  4DB3 A;  3V4I A;  2OZS A;  4FLW A;  1WAJ A;  1J9A A;  2NRR A;  5KQ8 A;  4Z4E A;  1BA0 A;  3VGL A;  4FW1 A;  3LAN A;  3VN5 A;  4DU4 A;  5HP1 A;  1T8E A;  1MWK A;  5CHI A;  1Y97 A;  4KH4 A;  3BP8 A;  2BH1 A;  2YCH A;  1T6C A;  1REV A;  3ULE A;  4CEA A;  4C8K A;  4CJQ A;  4MLE A;  3QEP A;  3H08 A;  2XY6 A;  1WSG A;  1RDW X;  2F8T A;  4EHU A;  3T69 A;  1D9F A;  1RTJ A;  2ZQB A;  2Q2R A;  3AVK A;  3GBT A;  4IFE A;  3EZW A;  4IXC A;  5C24 A;  1YJN N;  4IFV A;  2QKB A;  4OO1 J;  4I6M B;  1W0H A;  3K5M A;  2KLA A;  4FVU A;  3K5N A;  2DFH A;  2OAN A;  3SBG A;  4CER A;  4CJ5 A;  3H6E A;  2DFF A;  3I56 N;  3RRG A;  3QFU A;  1Z26 A;  3ZLJ A;  3D2E B;  4DSJ A;  4LF5 K;  1NMN A;  3AO1 A;  3M8S A;  3M6G A;  4FJX A;  3HSC A;  1BDG A;  2JLE A;  3C65 A;  3P4I A;  4IDH A;  3RRH A;  1X1P A;  4BGB A;  4BE0 A;  1KVA A;  4KHP K;  2YHX A;  2OCE A;  4BGA A;  3SUQ A;  2GBZ A;  4BR2 A;  3M1F A;  1IO2 A;  4PL8 A;  2KZZ A;  4RW6 A;  5JVH L;  2YNI A;  2X74 A;  1BIZ A;  3U9D A;  1L3V A;  1YVU A;  3PIO L;  3BF1 A;  3L6Q A;  1XWL A;  3OYB A;  3AVB A;  2QK9 A;  1YF5 L;  4E1J A;  3LL3 A;  2WC9 A;  3JXU A;  3KK1 A;  4CGF A;  4WQ5 A;  5FDL A;  3MED A;  4IZ9 A;  3OW2 M;  3T19 A;  1W97 L;  3P1G A;  4GVM A;  4CEE A;  2HBL A;  5AQF A;  4JV5 K;  3TAQ A;  3AVH A;  2WTU A;  3CFP A;  1QE1 A;  4DTS A;  4AHT A;  3ZX2 A;  2O4I A;  2GV9 A;  3THX A;  4BRK A;  5FRN A;  5I9E B;  1VQ5 N;  1QS4 A;  2W6K A;  3SI6 A;  1NGE A;  4YOV A;  2Z1I A;  1S1X A;  1QHA A;  3PO4 A;  3AVM A;  2P9U B;  3TSU A;  1R0A A;  4OX9 K;  4CGH A;  4AM7 A;  4CZH A;  4HVJ A;  1J6Z A;  2O8D B;  4U7B A;  3TAM A;  4HTL A;  3IKM A;  3I33 A;  5BRF A;  1KAY A;  1I94 K;  2CH6 A;  3T1A A;  4CF9 A;  2D0P A;  1C1A A;  4CF0 A;  1D9D A;  3CQY A;  4CZG A;  3K2P A;  3T3F A;  4C8L A;  4FM1 A;  1P90 A;  1ATR A;  3UB5 A;  1TK8 A;  4RTF D;  5EXW A;  3SJH A;  2XO7 A;  3KWI A;  1TAQ A;  3THW A;  4EIA A;  2YHY A;  1VQ7 N;  5C15 A;  3O9Q A;  3OBY A;  2UUB K;  2VYP A;  2G8I A;  4QS9 A;  4BRQ A;  4O8K A;  5AQZ A;  3PX0 A;  5DM6 L;  2OZM A;  2E20 A;  1RT4 A;  5AQQ A;  1QQM A;  4F8R A;  4B9T A;  1ZBU A;  4B9M A;  5KGX A;  1ITG A;  4FOI A;  1KAZ A;  3MN9 A;  3SV3 A;  3OTO K;  2YNH A;  2HNZ A;  1JL2 A;  1WOQ A;  1V4S A;  3HRG A;  5CZ1 A;  4DV4 K;  3A8Y A;  4BRD A;  4FJM A;  3AV9 A;  3SZ2 A;  1OH5 A;  3SAH A;  4WFB L;  3C94 A;  3C95 A;  1I3A A;  3QO9 A;  2KHO A;  2IDO A;  3F2K A;  3ITH A;  4DV3 K;  4NB4 A;  1BI4 A;  4KKO A;  4AF1 A;  4DV1 K;  5TKW A;  4OPA A;  3OJS A;  1CZ9 A;  4N56 A;  3NMU A;  5E84 A;  1NKC A;  4PHT X;  1SQK A;  1EO1 A;  4IEI A;  3K9J A;  4FJI A;  2FBX A;  3ZSO A;  1KCF A;  3UKR A;  1HNW K;  4B9Q A;  4F3T A;  2J4R A;  2W6L A;  3HTV A;  1S1W A;  5AQT A;  5CR4 A;  1EWR A;  5AQH A;  4M3U A;  4DTJ A;  2F96 A;  3AA3 A;  4BR9 A;  2CGJ A;  3U6F A;  3ZSV A;  2O8F A;  1G99 A;  1GLA G;  3FFI A;  4H03 B;  4NXM K;  4U67 L;  4W5T A;  2V7Z A;  1RNH A;  1TV6 A;  3O1W A;  1RFQ A;  4JD2 B;  2F4V K;  1HJO A;  2EWS A;  4FLY A;  3EEQ A;  3H45 C;  1QSL A;  4LFC K;  3O9T A;  4KB1 A;  4DQS A;  4NCG A;  4HCB A;  4A5A A;  3QNN A;  1FKO A;  2OPS A;  3VQD A;  4AH9 A;  1GLB G;  3QER A;  4LF6 K;  4AHV A;  4C1N I;  4O5F A;  1YUW A;  2RHK A;  1RBS A;  4JHD A;  4BDZ A;  4FLZ A;  2A40 A;  1HLU A;  5C2F A;  1BUP A;  3SPZ A;  2P9S B;  4B1V A;  4H5V A;  4DFJ A;  3TAG A;  1YHQ N;  3FLC O;  5M1N A;  5AQJ A;  4YOX A;  4CGD A;  2UUA K;  3VMF B;  4QS8 A;  4NYN A;  3MWP A;  3WXL A;  4R5P A;  4CZK A;  4M3R A;  1SKR A;  2E4L A;  3U4L A;  4CJV A;  5LY3 A; 
#chains in the Genus database with same CATH homology
 4LF5 K;  4B3M K;  4DR4 K;  4DR6 K;  1FJG K;  1XNR K;  5IWA K;  4LF4 K;  3OTO K;  5LMN K;  4V19 S;  4JI4 K;  5LL6 Z;  4AQY K;  4DV4 K;  1HNX K;  4X65 K;  4KHP K;  4DV6 K;  3J7Y P;  4DV0 K;  1N36 K;  1N32 K;  4DV3 K;  3J81 O;  1IBK K;  5AJ3 K;  4LF9 K;  4DV1 K;  3T1Y K;  4DV2 K;  2UU9 K;  4DV5 K;  4B3R K;  4B3S K;  1HNW K;  1XNQ K;  4JV5 K;  2UXC K;  4JI2 K;  4GKJ K;  3J7A P;  2E5L K;  3T1H K;  4JI3 K;  4DR2 K;  4B3T K;  1IBM K;  2UXD K;  4JI0 K;  3J80 O;  4NXM K;  1XMQ K;  5A2Q O;  2VQF K;  5LMU K;  5FLX O;  4K0K K;  5BR8 K;  4DR1 K;  4OX9 K;  2F4V K;  4X66 K;  2HHH K;  4DR5 K;  4LFC K;  4NXN K;  4JI1 K;  4CW7 B;  4JYA K;  4X62 K;  2ZM6 K;  1I94 K;  4DR7 K;  1N33 K;  4DUZ K;  1XMO K;  2VQE K;  1HR0 K;  4JI7 K;  1IBL K;  4DV7 K;  5IT9 O;  4LF8 K;  4DR3 K;  4LF6 K;  1HNZ K;  4YHH K;  4CVN E;  4DUY K;  4X64 K;  2UUB K;  2UUA K;  4LF7 K;  4JI6 K;  4YY3 K;  4LFA K;  4JI8 K;  4LFB K;  1J5E K;  4JI5 K;  3JAM O;  2UXB K;  1N34 K;  4GKK K;  2UUC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...