1XNRK

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xnrK00
1HNXK 4DV0K 2UU9K 4CVNE 5A2QO 1N34K 4DV7K 4DR5K 4CW7B 4DR1K 4DV4K 4JI2K 4JI6K 1I94K 4B3TK 4LF5K 4JI5K 2UUBK 4DV1K 4DUYK 4JV5K 4YHHK 4GKKK 5LMUK 4JI7K 3J80O 4DV3K 4LFBK 1IBMK 1HR0K 4JI8K 1HNWK 1XNRK 3OTOK 4DR7K 5IT9O 4LFCK 4X64K 4LF8K 4JI1K 1XMQK 4AQYK 4K0KK 4DUZK 4DR2K 2HHHK 1N33K 2UXBK 4DV2K 4B3MK 4YY3K 2F4VK 4B3SK 1XNQK 5BR8K 4LF7K 1IBLK 3T1HK 1IBKK 5LMNK 4B3RK 1XMOK 4DR6K 4JI3K 2ZM6K 2VQEK 1HNZK 4LF9K 4NXNK 5AJ3K 1J5EK 4LF6K 4V19S 4GKJK 5IWAK 2UXDK 4X62K 4OX9K 4NXMK 4JI4K 4LFAK 4DR3K 1N36K 5FLXO 3J7AP 2UXCK 4DV5K 2UUCK 4JI0K 4LF4K 3J7YP 5LL6Z 4X65K 4JYAK 4X66K 4DV6K 4DR4K 3T1YK 3J81O 3JAMO 2E5LK 2VQFK 2UUAK 4KHPK 1FJGK 1N32K
chains in the Genus database with same CATH superfamily
3CC4N 1JLBA 3E9LA 1YITN 3F73A 4B9NA 3V1OA 1WSIA 4BC3A 3ATUA 1VHXA 3A5OC 2RF2A 4B1UB 3DRRA 5BPMA 3RMCA 4CF1A 2YHWA 5KPTA 3HVRA 1C1AA 5F1XA 2ZGZA 4ELUA 2OCEA 3DI6A 1TAQA 3V9SA 2P9IB 2P9PB 4C8OA 1WB9A 4IG3A 1VQON 1T05A 5AQZA 3D7EO 2QWQA 1HNWK 1JCFA 1XNRK 3A8YA 4IDKA 3TU5A 1SV5A 1QQOA 2ZJQL 3V9XA 2QKKA 5KTQA 2KFZA 1Q9YA 1YF5L 2FC0A 1OH7A 4GV6A 3C0BA 2FSKA 1W7AA 4Y0WA 3VEZA 4JKGA 2Q0UA 2Q3SA 4FJMA 3LZIA 2W6LA 4YOUA 4FW2A 3G4SN 4BRCA 3QEIA 1VQ4N 1IKVA 1KC8O 4WQ4C 3R9PA 1SKRA 1ZXOA 1SZ2A 1X9WA 3SQ1A 2Z1HA 1LAVA 4FJNA 3WEEA 3DJCA 1TUUA 4CHYA 4FK2A 3G6EN 1L3UA 2QW9A 4V19S 4KTWA 4FWNA 4U67L 4Z4IA 3VGKA 4JI4K 2YJEA 2YHBA 4FVMA 4BC4A 4W5TA 4GVMA 4LFAK 3AVKA 1E3MA 4DR3K 2AP1A 3U9ZA 3KZBA 3TI0A 2D0OA 1R59O 4BRNA 3ENOA 3TAEA 1CXQA 1HLUA 4DFJA 4FLXA 3SQ4A 1JKHA 2I5JA 3C6AA 4N5SA 1F21A 2FBTA 2Q1NA 3O4QA 2QXFA 3AV9A 2YCHA 3ZT3A 1KVCA 3OYFA 3NVKA 2XY5A 4LH5A 1D9DA 4IOXA 3LM9A 4CERA 4DTNA 4NCAA 4MLEA 1HKGA 1RCHA 4JK7A 2QI2A 5AQTA 4JI5K 2HBLA 4FSVA 3EL2A 4CJPA 1BDGA 5LMUK 3KD5E 5AQKA 1IH7A 3O3FA 5M1OA 3PIPL 3SUPA 2P9UA 2XY6A 4BGAA 1ASWA 3HL8A 3MXMA 4DQPA 4DR7K 1NWKA 3R1XA 4HUEA 4YOVA 4F9OA 4CEAA 5HL7L 1KTQA 5K14A 4KV8A 4BR4A 5AR0A 2DPNA 1VSEA 3VTIA 4KB1A 1BU6O 1BCMA 4DV2K 3LALA 2OPPA 3O1WA 3KWGA 1HUXA 3QBXA 4DG1A 2HF3A 1Q18A 2FLOA 5KPZA 4N47A 5LMNK 2O8FA 4CEBA 3ENHA 3NDKA 4ZTFA 4GV3A 3P1GA 4CGIA 3HPHA 2VGNA 3ZT0A 1W9HA 1ZBFA 1QQCA 2PFUA 4CD3A 3M8RA 3ZT1A 1RILA 2YJFA 4ID1A 4H5WA 4KTZA 3THVA 5AQOA 2NNWA 1K73O 2QKBA 3P38A 2W42A 2PZSA 4DF4A 3DLHA 4CZLA 4R79A 3KLHA 3BGRA 3DOLA 1T8EA 4M3XA 4CF9A 5I3UA 3RMAA 4C8NA 4DWIA 1RT6A 3PY8A 3THXA 5CZ2A 4JRQA 2DY4A 5AQJA 4B08A 4BC2A 2GELA 3A5LC 5J1EA 4FLZA 4IOCL 2PBDA 3JAMO 3LANA 4PL7A 1GLAG 4DFMA 1Q81O 2R7YA 4FLUA 5HP1A 4M7YA 1BIZA 3OYNA 3V9WA 1WSJA 1Z05A 2BE2A 1S1XA 4OGEA 5I9EB 4F2SA 4FOIA 4K43A 1C0UA 2E2QA 2RN2A 1U48A 2QK9A 2YHXA 3RWUA 5TKYA 3VOVA 3A2FA 5CHIA 1JLFA 1KFDA 1NMNA 1NJZA 3CI5A 3H3NO 5BRHA 3AA2A 5BRFA 1SL0A 3BEXA 2X74A 4IZ9A 1NGBA 3A5NC 1NNEA 3QERA 1LAWA 4H5RA 4QS7A 3ZEUB 1WUAA 3O9SA 1S1TA 2PY5A 3N4QA 5EY4A 4FJ8A 1L3TA 1XC9A 2D0CA 2Z1IA 1TKZA 3NAEA 4CJSA 1NK6A 5C24A 1J5OA 4DU3A 1BA0A 1XMQK 4FZZA 3SAGA 2GEMA 3BZCA 3QETA 1WSHA 3ENBA 4RW8A 3CJ7A 2P1JA 2HHHK 4IG0A 2IAJA 3UIQA 1IBLK 4AHSA 3V81A 4U7BA 4RWTA 4O4GA 1QQNA 3DXKA 4B9TA 5M1KA 5HROA 3E01A 3LDPA 4CGFA 1QZ6A 3TR8A 4JKFA 3KIOA 1VQLN 1RTIA 4GKJK 5JVHL 4BE1A 4DSIA 5FPMA 3WNGA 3CCQN 4G1QA 4RCHA 3RRGA 4DSLA 2HMIA 4LSLA 4E7HA 4H03B 1D5AA 3DXKB 4BRIA 2WOMA 3L3UA 3V1RA 3VQDA 3J7YP 3SLCA 2NRRA 3DXMB 2IIRA 2Q36A 5AQNA 3ID8A 3VQ5A 4I2QA 2XO7A 4CF0A 3SAHA 4M3UA 4BDPA 3QMLA 3TAPA 3AVFA 2PAVA 3O08A 1LOTB 4CJ3A 3OYMA 1DLOA 2XY8A 3CFPA 1U47A 4EZ6A 3NH2A 4CGGA 3OS2A 1V4TA 3FE1A 3B8AX 4FJ9A 1YJNN 1OH5A 2ZJPL 1TKXA 3O5BA 5FROA 2GWKA 1EP4A 2HSTA 4CW7B 3ULEA 2QM1A 5EVZA 3AO1A 1REVA 2FBXA 5JMVA 3C94A 3AARA 4JV5K 2FSNA 1SL1A 3V9ZA 3QEXA 4CCHA 5BPLA 4ICLA 3HP6A 3M8PA 3J80O 2O8CA 3SUQA 3EKUA 4CJLA 3VGMA 4JS4A 4JKCA 5HRPA 1XUPO 4NB4A 3LPUA 4FWKA 1Z6RA 4FJGA 1VSDA 5CYMA 3OYHA 4CF8A 3SQ2A 3TSQA 3ZSZA 1UOCA 1OVYA 2BANA 3IRXA 3QB0A 1D4XA 4BWJA 4FWRA 4KI6A 4H4MA 2IS3A 1S1WA 2UXBK 3EZWA 3HTVA 4EAHD 3G71N 4FJ7A 4O8UA 3L8BA 4PHTX 4HWIA 4L8RB 1XQSC 2H3GX 1WSGA 3O6WA 4DR6K 3E9PA 2OA8A 4CBXA 1EX4A 5F0XA 2HNDA 4NXNK 1J54A 1GLDG 4IWVA 1H1VA 1Z25A 5B8HA 4A61A 3DLRA 1C6VA 3QEVA 5C25A 2OZMA 3VPZA 2HHQA 3MN9A 5DMRA 1NGEA 1S9EA 1HYVA 2BGGA 3BZKA 4MO5A 4CIEA 3WXJA 5C0YA 3NH0A 3IG1A 3S3NA 5LL6Z 3CFOA 5AQYA 4AM7A 1UA1A 5ELZA 3J8AA 2A41A 3EZ5A 4IXCA 2Z1GA 4CFBA 2NUBA 1YTUA 4PWDA 1A5XA 4DV0K 4KO0A 4FLWA 2BUPA 4CJTA 3LDSA 2YNHA 4DR1K 1VRUA 3H1VX 4CEEA 3RRHA 1NKEA 3NF8A 1TKTA 4UY8O 2D1KA 3I55N 1QSLA 1HRHA 4OKJA 3WT0A 2HOEA 3CYMA 3BDPA 4BVOA 1Q8IA 3S3MA 3SPZA 3TAFA 4KHUA 3LWLA 4CHQA 4KH4A 3H08A 1GLLO 4E3SA 3PSIA 3L6QA 1NOZA 4DV3K 3ZX0A 3OYLA 2O8BB 2IVNA 4DTXA 4ZTJA 2G8HA 3AA5X 3QFPA 3G10A 2F7TA 1WBDA 4KB0A 5KGXA 4O0IA 5BN9A 5M1QA 4QS8A 1JCGA 2HVIA 4MDAA 2FBYA 1VRTA 3P31A 4CE9A 4LSNA 3OYDA 4MLHA 1C0TA 1VSHA 3PX6A 1WNSA 3ZSYA 2KZMA 3QO9A 2VG5A 1C1CA 1JLEA 3LM2A 4FZXC 1S9GA 3ZSRA 1NLVA 4ELTA 4C8KA 4FO0A 1FKOA 4FW1A 2BH1A 1XMOK 4DS4A 1L5UA 1ZBIA 1YT3A 4DFKA 4BY9C 3FZFA 2HHUA 2FSJA 4BVPA 1QHTA 2XY7A 3VQCA 4JHDB 3GE1A 1O1WA 4LY7A 4XIUA 4CZIA 3KLFA 2ASMA 3NCIA 3HRGA 3VQAA 5BREA 3PSFA 4OVLA 2QA4N 2JGUA 1HPZA 2P9NA 3OVNA 1GLEG 4CHNA 1O13A 3OYGA 3ZLJA 5FRMA 4B9VA 5AFUH 3SCXA 2UXCK 2IGIA 4B9SA 3M3ZA 5M1NA 4DV6K 1HYZA 3IFRA 1XC3A 3D2EA 3CMAN 1MU2A 3AY9A 1YHQN 2OYQA 1RT7A 1CZAN 5JS1A 2E20A 4JKHA 5GADP 4I6MB 3KLEA 4FWQA 4DQRA 4KHNA 3O9QA 5D3GA 1MA9B 1NM1A 4KHQA 3FFIA 3ISNC 1LV5A 4DV4K 1KAXA 4YOXA 5C2DA 1I39A 5KPRA 3VQPA 2P9NB 4HUGA 3TANA 4E7IA 3L3VA 2G8FA 4YNQA 4CECA 3DLKA 2VGMA 3THWA 1Q9XA 1KLNA 2D0AA 1ATRA 4CJEA 1RBRA 3I8DA 1IBMK 1FKPA 1U04A 2NRVA 1LW2A 3DLEA 1HNIA 4DTPA 3MWPA 3T1AA 4QOZB 1LWEA 3M1FA 1J6ZA 3VGLA 3K5NA 4JD2A 5E84A 2JLEA 1K6YA 4Y1DA 4O5BA 2GV9A 3FGUA 3WXIA 1OKJA 1K9MO 4W5OA 1LWCA 4A5BA 4DF8A 4PKHA 4BRHA 3VETA 1TVRA 3HOSA 4XH4A 5BR8K 3GOIA 1YUWA 3QBWA 3HPOA 3EKSA 3KHYA 3VEOA 5HOOA 1QQMA 4RW4A 2Y1JA 4EIAA 1CZ9A 4I2PA 4CZGA 3SUNA 1C0FA 3UKUA 4KH6A 4FCYA 5SWMA 3FZHA 3GBTA 4PA1A 4H5TA 4ISEA 4CGDA 1VK0A 4E89A 3F2KA 2KKZA 1DKGD 2HB5A 2QWNA 3CIPA 4BR7A 4W5NA 3EE9A 1TK0A 1U4BA 3LZJA 4DTSA 1W97L 4X62K 1TYQB 4W5RA 2PYJA 3LDQA 3ZSQA 4IKFA 4BRAA 4C8LA 3NGZA 1J53A 2O4IA 3IUCA 1C1BA 5I42A 1N36K 5FLXO 4BREA 5HRNA 4IO9L 4F3OA 3ZEUA 3CQXA 3HI0A 3SV3A 3DRPA 1XI1A 2P9KB 3ZETB 3KLIA 4F4KA 5T7BA 3K2PA 4HVJA 4JK8A 3I33A 3MN5A 1JLGA 3VQQA 4Z4FA 4BQZA 2E4LA 3K58A 3C6TA 1NK9A 4UQGA 3PV8A 1E4GT 1JXBA 2I7PA 1NGFA 3MK6A 3VESA 3CXCM 4CBUA 1T44A 4IFEA 5KGWA 3SK3A 1N5YA 3VQ9A 3O80A 3ITHA 1VQ9N 1Y97A 1HKCA 4LC9B 4XH1A 3QEPA 1GLBG 3K5LA 4DS5A 1X9SA 5E41A 3DLGA 3MCPA 4FLYA 5MLCQ 1VQKN 4N56A 2E2OA 3EY1A 3ZSXA 4B8AB 5AQUA 2A1SA 3ZSOA 2YHYA 1RNHA 5SZTA 2XRIA 4OPHA 4NO7A 2GUIA 3H46O 4K8ZA 3KK2A 2FBVA 3CPEA 1GLJO 2LSNA 2Q31A 4GMJB 1BUPA 3DXMA 3QDKA 3F9KA 3MN6A 5AQGA 3KKRA 4H4OA 1JL1A 3UB5A 2OZSA 2KQ2A 3KWIA 3P4IA 3WXKA 4MFBA 1BL3A 4JI3K 1NBWA 1FW6A 3LP0A 2VQEK 2P5GA 2O8BA 5EX5A 4PKGA 2E88A 1KD1O 3QEWA 3U6FA 4RG8A 1BI4B 3AVBA 2IDOA 3ZX2A 1TK8A 1VQ6N 5DM6L 3CMEN 1JLCA 1KVAA 2VG7A 3O1BA 4KAZA 4E1JA 4OKEA 4CHPA 4CJ7A 5C10A 3OHRA 4BWMA 3O9TA 1HMVA 3O8MA 2X78A 3LP2A 3W0LA 3QNNA 1S72N 1QVFM 5HRRA 1Q7YO 2HBJA 2QWPA 3I0RA 3TARA 2UU9K 4YFUA 1KSPA 5A2QO 2D4WA 4DV7K 5AZJB 4JI2K 1E4FT 3EO3A 3FZMA 3CF5L 2UUBK 5JLFA 2Y1IA 4Q0BA 4DUYK 3BP8A 2DFHA 1WBBA 3I8BA 4FLTA 4BR2A 4CJWA 3GL1A 1OH8A 4PL8A 4E1NA 4CJKA 1IKYA 3OJSA 3BUZB 3SI6A 1BO5O 3L2UA 2OPRA 4BRLA 1OH6A 2CGLA 4FPAA 1UWBA 4H0YB 3MECA 1JLQA 3B6PA 4KI4A 3MWTA 3MEDA 3H45C 4AILC 3O9UA 3C6HA 4OO1J 1NMDA 3THWB 4K0KK 4I6MA 3LDOA 1IV0A 3P5JA 4M45A 3GG4A 1VQ7N 5GIOA 4DU4A 4EHTA 5HBMA 3F9MA 1RDCA 5AQLA 2YNGA 2YNFA 4HUFA 2WUSA 4RTFD 4A62A 4WCEL 1WSFA 4JLHA 4JD2B 4KBOA 2ZJRL 4BRGA 3V6DA 1CXUA 4HTLA 3CERA 4KREA 4C1NI 2WONA 4BRQA 3CJAA 4FXDA 1OVQA 5J2NA 4IOAL 1YTAA 1J5EK 1MWKA 1GOAA 3CQ8A 4FM0A 1C0GA 3QLHA 4BR5A 3PO4A 2VG6A 1CLQA 4OX9K 1RTJA 4KHYA 1X9MA 4NCGA 1EXQA 4FZYA 4OKKA 2CH6A 3R8EA 4KH5A 4M3YA 3SYZA 3AA3A 4B9UA 4YDUC 4X66K 4Z4EA 4EP4A 3OYEA 5GAHP 4HCCA 4FPBA 3J81O 3I0SA 2E5LK 1KFSA 4CEOA 4K42A 1N32K 3TTCA 1BQMA 3TTFA 2OTLN 3ALYA 4J2BA 1TL1A 1W0HA 2P9SA 2Q2RA 4B8CA 2ZGYA 3O9RA 2B5JA 3THXB 4CZEA 3LAKA 3EYZA 4XH5A 3VF2A 4BDZA 2G8WA 1NGHA 5JS2A 2F8SA 2HHWA 1HQEA 4E19A 1TYQA 2D0PA 1RT2A 4FJLA 1HJRA 3TAQA 3FFKB 5HLFA 3K0SA 3AO3A 3CCJN 3EE8A 3DYAA 3OBYA 3Q7BA 4LFBK 1GLFO 2HHVA 4OPJA 4FWMA 3DOKA 4B1VA 3HM8A 3C6UA 4JHDA 1YVUA 3ATVA 3CJ9A 4DMNA 4PQUA 4DQSA 4IFVA 1V4SA 2UYTA 2QWLA 2NRWA 3W3DA 3AVGA 4BRFA 4FM2A 3AVCA 1NGDA 4JI1K 1QVGM 2VWJA 4H0TB 4WQ5A 1IO2A 4DR2K 1EWRA 3WXMB 4CESA 1BISA 4EFHA 2E2NA 4FWPA 2ZQBA 4H0OA 2I7NA 4ILJA 1X1PA 1ZYQA 3D2FA 2GBZA 3VQBA 4H5VA 3KLGA 4ID5A 4YOWA 4R5PA 4B3RK 5CZ1A 3QIPA 1GOBA 2NRTA 4IBNA 4WE1A 4LF9K 3MX5A 3EEQA 3HZ6A 3MCAB 3WXLA 2B4JA 4IO8A 4O5FA 2NRHA 3OYCA 4QS9A 2O8EB 3CJCA 3RMDA 3DMJA 5AQMA 2NZTA 1GLCG 5DM7L 5C15A 3NE6A 1KCFA 1GOCA 1U2VB 2KFNA 4JAXA 2RKIA 3VEXA 4JI0K 4X65K 3OYBA 4FJXA 1IG8A 3AVAA 2V7YA 3D2FB 2FF3B 1IKWA 1KAYA 4BRPA 1M1KO 5C2FA 3VQEA 2G8UA 1J9AA 3RR8A 1LW0A 5JVGL 2EWSA 4H8KA 1JL2A 3KTQA 5FPNA 1BHLA 3QESA 3NH1A 4AHCA 1N34K 1VSLA 1RT3A 3SZ2A 3LL3A 2WBNA 3CG7A 3HT3A 4JK9A 3OBWA 5GINA 4G9ZA 4QAGA 3D2EB 3PX4A 3HOTA 1N8RO 1RTHA 2RE2A 3L4IA 4GY2B 4DSJA 4M42A 2WC9A 3WUHA 4B1ZA 4DSFA 5KRTA 3Q7CA 3D0PA 4B9QA 1RT1A 5IT9O 1ZBUA 1EO1A 4M3RA 3O4WA 4CZFA 3G0ZA 2VYPA 3K9KA 5BN8A 3OS0A 4NCBA 3QINA 1T3VA 3PX0A 4CJRA 4ILGB 4JN4A 4FM1A 3CC2N 4IJNA 3ZYYX 4BG9A 2F4VK 1HKBA 3ZETA 4CJUA 3PIOL 1ILYA 1DEJA 3K59A 3DRSA 3T19A 4BG8A 1EETA 1YXQA 2BTFA 1RBUA 4WQ5C 4CZKA 2QWMA 1ASVA 1VSJA 4IFYA 1HJOA 4JRPA 1NKBA 4FJHA 3PLAA 1BGXT 3MEEA 3MN7A 5AQQA 4ZHRA 1KQSM 1JCEA 3QFUA 3HO1A 4CIGA 4C8MA 4Z94A 3KKSA 5H1SQ 2QWRA 5KRSA 1TK5A 4WFAL 3SUOA 4DTMA 3HXMA 4O44A 2CH5A 1IJJA 4ELVA 3HJFA 1BQNA 4BE0A 5LY3A 1VSFA 3CC7N 3IMXA 3LP1A 2YKMA 2P5OA 4JKDA 4PKIA 3HSCA 4BR9A 3NBPA 4MDBA 3T7ZA 3OA9A 3AA4A 4H5NA 3U3GA 4CZHA 4M7XA 5C42A 3WNEA 1G15A 1BWFO 1Q82O 4Z0UA 1EWQA 3ZX3A 3R6MA 3I56N 4J8FA 4ISFA 4OPAA 5C12A 4FK0A 4EZ9A 2G8KA 2VCPA 4WYBA 3SNNA 3U9DA 3CHWA 1BIUA 4CJQA 3LDLA 1NK5A 2VWBA 4H0PA 1T6DA 4KPYA 4F3TA 4A2AA 2IVOA 1DT9A 4CEFA 5E26A 3NGIA 1NJWA 1QZ5A 4XEIA 2DFFA 3SBTA 1FXXA 4AHUA 1P8ZA 4CJ4A 2B6AA 3VA3A 1N33K 4YY3K 2A1RA 1KLMA 4GNIA 1XNQK 3L0QA 4JKAA 3T1HK 1U49A 2WTUA 3D6RA 3L2VA 4AHTA 1XWLA 3VENA 5AQHA 1KAZA 1RBTA 1SAZA 1UAXA 5CY4A 5GIPA 3DM2A 4KHSA 4BQLA 5AJ3K 5AQFA 1M90O 4BRKA 4FWSA 2UXDK 3IS9A 4YOYA 1NGJA 4FVUA 2AJQA 2KZZA 4JKEA 2OANA 3C95A 1L3SA 5KQ8A 5EOYA 1D9FA 4O0JA 3L2WA 1LWFA 4B9MA 2UUCK 4FJJA 3AO4A 3NHGA 4EHUA 3WNFA 1RDDA 3RVCA 1ZC6A 2UUAK 1QSSA 1RDAA 1FJGK 4DTJA 4M3ZA 4B3OA 1YVNA 5AZIA 1RTDA 3LP3A 4KRFA 1U6ZA 4FJ5A 2HHSA 1RT5A 1C0MA 4J2AA 1Q86O 3VQ8A 4JI6K 2ZD1A 4K25A 4CJ5A 4GV9A 1VSMA 4FYDA 4DV1K 1S1VA 2GWJA 4CK1A 4YHHK 1NGGA 1SL2A 4I9QA 4JI7K 3NVMA 1NK4A 1RT4A 5EU7A 4DSEA 2P9IA 3VF4A 2ZF5O 4QCLA 4GW6A 4MO4A 3MXJA 1XHZA 1ASUA 3RR7A 1I3AA 3ZSVA 3FZKA 1HQUA 4FL9A 4NYFA 3BF1A 3SPYA 2BDPA 5AQXA 1LCUA 4X64K 4PY5A 1YJWN 2IOCA 4CGHA 4OLAA 1K8KB 3LWMA 3HYFA 5FDLA 3TSUA 3O3HA 4M41A 3MXIA 5JLHA 3AGRA 2CGJA 1DTQA 4Q5VA 3CCSN 4HHTA 3PO5A 1X9JA 4B3MK 3SV4A 2E6MA 1RFQA 4B3SK 4N41A 4OGCA 1NKCA 4CHOA 1IBKK 3VEYA 1VQ5N 4DU1A 3UKRA 1G99A 2NRZA 3J7ZO 4F2RA 1QS4A 5LJWA 3L2RA 3CM6A 4B1YB 3MMVA 2VWKA 3V9UA 1BG3A 1S6QA 4FOEA 4W5QA 3JYTA 3DLLL 2Q0RA 2QWOA 4RW9A 1WAJA 5KQDA 2NLXA 3VTHA 2P51A 3H6EA 3UKUB 3CCLN 3DLBA 3SBGA 1YI2N 2GX9A 2D5RA 2XHBA 2HNYA 4DB3A 1HPMA 4FWLA 5M1PA 2YHAA 3NF6A 1FK9A 1RDWX 4LH4A 1VQPN 3ULEB 3OYKA 5J2QA 4M3TA 4KHPK 2QTDA 2ZE2A 5BPNA 2RHKA 2W6KA 4DCHA 3HP9A 2IVPA 3ZSWA 2JWLA 3PUFA 4CFDA 1A5VA 2X6NA 2GUPA 4DR5K 4E1MA 1B92A 2DTUA 3WNHA 2YI1A 2QEXN 3AAQA 4C23A 1VSKA 2ITMA 2IC3A 3HSTB 3O3GA 1X3MA 3CJ1A 4DKWA 2YX6A 4B1XB 1S6PA 3CD6N 5TKWA 2JWKA 5BRDA 5AQWA 2HF4A 1NJXA 4CFCA 3TTDA 1VAZA 4IJAA 3O4NA 1B9DA 2A40A 4YORA 3RSEA 4I9LA 3SJHA 3TAMA 2QXLA 3QICA 3RTVA 4KHWA 4LF8K 3A0IX 1DGKN 3EN9A 4DLGA 3RMBA 3VQ4A 1U45A 3LDNA 1IG9A 1YJ9N 3SAFA 2ITGA 3QIOA 3HPGA 1VSIA 1KRPA 1T03A 2YNIA 3NF7A 1P90A 4BRDA 4FJIA 2D0BA 1SUQA 1SS6A 5FPEA 4KKOA 5EXWA 1U2VA 2V7ZA 5F2RA 3TPQA 3KK3A 4AHVA 2E1YA 1ZBLA 3GDQA 1NGAA 3V1QA 4DTUA 3VQ6A 1SKSA 1A5WA 4LF6K 3IKMA 4YDUA 4RW6A 3RSEB 1KXPA 3AO2A 3P39A 4LD0A 4DSKA 1SQKA 3AAPA 5AQSA 1TV6A 3K5MA 5FRNA 3V4IA 4OJRA 4J2DA 3QNOA 1S5JA 3ASMA 3FR0A 4CI6A 4BR0A 3OYIA 4JYAK 4AM6A 4DR4K 1B9FA 3HBTA 1D8YA 2G8IA 1NK7A 5CR4A 2HMPA 3CCEN 2VQFK 2ETJA 3SQ0A 1UA0A 4DQIA 4C1NK 5HRSA 3E1YA 4CK2A 3KVGA 5ADXA 4HTUA 1TUYA 3S3OA 4BC5A 2HBMA 2P9PA 1NGIA 3K57A 1X3NA 3B6OA 4IDHA 2HHXA 4B3TK 4NLBA 2GTDA 2KHOA 3MX2A 5JICA 3T3FA 1NJYA 2HVHA 3HVTA 4B1WB 4E0DA 4KTQA 2E1ZA 3VN5A 4A59A 1HR0K 3KK1A 3U3YA 1Z26A 2HNZA 3OTOK 1WSEA 4LFCK 3M8QA 2E2PA 4NLCA 5AQIA 1YIJN 3TSPA 3JS6A 3UE5A 3SMSA 3VA0A 4DLEA 5AQPA 1DTTA 4DUZK 5J2MA 2E8AA 3TABA 3T69A 3NGYA 3HM9A 3IAYA 4ILHA 1RGIA 4WF9L 2P9LA 4FK4A 3L4QA 4LF7K 4M3WA 1ESVA 4AH9A 3C7NA 3H3OB 3AVJA 4DHYA 3E66A 3TAGA 1VQMN 2FF6A 1K8KA 4F8RA 4YOTA 3BF3A 3AVNA 3AVMA 1WN7A 3H1QA 2ZM6K 1HNZK 3VMFB 2G8VA 2F96A 1TKDA 3P83D 2O8DB 2AA4A 4JKBA 4Y1CA 3CQYA 4Z4GA 1HX1A 3VEVA 4DTOA 4NXMK 4MQ3A 3M6GA 3CCRN 1MDUB 4E7JA 4FJKA 3G25A 5FPDA 2RPIA 4E7LA 4WQ4A 3J7AP 1VQ8N 3AVIA 1NU0A 3KK7A 2P9LB 5J2PA 4O8KA 3C7NB 1TL3A 3TWHA 2A42A 2V52B 4A2BA 4WFNL 3NF9A 4GVEA 1HNXK 4FLVA 3LPTA 4CZJA 5GAGP 4M63C 5GAEP 2A5XA 2X6SA 5M1FA 4H0VB 4RW7A 4CZMA 3AO5A 3U8XA 3OY9A 2A3ZA 2W40A 2O4GA 4K8XA 3VERA 1NOYA 2O8EA 2KTQA 5ADXH 3KD1E 1NK0A 4A57A 3MEGA 3WQUA 2O8CB 4JI8K 4DTRA 1ZBSA 3VF6A 4IEIA 3K5OA 3CM5A 5CYQA 3ZT2A 1BI4A 3BY5A 4WFBL 2F8TA 3HK2A 1QE1A 2NRXA 4AF1A 2F9TA 3AGKA 4K41A 1ATNA 4NYNA 2HW3A 2YV0X 3WQTA 3AVLA 4BACA 2J4RA 4CJFA 1QSYA 2HBKA 4CJVA 3OYJA 1Y64A 4KFBA 3NFAA 1QTMA 1ZBHA 3OYAA 4JEPA 1NGCA 3CCVN 4CD1A 2DFEA 5CE3A 2P9SB 1RBSA 4BGBA 3KJVA 1RDUA 5AZIB 4Z4HA 4BRMA 4J2EA 3SMPA 4BE2A 3S9HA 1JJ2M 2O8DA 3ZCMA 2EHGA 1JXEA 5IWAK 1K8AO 4CGJA 2F9WA 1QHAA 1S3XA 3NMUA 3F5TA 1BCOA 2V51B 1BOTO 3CFRA 3FZLA 4LF4K 1RDBA 3M8SA 4JS5A 1KVBA 3T1YK 1NJIO 3LAMA 3IDHA 3A5MC 3ID6A 4IEEA 1ATSA 2HHTA 1RBVA 1T7PA 1T6CA 1VQNN 2A6AA 4L3QA 1ITGA 1NK8A 4A5AA 3E9OA 1TAUA 3R3LA 1L3VA 1NG9A 2FXUA 4CVNE 4O55A 2Q97A 3OW2M 4I7FA 4N76A 3VQ7A 3DWLA 4CEDA 1I94K 4LF5K 4Z4CA 3AVHA 3JXUA 3ULDA 4CBWA 2ZWHA 4DQ8A 4GKKK 5AFUA 5LJVA 3FLCO 3C65A 3ZT4A 4OPKA 4CFAA 4CK3A 5DK5A 4BROA 3K9JA 4DFPA 2OTJN 5AQVA 1HYSA 4OLBA 4E7KA 3S41A 2W41A 3U4LA 3OJUA 3CPWM 4TSXA 1JLAA 4ISGA 2O8FB 3MAQA 2KW4A 1YAGA 2OPQA 3JSMA 4AQYK 2CGKA 3N4PA 3CETA 4CHZA 4AHRA 5AZJA 1WLJA 2P9KA 3THYB 4CF2A 2ASOA 1HNVA 3VEWA 3D45A 1XHXA 1WOQA 4JKGB 1EQYA 5BR9A 1S22A 1IKXA 3M5RA 3OS1A 4DQQA 3SJJA 2OPSA 1WAFA 2P9UB 1R0AA 4CEZA 4BDYA 3MDQA 2KLAA 4CIFA 4B9LA 2ASPA 4H0XB 3WEEB 2ATQA 4PUOA 4FWOA 2YKNA 1W2BM 2Z1JA 1SKWA 2EX3A 3CCUN 3UKRB 4JNEA 1MWMA 3CJBA 4DV5K 3THYA 1TGOA 4EP5A 2PYLA 1CZBA 2E6LA 5KI6A 4HCBA 3DAWA 4CEQA 1N6QA 2WFBA 5AQRA 1S1UA 3L2QA 1EKEA 3CCMN 1BA1A
chains in the Genus database with same CATH topology
1HNXK 4DV0K 2UU9K 4CVNE 5A2QO 1N34K 4DV7K 4DR5K 4CW7B 4DR1K 4DV4K 4JI2K 4JI6K 1I94K 4B3TK 4LF5K 4JI5K 2UUBK 4DV1K 4DUYK 4JV5K 4YHHK 4GKKK 5LMUK 4JI7K 3J80O 4DV3K 4LFBK 1IBMK 1HR0K 4JI8K 1HNWK 1XNRK 3OTOK 4DR7K 5IT9O 4LFCK 4X64K 4LF8K 4JI1K 1XMQK 4AQYK 4K0KK 4DUZK 4DR2K 2HHHK 1N33K 2UXBK 4DV2K 4B3MK 4YY3K 2F4VK 4B3SK 1XNQK 5BR8K 4LF7K 1IBLK 3T1HK 1IBKK 5LMNK 4B3RK 1XMOK 4DR6K 4JI3K 2ZM6K 2VQEK 1HNZK 4LF9K 4NXNK 5AJ3K 1J5EK 4LF6K 4V19S 4GKJK 5IWAK 2UXDK 4X62K 4OX9K 4NXMK 4JI4K 4LFAK 4DR3K 1N36K 5FLXO 3J7AP 2UXCK 4DV5K 2UUCK 4JI0K 4LF4K 3J7YP 5LL6Z 4X65K 4JYAK 4X66K 4DV6K 4DR4K 3T1YK 3J81O 3JAMO 2E5LK 2VQFK 2UUAK 4KHPK 1FJGK 1N32K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX K;  4DV0 K;  2UU9 K;  4CVN E;  5A2Q O;  1N34 K;  4DV7 K;  4DR5 K;  4CW7 B;  4DR1 K;  4DV4 K;  4JI2 K;  4JI6 K;  1I94 K;  4B3T K;  4LF5 K;  4JI5 K;  2UUB K;  4DV1 K;  4DUY K;  4JV5 K;  4YHH K;  4GKK K;  5LMU K;  4JI7 K;  3J80 O;  4DV3 K;  4LFB K;  1IBM K;  1HR0 K;  4JI8 K;  1HNW K;  1XNR K;  3OTO K;  4DR7 K;  5IT9 O;  4LFC K;  4X64 K;  4LF8 K;  4JI1 K;  1XMQ K;  4AQY K;  4K0K K;  4DUZ K;  4DR2 K;  2HHH K;  1N33 K;  2UXB K;  4DV2 K;  4B3M K;  4YY3 K;  2F4V K;  4B3S K;  1XNQ K;  5BR8 K;  4LF7 K;  1IBL K;  3T1H K;  1IBK K;  5LMN K;  4B3R K;  1XMO K;  4DR6 K;  4JI3 K;  2ZM6 K;  2VQE K;  1HNZ K;  4LF9 K;  4NXN K;  5AJ3 K;  1J5E K;  4LF6 K;  4V19 S;  4GKJ K;  5IWA K;  2UXD K;  4X62 K;  4OX9 K;  4NXM K;  4JI4 K;  4LFA K;  4DR3 K;  1N36 K;  5FLX O;  3J7A P;  2UXC K;  4DV5 K;  2UUC K;  4JI0 K;  4LF4 K;  3J7Y P;  5LL6 Z;  4X65 K;  4JYA K;  4X66 K;  4DV6 K;  4DR4 K;  3T1Y K;  3J81 O;  3JAM O;  2E5L K;  2VQF K;  2UUA K;  4KHP K;  1FJG K;  1N32 K; 
#chains in the Genus database with same CATH topology
 3CC4 N;  1JLB A;  3E9L A;  1YIT N;  3F73 A;  4B9N A;  3V1O A;  1WSI A;  4BC3 A;  3ATU A;  1VHX A;  3A5O C;  2RF2 A;  4B1U B;  3DRR A;  5BPM A;  3RMC A;  4CF1 A;  2YHW A;  5KPT A;  3HVR A;  1C1A A;  5F1X A;  2ZGZ A;  4ELU A;  2OCE A;  3DI6 A;  1TAQ A;  3V9S A;  2P9I B;  2P9P B;  4C8O A;  1WB9 A;  4IG3 A;  1VQO N;  1T05 A;  5AQZ A;  3D7E O;  2QWQ A;  1HNW K;  1JCF A;  1XNR K;  3A8Y A;  4IDK A;  3TU5 A;  1SV5 A;  1QQO A;  2ZJQ L;  3V9X A;  2QKK A;  5KTQ A;  2KFZ A;  1Q9Y A;  1YF5 L;  2FC0 A;  1OH7 A;  4GV6 A;  3C0B A;  2FSK A;  1W7A A;  4Y0W A;  3VEZ A;  4JKG A;  2Q0U A;  2Q3S A;  4FJM A;  3LZI A;  2W6L A;  4YOU A;  4FW2 A;  3G4S N;  4BRC A;  3QEI A;  1VQ4 N;  1IKV A;  1KC8 O;  4WQ4 C;  3R9P A;  1SKR A;  1ZXO A;  1SZ2 A;  1X9W A;  3SQ1 A;  2Z1H A;  1LAV A;  4FJN A;  3WEE A;  3DJC A;  1TUU A;  4CHY A;  4FK2 A;  3G6E N;  1L3U A;  2QW9 A;  4V19 S;  4KTW A;  4FWN A;  4U67 L;  4Z4I A;  3VGK A;  4JI4 K;  2YJE A;  2YHB A;  4FVM A;  4BC4 A;  4W5T A;  4GVM A;  4LFA K;  3AVK A;  1E3M A;  4DR3 K;  2AP1 A;  3U9Z A;  3KZB A;  3TI0 A;  2D0O A;  1R59 O;  4BRN A;  3ENO A;  3TAE A;  1CXQ A;  1HLU A;  4DFJ A;  4FLX A;  3SQ4 A;  1JKH A;  2I5J A;  3C6A A;  4N5S A;  1F21 A;  2FBT A;  2Q1N A;  3O4Q A;  2QXF A;  3AV9 A;  2YCH A;  3ZT3 A;  1KVC A;  3OYF A;  3NVK A;  2XY5 A;  4LH5 A;  1D9D A;  4IOX A;  3LM9 A;  4CER A;  4DTN A;  4NCA A;  4MLE A;  1HKG A;  1RCH A;  4JK7 A;  2QI2 A;  5AQT A;  4JI5 K;  2HBL A;  4FSV A;  3EL2 A;  4CJP A;  1BDG A;  5LMU K;  3KD5 E;  5AQK A;  1IH7 A;  3O3F A;  5M1O A;  3PIP L;  3SUP A;  2P9U A;  2XY6 A;  4BGA A;  1ASW A;  3HL8 A;  3MXM A;  4DQP A;  4DR7 K;  1NWK A;  3R1X A;  4HUE A;  4YOV A;  4F9O A;  4CEA A;  5HL7 L;  1KTQ A;  5K14 A;  4KV8 A;  4BR4 A;  5AR0 A;  2DPN A;  1VSE A;  3VTI A;  4KB1 A;  1BU6 O;  1BCM A;  4DV2 K;  3LAL A;  2OPP A;  3O1W A;  3KWG A;  1HUX A;  3QBX A;  4DG1 A;  2HF3 A;  1Q18 A;  2FLO A;  5KPZ A;  4N47 A;  5LMN K;  2O8F A;  4CEB A;  3ENH A;  3NDK A;  4ZTF A;  4GV3 A;  3P1G A;  4CGI A;  3HPH A;  2VGN A;  3ZT0 A;  1W9H A;  1ZBF A;  1QQC A;  2PFU A;  4CD3 A;  3M8R A;  3ZT1 A;  1RIL A;  2YJF A;  4ID1 A;  4H5W A;  4KTZ A;  3THV A;  5AQO A;  2NNW A;  1K73 O;  2QKB A;  3P38 A;  2W42 A;  2PZS A;  4DF4 A;  3DLH A;  4CZL A;  4R79 A;  3KLH A;  3BGR A;  3DOL A;  1T8E A;  4M3X A;  4CF9 A;  5I3U A;  3RMA A;  4C8N A;  4DWI A;  1RT6 A;  3PY8 A;  3THX A;  5CZ2 A;  4JRQ A;  2DY4 A;  5AQJ A;  4B08 A;  4BC2 A;  2GEL A;  3A5L C;  5J1E A;  4FLZ A;  4IOC L;  2PBD A;  3JAM O;  3LAN A;  4PL7 A;  1GLA G;  4DFM A;  1Q81 O;  2R7Y A;  4FLU A;  5HP1 A;  4M7Y A;  1BIZ A;  3OYN A;  3V9W A;  1WSJ A;  1Z05 A;  2BE2 A;  1S1X A;  4OGE A;  5I9E B;  4F2S A;  4FOI A;  4K43 A;  1C0U A;  2E2Q A;  2RN2 A;  1U48 A;  2QK9 A;  2YHX A;  3RWU A;  5TKY A;  3VOV A;  3A2F A;  5CHI A;  1JLF A;  1KFD A;  1NMN A;  1NJZ A;  3CI5 A;  3H3N O;  5BRH A;  3AA2 A;  5BRF A;  1SL0 A;  3BEX A;  2X74 A;  4IZ9 A;  1NGB A;  3A5N C;  1NNE A;  3QER A;  1LAW A;  4H5R A;  4QS7 A;  3ZEU B;  1WUA A;  3O9S A;  1S1T A;  2PY5 A;  3N4Q A;  5EY4 A;  4FJ8 A;  1L3T A;  1XC9 A;  2D0C A;  2Z1I A;  1TKZ A;  3NAE A;  4CJS A;  1NK6 A;  5C24 A;  1J5O A;  4DU3 A;  1BA0 A;  1XMQ K;  4FZZ A;  3SAG A;  2GEM A;  3BZC A;  3QET A;  1WSH A;  3ENB A;  4RW8 A;  3CJ7 A;  2P1J A;  2HHH K;  4IG0 A;  2IAJ A;  3UIQ A;  1IBL K;  4AHS A;  3V81 A;  4U7B A;  4RWT A;  4O4G A;  1QQN A;  3DXK A;  4B9T A;  5M1K A;  5HRO A;  3E01 A;  3LDP A;  4CGF A;  1QZ6 A;  3TR8 A;  4JKF A;  3KIO A;  1VQL N;  1RTI A;  4GKJ K;  5JVH L;  4BE1 A;  4DSI A;  5FPM A;  3WNG A;  3CCQ N;  4G1Q A;  4RCH A;  3RRG A;  4DSL A;  2HMI A;  4LSL A;  4E7H A;  4H03 B;  1D5A A;  3DXK B;  4BRI A;  2WOM A;  3L3U A;  3V1R A;  3VQD A;  3J7Y P;  3SLC A;  2NRR A;  3DXM B;  2IIR A;  2Q36 A;  5AQN A;  3ID8 A;  3VQ5 A;  4I2Q A;  2XO7 A;  4CF0 A;  3SAH A;  4M3U A;  4BDP A;  3QML A;  3TAP A;  3AVF A;  2PAV A;  3O08 A;  1LOT B;  4CJ3 A;  3OYM A;  1DLO A;  2XY8 A;  3CFP A;  1U47 A;  4EZ6 A;  3NH2 A;  4CGG A;  3OS2 A;  1V4T A;  3FE1 A;  3B8A X;  4FJ9 A;  1YJN N;  1OH5 A;  2ZJP L;  1TKX A;  3O5B A;  5FRO A;  2GWK A;  1EP4 A;  2HST A;  4CW7 B;  3ULE A;  2QM1 A;  5EVZ A;  3AO1 A;  1REV A;  2FBX A;  5JMV A;  3C94 A;  3AAR A;  4JV5 K;  2FSN A;  1SL1 A;  3V9Z A;  3QEX A;  4CCH A;  5BPL A;  4ICL A;  3HP6 A;  3M8P A;  3J80 O;  2O8C A;  3SUQ A;  3EKU A;  4CJL A;  3VGM A;  4JS4 A;  4JKC A;  5HRP A;  1XUP O;  4NB4 A;  3LPU A;  4FWK A;  1Z6R A;  4FJG A;  1VSD A;  5CYM A;  3OYH A;  4CF8 A;  3SQ2 A;  3TSQ A;  3ZSZ A;  1UOC A;  1OVY A;  2BAN A;  3IRX A;  3QB0 A;  1D4X A;  4BWJ A;  4FWR A;  4KI6 A;  4H4M A;  2IS3 A;  1S1W A;  2UXB K;  3EZW A;  3HTV A;  4EAH D;  3G71 N;  4FJ7 A;  4O8U A;  3L8B A;  4PHT X;  4HWI A;  4L8R B;  1XQS C;  2H3G X;  1WSG A;  3O6W A;  4DR6 K;  3E9P A;  2OA8 A;  4CBX A;  1EX4 A;  5F0X A;  2HND A;  4NXN K;  1J54 A;  1GLD G;  4IWV A;  1H1V A;  1Z25 A;  5B8H A;  4A61 A;  3DLR A;  1C6V A;  3QEV A;  5C25 A;  2OZM A;  3VPZ A;  2HHQ A;  3MN9 A;  5DMR A;  1NGE A;  1S9E A;  1HYV A;  2BGG A;  3BZK A;  4MO5 A;  4CIE A;  3WXJ A;  5C0Y A;  3NH0 A;  3IG1 A;  3S3N A;  5LL6 Z;  3CFO A;  5AQY A;  4AM7 A;  1UA1 A;  5ELZ A;  3J8A A;  2A41 A;  3EZ5 A;  4IXC A;  2Z1G A;  4CFB A;  2NUB A;  1YTU A;  4PWD A;  1A5X A;  4DV0 K;  4KO0 A;  4FLW A;  2BUP A;  4CJT A;  3LDS A;  2YNH A;  4DR1 K;  1VRU A;  3H1V X;  4CEE A;  3RRH A;  1NKE A;  3NF8 A;  1TKT A;  4UY8 O;  2D1K A;  3I55 N;  1QSL A;  1HRH A;  4OKJ A;  3WT0 A;  2HOE A;  3CYM A;  3BDP A;  4BVO A;  1Q8I A;  3S3M A;  3SPZ A;  3TAF A;  4KHU A;  3LWL A;  4CHQ A;  4KH4 A;  3H08 A;  1GLL O;  4E3S A;  3PSI A;  3L6Q A;  1NOZ A;  4DV3 K;  3ZX0 A;  3OYL A;  2O8B B;  2IVN A;  4DTX A;  4ZTJ A;  2G8H A;  3AA5 X;  3QFP A;  3G10 A;  2F7T A;  1WBD A;  4KB0 A;  5KGX A;  4O0I A;  5BN9 A;  5M1Q A;  4QS8 A;  1JCG A;  2HVI A;  4MDA A;  2FBY A;  1VRT A;  3P31 A;  4CE9 A;  4LSN A;  3OYD A;  4MLH A;  1C0T A;  1VSH A;  3PX6 A;  1WNS A;  3ZSY A;  2KZM A;  3QO9 A;  2VG5 A;  1C1C A;  1JLE A;  3LM2 A;  4FZX C;  1S9G A;  3ZSR A;  1NLV A;  4ELT A;  4C8K A;  4FO0 A;  1FKO A;  4FW1 A;  2BH1 A;  1XMO K;  4DS4 A;  1L5U A;  1ZBI A;  1YT3 A;  4DFK A;  4BY9 C;  3FZF A;  2HHU A;  2FSJ A;  4BVP A;  1QHT A;  2XY7 A;  3VQC A;  4JHD B;  3GE1 A;  1O1W A;  4LY7 A;  4XIU A;  4CZI A;  3KLF A;  2ASM A;  3NCI A;  3HRG A;  3VQA A;  5BRE A;  3PSF A;  4OVL A;  2QA4 N;  2JGU A;  1HPZ A;  2P9N A;  3OVN A;  1GLE G;  4CHN A;  1O13 A;  3OYG A;  3ZLJ A;  5FRM A;  4B9V A;  5AFU H;  3SCX A;  2UXC K;  2IGI A;  4B9S A;  3M3Z A;  5M1N A;  4DV6 K;  1HYZ A;  3IFR A;  1XC3 A;  3D2E A;  3CMA N;  1MU2 A;  3AY9 A;  1YHQ N;  2OYQ A;  1RT7 A;  1CZA N;  5JS1 A;  2E20 A;  4JKH A;  5GAD P;  4I6M B;  3KLE A;  4FWQ A;  4DQR A;  4KHN A;  3O9Q A;  5D3G A;  1MA9 B;  1NM1 A;  4KHQ A;  3FFI A;  3ISN C;  1LV5 A;  4DV4 K;  1KAX A;  4YOX A;  5C2D A;  1I39 A;  5KPR A;  3VQP A;  2P9N B;  4HUG A;  3TAN A;  4E7I A;  3L3V A;  2G8F A;  4YNQ A;  4CEC A;  3DLK A;  2VGM A;  3THW A;  1Q9X A;  1KLN A;  2D0A A;  1ATR A;  4CJE A;  1RBR A;  3I8D A;  1IBM K;  1FKP A;  1U04 A;  2NRV A;  1LW2 A;  3DLE A;  1HNI A;  4DTP A;  3MWP A;  3T1A A;  4QOZ B;  1LWE A;  3M1F A;  1J6Z A;  3VGL A;  3K5N A;  4JD2 A;  5E84 A;  2JLE A;  1K6Y A;  4Y1D A;  4O5B A;  2GV9 A;  3FGU A;  3WXI A;  1OKJ A;  1K9M O;  4W5O A;  1LWC A;  4A5B A;  4DF8 A;  4PKH A;  4BRH A;  3VET A;  1TVR A;  3HOS A;  4XH4 A;  5BR8 K;  3GOI A;  1YUW A;  3QBW A;  3HPO A;  3EKS A;  3KHY A;  3VEO A;  5HOO A;  1QQM A;  4RW4 A;  2Y1J A;  4EIA A;  1CZ9 A;  4I2P A;  4CZG A;  3SUN A;  1C0F A;  3UKU A;  4KH6 A;  4FCY A;  5SWM A;  3FZH A;  3GBT A;  4PA1 A;  4H5T A;  4ISE A;  4CGD A;  1VK0 A;  4E89 A;  3F2K A;  2KKZ A;  1DKG D;  2HB5 A;  2QWN A;  3CIP A;  4BR7 A;  4W5N A;  3EE9 A;  1TK0 A;  1U4B A;  3LZJ A;  4DTS A;  1W97 L;  4X62 K;  1TYQ B;  4W5R A;  2PYJ A;  3LDQ A;  3ZSQ A;  4IKF A;  4BRA A;  4C8L A;  3NGZ A;  1J53 A;  2O4I A;  3IUC A;  1C1B A;  5I42 A;  1N36 K;  5FLX O;  4BRE A;  5HRN A;  4IO9 L;  4F3O A;  3ZEU A;  3CQX A;  3HI0 A;  3SV3 A;  3DRP A;  1XI1 A;  2P9K B;  3ZET B;  3KLI A;  4F4K A;  5T7B A;  3K2P A;  4HVJ A;  4JK8 A;  3I33 A;  3MN5 A;  1JLG A;  3VQQ A;  4Z4F A;  4BQZ A;  2E4L A;  3K58 A;  3C6T A;  1NK9 A;  4UQG A;  3PV8 A;  1E4G T;  1JXB A;  2I7P A;  1NGF A;  3MK6 A;  3VES A;  3CXC M;  4CBU A;  1T44 A;  4IFE A;  5KGW A;  3SK3 A;  1N5Y A;  3VQ9 A;  3O80 A;  3ITH A;  1VQ9 N;  1Y97 A;  1HKC A;  4LC9 B;  4XH1 A;  3QEP A;  1GLB G;  3K5L A;  4DS5 A;  1X9S A;  5E41 A;  3DLG A;  3MCP A;  4FLY A;  5MLC Q;  1VQK N;  4N56 A;  2E2O A;  3EY1 A;  3ZSX A;  4B8A B;  5AQU A;  2A1S A;  3ZSO A;  2YHY A;  1RNH A;  5SZT A;  2XRI A;  4OPH A;  4NO7 A;  2GUI A;  3H46 O;  4K8Z A;  3KK2 A;  2FBV A;  3CPE A;  1GLJ O;  2LSN A;  2Q31 A;  4GMJ B;  1BUP A;  3DXM A;  3QDK A;  3F9K A;  3MN6 A;  5AQG A;  3KKR A;  4H4O A;  1JL1 A;  3UB5 A;  2OZS A;  2KQ2 A;  3KWI A;  3P4I A;  3WXK A;  4MFB A;  1BL3 A;  4JI3 K;  1NBW A;  1FW6 A;  3LP0 A;  2VQE K;  2P5G A;  2O8B A;  5EX5 A;  4PKG A;  2E88 A;  1KD1 O;  3QEW A;  3U6F A;  4RG8 A;  1BI4 B;  3AVB A;  2IDO A;  3ZX2 A;  1TK8 A;  1VQ6 N;  5DM6 L;  3CME N;  1JLC A;  1KVA A;  2VG7 A;  3O1B A;  4KAZ A;  4E1J A;  4OKE A;  4CHP A;  4CJ7 A;  5C10 A;  3OHR A;  4BWM A;  3O9T A;  1HMV A;  3O8M A;  2X78 A;  3LP2 A;  3W0L A;  3QNN A;  1S72 N;  1QVF M;  5HRR A;  1Q7Y O;  2HBJ A;  2QWP A;  3I0R A;  3TAR A;  2UU9 K;  4YFU A;  1KSP A;  5A2Q O;  2D4W A;  4DV7 K;  5AZJ B;  4JI2 K;  1E4F T;  3EO3 A;  3FZM A;  3CF5 L;  2UUB K;  5JLF A;  2Y1I A;  4Q0B A;  4DUY K;  3BP8 A;  2DFH A;  1WBB A;  3I8B A;  4FLT A;  4BR2 A;  4CJW A;  3GL1 A;  1OH8 A;  4PL8 A;  4E1N A;  4CJK A;  1IKY A;  3OJS A;  3BUZ B;  3SI6 A;  1BO5 O;  3L2U A;  2OPR A;  4BRL A;  1OH6 A;  2CGL A;  4FPA A;  1UWB A;  4H0Y B;  3MEC A;  1JLQ A;  3B6P A;  4KI4 A;  3MWT A;  3MED A;  3H45 C;  4AIL C;  3O9U A;  3C6H A;  4OO1 J;  1NMD A;  3THW B;  4K0K K;  4I6M A;  3LDO A;  1IV0 A;  3P5J A;  4M45 A;  3GG4 A;  1VQ7 N;  5GIO A;  4DU4 A;  4EHT A;  5HBM A;  3F9M A;  1RDC A;  5AQL A;  2YNG A;  2YNF A;  4HUF A;  2WUS A;  4RTF D;  4A62 A;  4WCE L;  1WSF A;  4JLH A;  4JD2 B;  4KBO A;  2ZJR L;  4BRG A;  3V6D A;  1CXU A;  4HTL A;  3CER A;  4KRE A;  4C1N I;  2WON A;  4BRQ A;  3CJA A;  4FXD A;  1OVQ A;  5J2N A;  4IOA L;  1YTA A;  1J5E K;  1MWK A;  1GOA A;  3CQ8 A;  4FM0 A;  1C0G A;  3QLH A;  4BR5 A;  3PO4 A;  2VG6 A;  1CLQ A;  4OX9 K;  1RTJ A;  4KHY A;  1X9M A;  4NCG A;  1EXQ A;  4FZY A;  4OKK A;  2CH6 A;  3R8E A;  4KH5 A;  4M3Y A;  3SYZ A;  3AA3 A;  4B9U A;  4YDU C;  4X66 K;  4Z4E A;  4EP4 A;  3OYE A;  5GAH P;  4HCC A;  4FPB A;  3J81 O;  3I0S A;  2E5L K;  1KFS A;  4CEO A;  4K42 A;  1N32 K;  3TTC A;  1BQM A;  3TTF A;  2OTL N;  3ALY A;  4J2B A;  1TL1 A;  1W0H A;  2P9S A;  2Q2R A;  4B8C A;  2ZGY A;  3O9R A;  2B5J A;  3THX B;  4CZE A;  3LAK A;  3EYZ A;  4XH5 A;  3VF2 A;  4BDZ A;  2G8W A;  1NGH A;  5JS2 A;  2F8S A;  2HHW A;  1HQE A;  4E19 A;  1TYQ A;  2D0P A;  1RT2 A;  4FJL A;  1HJR A;  3TAQ A;  3FFK B;  5HLF A;  3K0S A;  3AO3 A;  3CCJ N;  3EE8 A;  3DYA A;  3OBY A;  3Q7B A;  4LFB K;  1GLF O;  2HHV A;  4OPJ A;  4FWM A;  3DOK A;  4B1V A;  3HM8 A;  3C6U A;  4JHD A;  1YVU A;  3ATV A;  3CJ9 A;  4DMN A;  4PQU A;  4DQS A;  4IFV A;  1V4S A;  2UYT A;  2QWL A;  2NRW A;  3W3D A;  3AVG A;  4BRF A;  4FM2 A;  3AVC A;  1NGD A;  4JI1 K;  1QVG M;  2VWJ A;  4H0T B;  4WQ5 A;  1IO2 A;  4DR2 K;  1EWR A;  3WXM B;  4CES A;  1BIS A;  4EFH A;  2E2N A;  4FWP A;  2ZQB A;  4H0O A;  2I7N A;  4ILJ A;  1X1P A;  1ZYQ A;  3D2F A;  2GBZ A;  3VQB A;  4H5V A;  3KLG A;  4ID5 A;  4YOW A;  4R5P A;  4B3R K;  5CZ1 A;  3QIP A;  1GOB A;  2NRT A;  4IBN A;  4WE1 A;  4LF9 K;  3MX5 A;  3EEQ A;  3HZ6 A;  3MCA B;  3WXL A;  2B4J A;  4IO8 A;  4O5F A;  2NRH A;  3OYC A;  4QS9 A;  2O8E B;  3CJC A;  3RMD A;  3DMJ A;  5AQM A;  2NZT A;  1GLC G;  5DM7 L;  5C15 A;  3NE6 A;  1KCF A;  1GOC A;  1U2V B;  2KFN A;  4JAX A;  2RKI A;  3VEX A;  4JI0 K;  4X65 K;  3OYB A;  4FJX A;  1IG8 A;  3AVA A;  2V7Y A;  3D2F B;  2FF3 B;  1IKW A;  1KAY A;  4BRP A;  1M1K O;  5C2F A;  3VQE A;  2G8U A;  1J9A A;  3RR8 A;  1LW0 A;  5JVG L;  2EWS A;  4H8K A;  1JL2 A;  3KTQ A;  5FPN A;  1BHL A;  3QES A;  3NH1 A;  4AHC A;  1N34 K;  1VSL A;  1RT3 A;  3SZ2 A;  3LL3 A;  2WBN A;  3CG7 A;  3HT3 A;  4JK9 A;  3OBW A;  5GIN A;  4G9Z A;  4QAG A;  3D2E B;  3PX4 A;  3HOT A;  1N8R O;  1RTH A;  2RE2 A;  3L4I A;  4GY2 B;  4DSJ A;  4M42 A;  2WC9 A;  3WUH A;  4B1Z A;  4DSF A;  5KRT A;  3Q7C A;  3D0P A;  4B9Q A;  1RT1 A;  5IT9 O;  1ZBU A;  1EO1 A;  4M3R A;  3O4W A;  4CZF A;  3G0Z A;  2VYP A;  3K9K A;  5BN8 A;  3OS0 A;  4NCB A;  3QIN A;  1T3V A;  3PX0 A;  4CJR A;  4ILG B;  4JN4 A;  4FM1 A;  3CC2 N;  4IJN A;  3ZYY X;  4BG9 A;  2F4V K;  1HKB A;  3ZET A;  4CJU A;  3PIO L;  1ILY A;  1DEJ A;  3K59 A;  3DRS A;  3T19 A;  4BG8 A;  1EET A;  1YXQ A;  2BTF A;  1RBU A;  4WQ5 C;  4CZK A;  2QWM A;  1ASV A;  1VSJ A;  4IFY A;  1HJO A;  4JRP A;  1NKB A;  4FJH A;  3PLA A;  1BGX T;  3MEE A;  3MN7 A;  5AQQ A;  4ZHR A;  1KQS M;  1JCE A;  3QFU A;  3HO1 A;  4CIG A;  4C8M A;  4Z94 A;  3KKS A;  5H1S Q;  2QWR A;  5KRS A;  1TK5 A;  4WFA L;  3SUO A;  4DTM A;  3HXM A;  4O44 A;  2CH5 A;  1IJJ A;  4ELV A;  3HJF A;  1BQN A;  4BE0 A;  5LY3 A;  1VSF A;  3CC7 N;  3IMX A;  3LP1 A;  2YKM A;  2P5O A;  4JKD A;  4PKI A;  3HSC A;  4BR9 A;  3NBP A;  4MDB A;  3T7Z A;  3OA9 A;  3AA4 A;  4H5N A;  3U3G A;  4CZH A;  4M7X A;  5C42 A;  3WNE A;  1G15 A;  1BWF O;  1Q82 O;  4Z0U A;  1EWQ A;  3ZX3 A;  3R6M A;  3I56 N;  4J8F A;  4ISF A;  4OPA A;  5C12 A;  4FK0 A;  4EZ9 A;  2G8K A;  2VCP A;  4WYB A;  3SNN A;  3U9D A;  3CHW A;  1BIU A;  4CJQ A;  3LDL A;  1NK5 A;  2VWB A;  4H0P A;  1T6D A;  4KPY A;  4F3T A;  4A2A A;  2IVO A;  1DT9 A;  4CEF A;  5E26 A;  3NGI A;  1NJW A;  1QZ5 A;  4XEI A;  2DFF A;  3SBT A;  1FXX A;  4AHU A;  1P8Z A;  4CJ4 A;  2B6A A;  3VA3 A;  1N33 K;  4YY3 K;  2A1R A;  1KLM A;  4GNI A;  1XNQ K;  3L0Q A;  4JKA A;  3T1H K;  1U49 A;  2WTU A;  3D6R A;  3L2V A;  4AHT A;  1XWL A;  3VEN A;  5AQH A;  1KAZ A;  1RBT A;  1SAZ A;  1UAX A;  5CY4 A;  5GIP A;  3DM2 A;  4KHS A;  4BQL A;  5AJ3 K;  5AQF A;  1M90 O;  4BRK A;  4FWS A;  2UXD K;  3IS9 A;  4YOY A;  1NGJ A;  4FVU A;  2AJQ A;  2KZZ A;  4JKE A;  2OAN A;  3C95 A;  1L3S A;  5KQ8 A;  5EOY A;  1D9F A;  4O0J A;  3L2W A;  1LWF A;  4B9M A;  2UUC K;  4FJJ A;  3AO4 A;  3NHG A;  4EHU A;  3WNF A;  1RDD A;  3RVC A;  1ZC6 A;  2UUA K;  1QSS A;  1RDA A;  1FJG K;  4DTJ A;  4M3Z A;  4B3O A;  1YVN A;  5AZI A;  1RTD A;  3LP3 A;  4KRF A;  1U6Z A;  4FJ5 A;  2HHS A;  1RT5 A;  1C0M A;  4J2A A;  1Q86 O;  3VQ8 A;  4JI6 K;  2ZD1 A;  4K25 A;  4CJ5 A;  4GV9 A;  1VSM A;  4FYD A;  4DV1 K;  1S1V A;  2GWJ A;  4CK1 A;  4YHH K;  1NGG A;  1SL2 A;  4I9Q A;  4JI7 K;  3NVM A;  1NK4 A;  1RT4 A;  5EU7 A;  4DSE A;  2P9I A;  3VF4 A;  2ZF5 O;  4QCL A;  4GW6 A;  4MO4 A;  3MXJ A;  1XHZ A;  1ASU A;  3RR7 A;  1I3A A;  3ZSV A;  3FZK A;  1HQU A;  4FL9 A;  4NYF A;  3BF1 A;  3SPY A;  2BDP A;  5AQX A;  1LCU A;  4X64 K;  4PY5 A;  1YJW N;  2IOC A;  4CGH A;  4OLA A;  1K8K B;  3LWM A;  3HYF A;  5FDL A;  3TSU A;  3O3H A;  4M41 A;  3MXI A;  5JLH A;  3AGR A;  2CGJ A;  1DTQ A;  4Q5V A;  3CCS N;  4HHT A;  3PO5 A;  1X9J A;  4B3M K;  3SV4 A;  2E6M A;  1RFQ A;  4B3S K;  4N41 A;  4OGC A;  1NKC A;  4CHO A;  1IBK K;  3VEY A;  1VQ5 N;  4DU1 A;  3UKR A;  1G99 A;  2NRZ A;  3J7Z O;  4F2R A;  1QS4 A;  5LJW A;  3L2R A;  3CM6 A;  4B1Y B;  3MMV A;  2VWK A;  3V9U A;  1BG3 A;  1S6Q A;  4FOE A;  4W5Q A;  3JYT A;  3DLL L;  2Q0R A;  2QWO A;  4RW9 A;  1WAJ A;  5KQD A;  2NLX A;  3VTH A;  2P51 A;  3H6E A;  3UKU B;  3CCL N;  3DLB A;  3SBG A;  1YI2 N;  2GX9 A;  2D5R A;  2XHB A;  2HNY A;  4DB3 A;  1HPM A;  4FWL A;  5M1P A;  2YHA A;  3NF6 A;  1FK9 A;  1RDW X;  4LH4 A;  1VQP N;  3ULE B;  3OYK A;  5J2Q A;  4M3T A;  4KHP K;  2QTD A;  2ZE2 A;  5BPN A;  2RHK A;  2W6K A;  4DCH A;  3HP9 A;  2IVP A;  3ZSW A;  2JWL A;  3PUF A;  4CFD A;  1A5V A;  2X6N A;  2GUP A;  4DR5 K;  4E1M A;  1B92 A;  2DTU A;  3WNH A;  2YI1 A;  2QEX N;  3AAQ A;  4C23 A;  1VSK A;  2ITM A;  2IC3 A;  3HST B;  3O3G A;  1X3M A;  3CJ1 A;  4DKW A;  2YX6 A;  4B1X B;  1S6P A;  3CD6 N;  5TKW A;  2JWK A;  5BRD A;  5AQW A;  2HF4 A;  1NJX A;  4CFC A;  3TTD A;  1VAZ A;  4IJA A;  3O4N A;  1B9D A;  2A40 A;  4YOR A;  3RSE A;  4I9L A;  3SJH A;  3TAM A;  2QXL A;  3QIC A;  3RTV A;  4KHW A;  4LF8 K;  3A0I X;  1DGK N;  3EN9 A;  4DLG A;  3RMB A;  3VQ4 A;  1U45 A;  3LDN A;  1IG9 A;  1YJ9 N;  3SAF A;  2ITG A;  3QIO A;  3HPG A;  1VSI A;  1KRP A;  1T03 A;  2YNI A;  3NF7 A;  1P90 A;  4BRD A;  4FJI A;  2D0B A;  1SUQ A;  1SS6 A;  5FPE A;  4KKO A;  5EXW A;  1U2V A;  2V7Z A;  5F2R A;  3TPQ A;  3KK3 A;  4AHV A;  2E1Y A;  1ZBL A;  3GDQ A;  1NGA A;  3V1Q A;  4DTU A;  3VQ6 A;  1SKS A;  1A5W A;  4LF6 K;  3IKM A;  4YDU A;  4RW6 A;  3RSE B;  1KXP A;  3AO2 A;  3P39 A;  4LD0 A;  4DSK A;  1SQK A;  3AAP A;  5AQS A;  1TV6 A;  3K5M A;  5FRN A;  3V4I A;  4OJR A;  4J2D A;  3QNO A;  1S5J A;  3ASM A;  3FR0 A;  4CI6 A;  4BR0 A;  3OYI A;  4JYA K;  4AM6 A;  4DR4 K;  1B9F A;  3HBT A;  1D8Y A;  2G8I A;  1NK7 A;  5CR4 A;  2HMP A;  3CCE N;  2VQF K;  2ETJ A;  3SQ0 A;  1UA0 A;  4DQI A;  4C1N K;  5HRS A;  3E1Y A;  4CK2 A;  3KVG A;  5ADX A;  4HTU A;  1TUY A;  3S3O A;  4BC5 A;  2HBM A;  2P9P A;  1NGI A;  3K57 A;  1X3N A;  3B6O A;  4IDH A;  2HHX A;  4B3T K;  4NLB A;  2GTD A;  2KHO A;  3MX2 A;  5JIC A;  3T3F A;  1NJY A;  2HVH A;  3HVT A;  4B1W B;  4E0D A;  4KTQ A;  2E1Z A;  3VN5 A;  4A59 A;  1HR0 K;  3KK1 A;  3U3Y A;  1Z26 A;  2HNZ A;  3OTO K;  1WSE A;  4LFC K;  3M8Q A;  2E2P A;  4NLC A;  5AQI A;  1YIJ N;  3TSP A;  3JS6 A;  3UE5 A;  3SMS A;  3VA0 A;  4DLE A;  5AQP A;  1DTT A;  4DUZ K;  5J2M A;  2E8A A;  3TAB A;  3T69 A;  3NGY A;  3HM9 A;  3IAY A;  4ILH A;  1RGI A;  4WF9 L;  2P9L A;  4FK4 A;  3L4Q A;  4LF7 K;  4M3W A;  1ESV A;  4AH9 A;  3C7N A;  3H3O B;  3AVJ A;  4DHY A;  3E66 A;  3TAG A;  1VQM N;  2FF6 A;  1K8K A;  4F8R A;  4YOT A;  3BF3 A;  3AVN A;  3AVM A;  1WN7 A;  3H1Q A;  2ZM6 K;  1HNZ K;  3VMF B;  2G8V A;  2F96 A;  1TKD A;  3P83 D;  2O8D B;  2AA4 A;  4JKB A;  4Y1C A;  3CQY A;  4Z4G A;  1HX1 A;  3VEV A;  4DTO A;  4NXM K;  4MQ3 A;  3M6G A;  3CCR N;  1MDU B;  4E7J A;  4FJK A;  3G25 A;  5FPD A;  2RPI A;  4E7L A;  4WQ4 A;  3J7A P;  1VQ8 N;  3AVI A;  1NU0 A;  3KK7 A;  2P9L B;  5J2P A;  4O8K A;  3C7N B;  1TL3 A;  3TWH A;  2A42 A;  2V52 B;  4A2B A;  4WFN L;  3NF9 A;  4GVE A;  1HNX K;  4FLV A;  3LPT A;  4CZJ A;  5GAG P;  4M63 C;  5GAE P;  2A5X A;  2X6S A;  5M1F A;  4H0V B;  4RW7 A;  4CZM A;  3AO5 A;  3U8X A;  3OY9 A;  2A3Z A;  2W40 A;  2O4G A;  4K8X A;  3VER A;  1NOY A;  2O8E A;  2KTQ A;  5ADX H;  3KD1 E;  1NK0 A;  4A57 A;  3MEG A;  3WQU A;  2O8C B;  4JI8 K;  4DTR A;  1ZBS A;  3VF6 A;  4IEI A;  3K5O A;  3CM5 A;  5CYQ A;  3ZT2 A;  1BI4 A;  3BY5 A;  4WFB L;  2F8T A;  3HK2 A;  1QE1 A;  2NRX A;  4AF1 A;  2F9T A;  3AGK A;  4K41 A;  1ATN A;  4NYN A;  2HW3 A;  2YV0 X;  3WQT A;  3AVL A;  4BAC A;  2J4R A;  4CJF A;  1QSY A;  2HBK A;  4CJV A;  3OYJ A;  1Y64 A;  4KFB A;  3NFA A;  1QTM A;  1ZBH A;  3OYA A;  4JEP A;  1NGC A;  3CCV N;  4CD1 A;  2DFE A;  5CE3 A;  2P9S B;  1RBS A;  4BGB A;  3KJV A;  1RDU A;  5AZI B;  4Z4H A;  4BRM A;  4J2E A;  3SMP A;  4BE2 A;  3S9H A;  1JJ2 M;  2O8D A;  3ZCM A;  2EHG A;  1JXE A;  5IWA K;  1K8A O;  4CGJ A;  2F9W A;  1QHA A;  1S3X A;  3NMU A;  3F5T A;  1BCO A;  2V51 B;  1BOT O;  3CFR A;  3FZL A;  4LF4 K;  1RDB A;  3M8S A;  4JS5 A;  1KVB A;  3T1Y K;  1NJI O;  3LAM A;  3IDH A;  3A5M C;  3ID6 A;  4IEE A;  1ATS A;  2HHT A;  1RBV A;  1T7P A;  1T6C A;  1VQN N;  2A6A A;  4L3Q A;  1ITG A;  1NK8 A;  4A5A A;  3E9O A;  1TAU A;  3R3L A;  1L3V A;  1NG9 A;  2FXU A;  4CVN E;  4O55 A;  2Q97 A;  3OW2 M;  4I7F A;  4N76 A;  3VQ7 A;  3DWL A;  4CED A;  1I94 K;  4LF5 K;  4Z4C A;  3AVH A;  3JXU A;  3ULD A;  4CBW A;  2ZWH A;  4DQ8 A;  4GKK K;  5AFU A;  5LJV A;  3FLC O;  3C65 A;  3ZT4 A;  4OPK A;  4CFA A;  4CK3 A;  5DK5 A;  4BRO A;  3K9J A;  4DFP A;  2OTJ N;  5AQV A;  1HYS A;  4OLB A;  4E7K A;  3S41 A;  2W41 A;  3U4L A;  3OJU A;  3CPW M;  4TSX A;  1JLA A;  4ISG A;  2O8F B;  3MAQ A;  2KW4 A;  1YAG A;  2OPQ A;  3JSM A;  4AQY K;  2CGK A;  3N4P A;  3CET A;  4CHZ A;  4AHR A;  5AZJ A;  1WLJ A;  2P9K A;  3THY B;  4CF2 A;  2ASO A;  1HNV A;  3VEW A;  3D45 A;  1XHX A;  1WOQ A;  4JKG B;  1EQY A;  5BR9 A;  1S22 A;  1IKX A;  3M5R A;  3OS1 A;  4DQQ A;  3SJJ A;  2OPS A;  1WAF A;  2P9U B;  1R0A A;  4CEZ A;  4BDY A;  3MDQ A;  2KLA A;  4CIF A;  4B9L A;  2ASP A;  4H0X B;  3WEE B;  2ATQ A;  4PUO A;  4FWO A;  2YKN A;  1W2B M;  2Z1J A;  1SKW A;  2EX3 A;  3CCU N;  3UKR B;  4JNE A;  1MWM A;  3CJB A;  4DV5 K;  3THY A;  1TGO A;  4EP5 A;  2PYL A;  1CZB A;  2E6L A;  5KI6 A;  4HCB A;  3DAW A;  4CEQ A;  1N6Q A;  2WFB A;  5AQR A;  1S1U A;  3L2Q A;  1EKE A;  3CCM N;  1BA1 A; 
#chains in the Genus database with same CATH homology
 1HNX K;  4DV0 K;  2UU9 K;  4CVN E;  5A2Q O;  1N34 K;  4DV7 K;  4DR5 K;  4CW7 B;  4DR1 K;  4DV4 K;  4JI2 K;  4JI6 K;  1I94 K;  4B3T K;  4LF5 K;  4JI5 K;  2UUB K;  4DV1 K;  4DUY K;  4JV5 K;  4YHH K;  4GKK K;  5LMU K;  4JI7 K;  3J80 O;  4DV3 K;  4LFB K;  1IBM K;  1HR0 K;  4JI8 K;  1HNW K;  1XNR K;  3OTO K;  4DR7 K;  5IT9 O;  4LFC K;  4X64 K;  4LF8 K;  4JI1 K;  1XMQ K;  4AQY K;  4K0K K;  4DUZ K;  4DR2 K;  2HHH K;  1N33 K;  2UXB K;  4DV2 K;  4B3M K;  4YY3 K;  2F4V K;  4B3S K;  1XNQ K;  5BR8 K;  4LF7 K;  1IBL K;  3T1H K;  1IBK K;  5LMN K;  4B3R K;  1XMO K;  4DR6 K;  4JI3 K;  2ZM6 K;  2VQE K;  1HNZ K;  4LF9 K;  4NXN K;  5AJ3 K;  1J5E K;  4LF6 K;  4V19 S;  4GKJ K;  5IWA K;  2UXD K;  4X62 K;  4OX9 K;  4NXM K;  4JI4 K;  4LFA K;  4DR3 K;  1N36 K;  5FLX O;  3J7A P;  2UXC K;  4DV5 K;  2UUC K;  4JI0 K;  4LF4 K;  3J7Y P;  5LL6 Z;  4X65 K;  4JYA K;  4X66 K;  4DV6 K;  4DR4 K;  3T1Y K;  3J81 O;  3JAM O;  2E5L K;  2VQF K;  2UUA K;  4KHP K;  1FJG K;  1N32 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...