1XNRT

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xnrT00
4NXMT 3T1HT 4JI2T 4AQYT 5LMUT 2UUAT 4X64T 2VQFT 4YHHT 4JI1T 4DV0T 4GKKT 4JV5T 2F4VT 1XMQT 1IBKT 4DV1T 3OTOT 4YY3T 2UXBT 4DR6T 4LFAT 4DV3T 1N34T 4OX9T 1HR0T 1HNXT 1N32T 4LF6T 5LMNT 4DR3T 2VQET 4DR2T 4K0KT 1I94T 4DR4T 1XNQT 4JI7T 4B3ST 4B3RT 4B3TT 4JI3T 4DUZT 4DV7T 4DR7T 1HNWT 2UXDT 4DV5T 2UUBT 1HNZT 4NXNT 2HHHT 4B3MT 2ZM6T 2E5LT 1J5ET 4X65T 4JI0T 4X62T 2UXCT 4KHPT 4LFBT 4DUYT 4LF8T 4GKJT 1N36T 4DV6T 2UUCT 4JI4T 4LF5T 4JI8T 4DV4T 4JI5T 1FJGT 4LFCT 1IBMT 4X66T 1XNRT 4DR5T 2UU9T 1N33T 4JYAT 3T1YT 1IBLT 4LF7T 4DV2T 4LF9T 4JI6T 1XMOT 5BR8T 5IWAT 4LF4T 4DR1T
chains in the Genus database with same CATH superfamily
2V1DB 3QOFA 4B6XA 3IHRA 1QUUA 1Y64B 2BS4A 2E9XA 4TNWA 4AQYT 3FXEB 3IA3A 3EDUA 5LMUT 2NWBA 2NP9A 4AXPA 4CN4A 1X79A 3AVRA 5FP3A 2X0YA 4WZXA 3ONXA 2WAUA 2X67A 5HAXA 1SA0E 3FBLA 4P09A 2XSBA 3NVOA 3IBPA 3KBUA 3ZJ1A 1FEWA 4ZZBA 2DL1A 5ADXL 3PUVF 2XZEA 2LE8A 2CHOA 2E9XC 4DV1T 3OTOT 3ZSTA 1BR0A 2BVMA 3UUXB 1WR0A 4H63V 2HPLA 3AEFA 3I1AA 3RIFA 4GKJT 5FXZA 1UCUA 2D0TA 2JRKA 4HKAA 3RRWA 4WBNE 2HN1A 3RI5A 4OX9T 2CXDA 5L47A 4CI1B 1N32T 4EYUA 3GN5A 4N78D 1E2AA 3GA8A 4ZOLE 2XPKA 2Y48B 4DBRA 2VKHA 2YINA 3AEBA 4A97A 5LJMA 5LMNT 2YDQA 3AEAA 2LHNA 3RYHE 2V5DA 1KEYA 4O4IE 2H7OA 2QVAA 3L3PA 2L9QA 5FYMA 3MZKB 3JADA 4CXYA 2YEVC 4AKRB 4X1YE 5L3EB 1MIYA 4IE6A 5L3DB 1Z0PA 5LOVE 1WLXA 4KP3C 4TNVA 2MAWA 1KNRA 3ABVA 4H9QC 4ZEYA 3UQ7A 4O4LE 4IHJE 3ZMZB 2G0UA 3FHNA 5HEJA 3AB3B 3BQIA 2XJ7A 2K24A 4I50E 5FL0A 2V7JA 4QWNB 2K9AA 2X0LB 1WFDA 3VR9A 2BBJA 4P0AA 3V5SA 1EZ3A 4HE8A 3KFWX 3LBXA 4IE0A 3AEDA 2E2AA 4F6RC 3RQUA 3CX8B 2H88A 4L9IA 4PK4A 2NTYA 5FY7A 4EEBA 3H37A 5LP6E 4HFBA 5JQGE 1MMNA 2LEHA 3FZLB 3PUAA 2YU1A 3Q5WA 4QH4A 2RPAA 4NXNT 2HHHT 2XM1A 2PBIA 2Y6XA 3JC6D 4HFHA 4UF0A 3TLWA 2E5LT 3KVBA 4PFPA 2XQ6A 1NAFA 4X65T 2UXXB 4HFIA 4BJNA 4X5TA 5AQMB 2D0UA 2XY8B 2V5CA 3SRZA 3KV5A 2WS3A 3RRCA 4QHOA 3CIRA 4X62T 2IAKA 1S35A 2J4GA 3N9QA 4ZI2C 1QSDA 2L3LA 2ZM8A 3AAEB 3BK9A 3PJAJ 4LF8T 3RQWA 3SS1A 1VCTA 1BR1A 4AQFA 2MBGA 4UF0B 1W09A 2XQ8A 1B7TA 2W2UA 3AE8A 1W0BA 3IEEA 4GK0E 4NUUA 4PJLA 5C2TA 2XQ4A 3AAIA 4L0RA 3TLSA 2UUCT 2PFVA 2X66A 3KV4A 3ZC0A 1YXRA 3O1JA 3Q5XA 4AQGA 2WCAA 5LGUB 5L3GB 2I59A 3Q5EA 3P50A 3QUJA 5LG3A 3UU8A 3P7IA 1IJ5A 1WCRA 2BKOA 3FBZA 4IE4A 4P0BA 5FXXA 3UUNA 4JUYA 4XBFB 2NW7A 3LK42 2P9BA 3H3MA 3CPZA 2BKNA 2VKDA 3OKQA 2BBHA 5CA0E 1XNRT 5KDMC 1DU2A 2MYSA 4DBQA 2CPTA 3N5LA 4A5XA 4TUYE 1KNZA 2YDSA 4IREA 1NENA 4LF7T 1ZP0A 4TV9E 3AE6A 2RP4A 5JR9A 3J7Yq 5AFUL 2M67A 2A9UA 2XAGB 3PE0A 4COFA 5HXSA 2D9DA 2E9XB 3AE9A 4DVDA 4YSZA 3V5UA 4WYVA 4G63A 3ZYKA 3EAMA 4CXWA 4ZI3D 5AQRB 2C0SA 2NW9A 5KMGP 2X9YA 2DWGA 5GONE 1VCSA 2KWIB 4TWDA 2A3DA 5HEHA 2BZBA 3CQCB 4QXCB 5IWAT 4LF4T 4DMWA 2XQ5A 4YLHA 5H6RB 5HWYA 3HKBE 2Y8DA 3EHZA 4QXHB 5LHIB 3F2EA 4U7IA 5J2TE 2DNXA 3C4WA 5DQVA 2N9DA 2EHOD 3EDVA 4I0UA 3CQGB 5AQOB 2UUAT 3L39A 4EV6A 4X64T 2VQFT 2J1DG 4JI1T 2NTXA 2JQKA 3MACA 2FBWA 3C64A 5AQVB 3ZMUB 4IDOA 3EVYA 4HFVA 5AQPB 3ZPOA 4C91A 5HWXA 1XZYA 5JRCB 2E5VA 4TN7B 3Q5DA 3NZPA 4MLKA 2DCFA 4ISSA 3AVSA 1D1CA 3UUMA 4HFDA 3ZJ2A 4YSXA 4KUMB 2VVSA 4YY3T 1GQEA 5AQUB 5JDFA 2BVLA 2V7LA 1XWMA 2X68A 4U33A 1FMWA 2WZIA 3F57A 3NKZA 3PJAA 5HEGA 3N9MA 3RF1A 4EGWA 5FL1A 4DR6T 1U4QA 4O4JE 3AE3A 1HR0T 4PK5A 2YDRA 2K3WA 2C5JA 3Q9DA 3FB2A 5LBQB 1WYCA 4AISA 4EOZB 4Q25A 2BG9B 3GWHA 2WWVA 1CUNA 2CA5A 2WDVA 3C4ZA 2DI4A 2WB5A 2B76A 4DR2T 4K0KT 3N9OA 2CLYB 3LBXB 3C51A 3RHWA 2WY2A 3RPUA 1I94T 4IDNA 3D0TA 3HA4A 1J1JA 1XNQT 2KT9A 3AE5A 3VKGA 5AQIB 3UT5E 4AI6A 3VU7H 4B3ST 5JRCA 2XAJB 5JR9B 1MIWA 2HPJA 2NW8A 3HL6A 1YD8G 3I9WA 3RYCE 1FIOA 4WW0A 4YXDA 3Q2MA 1D1BA 2WZHA 3ETUA 2Q9QD 4YTPA 4DUZT 4JI3T 3PU3A 5FMNA 4GYSA 1MNDA 4I43B 1ZHCA 5L4EA 1JNZA 4LMKA 3O9XA 1G8XA 1M7KA 2KINB 2XTLA 3LDQB 2XQ9A 3CMLA 3LG7A 3N2OA 3R84B 1HG5A 3TLVA 4DV5T 1MMAA 1D0YA 3AE4A 5LCYA 2IIUA 3MKDA 5JTGA 1HNZT 2LSYA 4ILBA 2X51A 3P4RA 4B3MT 2ZM6T 5LA6E 2XQ3A 2DWKA 2CXFA 4YT0A 2MTQA 2N1GA 4TZ4C 5AQKB 2CMRA 4U31A 3E08A 2VKJA 2YN6A 2ODVA 4PK6A 5AQGB 4TX5A 4ZI3C 3RLFF 3RYIE 4EYYR 2IHR1 2KXPB 2VWAA 2JQQA 2JIWA 2ZM2A 2C5IT 3UUBA 4AIUA 2H89A 3SFDA 4ADZA 3ZYLA 5LXTE 1ZEEA 3FZMB 5FY0A 4XZCA 3RH3A 3PDYA 4AQFC 4LF9T 4UVBB 3PTRB 4HWFA 1N36T 3KVAA 4L5GA 5L4HA 3QB5A 4JI4T 1UGOA 4LF5T 3L8RA 3AE2A 4U7YA 1HS7A 4AKHA 2JMHA 1SUMB 2LSJA 2V6YA 2AE9A 2V7IA 2XM2A 4ILCA 3UU5A 4DV4T 3NRYA 3UFEA 4JI8T 4JI5T 1VOMA 5HCMA 1OEDC 1T72A 5HCJA 1WYBA 3VRAA 1D0ZA 2NR4A 2D2SA 5LHHB 1XDOA 5FVLA 5M4YA 5LGTB 2UU9T 2WWUA 1N33T 2W0GA 2LM9A 4ISTA 4JYAT 3SWHA 3T1YT 4KX6A 1KNPA 3PUWF 2OV9A 2LSKA 2ES0A 3K3OA 3M65A 3UU3A 2HH7A 3L09A 3PUSA 3PUQA 4IE7A 3CKDA 3OJAA 2M6IA 4H9OC 3R6NA 2PTFA 2JJ9A 2X9HA 5DABA 2V7KA 4X20E 3B13A 1XMQT 2WM9A 2QGSA 5EK4A 2AXDS 2X9XA 4Z91A 3ZSSA 1MMDA 4EIWA 2EHOA 3PUGA 4MHCA 4DNDA 5AQQB 4E7SA 3B57A 4YSYA 3ZMTB 3ZCJA 4IIJE 5A1LA 2V6YB 2WDRA 1WR6A 3RGLA 1UX5A 1YQ3A 3P4WA 4X1KE 5L3FB 3FZFB 4NXMT 3T1HT 3VKHA 3ZEFB 3E22E 2OA5A 2RA1A 2XQAA 2KWHA 4JEHB 5FY1A 1I6ZA 2V26A 4Z8XA 5F5WA 1ZKEA 1W9RA 3F31A 2Q9QC 3JAEA 5HEUA 3WI3A 5ABHA 1IBKT 2F4VT 3HKEE 4JV5T 3P8CD 1T7SA 5LGNB 3A5XA 4GK5E 1H7CA 1JNRA 3RIUA 1IAPA 2VASA 4ZS2A 2BG9A 5LHGB 4MBQA 2VB6A 3KV9A 4O2AE 1US7B 2H7VC 3P4QA 1YKEB 2HN2A 2EHOC 2FJDA 2A72A 3AXJB 5CGMA 4DV3T 4YJ2E 4AKGA 3U3IA 4QX7B 3PV0F 5HEOA 4ERRA 4KHPT 3EI0A 4LF6T 4TV8E 4QKNA 3AEEA 3HKDE 3OYZA 4HWCA 2IDOB 3UTKA 2BG9E 3LSVA 3OVUA 2VQET 4DR3T 4HGAA 3LJCA 4HFCA 2KMFA 3AE1A 3PUYF 3I9YA 4MFRA 4A98A 2MOZA 3ESLA 1AJ3A 5TAOA 2KNDA 2H3RA 3SFEA 5JDNA 3VHLA 2ACXA 4NPPA 1MIVA 1IZNB 2WQYA 5JREA 3AEGA 3ZT7A 3P4SA 3RC3A 2IW5B 2JQ9A 3BQLA 4A56A 1G73A 5J0ZA 2XQYA 2W4XA 4UXNB 4UR9A 2WU2A 3N9PA 4U2ZA 3BQKA 4UVCB 3C50A 4HEAA 4XAXB 5HXCA 3RIAA 3TLTA 4B3TT 4YJ3E 4PJJA 1SHZC 4QH5A 4AKLA 5JDQA 4KHZF 4G2AA 4PNIA 2EHOB 2LSGA 2XSAA 3I0QA 2XAQB 4IDQA 1HNWT 2VVNA 5CB4E 5AQHB 5BMVE 4IDPA 4OYJA 3KDSE 3O1HA 3M3ZB 5F3JA 2WSSV 5AQNB 2BS3A 2GK9A 4PAGA 5ABGA 4U74A 2UUBT 2XASB 3GMIA 4ZI2D 2OLTA 2WU5A 4ZZCA 2ZMAA 3UQ4A 1R8IA 5JDGA 1J5ET 5ABFB 5L3BB 4JI0T 3CWZB 4PFOA 1J5WA 2W00A 1S94A 2LRLA 3FXDB 1HCIA 4H9PC 5AQJB 5FNVE 3RKOA 3RKGA 3RIUC 3AA7B 4C90A 5LYJE 3JC6C 2BDEA 4IT4A 1L0VA 2J47A 5L3CB 1Z8UA 3S4UA 3AXJA 1MMGA 5CJ5A 3I0OA 5EZYE 2JMKA 4HWHA 1T98A 1XDPA 3T8OA 1LVKA 2CE7A 4IL4A 5LBMA 3PURA 3FZKB 5CA1E 3MK7C 3AECA 5HYAA 3ZCIA 3CQXC 2X0HA 3EABA 4KBMB 2CXLA 2LOSA 2NOXA 1FJGT 1HG2A 2UXDT 2V6XA 2J62A 4X66T 4QH1A 5AQSB 1IBMT 2Q9QA 2QYWA 1X9BA 4LMLA 4HTEA 4QXBB 4TWHA 4WBOA 3ANWA 5E0OA 2B1EA 1NEKA 2PJQA 2W61A 5ETWA 3UULA 5KX5E 1YQ4A 5HXHA 1D1AA 4FI5A 2KSRA 1E7PA 1OEDE 2D5UA 2VURA 5JVDE 3QC9A 5JDHA 4JI6T 4CI3B 2IUBA 3LK3B 1UX4A 2R6GF 1XMOT 2LSIA 3G06A 2IC9A 3OYXA 2Q9QB 2N2NA 4ZI7E 2I0MA 2V8SV 3KV6A 1QLBA 2BKPA 3MXZA 5HXRA 3SOLA 1UK5A 3B5MA 4WNKA 2KZ7B 2PG8A 3AA6B 3C98B 3PU8A 3PUZF 4YHJA 2E9XD 5IUXA 4UIGA 1WRDA 2LJLA 2LKHA 2YU2A 1OEDA 4HN9A 4I4TE 4CN6A 5LNKA 4DR1T 4YTNA 3K1SA 4QX8B 3VR8A 1T8BA 4DMVA 1MNEA 2FJBA 4JI2T 2CHNA 4CN1A 5HXEA 5JDMA 3MJXA 4CQIA 4O4HE 5ABFA 1UURA 3C4XA 3TKLB 5FVKA 1BR2A 2LM2A 3CX7B 4YHHT 2K48A 2BS2A 5IHYA 2X9WA 4GKKT 3QNUA 3X1DA 4EZHA 2CWYA 2DLRA 5C8YE 1BR4A 5KXJA 4U2YA 4ASKA 3NBXX 3JAFA 1HF8A 1HX8A 4UEMA 3UFGA 5DJQC 5J2UE 1Y01A 2V7MA 4EXTA 3ONLC 2VK9A 3W15B 3HKCE 4KI0F 2VL8A 2JPFA 3AA1B 3N2KE 4UVAB 2WBLA 4UV9B 5EK3A 2UXBT 1OXZA 2LLYA 1U5PA 2L8KA 3QB5K 5IYZE 2IC6A 2YOEA 1N34T 4LFAT 2ZM0A 3N9NA 3OPCA 1HNXT 2E8IA 3HR0A 2A2FX 3ZLIA 4IL9A 3RYFE 2KLQA 4FJOA 1OEDB 4OYKA 5DQWA 2ZLYA 4PW8A 4ILAA 4I55E 4JBWF 4EZ4A 3ZMSB 1LVFA 4BJMA 3CX6B 5JR9C 3N2GE 4JEUB 4DO0A 2LKGA 4PJNA 4AKIA 3ZN1B 4TWFA 2W66A 2YKSA 4H9RC 1V9DA 2MPKA 3IF8B 3AE7A 4U3CA 4YTMA 3ANWB 3A8YC 4ILUA 4K0UA 4NUVA 4DR4T 3JCFA 1NWMX 2UXNB 1UUSA 2CM0A 2DHRA 2LT3A 3A7MA 4JI7T 1YKHB 2XAFB 2BG9C 3LFMA 4Z90A 4IGUA 2C5KT 4MALA 1M62A 3K3QC 3ZKRA 4B3RT 2LOPA 3RX6A 5AQLB 4ANJA 3H3AA 3PUXF 1HX1B 4DV7T 2CWOA 2CLYC 2W67A 4YFSA 4DR7T 2W62A 4ZXLA 3CK6A 2Z6EA 5J1GA 4DV0T 2QRXA 2XQ7A 3CVRA 4ZHQE 4P1NA 4E7ZA 3ZC1A 2M6BA 2WDQA 5JDLA 5LB7B 5LJNA 4V1Av 3AAAB 2FJEA 3FZHB 4UELA 1FMVA 1HTJF 3KBTA 4IE5A 3UU6A 5AQFB 5C3JA 1CHUA 4H9NC 1KF6A 3OBVE 1O3XA 4O2BE 3ZYMA 4CZZB 3MA9A 1E1HB 4HWIB 2W63A 4OFZA 1KK7A 1IJ6A 4H63H 3WAJA 5H6QB 2K5BB 3DP7A 3HI2A 1D0XA 4U72A 3O4XE 2UXCT 3WAKA 1SE7A 1W0AA 4LFBT 5CFBA 4M1PA 2FUPA 4DUYT 4KMCA 1ZV4X 2CBIA 2VKOA 1KFYA 2YK0A 3KINB 4PJMA 4HWDA 2WMNA 4LMJA 3K8PC 1VRBA 4GIWA 4ZS3A 1OWAA 4HFEA 4CI2B 5JH7E 2I6HA 3ZT5A 5LG4A 2QA7A 2CBJA 4DV6T 1LKXA 3NRXA 3DJBA 3NZQA 4OHFA 2WP9A 2XUEA 3DTOA 3K3NA 3N9LA 3AA0B 4BAYB 4EB6E 2ACZA 4GYRA 3GN5B 2CRBA 5AQTB 4X1IE 4LFCT 4CXXA 1HFAA 4NIQA 3EUHA 5F8PA 2WMOA 4UV8B 2SPCA 5FXWA 3UU4A 1ZOYA 4DR5T 3ZMVB 4J2CA 5ABEA 3P4PA 4O8SA 3J9X1 5EK2A 1IBLT 3RC8A 3U78A 5L2LA 4DIDB 4DV2T 1LRZA 1YW0A 2VL0A 3ZT6A 4JLEA 4BA9A 4IDZA 5FXVA 4F8HA 3ETVA 4OK0A 2XAHB 2XHEB 3TLUA 4EAHA 3O1IA 2ODUA 3NWIA 4GOUA 3ONJA 4H9SE 3ZN0B 3VRBA 5BR8T 3E0ZA 3LK2B 2LHRA 3QK6A 5FKYA 2JQHA 2FJAA 2LRKA 4EEDA 2IMLA 2CEAA 2CCQA
chains in the Genus database with same CATH topology
4NXMT 3T1HT 4JI2T 4AQYT 5LMUT 2UUAT 4X64T 2VQFT 4YHHT 4JI1T 4DV0T 4GKKT 4JV5T 2F4VT 1XMQT 1IBKT 4DV1T 3OTOT 4YY3T 2UXBT 4DR6T 4LFAT 4DV3T 1N34T 4OX9T 1HR0T 1HNXT 1N32T 4LF6T 5LMNT 4DR3T 2VQET 4DR2T 4K0KT 1I94T 4DR4T 1XNQT 4JI7T 4B3ST 4B3RT 4B3TT 4JI3T 4DUZT 4DV7T 4DR7T 1HNWT 2UXDT 4DV5T 2UUBT 1HNZT 4NXNT 2HHHT 4B3MT 2ZM6T 2E5LT 1J5ET 4X65T 4JI0T 4X62T 2UXCT 4KHPT 4LFBT 4DUYT 4LF8T 4GKJT 1N36T 4DV6T 2UUCT 4JI4T 4LF5T 4JI8T 4DV4T 4JI5T 1FJGT 4LFCT 1IBMT 4X66T 1XNRT 4DR5T 2UU9T 1N33T 4JYAT 3T1YT 1IBLT 4LF7T 4DV2T 4LF9T 4JI6T 1XMOT 5BR8T 5IWAT 4LF4T 4DR1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM T;  3T1H T;  4JI2 T;  4AQY T;  5LMU T;  2UUA T;  4X64 T;  2VQF T;  4YHH T;  4JI1 T;  4DV0 T;  4GKK T;  4JV5 T;  2F4V T;  1XMQ T;  1IBK T;  4DV1 T;  3OTO T;  4YY3 T;  2UXB T;  4DR6 T;  4LFA T;  4DV3 T;  1N34 T;  4OX9 T;  1HR0 T;  1HNX T;  1N32 T;  4LF6 T;  5LMN T;  4DR3 T;  2VQE T;  4DR2 T;  4K0K T;  1I94 T;  4DR4 T;  1XNQ T;  4JI7 T;  4B3S T;  4B3R T;  4B3T T;  4JI3 T;  4DUZ T;  4DV7 T;  4DR7 T;  1HNW T;  2UXD T;  4DV5 T;  2UUB T;  1HNZ T;  4NXN T;  2HHH T;  4B3M T;  2ZM6 T;  2E5L T;  1J5E T;  4X65 T;  4JI0 T;  4X62 T;  2UXC T;  4KHP T;  4LFB T;  4DUY T;  4LF8 T;  4GKJ T;  1N36 T;  4DV6 T;  2UUC T;  4JI4 T;  4LF5 T;  4JI8 T;  4DV4 T;  4JI5 T;  1FJG T;  4LFC T;  1IBM T;  4X66 T;  1XNR T;  4DR5 T;  2UU9 T;  1N33 T;  4JYA T;  3T1Y T;  1IBL T;  4LF7 T;  4DV2 T;  4LF9 T;  4JI6 T;  1XMO T;  5BR8 T;  5IWA T;  4LF4 T;  4DR1 T; 
#chains in the Genus database with same CATH topology
 2V1D B;  3QOF A;  4B6X A;  3IHR A;  1QUU A;  1Y64 B;  2BS4 A;  2E9X A;  4TNW A;  4AQY T;  3FXE B;  3IA3 A;  3EDU A;  5LMU T;  2NWB A;  2NP9 A;  4AXP A;  4CN4 A;  1X79 A;  3AVR A;  5FP3 A;  2X0Y A;  4WZX A;  3ONX A;  2WAU A;  2X67 A;  5HAX A;  1SA0 E;  3FBL A;  4P09 A;  2XSB A;  3NVO A;  3IBP A;  3KBU A;  3ZJ1 A;  1FEW A;  4ZZB A;  2DL1 A;  5ADX L;  3PUV F;  2XZE A;  2LE8 A;  2CHO A;  2E9X C;  4DV1 T;  3OTO T;  3ZST A;  1BR0 A;  2BVM A;  3UUX B;  1WR0 A;  4H63 V;  2HPL A;  3AEF A;  3I1A A;  3RIF A;  4GKJ T;  5FXZ A;  1UCU A;  2D0T A;  2JRK A;  4HKA A;  3RRW A;  4WBN E;  2HN1 A;  3RI5 A;  4OX9 T;  2CXD A;  5L47 A;  4CI1 B;  1N32 T;  4EYU A;  3GN5 A;  4N78 D;  1E2A A;  3GA8 A;  4ZOL E;  2XPK A;  2Y48 B;  4DBR A;  2VKH A;  2YIN A;  3AEB A;  4A97 A;  5LJM A;  5LMN T;  2YDQ A;  3AEA A;  2LHN A;  3RYH E;  2V5D A;  1KEY A;  4O4I E;  2H7O A;  2QVA A;  3L3P A;  2L9Q A;  5FYM A;  3MZK B;  3JAD A;  4CXY A;  2YEV C;  4AKR B;  4X1Y E;  5L3E B;  1MIY A;  4IE6 A;  5L3D B;  1Z0P A;  5LOV E;  1WLX A;  4KP3 C;  4TNV A;  2MAW A;  1KNR A;  3ABV A;  4H9Q C;  4ZEY A;  3UQ7 A;  4O4L E;  4IHJ E;  3ZMZ B;  2G0U A;  3FHN A;  5HEJ A;  3AB3 B;  3BQI A;  2XJ7 A;  2K24 A;  4I50 E;  5FL0 A;  2V7J A;  4QWN B;  2K9A A;  2X0L B;  1WFD A;  3VR9 A;  2BBJ A;  4P0A A;  3V5S A;  1EZ3 A;  4HE8 A;  3KFW X;  3LBX A;  4IE0 A;  3AED A;  2E2A A;  4F6R C;  3RQU A;  3CX8 B;  2H88 A;  4L9I A;  4PK4 A;  2NTY A;  5FY7 A;  4EEB A;  3H37 A;  5LP6 E;  4HFB A;  5JQG E;  1MMN A;  2LEH A;  3FZL B;  3PUA A;  2YU1 A;  3Q5W A;  4QH4 A;  2RPA A;  4NXN T;  2HHH T;  2XM1 A;  2PBI A;  2Y6X A;  3JC6 D;  4HFH A;  4UF0 A;  3TLW A;  2E5L T;  3KVB A;  4PFP A;  2XQ6 A;  1NAF A;  4X65 T;  2UXX B;  4HFI A;  4BJN A;  4X5T A;  5AQM B;  2D0U A;  2XY8 B;  2V5C A;  3SRZ A;  3KV5 A;  2WS3 A;  3RRC A;  4QHO A;  3CIR A;  4X62 T;  2IAK A;  1S35 A;  2J4G A;  3N9Q A;  4ZI2 C;  1QSD A;  2L3L A;  2ZM8 A;  3AAE B;  3BK9 A;  3PJA J;  4LF8 T;  3RQW A;  3SS1 A;  1VCT A;  1BR1 A;  4AQF A;  2MBG A;  4UF0 B;  1W09 A;  2XQ8 A;  1B7T A;  2W2U A;  3AE8 A;  1W0B A;  3IEE A;  4GK0 E;  4NUU A;  4PJL A;  5C2T A;  2XQ4 A;  3AAI A;  4L0R A;  3TLS A;  2UUC T;  2PFV A;  2X66 A;  3KV4 A;  3ZC0 A;  1YXR A;  3O1J A;  3Q5X A;  4AQG A;  2WCA A;  5LGU B;  5L3G B;  2I59 A;  3Q5E A;  3P50 A;  3QUJ A;  5LG3 A;  3UU8 A;  3P7I A;  1IJ5 A;  1WCR A;  2BKO A;  3FBZ A;  4IE4 A;  4P0B A;  5FXX A;  3UUN A;  4JUY A;  4XBF B;  2NW7 A;  3LK4 2;  2P9B A;  3H3M A;  3CPZ A;  2BKN A;  2VKD A;  3OKQ A;  2BBH A;  5CA0 E;  1XNR T;  5KDM C;  1DU2 A;  2MYS A;  4DBQ A;  2CPT A;  3N5L A;  4A5X A;  4TUY E;  1KNZ A;  2YDS A;  4IRE A;  1NEN A;  4LF7 T;  1ZP0 A;  4TV9 E;  3AE6 A;  2RP4 A;  5JR9 A;  3J7Y q;  5AFU L;  2M67 A;  2A9U A;  2XAG B;  3PE0 A;  4COF A;  5HXS A;  2D9D A;  2E9X B;  3AE9 A;  4DVD A;  4YSZ A;  3V5U A;  4WYV A;  4G63 A;  3ZYK A;  3EAM A;  4CXW A;  4ZI3 D;  5AQR B;  2C0S A;  2NW9 A;  5KMG P;  2X9Y A;  2DWG A;  5GON E;  1VCS A;  2KWI B;  4TWD A;  2A3D A;  5HEH A;  2BZB A;  3CQC B;  4QXC B;  5IWA T;  4LF4 T;  4DMW A;  2XQ5 A;  4YLH A;  5H6R B;  5HWY A;  3HKB E;  2Y8D A;  3EHZ A;  4QXH B;  5LHI B;  3F2E A;  4U7I A;  5J2T E;  2DNX A;  3C4W A;  5DQV A;  2N9D A;  2EHO D;  3EDV A;  4I0U A;  3CQG B;  5AQO B;  2UUA T;  3L39 A;  4EV6 A;  4X64 T;  2VQF T;  2J1D G;  4JI1 T;  2NTX A;  2JQK A;  3MAC A;  2FBW A;  3C64 A;  5AQV B;  3ZMU B;  4IDO A;  3EVY A;  4HFV A;  5AQP B;  3ZPO A;  4C91 A;  5HWX A;  1XZY A;  5JRC B;  2E5V A;  4TN7 B;  3Q5D A;  3NZP A;  4MLK A;  2DCF A;  4ISS A;  3AVS A;  1D1C A;  3UUM A;  4HFD A;  3ZJ2 A;  4YSX A;  4KUM B;  2VVS A;  4YY3 T;  1GQE A;  5AQU B;  5JDF A;  2BVL A;  2V7L A;  1XWM A;  2X68 A;  4U33 A;  1FMW A;  2WZI A;  3F57 A;  3NKZ A;  3PJA A;  5HEG A;  3N9M A;  3RF1 A;  4EGW A;  5FL1 A;  4DR6 T;  1U4Q A;  4O4J E;  3AE3 A;  1HR0 T;  4PK5 A;  2YDR A;  2K3W A;  2C5J A;  3Q9D A;  3FB2 A;  5LBQ B;  1WYC A;  4AIS A;  4EOZ B;  4Q25 A;  2BG9 B;  3GWH A;  2WWV A;  1CUN A;  2CA5 A;  2WDV A;  3C4Z A;  2DI4 A;  2WB5 A;  2B76 A;  4DR2 T;  4K0K T;  3N9O A;  2CLY B;  3LBX B;  3C51 A;  3RHW A;  2WY2 A;  3RPU A;  1I94 T;  4IDN A;  3D0T A;  3HA4 A;  1J1J A;  1XNQ T;  2KT9 A;  3AE5 A;  3VKG A;  5AQI B;  3UT5 E;  4AI6 A;  3VU7 H;  4B3S T;  5JRC A;  2XAJ B;  5JR9 B;  1MIW A;  2HPJ A;  2NW8 A;  3HL6 A;  1YD8 G;  3I9W A;  3RYC E;  1FIO A;  4WW0 A;  4YXD A;  3Q2M A;  1D1B A;  2WZH A;  3ETU A;  2Q9Q D;  4YTP A;  4DUZ T;  4JI3 T;  3PU3 A;  5FMN A;  4GYS A;  1MND A;  4I43 B;  1ZHC A;  5L4E A;  1JNZ A;  4LMK A;  3O9X A;  1G8X A;  1M7K A;  2KIN B;  2XTL A;  3LDQ B;  2XQ9 A;  3CML A;  3LG7 A;  3N2O A;  3R84 B;  1HG5 A;  3TLV A;  4DV5 T;  1MMA A;  1D0Y A;  3AE4 A;  5LCY A;  2IIU A;  3MKD A;  5JTG A;  1HNZ T;  2LSY A;  4ILB A;  2X51 A;  3P4R A;  4B3M T;  2ZM6 T;  5LA6 E;  2XQ3 A;  2DWK A;  2CXF A;  4YT0 A;  2MTQ A;  2N1G A;  4TZ4 C;  5AQK B;  2CMR A;  4U31 A;  3E08 A;  2VKJ A;  2YN6 A;  2ODV A;  4PK6 A;  5AQG B;  4TX5 A;  4ZI3 C;  3RLF F;  3RYI E;  4EYY R;  2IHR 1;  2KXP B;  2VWA A;  2JQQ A;  2JIW A;  2ZM2 A;  2C5I T;  3UUB A;  4AIU A;  2H89 A;  3SFD A;  4ADZ A;  3ZYL A;  5LXT E;  1ZEE A;  3FZM B;  5FY0 A;  4XZC A;  3RH3 A;  3PDY A;  4AQF C;  4LF9 T;  4UVB B;  3PTR B;  4HWF A;  1N36 T;  3KVA A;  4L5G A;  5L4H A;  3QB5 A;  4JI4 T;  1UGO A;  4LF5 T;  3L8R A;  3AE2 A;  4U7Y A;  1HS7 A;  4AKH A;  2JMH A;  1SUM B;  2LSJ A;  2V6Y A;  2AE9 A;  2V7I A;  2XM2 A;  4ILC A;  3UU5 A;  4DV4 T;  3NRY A;  3UFE A;  4JI8 T;  4JI5 T;  1VOM A;  5HCM A;  1OED C;  1T72 A;  5HCJ A;  1WYB A;  3VRA A;  1D0Z A;  2NR4 A;  2D2S A;  5LHH B;  1XDO A;  5FVL A;  5M4Y A;  5LGT B;  2UU9 T;  2WWU A;  1N33 T;  2W0G A;  2LM9 A;  4IST A;  4JYA T;  3SWH A;  3T1Y T;  4KX6 A;  1KNP A;  3PUW F;  2OV9 A;  2LSK A;  2ES0 A;  3K3O A;  3M65 A;  3UU3 A;  2HH7 A;  3L09 A;  3PUS A;  3PUQ A;  4IE7 A;  3CKD A;  3OJA A;  2M6I A;  4H9O C;  3R6N A;  2PTF A;  2JJ9 A;  2X9H A;  5DAB A;  2V7K A;  4X20 E;  3B13 A;  1XMQ T;  2WM9 A;  2QGS A;  5EK4 A;  2AXD S;  2X9X A;  4Z91 A;  3ZSS A;  1MMD A;  4EIW A;  2EHO A;  3PUG A;  4MHC A;  4DND A;  5AQQ B;  4E7S A;  3B57 A;  4YSY A;  3ZMT B;  3ZCJ A;  4IIJ E;  5A1L A;  2V6Y B;  2WDR A;  1WR6 A;  3RGL A;  1UX5 A;  1YQ3 A;  3P4W A;  4X1K E;  5L3F B;  3FZF B;  4NXM T;  3T1H T;  3VKH A;  3ZEF B;  3E22 E;  2OA5 A;  2RA1 A;  2XQA A;  2KWH A;  4JEH B;  5FY1 A;  1I6Z A;  2V26 A;  4Z8X A;  5F5W A;  1ZKE A;  1W9R A;  3F31 A;  2Q9Q C;  3JAE A;  5HEU A;  3WI3 A;  5ABH A;  1IBK T;  2F4V T;  3HKE E;  4JV5 T;  3P8C D;  1T7S A;  5LGN B;  3A5X A;  4GK5 E;  1H7C A;  1JNR A;  3RIU A;  1IAP A;  2VAS A;  4ZS2 A;  2BG9 A;  5LHG B;  4MBQ A;  2VB6 A;  3KV9 A;  4O2A E;  1US7 B;  2H7V C;  3P4Q A;  1YKE B;  2HN2 A;  2EHO C;  2FJD A;  2A72 A;  3AXJ B;  5CGM A;  4DV3 T;  4YJ2 E;  4AKG A;  3U3I A;  4QX7 B;  3PV0 F;  5HEO A;  4ERR A;  4KHP T;  3EI0 A;  4LF6 T;  4TV8 E;  4QKN A;  3AEE A;  3HKD E;  3OYZ A;  4HWC A;  2IDO B;  3UTK A;  2BG9 E;  3LSV A;  3OVU A;  2VQE T;  4DR3 T;  4HGA A;  3LJC A;  4HFC A;  2KMF A;  3AE1 A;  3PUY F;  3I9Y A;  4MFR A;  4A98 A;  2MOZ A;  3ESL A;  1AJ3 A;  5TAO A;  2KND A;  2H3R A;  3SFE A;  5JDN A;  3VHL A;  2ACX A;  4NPP A;  1MIV A;  1IZN B;  2WQY A;  5JRE A;  3AEG A;  3ZT7 A;  3P4S A;  3RC3 A;  2IW5 B;  2JQ9 A;  3BQL A;  4A56 A;  1G73 A;  5J0Z A;  2XQY A;  2W4X A;  4UXN B;  4UR9 A;  2WU2 A;  3N9P A;  4U2Z A;  3BQK A;  4UVC B;  3C50 A;  4HEA A;  4XAX B;  5HXC A;  3RIA A;  3TLT A;  4B3T T;  4YJ3 E;  4PJJ A;  1SHZ C;  4QH5 A;  4AKL A;  5JDQ A;  4KHZ F;  4G2A A;  4PNI A;  2EHO B;  2LSG A;  2XSA A;  3I0Q A;  2XAQ B;  4IDQ A;  1HNW T;  2VVN A;  5CB4 E;  5AQH B;  5BMV E;  4IDP A;  4OYJ A;  3KDS E;  3O1H A;  3M3Z B;  5F3J A;  2WSS V;  5AQN B;  2BS3 A;  2GK9 A;  4PAG A;  5ABG A;  4U74 A;  2UUB T;  2XAS B;  3GMI A;  4ZI2 D;  2OLT A;  2WU5 A;  4ZZC A;  2ZMA A;  3UQ4 A;  1R8I A;  5JDG A;  1J5E T;  5ABF B;  5L3B B;  4JI0 T;  3CWZ B;  4PFO A;  1J5W A;  2W00 A;  1S94 A;  2LRL A;  3FXD B;  1HCI A;  4H9P C;  5AQJ B;  5FNV E;  3RKO A;  3RKG A;  3RIU C;  3AA7 B;  4C90 A;  5LYJ E;  3JC6 C;  2BDE A;  4IT4 A;  1L0V A;  2J47 A;  5L3C B;  1Z8U A;  3S4U A;  3AXJ A;  1MMG A;  5CJ5 A;  3I0O A;  5EZY E;  2JMK A;  4HWH A;  1T98 A;  1XDP A;  3T8O A;  1LVK A;  2CE7 A;  4IL4 A;  5LBM A;  3PUR A;  3FZK B;  5CA1 E;  3MK7 C;  3AEC A;  5HYA A;  3ZCI A;  3CQX C;  2X0H A;  3EAB A;  4KBM B;  2CXL A;  2LOS A;  2NOX A;  1FJG T;  1HG2 A;  2UXD T;  2V6X A;  2J62 A;  4X66 T;  4QH1 A;  5AQS B;  1IBM T;  2Q9Q A;  2QYW A;  1X9B A;  4LML A;  4HTE A;  4QXB B;  4TWH A;  4WBO A;  3ANW A;  5E0O A;  2B1E A;  1NEK A;  2PJQ A;  2W61 A;  5ETW A;  3UUL A;  5KX5 E;  1YQ4 A;  5HXH A;  1D1A A;  4FI5 A;  2KSR A;  1E7P A;  1OED E;  2D5U A;  2VUR A;  5JVD E;  3QC9 A;  5JDH A;  4JI6 T;  4CI3 B;  2IUB A;  3LK3 B;  1UX4 A;  2R6G F;  1XMO T;  2LSI A;  3G06 A;  2IC9 A;  3OYX A;  2Q9Q B;  2N2N A;  4ZI7 E;  2I0M A;  2V8S V;  3KV6 A;  1QLB A;  2BKP A;  3MXZ A;  5HXR A;  3SOL A;  1UK5 A;  3B5M A;  4WNK A;  2KZ7 B;  2PG8 A;  3AA6 B;  3C98 B;  3PU8 A;  3PUZ F;  4YHJ A;  2E9X D;  5IUX A;  4UIG A;  1WRD A;  2LJL A;  2LKH A;  2YU2 A;  1OED A;  4HN9 A;  4I4T E;  4CN6 A;  5LNK A;  4DR1 T;  4YTN A;  3K1S A;  4QX8 B;  3VR8 A;  1T8B A;  4DMV A;  1MNE A;  2FJB A;  4JI2 T;  2CHN A;  4CN1 A;  5HXE A;  5JDM A;  3MJX A;  4CQI A;  4O4H E;  5ABF A;  1UUR A;  3C4X A;  3TKL B;  5FVK A;  1BR2 A;  2LM2 A;  3CX7 B;  4YHH T;  2K48 A;  2BS2 A;  5IHY A;  2X9W A;  4GKK T;  3QNU A;  3X1D A;  4EZH A;  2CWY A;  2DLR A;  5C8Y E;  1BR4 A;  5KXJ A;  4U2Y A;  4ASK A;  3NBX X;  3JAF A;  1HF8 A;  1HX8 A;  4UEM A;  3UFG A;  5DJQ C;  5J2U E;  1Y01 A;  2V7M A;  4EXT A;  3ONL C;  2VK9 A;  3W15 B;  3HKC E;  4KI0 F;  2VL8 A;  2JPF A;  3AA1 B;  3N2K E;  4UVA B;  2WBL A;  4UV9 B;  5EK3 A;  2UXB T;  1OXZ A;  2LLY A;  1U5P A;  2L8K A;  3QB5 K;  5IYZ E;  2IC6 A;  2YOE A;  1N34 T;  4LFA T;  2ZM0 A;  3N9N A;  3OPC A;  1HNX T;  2E8I A;  3HR0 A;  2A2F X;  3ZLI A;  4IL9 A;  3RYF E;  2KLQ A;  4FJO A;  1OED B;  4OYK A;  5DQW A;  2ZLY A;  4PW8 A;  4ILA A;  4I55 E;  4JBW F;  4EZ4 A;  3ZMS B;  1LVF A;  4BJM A;  3CX6 B;  5JR9 C;  3N2G E;  4JEU B;  4DO0 A;  2LKG A;  4PJN A;  4AKI A;  3ZN1 B;  4TWF A;  2W66 A;  2YKS A;  4H9R C;  1V9D A;  2MPK A;  3IF8 B;  3AE7 A;  4U3C A;  4YTM A;  3ANW B;  3A8Y C;  4ILU A;  4K0U A;  4NUV A;  4DR4 T;  3JCF A;  1NWM X;  2UXN B;  1UUS A;  2CM0 A;  2DHR A;  2LT3 A;  3A7M A;  4JI7 T;  1YKH B;  2XAF B;  2BG9 C;  3LFM A;  4Z90 A;  4IGU A;  2C5K T;  4MAL A;  1M62 A;  3K3Q C;  3ZKR A;  4B3R T;  2LOP A;  3RX6 A;  5AQL B;  4ANJ A;  3H3A A;  3PUX F;  1HX1 B;  4DV7 T;  2CWO A;  2CLY C;  2W67 A;  4YFS A;  4DR7 T;  2W62 A;  4ZXL A;  3CK6 A;  2Z6E A;  5J1G A;  4DV0 T;  2QRX A;  2XQ7 A;  3CVR A;  4ZHQ E;  4P1N A;  4E7Z A;  3ZC1 A;  2M6B A;  2WDQ A;  5JDL A;  5LB7 B;  5LJN A;  4V1A v;  3AAA B;  2FJE A;  3FZH B;  4UEL A;  1FMV A;  1HTJ F;  3KBT A;  4IE5 A;  3UU6 A;  5AQF B;  5C3J A;  1CHU A;  4H9N C;  1KF6 A;  3OBV E;  1O3X A;  4O2B E;  3ZYM A;  4CZZ B;  3MA9 A;  1E1H B;  4HWI B;  2W63 A;  4OFZ A;  1KK7 A;  1IJ6 A;  4H63 H;  3WAJ A;  5H6Q B;  2K5B B;  3DP7 A;  3HI2 A;  1D0X A;  4U72 A;  3O4X E;  2UXC T;  3WAK A;  1SE7 A;  1W0A A;  4LFB T;  5CFB A;  4M1P A;  2FUP A;  4DUY T;  4KMC A;  1ZV4 X;  2CBI A;  2VKO A;  1KFY A;  2YK0 A;  3KIN B;  4PJM A;  4HWD A;  2WMN A;  4LMJ A;  3K8P C;  1VRB A;  4GIW A;  4ZS3 A;  1OWA A;  4HFE A;  4CI2 B;  5JH7 E;  2I6H A;  3ZT5 A;  5LG4 A;  2QA7 A;  2CBJ A;  4DV6 T;  1LKX A;  3NRX A;  3DJB A;  3NZQ A;  4OHF A;  2WP9 A;  2XUE A;  3DTO A;  3K3N A;  3N9L A;  3AA0 B;  4BAY B;  4EB6 E;  2ACZ A;  4GYR A;  3GN5 B;  2CRB A;  5AQT B;  4X1I E;  4LFC T;  4CXX A;  1HFA A;  4NIQ A;  3EUH A;  5F8P A;  2WMO A;  4UV8 B;  2SPC A;  5FXW A;  3UU4 A;  1ZOY A;  4DR5 T;  3ZMV B;  4J2C A;  5ABE A;  3P4P A;  4O8S A;  3J9X 1;  5EK2 A;  1IBL T;  3RC8 A;  3U78 A;  5L2L A;  4DID B;  4DV2 T;  1LRZ A;  1YW0 A;  2VL0 A;  3ZT6 A;  4JLE A;  4BA9 A;  4IDZ A;  5FXV A;  4F8H A;  3ETV A;  4OK0 A;  2XAH B;  2XHE B;  3TLU A;  4EAH A;  3O1I A;  2ODU A;  3NWI A;  4GOU A;  3ONJ A;  4H9S E;  3ZN0 B;  3VRB A;  5BR8 T;  3E0Z A;  3LK2 B;  2LHR A;  3QK6 A;  5FKY A;  2JQH A;  2FJA A;  2LRK A;  4EED A;  2IML A;  2CEA A;  2CCQ A; 
#chains in the Genus database with same CATH homology
 4NXM T;  3T1H T;  4JI2 T;  4AQY T;  5LMU T;  2UUA T;  4X64 T;  2VQF T;  4YHH T;  4JI1 T;  4DV0 T;  4GKK T;  4JV5 T;  2F4V T;  1XMQ T;  1IBK T;  4DV1 T;  3OTO T;  4YY3 T;  2UXB T;  4DR6 T;  4LFA T;  4DV3 T;  1N34 T;  4OX9 T;  1HR0 T;  1HNX T;  1N32 T;  4LF6 T;  5LMN T;  4DR3 T;  2VQE T;  4DR2 T;  4K0K T;  1I94 T;  4DR4 T;  1XNQ T;  4JI7 T;  4B3S T;  4B3R T;  4B3T T;  4JI3 T;  4DUZ T;  4DV7 T;  4DR7 T;  1HNW T;  2UXD T;  4DV5 T;  2UUB T;  1HNZ T;  4NXN T;  2HHH T;  4B3M T;  2ZM6 T;  2E5L T;  1J5E T;  4X65 T;  4JI0 T;  4X62 T;  2UXC T;  4KHP T;  4LFB T;  4DUY T;  4LF8 T;  4GKJ T;  1N36 T;  4DV6 T;  2UUC T;  4JI4 T;  4LF5 T;  4JI8 T;  4DV4 T;  4JI5 T;  1FJG T;  4LFC T;  1IBM T;  4X66 T;  1XNR T;  4DR5 T;  2UU9 T;  1N33 T;  4JYA T;  3T1Y T;  1IBL T;  4LF7 T;  4DV2 T;  4LF9 T;  4JI6 T;  1XMO T;  5BR8 T;  5IWA T;  4LF4 T;  4DR1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...