1XNRT

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xnrT00
3OTOT 1N33T 1N36T 1XNQT 2HHHT 1IBKT 4DV3T 3T1YT 2UUAT 4YY3T 1HNWT 4JI3T 4DV0T 4DR7T 4DV1T 1IBLT 4KHPT 4JI2T 2UUCT 4LF5T 4DR1T 4DV5T 4LFCT 4JYAT 4LF8T 4DV6T 1HNZT 4JI5T 4LF9T 4LFBT 4LFAT 4X64T 3T1HT 4JI4T 4DR2T 4DV4T 4DUZT 4JI7T 2UXDT 2UUBT 4GKJT 4X62T 2VQFT 1IBMT 2UXCT 4B3RT 2UU9T 4B3TT 4OX9T 1J5ET 4K0KT 5LMNT 1XMQT 1HNXT 4JI1T 4DV2T 4LF6T 4JI6T 4B3MT 1XNRT 1N34T 4NXNT 4JI8T 4B3ST 2ZM6T 4AQYT 4DR4T 4YHHT 4DUYT 1XMOT 4DR3T 4LF4T 4X65T 2F4VT 1N32T 4NXMT 4DR5T 4GKKT 4JI0T 4DV7T 2UXBT 4DR6T 5IWAT 5BR8T 1I94T 4LF7T 5LMUT 4JV5T 1HR0T 1FJGT 4X66T 2E5LT 2VQET
chains in the Genus database with same CATH superfamily
2ZM0A 4ZI2D 1N33T 4QXHB 3ZYLA 4IIJE 3ZN1B 3N9MA 5M4YA 3ZSTA 2X9XA 5GONE 5KMGP 3E0ZA 3O1HA 4OFZA 2NTYA 3A8YC 5JDLA 5JDHA 4PK5A 5A1LA 3VRAA 4JI4T 4PW8A 5EK4A 4G63A 3B13A 3RYFE 3OYXA 2YDSA 3VU7H 3ZMUB 4B3RT 4MFRA 2MPKA 2CM0A 4QH1A 2DL1A 3NRYA 2PTFA 3IEEA 4TUYE 3O1IA 2XQ9A 4PFOA 5JTGA 2FJBA 4DR3T 3ONXA 4K0UA 3PUZF 3N9QA 1OEDB 4UVAB 3OYZA 4NXMT 4GKKT 5F5WA 3I0OA 3TKLB 2UXBT 2CE7A 2D9DA 1IZNB 2QA7A 2A3DA 3UU3A 2XUEA 3HKCE 2E9XB 1KEYA 4OHFA 4NPPA 1L0VA 2LSYA 4C91A 2CLYB 2LJLA 4PJLA 4ILUA 5FL0A 2XQ8A 2WU2A 2YKSA 3AA0B 3LJCA 5J0ZA 1W09A 5TAOA 3E22E 2IW5B 4O8SA 3VRBA 2KSRA 3CWZB 2WB5A 4YY3T 2V5DA 1HNWT 1Z8UA 2CEAA 2BKNA 4UVBB 4U7IA 1WCRA 3ETVA 3FBLA 5FNVE 4LF5T 4EYYR 4HEAA 4IDZA 4HFBA 5FXZA 3CKDA 3EUHA 3UULA 4WYVA 2G0UA 2WWVA 4KMCA 4JI7T 2BS2A 1D1AA 4P0BA 4OYJA 1KNZA 2UU9T 3L39A 2V5CA 3PUXF 3J9X1 2MYSA 2L3LA 3PUQA 4MHCA 4HGAA 5JDFA 4A5XA 2I0MA 3FZMB 3Q9DA 2VB6A 1NEKA 3EABA 2VKDA 3RKOA 3ZSSA 5LBMA 2FJAA 5DABA 2M6BA 3PURA 2H3RA 4TV8E 2EHOD 4IHJE 2NTXA 3SRZA 4QHOA 4WW0A 2BG9B 2LSKA 2HPLA 3NZPA 2LOSA 2RPAA 5HEUA 3NWIA 2LRKA 2M6IA 2D5UA 3ANWB 5C3JA 4KHZF 4HFEA 4A98A 5CGMA 4UVCB 5H6RB 3LK42 5HXSA 5KDMC 4YTNA 4ZI2C 3V5UA 4KUMB 4L5GA 1IBKT 2KT9A 3RLFF 1OEDE 4NUVA 3CIRA 3AE7A 5JR9C 2D0UA 1OEDA 3KDSE 4KHPT 3HI2A 4KI0F 4QH4A 4X1YE 1UK5A 5ABGA 4UXNB 4NUUA 3QC9A 5ADXL 4YJ3E 2WZHA 4JI5T 4LFAT 5IUXA 3W15B 2E9XA 2MAWA 4TWHA 1BR2A 4PJJA 2X0YA 2ZMAA 5HWXA 4A56A 2JQHA 1QSDA 3K3QC 3ZPOA 1MNDA 2ACZA 3AVRA 2PG8A 4WZXA 1J5ET 3SFDA 4CN1A 1HTJF 4CN4A 4AKLA 2Q9QA 5AQVB 3RIUC 2DNXA 4EEBA 2NW9A 2I59A 3EAMA 2K9AA 3MZKB 4IDNA 1YXRA 4UV8B 4IDPA 5FXVA 1BR4A 4YHHT 4YTPA 3AA1B 3VR9A 3CQXC 3RIAA 2W61A 1UGOA 4PJNA 3KVAA 3RF1A 1YKEB 1T7SA 1G8XA 3IA3A 1US7B 3T8OA 3BQKA 2X0LB 1LVFA 2WSSV 2ES0A 2WAUA 3NVOA 5F3JA 2H7VC 3GA8A 2J4GA 2XJ7A 3C4WA 3OVUA 3P7IA 3ZT7A 2CHOA 2VKHA 3PU3A 2CHNA 2XSBA 4I50E 1WRDA 4MALA 3RYHE 1UURA 2M67A 2P9BA 2LE8A 1NWMX 2BG9A 4Q25A 3KBUA 4GYRA 1YQ4A 3T1HT 4JUYA 5LHIB 1W0BA 3ZYKA 4CXYA 3ANWA 3ZJ2A 4X62T 3U3IA 3P4QA 3IHRA 3RPUA 1WR6A 5C8YE 5DJQC 4IE7A 3PUVF 2VK9A 2ZM8A 4UR9A 3JC6C 3VR8A 3CPZA 1D0XA 3LK2B 4LF4T 4EYUA 1WLXA 1MMDA 2FUPA 2H7OA 3N5LA 3ZEFB 2EHOC 4YT0A 4DR6T 5FY0A 2H89A 2KINB 4DIDB 3RIFA 2JQQA 2KMFA 5LJNA 4EB6E 1EZ3A 5EZYE 5LOVE 4GOUA 4BJNA 3ZYMA 1N36T 2DCFA 3KV9A 3KV4A 2XQ5A 1W9RA 5ABHA 5LYJE 3RI5A 3VHLA 4TZ4C 2WQYA 2A9UA 1FMWA 4PNIA 3F57A 3Q5WA 3C4XA 4IGUA 3CX6B 3ZLIA 3RC8A 2YOEA 1ZHCA 4BA9A 3AAIA 2JMKA 4E7SA 4U33A 4OYKA 4MLKA 3PTRB 1NENA 4GK0E 3AEEA 3AEFA 3QNUA 1VCTA 2VL8A 1J1JA 5AQGB 1BR0A 4HE8A 5AQQB 1NAFA 4LF6T 5LJMA 3TLVA 4CXXA 1N34T 2YDRA 3U78A 2XTLA 4X1KE 5HEHA 5FXXA 4YTMA 3LG7A 5KXJA 3ESLA 4H9SE 2Y6XA 4YXDA 5HCMA 5AQKB 3ZKRA 2PFVA 3B5MA 4HFCA 2WWUA 2LSIA 4HWFA 1XWMA 1MIYA 2ACXA 2HPJA 5FP3A 1DU2A 1YW0A 2I6HA 5HEOA 5JRCB 2DLRA 4FJOA 1HCIA 2AXDS 1S94A 4AQFC 3TLSA 4YHJA 2HN2A 3H3AA 4U72A 1IJ5A 3GN5B 2C5JA 5AQTB 2RA1A 3PUSA 3EDUA 5JDQA 4U31A 1FEWA 4AKIA 5AFUL 4IL4A 3KINB 4DV0T 4JI2T 2A2FX 3FXDB 4ZEYA 3AECA 1UX5A 1HNZT 3RX6A 2XHEB 1UX4A 3Q5DA 5L3GB 3AXJB 4IE5A 1JNRA 4XZCA 1HG2A 2ZM2A 2V7LA 5AQIB 4DV4T 3M65A 1J5WA 2MTQA 5FKYA 3O1JA 3UU4A 1ZEEA 5L4EA 4B3TT 3BQIA 2IMLA 1VOMA 1I6ZA 3AE3A 2MBGA 3AE8A 2VVNA 1LKXA 1BR1A 2J47A 3SWHA 4BJMA 4NXNT 3S4UA 1MMAA 4DUYT 1GQEA 2WDQA 2UXXB 3HL6A 4EZ4A 2YU1A 2IHR1 3A7MA 4X20E 4B6XA 3VKGA 5LP6E 4DR5T 2VL0A 2QYWA 3RH3A 4YSYA 3RHWA 3FB2A 2J62A 1XDPA 3N9PA 3C51A 2WMOA 1S35A 4IE6A 4A97A 4U3CA 2Q9QD 3MA9A 3UUNA 2XZEA 3H37A 2CXFA 4O4JE 5LBQB 3EI0A 3UFGA 1YQ3A 3IF8B 4TNWA 1MIVA 1Y64B 2VURA 2X68A 4EV6A 1D1CA 1KFYA 1E1HB 3CX8B 1KF6A 2UXNB 5L3BB 5FXWA 5JDGA 3Q2MA 3N2GE 2KNDA 3WAJA 2B76A 3ZC0A 3P50A 5LG4A 5HXHA 5JRCA 1QLBA 4IREA 2BS3A 3L3PA 3I0QA 3FZFB 1HG5A 4JEHB 1D1BA 3CQGB 2WBLA 3GN5A 5H6QB 1T72A 4IT4A 4TX5A 4PFPA 3RRWA 2FBWA 3P4WA 3QB5A 2Y48B 3AA7B 2D2SA 2L9QA 4QX8B 4X5TA 5AQJB 3AE4A 3OKQA 4TWFA 3OJAA 5ETWA 4G2AA 2WCAA 4M1PA 4CI3B 5J1GA 5LNKA 1IAPA 4Z91A 1CUNA 2CA5A 5AQUB 4ZOLE 4ASKA 5LCYA 3C98B 2DWGA 4DV1T 5LA6E 2YEVC 3ZT5A 1X79A 3AE1A 2JIWA 3MACA 5EK2A 2V6YB 4U7YA 3LSVA 3ZC1A 4HFDA 1VCSA 2UXDT 5F8PA 4QXBB 2VWAA 2LSGA 2WZIA 4I55E 3Q5XA 2HH7A 2WY2A 4WBOA 2K5BB 4XAXB 1XNRT 2CWOA 4ZZCA 5J2UE 4O4HE 4OK0A 3N9OA 2BVLA 5AQRB 2XSAA 4AISA 3FXEB 4AQGA 3V5SA 3R6NA 2YU2A 4QXCB 4JI0T 3JCFA 2ODUA 4EOZB 4YJ2E 5FY1A 5BR8T 2DI4A 2CLYC 4L0RA 3RIUA 5L3CB 2V8SV 2WDRA 5CJ5A 4JLEA 3JAFA 4ZHQE 1Z0PA 1HFAA 4AIUA 2Q9QC 2CWYA 3EHZA 5E0OA 2ZLYA 5HXRA 3NBXX 5DQWA 3N2KE 1E2AA 3LBXB 5LHGB 1U5PA 4JI3T 3TLUA 4DV5T 2LHRA 3SOLA 5IYZE 2IIUA 3N9NA 2NW8A 4CI2B 4HFHA 2YK0A 4ZXLA 2IUBA 3F2EA 2WMNA 3UUBA 3UUMA 2BG9E 1X9BA 2XASB 2QGSA 4FI5A 2LEHA 2E2AA 2V7KA 2JRKA 3KFWX 4O2BE 2FJEA 4ISSA 5LHHB 3WAKA 4YSZA 3PV0F 2V6YA 2LKGA 3O4XE 1HS7A 3F31A 1FJGT 5HXEA 5IHYA 3LFMA 2X9YA 2OV9A 2X66A 2XAGB 2XAHB 3KV5A 5CB4E 5JVDE 4AI6A 2LRLA 3M3ZB 4KP3C 1MMNA 1SUMB 1XDOA 3AEDA 3PUWF 3OPCA 2X0HA 2XQ7A 3ZT6A 3RKGA 5DQVA 5LXTE 2W4XA 2QVAA 2XPKA 4TV9E 2LM9A 2V6XA 4ZS2A 1M7KA 3SFEA 3LBXA 4JI8T 3DP7A 2HN1A 4TWDA 4WBNE 4H9QC 3JAEA 2F4VT 3CX7B 3ZN0B 3AE9A 1MNEA 1ZKEA 3FBZA 4LF7T 3AEAA 2DHRA 3BQLA 5CA0E 4JEUB 5L3EB 5FMNA 2W62A 4H9NC 2CPTA 4AKGA 2E5LT 3ZMSB 3KV6A 3UTKA 1UCUA 4JBWF 4KBMB 2WM9A 4Z8XA 3T1YT 4CN6A 1UUSA 2JMHA 1D0ZA 1AJ3A 2C0SA 3AVSA 3FZHB 2VKJA 2UUCT 2YDQA 3AB3B 3K1SA 4ZI7E 3NRXA 4DV6T 4Z90A 1VRBA 4LFBT 5JH7E 2LOPA 2E5VA 1KK7A 2L8KA 3PUGA 3QOFA 1FMVA 4CZZB 2BBHA 2XQ3A 2BVMA 1FIOA 4ANJA 2UUBT 4LMKA 5EK3A 2UXCT 3GMIA 5LMNT 1Y01A 4PK4A 5AQOB 4DV2T 3EDVA 4F6RC 3TLTA 3HR0A 4QX7B 3AEGA 4P1NA 2K3WA 4HWDA 4DR4T 1D0YA 4ERRA 4L9IA 2CBJA 3UUXB 1LRZA 3PJAA 2OLTA 3HA4A 4DVDA 5AQPB 5LGNB 4IE0A 2CBIA 2WDVA 3N9LA 3ZMVB 2BKPA 3RYIE 2CXLA 5C2TA 5LB7B 4HN9A 4JV5T 3N2OA 5L3FB 2XQ6A 2OA5A 2E9XD 4UF0B 3ZMTB 3KVBA 3ZCJA 3OTOT 2W0GA 3CMLA 5L4HA 3GWHA 1SA0E 3A5XA 4DNDA 2N2NA 2QRXA 2NP9A 3FZLB 1SE7A 2WS3A 4DR1T 2H88A 2C5IT 4XBFB 4LFCT 1WFDA 5JR9B 5JDNA 2CRBA 3RQUA 3AE2A 2CCQA 4U2YA 1T98A 3BK9A 4HKAA 2KZ7B 2LT3A 4I0UA 4LMJA 1JNZA 1MIWA 4UELA 3K3OA 5KX5E 4K0KT 4EZHA 2XQYA 3UU6A 2ODVA 3C4ZA 3OBVE 4LMLA 5JQGE 3C50A 3UQ4A 5AQFB 2JPFA 2ZM6T 4AQYT 3HKEE 4GK5E 1LVKA 3VKHA 3RC3A 5HEJA 4KX6A 3PDYA 2LHNA 4HFIA 4O4LE 2R6GF 1CHUA 2Q9QB 1OWAA 2V26A 5L47A 3ZJ1A 5LG3A 1I94T 2W63A 1HX8A 2LSJA 4ADZA 4X66T 2IC9A 4ILAA 3AXJA 3FZKB 3H3MA 5ABFB 5CA1E 1R8IA 3QB5K 1XNQT 4EAHA 3EVYA 3HKDE 3R84B 2MOZA 4HFVA 4V1Av 4YSXA 2NOXA 3ONLC 2V7JA 1KNRA 2NW7A 2NWBA 3CK6A 4WNKA 5LGTB 2W67A 3O9XA 1QUUA 3B57A 4ZZBA 2JJ9A 4X64T 3JC6D 3CVRA 4CQIA 3NZQA 3P4SA 4DUZT 2LLYA 4AXPA 4GKJT 4UF0A 4CI1B 3FHNA 2K24A 3AA6B 2GK9A 2YINA 2LKHA 1HNXT 4JI1T 2XQAA 4DBQA 3DJBA 4COFA 3RRCA 3ABVA 4QKNA 5FL1A 4U74A 2CXDA 3L8RA 5HWYA 4ILCA 2KWHA 3MXZA 2X67A 5JR9A 2XY8B 5FYMA 2JQKA 2VVSA 4E7ZA 2BZBA 5FY7A 5IWAT 2CMRA 3PJAJ 4H9RC 2K48A 2XQ4A 2EHOB 4AKRB 1OEDC 5J2TE 2WU5A 5HYAA 2N1GA 4ZI3D 3G06A 1MMGA 2X9HA 2D0TA 3KBTA 2XM2A 3K8PC 2E9XC 2HHHT 2VKOA 4BAYB 4DV3T 5AQHB 5L2LA 2BS4A 4UEMA 1WYCA 3UU8A 4DR7T 1O3XA 1IBLT 4H63H 3AE5A 4LF8T 3AE6A 1YD8G 2W00A 4LF9T 5BMVE 1M62A 4DR2T 3MKDA 3D0TA 5AQMB 4YFSA 4AKHA 2SPCA 2XAJB 4O4IE 2IC6A 4H63V 5HCJA 4P09A 5ABFA 4C90A 2PBIA 5HXCA 3UFEA 5JREA 2XM1A 1ZP0A 4JI6T 4B3MT 4N78D 1HF8A 2V7IA 2N9DA 1E7PA 3E08A 4X65T 4IE4A 4TNVA 4YLHA 5JDMA 4DV7T 5HEGA 3P8CD 4HWIB 3AEBA 4DBRA 2AE9A 3RGLA 5ABEA 4GYSA 5L3DB 1HR0T 3X1DA 4O2AE 4X1IE 3ZMZB 1U4QA 5AQNB 1V9DA 4ISTA 2VQET 3JADA 2BG9C 2X9WA 1T8BA 3ZCIA 2A72A 3UT5E 3UQ7A 5HAXA 3P4PA 5CFBA 3CQCB 2UUAT 4HWCA 2V1DB 2KWIB 2V7MA 4EEDA 3ETUA 4P0AA 2IDOB 4U2ZA 3RYCE 4QH5A 3PUAA 4JYAT 5AQLB 4H9OC 1H7CA 3PU8A 2EHOA 5FVKA 3HKBE 4MBQA 4ZS3A 4I4TE 4IL9A 4PJMA 2VQFT 4HTEA 3DTOA 1OXZA 4EIWA 3MK7C 3LK3B 2Y8DA 1ZOYA 4I43B 4IDQA 3K3NA 3J7Yq 4EXTA 4DO0A 2VASA 3RQWA 4DMWA 1HX1B 5FVLA 4B3ST 3QK6A 3I9WA 4HWHA 3NKZA 4TN7B 1N32T 2BKOA 2BDEA 2B1EA 4UV9B 3PUYF 2IAKA 3ONJA 3SS1A 1YKHB 2FJDA 4DMVA 4J2CA 3AAAB 2XAFB 4H9PC 3Q5EA 3QUJA 1WR0A 2KLQA 4CXWA 3TLWA 4ZI3C 4PAGA 3L09A 4F8HA 2E8IA 4EGWA 4PK6A 3WI3A 3IBPA 3LDQB 1SHZC 2YN6A 2LM2A 2RP4A 1B7TA 2WP9A 4QWNB 5AQSB 3MJXA 1IBMT 2Z6EA 4OX9T 4ILBA 2DWKA 3C64A 2PJQA 1XMQT 4AQFA 2X51A 2JQ9A 3I9YA 4IDOA 2BBJA 1XZYA 2J1DG 3PE0A 2NR4A 1W0AA 2W66A 3UU5A 3P4RA 1XMOT 2KXPB 1KNPA 4GIWA 1IJ6A 1ZV4X 2W2UA 5LGUB 2C5KT 3AAEB 3I1AA 1WYBA 4NIQA 5LMUT 4UIGA 1G73A 2XAQB
chains in the Genus database with same CATH topology
3OTOT 1N33T 1N36T 1XNQT 2HHHT 1IBKT 4DV3T 3T1YT 2UUAT 4YY3T 1HNWT 4JI3T 4DV0T 4DR7T 4DV1T 1IBLT 4KHPT 4JI2T 2UUCT 4LF5T 4DR1T 4DV5T 4LFCT 4JYAT 4LF8T 4DV6T 1HNZT 4JI5T 4LF9T 4LFBT 4LFAT 4X64T 3T1HT 4JI4T 4DR2T 4DV4T 4DUZT 4JI7T 2UXDT 2UUBT 4GKJT 4X62T 2VQFT 1IBMT 2UXCT 4B3RT 2UU9T 4B3TT 4OX9T 1J5ET 4K0KT 5LMNT 1XMQT 1HNXT 4JI1T 4DV2T 4LF6T 4JI6T 4B3MT 1XNRT 1N34T 4NXNT 4JI8T 4B3ST 2ZM6T 4AQYT 4DR4T 4YHHT 4DUYT 1XMOT 4DR3T 4LF4T 4X65T 2F4VT 1N32T 4NXMT 4DR5T 4GKKT 4JI0T 4DV7T 2UXBT 4DR6T 5IWAT 5BR8T 1I94T 4LF7T 5LMUT 4JV5T 1HR0T 1FJGT 4X66T 2E5LT 2VQET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO T;  1N33 T;  1N36 T;  1XNQ T;  2HHH T;  1IBK T;  4DV3 T;  3T1Y T;  2UUA T;  4YY3 T;  1HNW T;  4JI3 T;  4DV0 T;  4DR7 T;  4DV1 T;  1IBL T;  4KHP T;  4JI2 T;  2UUC T;  4LF5 T;  4DR1 T;  4DV5 T;  4LFC T;  4JYA T;  4LF8 T;  4DV6 T;  1HNZ T;  4JI5 T;  4LF9 T;  4LFB T;  4LFA T;  4X64 T;  3T1H T;  4JI4 T;  4DR2 T;  4DV4 T;  4DUZ T;  4JI7 T;  2UXD T;  2UUB T;  4GKJ T;  4X62 T;  2VQF T;  1IBM T;  2UXC T;  4B3R T;  2UU9 T;  4B3T T;  4OX9 T;  1J5E T;  4K0K T;  5LMN T;  1XMQ T;  1HNX T;  4JI1 T;  4DV2 T;  4LF6 T;  4JI6 T;  4B3M T;  1XNR T;  1N34 T;  4NXN T;  4JI8 T;  4B3S T;  2ZM6 T;  4AQY T;  4DR4 T;  4YHH T;  4DUY T;  1XMO T;  4DR3 T;  4LF4 T;  4X65 T;  2F4V T;  1N32 T;  4NXM T;  4DR5 T;  4GKK T;  4JI0 T;  4DV7 T;  2UXB T;  4DR6 T;  5IWA T;  5BR8 T;  1I94 T;  4LF7 T;  5LMU T;  4JV5 T;  1HR0 T;  1FJG T;  4X66 T;  2E5L T;  2VQE T; 
#chains in the Genus database with same CATH topology
 2ZM0 A;  4ZI2 D;  1N33 T;  4QXH B;  3ZYL A;  4IIJ E;  3ZN1 B;  3N9M A;  5M4Y A;  3ZST A;  2X9X A;  5GON E;  5KMG P;  3E0Z A;  3O1H A;  4OFZ A;  2NTY A;  3A8Y C;  5JDL A;  5JDH A;  4PK5 A;  5A1L A;  3VRA A;  4JI4 T;  4PW8 A;  5EK4 A;  4G63 A;  3B13 A;  3RYF E;  3OYX A;  2YDS A;  3VU7 H;  3ZMU B;  4B3R T;  4MFR A;  2MPK A;  2CM0 A;  4QH1 A;  2DL1 A;  3NRY A;  2PTF A;  3IEE A;  4TUY E;  3O1I A;  2XQ9 A;  4PFO A;  5JTG A;  2FJB A;  4DR3 T;  3ONX A;  4K0U A;  3PUZ F;  3N9Q A;  1OED B;  4UVA B;  3OYZ A;  4NXM T;  4GKK T;  5F5W A;  3I0O A;  3TKL B;  2UXB T;  2CE7 A;  2D9D A;  1IZN B;  2QA7 A;  2A3D A;  3UU3 A;  2XUE A;  3HKC E;  2E9X B;  1KEY A;  4OHF A;  4NPP A;  1L0V A;  2LSY A;  4C91 A;  2CLY B;  2LJL A;  4PJL A;  4ILU A;  5FL0 A;  2XQ8 A;  2WU2 A;  2YKS A;  3AA0 B;  3LJC A;  5J0Z A;  1W09 A;  5TAO A;  3E22 E;  2IW5 B;  4O8S A;  3VRB A;  2KSR A;  3CWZ B;  2WB5 A;  4YY3 T;  2V5D A;  1HNW T;  1Z8U A;  2CEA A;  2BKN A;  4UVB B;  4U7I A;  1WCR A;  3ETV A;  3FBL A;  5FNV E;  4LF5 T;  4EYY R;  4HEA A;  4IDZ A;  4HFB A;  5FXZ A;  3CKD A;  3EUH A;  3UUL A;  4WYV A;  2G0U A;  2WWV A;  4KMC A;  4JI7 T;  2BS2 A;  1D1A A;  4P0B A;  4OYJ A;  1KNZ A;  2UU9 T;  3L39 A;  2V5C A;  3PUX F;  3J9X 1;  2MYS A;  2L3L A;  3PUQ A;  4MHC A;  4HGA A;  5JDF A;  4A5X A;  2I0M A;  3FZM B;  3Q9D A;  2VB6 A;  1NEK A;  3EAB A;  2VKD A;  3RKO A;  3ZSS A;  5LBM A;  2FJA A;  5DAB A;  2M6B A;  3PUR A;  2H3R A;  4TV8 E;  2EHO D;  4IHJ E;  2NTX A;  3SRZ A;  4QHO A;  4WW0 A;  2BG9 B;  2LSK A;  2HPL A;  3NZP A;  2LOS A;  2RPA A;  5HEU A;  3NWI A;  2LRK A;  2M6I A;  2D5U A;  3ANW B;  5C3J A;  4KHZ F;  4HFE A;  4A98 A;  5CGM A;  4UVC B;  5H6R B;  3LK4 2;  5HXS A;  5KDM C;  4YTN A;  4ZI2 C;  3V5U A;  4KUM B;  4L5G A;  1IBK T;  2KT9 A;  3RLF F;  1OED E;  4NUV A;  3CIR A;  3AE7 A;  5JR9 C;  2D0U A;  1OED A;  3KDS E;  4KHP T;  3HI2 A;  4KI0 F;  4QH4 A;  4X1Y E;  1UK5 A;  5ABG A;  4UXN B;  4NUU A;  3QC9 A;  5ADX L;  4YJ3 E;  2WZH A;  4JI5 T;  4LFA T;  5IUX A;  3W15 B;  2E9X A;  2MAW A;  4TWH A;  1BR2 A;  4PJJ A;  2X0Y A;  2ZMA A;  5HWX A;  4A56 A;  2JQH A;  1QSD A;  3K3Q C;  3ZPO A;  1MND A;  2ACZ A;  3AVR A;  2PG8 A;  4WZX A;  1J5E T;  3SFD A;  4CN1 A;  1HTJ F;  4CN4 A;  4AKL A;  2Q9Q A;  5AQV B;  3RIU C;  2DNX A;  4EEB A;  2NW9 A;  2I59 A;  3EAM A;  2K9A A;  3MZK B;  4IDN A;  1YXR A;  4UV8 B;  4IDP A;  5FXV A;  1BR4 A;  4YHH T;  4YTP A;  3AA1 B;  3VR9 A;  3CQX C;  3RIA A;  2W61 A;  1UGO A;  4PJN A;  3KVA A;  3RF1 A;  1YKE B;  1T7S A;  1G8X A;  3IA3 A;  1US7 B;  3T8O A;  3BQK A;  2X0L B;  1LVF A;  2WSS V;  2ES0 A;  2WAU A;  3NVO A;  5F3J A;  2H7V C;  3GA8 A;  2J4G A;  2XJ7 A;  3C4W A;  3OVU A;  3P7I A;  3ZT7 A;  2CHO A;  2VKH A;  3PU3 A;  2CHN A;  2XSB A;  4I50 E;  1WRD A;  4MAL A;  3RYH E;  1UUR A;  2M67 A;  2P9B A;  2LE8 A;  1NWM X;  2BG9 A;  4Q25 A;  3KBU A;  4GYR A;  1YQ4 A;  3T1H T;  4JUY A;  5LHI B;  1W0B A;  3ZYK A;  4CXY A;  3ANW A;  3ZJ2 A;  4X62 T;  3U3I A;  3P4Q A;  3IHR A;  3RPU A;  1WR6 A;  5C8Y E;  5DJQ C;  4IE7 A;  3PUV F;  2VK9 A;  2ZM8 A;  4UR9 A;  3JC6 C;  3VR8 A;  3CPZ A;  1D0X A;  3LK2 B;  4LF4 T;  4EYU A;  1WLX A;  1MMD A;  2FUP A;  2H7O A;  3N5L A;  3ZEF B;  2EHO C;  4YT0 A;  4DR6 T;  5FY0 A;  2H89 A;  2KIN B;  4DID B;  3RIF A;  2JQQ A;  2KMF A;  5LJN A;  4EB6 E;  1EZ3 A;  5EZY E;  5LOV E;  4GOU A;  4BJN A;  3ZYM A;  1N36 T;  2DCF A;  3KV9 A;  3KV4 A;  2XQ5 A;  1W9R A;  5ABH A;  5LYJ E;  3RI5 A;  3VHL A;  4TZ4 C;  2WQY A;  2A9U A;  1FMW A;  4PNI A;  3F57 A;  3Q5W A;  3C4X A;  4IGU A;  3CX6 B;  3ZLI A;  3RC8 A;  2YOE A;  1ZHC A;  4BA9 A;  3AAI A;  2JMK A;  4E7S A;  4U33 A;  4OYK A;  4MLK A;  3PTR B;  1NEN A;  4GK0 E;  3AEE A;  3AEF A;  3QNU A;  1VCT A;  2VL8 A;  1J1J A;  5AQG B;  1BR0 A;  4HE8 A;  5AQQ B;  1NAF A;  4LF6 T;  5LJM A;  3TLV A;  4CXX A;  1N34 T;  2YDR A;  3U78 A;  2XTL A;  4X1K E;  5HEH A;  5FXX A;  4YTM A;  3LG7 A;  5KXJ A;  3ESL A;  4H9S E;  2Y6X A;  4YXD A;  5HCM A;  5AQK B;  3ZKR A;  2PFV A;  3B5M A;  4HFC A;  2WWU A;  2LSI A;  4HWF A;  1XWM A;  1MIY A;  2ACX A;  2HPJ A;  5FP3 A;  1DU2 A;  1YW0 A;  2I6H A;  5HEO A;  5JRC B;  2DLR A;  4FJO A;  1HCI A;  2AXD S;  1S94 A;  4AQF C;  3TLS A;  4YHJ A;  2HN2 A;  3H3A A;  4U72 A;  1IJ5 A;  3GN5 B;  2C5J A;  5AQT B;  2RA1 A;  3PUS A;  3EDU A;  5JDQ A;  4U31 A;  1FEW A;  4AKI A;  5AFU L;  4IL4 A;  3KIN B;  4DV0 T;  4JI2 T;  2A2F X;  3FXD B;  4ZEY A;  3AEC A;  1UX5 A;  1HNZ T;  3RX6 A;  2XHE B;  1UX4 A;  3Q5D A;  5L3G B;  3AXJ B;  4IE5 A;  1JNR A;  4XZC A;  1HG2 A;  2ZM2 A;  2V7L A;  5AQI B;  4DV4 T;  3M65 A;  1J5W A;  2MTQ A;  5FKY A;  3O1J A;  3UU4 A;  1ZEE A;  5L4E A;  4B3T T;  3BQI A;  2IML A;  1VOM A;  1I6Z A;  3AE3 A;  2MBG A;  3AE8 A;  2VVN A;  1LKX A;  1BR1 A;  2J47 A;  3SWH A;  4BJM A;  4NXN T;  3S4U A;  1MMA A;  4DUY T;  1GQE A;  2WDQ A;  2UXX B;  3HL6 A;  4EZ4 A;  2YU1 A;  2IHR 1;  3A7M A;  4X20 E;  4B6X A;  3VKG A;  5LP6 E;  4DR5 T;  2VL0 A;  2QYW A;  3RH3 A;  4YSY A;  3RHW A;  3FB2 A;  2J62 A;  1XDP A;  3N9P A;  3C51 A;  2WMO A;  1S35 A;  4IE6 A;  4A97 A;  4U3C A;  2Q9Q D;  3MA9 A;  3UUN A;  2XZE A;  3H37 A;  2CXF A;  4O4J E;  5LBQ B;  3EI0 A;  3UFG A;  1YQ3 A;  3IF8 B;  4TNW A;  1MIV A;  1Y64 B;  2VUR A;  2X68 A;  4EV6 A;  1D1C A;  1KFY A;  1E1H B;  3CX8 B;  1KF6 A;  2UXN B;  5L3B B;  5FXW A;  5JDG A;  3Q2M A;  3N2G E;  2KND A;  3WAJ A;  2B76 A;  3ZC0 A;  3P50 A;  5LG4 A;  5HXH A;  5JRC A;  1QLB A;  4IRE A;  2BS3 A;  3L3P A;  3I0Q A;  3FZF B;  1HG5 A;  4JEH B;  1D1B A;  3CQG B;  2WBL A;  3GN5 A;  5H6Q B;  1T72 A;  4IT4 A;  4TX5 A;  4PFP A;  3RRW A;  2FBW A;  3P4W A;  3QB5 A;  2Y48 B;  3AA7 B;  2D2S A;  2L9Q A;  4QX8 B;  4X5T A;  5AQJ B;  3AE4 A;  3OKQ A;  4TWF A;  3OJA A;  5ETW A;  4G2A A;  2WCA A;  4M1P A;  4CI3 B;  5J1G A;  5LNK A;  1IAP A;  4Z91 A;  1CUN A;  2CA5 A;  5AQU B;  4ZOL E;  4ASK A;  5LCY A;  3C98 B;  2DWG A;  4DV1 T;  5LA6 E;  2YEV C;  3ZT5 A;  1X79 A;  3AE1 A;  2JIW A;  3MAC A;  5EK2 A;  2V6Y B;  4U7Y A;  3LSV A;  3ZC1 A;  4HFD A;  1VCS A;  2UXD T;  5F8P A;  4QXB B;  2VWA A;  2LSG A;  2WZI A;  4I55 E;  3Q5X A;  2HH7 A;  2WY2 A;  4WBO A;  2K5B B;  4XAX B;  1XNR T;  2CWO A;  4ZZC A;  5J2U E;  4O4H E;  4OK0 A;  3N9O A;  2BVL A;  5AQR B;  2XSA A;  4AIS A;  3FXE B;  4AQG A;  3V5S A;  3R6N A;  2YU2 A;  4QXC B;  4JI0 T;  3JCF A;  2ODU A;  4EOZ B;  4YJ2 E;  5FY1 A;  5BR8 T;  2DI4 A;  2CLY C;  4L0R A;  3RIU A;  5L3C B;  2V8S V;  2WDR A;  5CJ5 A;  4JLE A;  3JAF A;  4ZHQ E;  1Z0P A;  1HFA A;  4AIU A;  2Q9Q C;  2CWY A;  3EHZ A;  5E0O A;  2ZLY A;  5HXR A;  3NBX X;  5DQW A;  3N2K E;  1E2A A;  3LBX B;  5LHG B;  1U5P A;  4JI3 T;  3TLU A;  4DV5 T;  2LHR A;  3SOL A;  5IYZ E;  2IIU A;  3N9N A;  2NW8 A;  4CI2 B;  4HFH A;  2YK0 A;  4ZXL A;  2IUB A;  3F2E A;  2WMN A;  3UUB A;  3UUM A;  2BG9 E;  1X9B A;  2XAS B;  2QGS A;  4FI5 A;  2LEH A;  2E2A A;  2V7K A;  2JRK A;  3KFW X;  4O2B E;  2FJE A;  4ISS A;  5LHH B;  3WAK A;  4YSZ A;  3PV0 F;  2V6Y A;  2LKG A;  3O4X E;  1HS7 A;  3F31 A;  1FJG T;  5HXE A;  5IHY A;  3LFM A;  2X9Y A;  2OV9 A;  2X66 A;  2XAG B;  2XAH B;  3KV5 A;  5CB4 E;  5JVD E;  4AI6 A;  2LRL A;  3M3Z B;  4KP3 C;  1MMN A;  1SUM B;  1XDO A;  3AED A;  3PUW F;  3OPC A;  2X0H A;  2XQ7 A;  3ZT6 A;  3RKG A;  5DQV A;  5LXT E;  2W4X A;  2QVA A;  2XPK A;  4TV9 E;  2LM9 A;  2V6X A;  4ZS2 A;  1M7K A;  3SFE A;  3LBX A;  4JI8 T;  3DP7 A;  2HN1 A;  4TWD A;  4WBN E;  4H9Q C;  3JAE A;  2F4V T;  3CX7 B;  3ZN0 B;  3AE9 A;  1MNE A;  1ZKE A;  3FBZ A;  4LF7 T;  3AEA A;  2DHR A;  3BQL A;  5CA0 E;  4JEU B;  5L3E B;  5FMN A;  2W62 A;  4H9N C;  2CPT A;  4AKG A;  2E5L T;  3ZMS B;  3KV6 A;  3UTK A;  1UCU A;  4JBW F;  4KBM B;  2WM9 A;  4Z8X A;  3T1Y T;  4CN6 A;  1UUS A;  2JMH A;  1D0Z A;  1AJ3 A;  2C0S A;  3AVS A;  3FZH B;  2VKJ A;  2UUC T;  2YDQ A;  3AB3 B;  3K1S A;  4ZI7 E;  3NRX A;  4DV6 T;  4Z90 A;  1VRB A;  4LFB T;  5JH7 E;  2LOP A;  2E5V A;  1KK7 A;  2L8K A;  3PUG A;  3QOF A;  1FMV A;  4CZZ B;  2BBH A;  2XQ3 A;  2BVM A;  1FIO A;  4ANJ A;  2UUB T;  4LMK A;  5EK3 A;  2UXC T;  3GMI A;  5LMN T;  1Y01 A;  4PK4 A;  5AQO B;  4DV2 T;  3EDV A;  4F6R C;  3TLT A;  3HR0 A;  4QX7 B;  3AEG A;  4P1N A;  2K3W A;  4HWD A;  4DR4 T;  1D0Y A;  4ERR A;  4L9I A;  2CBJ A;  3UUX B;  1LRZ A;  3PJA A;  2OLT A;  3HA4 A;  4DVD A;  5AQP B;  5LGN B;  4IE0 A;  2CBI A;  2WDV A;  3N9L A;  3ZMV B;  2BKP A;  3RYI E;  2CXL A;  5C2T A;  5LB7 B;  4HN9 A;  4JV5 T;  3N2O A;  5L3F B;  2XQ6 A;  2OA5 A;  2E9X D;  4UF0 B;  3ZMT B;  3KVB A;  3ZCJ A;  3OTO T;  2W0G A;  3CML A;  5L4H A;  3GWH A;  1SA0 E;  3A5X A;  4DND A;  2N2N A;  2QRX A;  2NP9 A;  3FZL B;  1SE7 A;  2WS3 A;  4DR1 T;  2H88 A;  2C5I T;  4XBF B;  4LFC T;  1WFD A;  5JR9 B;  5JDN A;  2CRB A;  3RQU A;  3AE2 A;  2CCQ A;  4U2Y A;  1T98 A;  3BK9 A;  4HKA A;  2KZ7 B;  2LT3 A;  4I0U A;  4LMJ A;  1JNZ A;  1MIW A;  4UEL A;  3K3O A;  5KX5 E;  4K0K T;  4EZH A;  2XQY A;  3UU6 A;  2ODV A;  3C4Z A;  3OBV E;  4LML A;  5JQG E;  3C50 A;  3UQ4 A;  5AQF B;  2JPF A;  2ZM6 T;  4AQY T;  3HKE E;  4GK5 E;  1LVK A;  3VKH A;  3RC3 A;  5HEJ A;  4KX6 A;  3PDY A;  2LHN A;  4HFI A;  4O4L E;  2R6G F;  1CHU A;  2Q9Q B;  1OWA A;  2V26 A;  5L47 A;  3ZJ1 A;  5LG3 A;  1I94 T;  2W63 A;  1HX8 A;  2LSJ A;  4ADZ A;  4X66 T;  2IC9 A;  4ILA A;  3AXJ A;  3FZK B;  3H3M A;  5ABF B;  5CA1 E;  1R8I A;  3QB5 K;  1XNQ T;  4EAH A;  3EVY A;  3HKD E;  3R84 B;  2MOZ A;  4HFV A;  4V1A v;  4YSX A;  2NOX A;  3ONL C;  2V7J A;  1KNR A;  2NW7 A;  2NWB A;  3CK6 A;  4WNK A;  5LGT B;  2W67 A;  3O9X A;  1QUU A;  3B57 A;  4ZZB A;  2JJ9 A;  4X64 T;  3JC6 D;  3CVR A;  4CQI A;  3NZQ A;  3P4S A;  4DUZ T;  2LLY A;  4AXP A;  4GKJ T;  4UF0 A;  4CI1 B;  3FHN A;  2K24 A;  3AA6 B;  2GK9 A;  2YIN A;  2LKH A;  1HNX T;  4JI1 T;  2XQA A;  4DBQ A;  3DJB A;  4COF A;  3RRC A;  3ABV A;  4QKN A;  5FL1 A;  4U74 A;  2CXD A;  3L8R A;  5HWY A;  4ILC A;  2KWH A;  3MXZ A;  2X67 A;  5JR9 A;  2XY8 B;  5FYM A;  2JQK A;  2VVS A;  4E7Z A;  2BZB A;  5FY7 A;  5IWA T;  2CMR A;  3PJA J;  4H9R C;  2K48 A;  2XQ4 A;  2EHO B;  4AKR B;  1OED C;  5J2T E;  2WU5 A;  5HYA A;  2N1G A;  4ZI3 D;  3G06 A;  1MMG A;  2X9H A;  2D0T A;  3KBT A;  2XM2 A;  3K8P C;  2E9X C;  2HHH T;  2VKO A;  4BAY B;  4DV3 T;  5AQH B;  5L2L A;  2BS4 A;  4UEM A;  1WYC A;  3UU8 A;  4DR7 T;  1O3X A;  1IBL T;  4H63 H;  3AE5 A;  4LF8 T;  3AE6 A;  1YD8 G;  2W00 A;  4LF9 T;  5BMV E;  1M62 A;  4DR2 T;  3MKD A;  3D0T A;  5AQM B;  4YFS A;  4AKH A;  2SPC A;  2XAJ B;  4O4I E;  2IC6 A;  4H63 V;  5HCJ A;  4P09 A;  5ABF A;  4C90 A;  2PBI A;  5HXC A;  3UFE A;  5JRE A;  2XM1 A;  1ZP0 A;  4JI6 T;  4B3M T;  4N78 D;  1HF8 A;  2V7I A;  2N9D A;  1E7P A;  3E08 A;  4X65 T;  4IE4 A;  4TNV A;  4YLH A;  5JDM A;  4DV7 T;  5HEG A;  3P8C D;  4HWI B;  3AEB A;  4DBR A;  2AE9 A;  3RGL A;  5ABE A;  4GYS A;  5L3D B;  1HR0 T;  3X1D A;  4O2A E;  4X1I E;  3ZMZ B;  1U4Q A;  5AQN B;  1V9D A;  4IST A;  2VQE T;  3JAD A;  2BG9 C;  2X9W A;  1T8B A;  3ZCI A;  2A72 A;  3UT5 E;  3UQ7 A;  5HAX A;  3P4P A;  5CFB A;  3CQC B;  2UUA T;  4HWC A;  2V1D B;  2KWI B;  2V7M A;  4EED A;  3ETU A;  4P0A A;  2IDO B;  4U2Z A;  3RYC E;  4QH5 A;  3PUA A;  4JYA T;  5AQL B;  4H9O C;  1H7C A;  3PU8 A;  2EHO A;  5FVK A;  3HKB E;  4MBQ A;  4ZS3 A;  4I4T E;  4IL9 A;  4PJM A;  2VQF T;  4HTE A;  3DTO A;  1OXZ A;  4EIW A;  3MK7 C;  3LK3 B;  2Y8D A;  1ZOY A;  4I43 B;  4IDQ A;  3K3N A;  3J7Y q;  4EXT A;  4DO0 A;  2VAS A;  3RQW A;  4DMW A;  1HX1 B;  5FVL A;  4B3S T;  3QK6 A;  3I9W A;  4HWH A;  3NKZ A;  4TN7 B;  1N32 T;  2BKO A;  2BDE A;  2B1E A;  4UV9 B;  3PUY F;  2IAK A;  3ONJ A;  3SS1 A;  1YKH B;  2FJD A;  4DMV A;  4J2C A;  3AAA B;  2XAF B;  4H9P C;  3Q5E A;  3QUJ A;  1WR0 A;  2KLQ A;  4CXW A;  3TLW A;  4ZI3 C;  4PAG A;  3L09 A;  4F8H A;  2E8I A;  4EGW A;  4PK6 A;  3WI3 A;  3IBP A;  3LDQ B;  1SHZ C;  2YN6 A;  2LM2 A;  2RP4 A;  1B7T A;  2WP9 A;  4QWN B;  5AQS B;  3MJX A;  1IBM T;  2Z6E A;  4OX9 T;  4ILB A;  2DWK A;  3C64 A;  2PJQ A;  1XMQ T;  4AQF A;  2X51 A;  2JQ9 A;  3I9Y A;  4IDO A;  2BBJ A;  1XZY A;  2J1D G;  3PE0 A;  2NR4 A;  1W0A A;  2W66 A;  3UU5 A;  3P4R A;  1XMO T;  2KXP B;  1KNP A;  4GIW A;  1IJ6 A;  1ZV4 X;  2W2U A;  5LGU B;  2C5K T;  3AAE B;  3I1A A;  1WYB A;  4NIQ A;  5LMU T;  4UIG A;  1G73 A;  2XAQ B; 
#chains in the Genus database with same CATH homology
 3OTO T;  1N33 T;  1N36 T;  1XNQ T;  2HHH T;  1IBK T;  4DV3 T;  3T1Y T;  2UUA T;  4YY3 T;  1HNW T;  4JI3 T;  4DV0 T;  4DR7 T;  4DV1 T;  1IBL T;  4KHP T;  4JI2 T;  2UUC T;  4LF5 T;  4DR1 T;  4DV5 T;  4LFC T;  4JYA T;  4LF8 T;  4DV6 T;  1HNZ T;  4JI5 T;  4LF9 T;  4LFB T;  4LFA T;  4X64 T;  3T1H T;  4JI4 T;  4DR2 T;  4DV4 T;  4DUZ T;  4JI7 T;  2UXD T;  2UUB T;  4GKJ T;  4X62 T;  2VQF T;  1IBM T;  2UXC T;  4B3R T;  2UU9 T;  4B3T T;  4OX9 T;  1J5E T;  4K0K T;  5LMN T;  1XMQ T;  1HNX T;  4JI1 T;  4DV2 T;  4LF6 T;  4JI6 T;  4B3M T;  1XNR T;  1N34 T;  4NXN T;  4JI8 T;  4B3S T;  2ZM6 T;  4AQY T;  4DR4 T;  4YHH T;  4DUY T;  1XMO T;  4DR3 T;  4LF4 T;  4X65 T;  2F4V T;  1N32 T;  4NXM T;  4DR5 T;  4GKK T;  4JI0 T;  4DV7 T;  2UXB T;  4DR6 T;  5IWA T;  5BR8 T;  1I94 T;  4LF7 T;  5LMU T;  4JV5 T;  1HR0 T;  1FJG T;  4X66 T;  2E5L T;  2VQE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...