1XNRT

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1xnrT00
4X66T 1FJGT 2UUCT 4DR6T 4DR7T 4JV5T 1I94T 1N36T 4YHHT 4DR3T 1IBMT 4LF5T 1IBKT 4DV3T 4B3TT 2VQET 4LF4T 1HNXT 4AQYT 4B3ST 4DUZT 3OTOT 4B3MT 4B3RT 4LF6T 2UXCT 4K0KT 4GKKT 4JI8T 5IWAT 4JI6T 1XNQT 4LF7T 4LFAT 4LF8T 4X65T 4OX9T 2UXDT 3T1YT 1IBLT 4JI3T 4JI0T 4LFBT 2UUAT 4GKJT 4DR4T 4DV6T 4JI7T 1HNWT 2UXBT 2E5LT 4X64T 1J5ET 5LMUT 4DV2T 1XMOT 1N33T 4NXMT 4DV0T 1N34T 4KHPT 4DR2T 1XMQT 4JI5T 4NXNT 2HHHT 1HR0T 1HNZT 2F4VT 4LFCT 4JI4T 4JI1T 4JYAT 4DV1T 1N32T 4X62T 4DR1T 1XNRT 4LF9T 5BR8T 4DR5T 3T1HT 4DV7T 2VQFT 4JI2T 4DV4T 4DV5T 5LMNT 4DUYT 4YY3T 2ZM6T 2UUBT 2UU9T
chains in the Genus database with same CATH superfamily
4NIQA 5HEHA 3RC3A 1BR1A 4X66T 1QSDA 1HFAA 4HFCA 2NR4A 4B3TT 2XM1A 4I55E 4KP3C 5CFBA 4MALA 2W4XA 2WQYA 3ZJ1A 5JDMA 5LB7B 3I1AA 5HXSA 1US7B 3B13A 3CX8B 1KFYA 1IJ5A 2IMLA 1IAPA 2Q9QD 4HWIB 4J2CA 5ETWA 2PBIA 4YHHT 1N36T 1AJ3A 2X9YA 3PUYF 2Q9QA 4QXBB 4UV9B 5FL1A 3NZQA 5J2UE 2Y6XA 2XPKA 3ETUA 1UCUA 1YKHB 2KLQA 4Z90A 1LVKA 2VKOA 5J0ZA 4CI3B 2XQ9A 4KMCA 1HG5A 1ZP0A 4HWHA 3N5LA 4HE8A 4YSZA 5LXTE 4AQGA 4LF4T 1J1JA 4PJMA 5CB4E 3EVYA 3L3PA 5AQRB 3X1DA 4B3ST 2R6GF 2V6YB 3L09A 4TWHA 2H89A 3RYCE 2XAFB 4YTNA 5JDFA 4B3RT 4GYRA 5DQWA 5LNKA 4AXPA 2H3RA 4AQFA 4UVAB 5IYZE 2JQQA 4YT0A 5EK3A 2YINA 3N9NA 3N9OA 4MBQA 5FMNA 5L4HA 3VR8A 3RYHE 5LOVE 3SWHA 2J62A 1JNRA 1W9RA 1D0ZA 3NZPA 2FJEA 5H6RB 1ZKEA 4TNVA 5JREA 2A2FX 4ISSA 3RQUA 2MPKA 3CK6A 3JC6C 5F8PA 1I94T 4TV8E 3N2OA 2LM9A 1T98A 1MNDA 4IREA 4TZ4C 3M3ZB 2IUBA 4U2ZA 4GYSA 4H9OC 2LRLA 4JEHB 4IE6A 3TKLB 4DBRA 4AIUA 3P7IA 5AQNB 4ZZBA 2EHOD 4X65T 4OX9T 4QX7B 3ZPOA 3Q9DA 4EGWA 4ZI2D 3PUXF 2HN1A 3LK42 2LHRA 3ANWB 5FVLA 3TLVA 3ZCIA 4NUUA 2QA7A 2FJBA 3AVSA 3P4RA 3WI3A 3ZYMA 4F6RC 3R84B 5JDQA 2LRKA 4TUYE 2QYWA 1LVFA 4U74A 3JADA 5L3CB 1HNWT 4KBMB 1E1HB 3OKQA 4HKAA 2MYSA 3AA1B 2W0GA 3HL6A 2CEAA 3PDYA 3UTKA 5C3JA 2E5LT 2J47A 2FJAA 2X67A 1WFDA 4DV2T 4EEBA 2J1DG 4DMVA 3QC9A 3S4UA 1XMOT 1HTJF 1X79A 5L47A 3AE8A 3FXDB 2WMNA 3UUNA 2A9UA 2IDOB 2E8IA 2KSRA 1YKEB 2UXNB 1XMQT 5LJMA 3I0OA 4PK4A 5CGMA 1OEDB 2HHHT 2LT3A 3FBZA 5AQMB 5EZYE 5FP3A 5J1GA 5JR9A 1D1CA 2BZBA 3C4XA 3U3IA 3VRAA 2X0LB 3AEGA 4EYUA 5JTGA 4TX5A 3I0QA 2JJ9A 5LHGB 2GK9A 3GMIA 2ODVA 3OJAA 3F31A 5HEJA 4QH1A 4JI4T 4LFCT 4JYAT 3GWHA 4F8HA 4PK5A 2BS4A 3RLFF 5F3JA 4O4IE 2V7IA 4P09A 2IC9A 3RKGA 2CPTA 2D9DA 2LEHA 3R6NA 4V1Av 2QRXA 4BA9A 4CXXA 5JDLA 2NWBA 2D0TA 4U7IA 3AE3A 2BS3A 2YOEA 3LDQB 4ILCA 3UQ4A 5ADXL 4DV7T 2LM2A 1D1AA 2P9BA 4NUVA 4P0BA 2LSYA 4X1YE 4DIDB 3SFEA 4HWDA 4UV8B 2XQ4A 3JAFA 3MACA 3UUBA 5L3FB 3RIUA 2DNXA 5LGUB 4I43B 2E9XB 4GK5E 2CLYB 1YW0A 2BDEA 2D0UA 5EK4A 3RC8A 1XDPA 2YDRA 4HN9A 2DI4A 2YU2A 3DP7A 2ZM6T 2XAHB 2UXXB 2Y48B 4AISA 3EHZA 1ZV4X 2XZEA 4A97A 2YU1A 4BJNA 4CI1B 4ZZCA 3C51A 3PU8A 5AQHB 3CPZA 1G73A 1HCIA 2K5BB 2Q9QB 1X9BA 2ODUA 2DLRA 3RHWA 5ABHA 1KNZA 3ABVA 4G63A 2L9QA 5L3EB 1FJGT 3M65A 2AXDS 4ERRA 1QLBA 2UUCT 4DR6T 4DR7T 3H3AA 4HFEA 2I59A 3UU6A 2XM2A 1W0BA 5DABA 5JDHA 1IBMT 1S94A 2A72A 2NW7A 3HA4A 3DJBA 4GIWA 5DQVA 1DU2A 3KBUA 4DVDA 4EIWA 2NW8A 4P1NA 2PFVA 3QUJA 4PFOA 5FNVE 5AQUB 3UFGA 4DV3T 4ZHQE 3ZMTB 1E2AA 1T72A 2VKJA 2VK9A 3Q5DA 3ZT7A 3NBXX 4EZHA 4GOUA 5L4EA 3OBVE 1ZOYA 2CMRA 3O1JA 4HWCA 2CE7A 4YLHA 2CBJA 2YK0A 3AECA 3UUMA 4DMWA 2K9AA 4AQYT 2XAGB 3NRYA 1LKXA 2JPFA 2LE8A 3CKDA 2V26A 2H88A 3IHRA 3TLTA 2WU2A 4GK0E 5L3BB 2RP4A 5GONE 3J9X1 5CA0E 4B3MT 3N2GE 2JRKA 3FZHB 5AQKB 4LF6T 5LBMA 4I4TE 5IHYA 1VRBA 2WS3A 4PFPA 2XQYA 3TLUA 3KV5A 1MIWA 4YJ3E 1MMGA 2NP9A 2CA5A 3NRXA 5FXWA 1L0VA 4L9IA 1NEKA 3W15B 4GKKT 1VOMA 1UURA 3GN5A 1YXRA 2PG8A 4EOZB 4UELA 4ZOLE 5ABFA 1ZEEA 4JI8T 3AE4A 2JQKA 2WDRA 4HFHA 2V5DA 5AQSB 4E7ZA 5IWAT 3AE7A 2LHNA 3FHNA 3N2KE 5LGNB 4YJ2E 3CX7B 4H9PC 4JBWF 4YSXA 3LJCA 1HS7A 3UQ7A 2YN6A 4TWDA 2CWOA 2A3DA 3HKDE 1WYBA 2JIWA 3P4WA 4EXTA 4MLKA 2ES0A 2E9XA 3NKZA 1UUSA 2M6IA 2CRBA 2KNDA 4JI3T 2XSBA 3A7MA 2K3WA 1HF8A 2ZM2A 4I0UA 3UUXB 3WAJA 5JQGE 1YQ3A 2UUAT 4DR4T 3FXEB 4DV6T 2LLYA 2V8SV 3RQWA 2JMKA 3IF8B 2PJQA 3PUAA 2SPCA 3H3MA 3KINB 4WBOA 3V5SA 1FMVA 4UVCB 5E0OA 3ZC1A 1OEDC 4HFBA 1Y01A 4HTEA 2VKDA 3LBXA 1UX5A 4HFVA 2WZIA 3QNUA 2V6XA 4BAYB 1FEWA 2WM9A 4WW0A 3O9XA 1CUNA 2H7OA 2XQ8A 2JMHA 2ZM8A 4AKRB 3AXJA 3MJXA 3RX6A 5L3GB 4K0KT 2W61A 3ZEFB 4ZI2C 1NWMX 4U72A 4DR2T 1N34T 2EHOC 4HEAA 4PAGA 4QWNB 5AQLB 3RPUA 4P0AA 4O4HE 4JI5T 2FJDA 4G2AA 5HWYA 5F5WA 3HR0A 4IHJE 4ISTA 5FVKA 4U33A 2I6HA 2X0HA 2KWHA 3PV0F 2IC6A 3AA6B 2HPJA 1KK7A 1LRZA 3JC6D 1BR0A 4MFRA 1HNZT 3VKGA 2F4VT 3KV6A 3FZFB 4XZCA 5FXZA 5HCJA 4QX8B 4DV1T 3PUGA 5L2LA 2BKPA 5L3DB 4DR1T 4Q25A 2KXPB 3LG7A 2CBIA 1IBLT 3F2EA 4QKNA 4DR5T 5LYJE 4TNWA 5KXJA 4DNDA 3O1IA 3OYXA 2C5JA 2C5IT 3ZMVB 5LGTB 2L8KA 2XJ7A 3P4PA 4X1IE 3O1HA 3AA0B 1M7KA 3SRZA 5JRCA 3MXZA 4BJMA 2NTYA 4IDNA 4CN1A 2CXDA 2LKGA 3PTRB 5J2TE 3LFMA 5AQJB 5AFUL 2DHRA 2WWVA 4YY3T 3CQGB 3E08A 3RI5A 2YDQA 3NVOA 1EZ3A 4MHCA 3N9MA 3P50A 5HEOA 1ZHCA 3G06A 2Z6EA 3AE6A 3VU7H 4M1PA 4DBQA 2K48A 3A8YC 4WZXA 2OA5A 2IHR1 3LBXB 4ANJA 4KI0F 1H7CA 3K3QC 5HAXA 5C8YE 4IE7A 1D0YA 3EDUA 4IE0A 2RPAA 3AEDA 2X51A 2NOXA 3F57A 1T7SA 3OPCA 4E7SA 4DR3T 4LF5T 2BKOA 2DWKA 2XAQB 2YDSA 3E0ZA 2XHEB 3K1SA 3HKEE 5HXCA 1WCRA 3ZT5A 3TLWA 4U7YA 1MMNA 3UU8A 1KNPA 2CXFA 3EI0A 4PW8A 2ACXA 2V7JA 3ANWA 5HXRA 3AE1A 2VQET 3QB5A 2E9XC 4UVBB 5LHHB 2V7KA 4EZ4A 2CXLA 3P4QA 4X1KE 4YXDA 2HN2A 4UEMA 4PNIA 2MBGA 3RRCA 3AA7B 2X9WA 4DUZT 4AI6A 2WZHA 4QH4A 2FUPA 3PE0A 4HFIA 4X5TA 5LBQB 3RYFE 3IA3A 4C90A 1BR4A 2D2SA 4IDZA 2JQ9A 2XQ6A 3V5UA 3CIRA 3L39A 3RF1A 2XAJB 2BG9B 1D1BA 2BKNA 2W67A 3SOLA 4ILUA 2VVNA 1KEYA 1B7TA 3PJAA 2W62A 2G0UA 2J4GA 5HEGA 2YEVC 4YFSA 3Q5XA 3IBPA 3SS1A 3AAEB 3EDVA 5FYMA 3ZJ2A 4CZZB 5A1LA 4JI6T 1XNQT 4EEDA 4AKGA 3CWZB 3RIAA 3KVBA 5LG3A 2HPLA 3ZMZB 1XWMA 1U5PA 4YHJA 2E5VA 4XBFB 4LF8T 4IGUA 3JAEA 4TV9E 4OYJA 3UT5E 3KDSE 1IJ6A 1MMDA 3FB2A 4IL9A 1NENA 4A98A 3K8PC 4JI0T 2M6BA 4LFBT 3Q5WA 4GKJT 1Z8UA 2VVSA 5AQVB 3AAAB 2BG9A 2KWIB 2VURA 3K3NA 3N9LA 1WR6A 1G8XA 4JI7T 4U2YA 4ASKA 4AKIA 1VCSA 3UULA 2QGSA 2BBJA 2LOSA 3C4ZA 3PUVF 4ZI3C 3AEBA 4N78D 3UU5A 5EK2A 2NW9A 4LMJA 5FL0A 5IUXA 2WDVA 5LA6E 1J5ET 3B5MA 3MKDA 3VR9A 5LG4A 5LMUT 1D0XA 4ADZA 2Y8DA 4EB6E 2I0MA 1N33T 4ILBA 4KHZF 4NXMT 4ZI3D 3OVUA 3AEEA 3GA8A 2KINB 3PJAJ 4HWFA 2WDQA 4EV6A 1M62A 2LSKA 1WYCA 1XZYA 3KV9A 2PTFA 4ZI7E 3EABA 1HR0T 2OLTA 3KVAA 1OXZA 1W0AA 5FXVA 5C2TA 5AQFB 3OYZA 3RRWA 3SFDA 5HYAA 3MZKB 2LSGA 2VL8A 3T8OA 3QOFA 1I6ZA 4IDQA 5FY1A 3RH3A 2X9HA 4K0UA 4JI1T 3ZC0A 3MA9A 3LK3B 1N32T 4X62T 4QXCB 1YQ4A 4UF0A 4UIGA 4B6XA 5BR8T 3QK6A 3T1HT 4LF9T 2C0SA 2RA1A 1KNRA 3N9QA 3AE5A 1SHZC 5LJNA 5LP6E 2W2UA 2CHNA 3CVRA 5CJ5A 3I9WA 4WBNE 2X68A 2V7MA 3PURA 4H63H 4QXHB 1UGOA 4TWFA 4QHOA 3O4XE 3BQLA 4JI2T 4DV4T 5JR9C 2XQ5A 2BS2A 2FBWA 2LJLA 3AEAA 2L3LA 1FIOA 1IZNB 2LSIA 3L8RA 3JCFA 2OV9A 3PUWF 4DV5T 5AQQB 3ZYLA 5JDGA 2WB5A 4UR9A 2EHOB 3EUHA 4WYVA 2ZM0A 4ZS3A 2CCQA 3WAKA 2UU9T 5DJQC 3PUZF 2MOZA 3ZSTA 2JQHA 3FZKB 3LK2B 4JUYA 4U3CA 2VKHA 4H9NC 4JLEA 5H6QB 1CHUA 2N9DA 3K3OA 4IT4A 1T8BA 4O8SA 3I9YA 3AE9A 1SUMB 2CLYC 3QB5K 3ONJA 1J5WA 1R8IA 5HXEA 4JV5T 1FMWA 1Y64B 2VL0A 3KBTA 5JDNA 4COFA 2X66A 3CQCB 3U78A 2VASA 1V9DA 2WBLA 2WWUA 5CA1E 1IBKT 5ABFB 2Q9QC 5LCYA 4NPPA 3BQKA 3D0TA 2XTLA 3AVRA 4WNKA 3P8CD 3C64A 3ZLIA 4IDOA 4A5XA 3VKHA 5LHIB 4PJJA 1HNXT 3HKBE 2KT9A 4PK6A 5FY0A 1HX8A 3ONXA 1MIYA 1VCTA 4LMLA 2LOPA 4H9SE 4A56A 4CQIA 4U31A 1W09A 2DCFA 3J7Yq 1SA0E 1WRDA 3UU4A 4O4LE 3OTOT 3C4WA 4L5GA 4PJLA 1GQEA 4OHFA 4OYKA 4YSYA 3FZLB 4O2BE 3C50A 4QH5A 3ZKRA 4LFAT 2UXCT 1SE7A 4I50E 3RIFA 5JRCB 2N2NA 2MAWA 2CM0A 2IAKA 4OK0A 5FXXA 5HCMA 3EAMA 3BK9A 3VRBA 4ZEYA 2XUEA 1WR0A 4KX6A 5BMVE 1OWAA 2WCAA 2AE9A 2XASB 3C98B 3BQIA 4JEUB 1HG2A 4Z8XA 3ZYKA 3ZSSA 2WU5A 4LF7T 2D5UA 1UK5A 1O3XA 2MTQA 2W00A 4OFZA 2WP9A 5ABEA 5HXHA 5TAOA 1OEDE 1S35A 2X9XA 2LSJA 2DWGA 3NWIA 3RKOA 2LKHA 3A5XA 2UXDT 5FY7A 2WAUA 3P4SA 4IDPA 3AXJB 4FI5A 5FKYA 5ABGA 2W66A 3CX6B 3DTOA 5HWXA 2CWYA 3E22E 3ONLC 3T1YT 1E7PA 2WSSV 3KFWX 3Q5EA 2V1DB 1OEDA 2KZ7B 4EAHA 4YTPA 2XY8B 1MNEA 4HGAA 4ZS2A 5HEUA 4AKLA 4H9RC 4CN4A 3ZMUB 4KUMB 2BVMA 4PJNA 5KDMC 3H37A 2UXBT 5AQPB 2DL1A 4CXYA 1YD8G 2BG9C 4X64T 4AQFC 3AB3B 4EYYR 1UX4A 2V7LA 2ACZA 2XQAA 5AQIB 3ZN0B 1JNZA 4YTMA 3UFEA 3ETVA 4IL4A 4DV0T 1HX1B 1U4QA 1WLXA 1XDOA 3AE2A 2HH7A 4C91A 4KHPT 3ZCJA 5M4YA 4CXWA 5AQGB 2V5CA 4NXNT 2XQ3A 1QUUA 1BR2A 3KV4A 4L0RA 2XSAA 3RGLA 3UU3A 2N1GA 4X20E 3ZN1B 2QVAA 2KMFA 2XQ7A 3ESLA 2EHOA 2M67A 2ZMAA 3CQXC 2B76A 3HI2A 3PUSA 4O4JE 4Z91A 3CMLA 3ZT6A 4FJOA 1NAFA 5AQOB 4O2AE 2YKSA 5AQTB 2E2AA 4IE4A 1Z0PA 2H7VC 3TLSA 2VB6A 3PU3A 5JR9B 3GN5B 4H9QC 4LMKA 4TN7B 5KX5E 1XNRT 3AEFA 4DO0A 2W63A 2X0YA 3Q2MA 1MMAA 3FZMB 2IIUA 3B57A 2ZLYA 4ILAA 4AKHA 2WY2A 1KF6A 4H63V 3LSVA 2VQFT 3PUQA 4UF0B 4IE5A 2IW5B 3RIUC 2WMOA 3FBLA 2B1EA 3MK7C 2BVLA 5JH7E 2BBHA 3N9PA 4ZXLA 5LMNT 2E9XD 2V6YA 2K24A 3IEEA 4DUYT 4UXNB 3ZMSB 2CHOA 5JVDE 2C5KT 4HFDA 1MIVA 3RYIE 4CI2B 2NTXA 4CN6A 3HKCE 3VHLA 5KMGP 2UUBT 4XAXB 2VWAA 2BG9E 3AAIA 4IIJE
chains in the Genus database with same CATH topology
4X66T 1FJGT 2UUCT 4DR6T 4DR7T 4JV5T 1I94T 1N36T 4YHHT 4DR3T 1IBMT 4LF5T 1IBKT 4DV3T 4B3TT 2VQET 4LF4T 1HNXT 4AQYT 4B3ST 4DUZT 3OTOT 4B3MT 4B3RT 4LF6T 2UXCT 4K0KT 4GKKT 4JI8T 5IWAT 4JI6T 1XNQT 4LF7T 4LFAT 4LF8T 4X65T 4OX9T 2UXDT 3T1YT 1IBLT 4JI3T 4JI0T 4LFBT 2UUAT 4GKJT 4DR4T 4DV6T 4JI7T 1HNWT 2UXBT 2E5LT 4X64T 1J5ET 5LMUT 4DV2T 1XMOT 1N33T 4NXMT 4DV0T 1N34T 4KHPT 4DR2T 1XMQT 4JI5T 4NXNT 2HHHT 1HR0T 1HNZT 2F4VT 4LFCT 4JI4T 4JI1T 4JYAT 4DV1T 1N32T 4X62T 4DR1T 1XNRT 4LF9T 5BR8T 4DR5T 3T1HT 4DV7T 2VQFT 4JI2T 4DV4T 4DV5T 5LMNT 4DUYT 4YY3T 2ZM6T 2UUBT 2UU9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 T;  1FJG T;  2UUC T;  4DR6 T;  4DR7 T;  4JV5 T;  1I94 T;  1N36 T;  4YHH T;  4DR3 T;  1IBM T;  4LF5 T;  1IBK T;  4DV3 T;  4B3T T;  2VQE T;  4LF4 T;  1HNX T;  4AQY T;  4B3S T;  4DUZ T;  3OTO T;  4B3M T;  4B3R T;  4LF6 T;  2UXC T;  4K0K T;  4GKK T;  4JI8 T;  5IWA T;  4JI6 T;  1XNQ T;  4LF7 T;  4LFA T;  4LF8 T;  4X65 T;  4OX9 T;  2UXD T;  3T1Y T;  1IBL T;  4JI3 T;  4JI0 T;  4LFB T;  2UUA T;  4GKJ T;  4DR4 T;  4DV6 T;  4JI7 T;  1HNW T;  2UXB T;  2E5L T;  4X64 T;  1J5E T;  5LMU T;  4DV2 T;  1XMO T;  1N33 T;  4NXM T;  4DV0 T;  1N34 T;  4KHP T;  4DR2 T;  1XMQ T;  4JI5 T;  4NXN T;  2HHH T;  1HR0 T;  1HNZ T;  2F4V T;  4LFC T;  4JI4 T;  4JI1 T;  4JYA T;  4DV1 T;  1N32 T;  4X62 T;  4DR1 T;  1XNR T;  4LF9 T;  5BR8 T;  4DR5 T;  3T1H T;  4DV7 T;  2VQF T;  4JI2 T;  4DV4 T;  4DV5 T;  5LMN T;  4DUY T;  4YY3 T;  2ZM6 T;  2UUB T;  2UU9 T; 
#chains in the Genus database with same CATH topology
 4NIQ A;  5HEH A;  3RC3 A;  1BR1 A;  4X66 T;  1QSD A;  1HFA A;  4HFC A;  2NR4 A;  4B3T T;  2XM1 A;  4I55 E;  4KP3 C;  5CFB A;  4MAL A;  2W4X A;  2WQY A;  3ZJ1 A;  5JDM A;  5LB7 B;  3I1A A;  5HXS A;  1US7 B;  3B13 A;  3CX8 B;  1KFY A;  1IJ5 A;  2IML A;  1IAP A;  2Q9Q D;  4HWI B;  4J2C A;  5ETW A;  2PBI A;  4YHH T;  1N36 T;  1AJ3 A;  2X9Y A;  3PUY F;  2Q9Q A;  4QXB B;  4UV9 B;  5FL1 A;  3NZQ A;  5J2U E;  2Y6X A;  2XPK A;  3ETU A;  1UCU A;  1YKH B;  2KLQ A;  4Z90 A;  1LVK A;  2VKO A;  5J0Z A;  4CI3 B;  2XQ9 A;  4KMC A;  1HG5 A;  1ZP0 A;  4HWH A;  3N5L A;  4HE8 A;  4YSZ A;  5LXT E;  4AQG A;  4LF4 T;  1J1J A;  4PJM A;  5CB4 E;  3EVY A;  3L3P A;  5AQR B;  3X1D A;  4B3S T;  2R6G F;  2V6Y B;  3L09 A;  4TWH A;  2H89 A;  3RYC E;  2XAF B;  4YTN A;  5JDF A;  4B3R T;  4GYR A;  5DQW A;  5LNK A;  4AXP A;  2H3R A;  4AQF A;  4UVA B;  5IYZ E;  2JQQ A;  4YT0 A;  5EK3 A;  2YIN A;  3N9N A;  3N9O A;  4MBQ A;  5FMN A;  5L4H A;  3VR8 A;  3RYH E;  5LOV E;  3SWH A;  2J62 A;  1JNR A;  1W9R A;  1D0Z A;  3NZP A;  2FJE A;  5H6R B;  1ZKE A;  4TNV A;  5JRE A;  2A2F X;  4ISS A;  3RQU A;  2MPK A;  3CK6 A;  3JC6 C;  5F8P A;  1I94 T;  4TV8 E;  3N2O A;  2LM9 A;  1T98 A;  1MND A;  4IRE A;  4TZ4 C;  3M3Z B;  2IUB A;  4U2Z A;  4GYS A;  4H9O C;  2LRL A;  4JEH B;  4IE6 A;  3TKL B;  4DBR A;  4AIU A;  3P7I A;  5AQN B;  4ZZB A;  2EHO D;  4X65 T;  4OX9 T;  4QX7 B;  3ZPO A;  3Q9D A;  4EGW A;  4ZI2 D;  3PUX F;  2HN1 A;  3LK4 2;  2LHR A;  3ANW B;  5FVL A;  3TLV A;  3ZCI A;  4NUU A;  2QA7 A;  2FJB A;  3AVS A;  3P4R A;  3WI3 A;  3ZYM A;  4F6R C;  3R84 B;  5JDQ A;  2LRK A;  4TUY E;  2QYW A;  1LVF A;  4U74 A;  3JAD A;  5L3C B;  1HNW T;  4KBM B;  1E1H B;  3OKQ A;  4HKA A;  2MYS A;  3AA1 B;  2W0G A;  3HL6 A;  2CEA A;  3PDY A;  3UTK A;  5C3J A;  2E5L T;  2J47 A;  2FJA A;  2X67 A;  1WFD A;  4DV2 T;  4EEB A;  2J1D G;  4DMV A;  3QC9 A;  3S4U A;  1XMO T;  1HTJ F;  1X79 A;  5L47 A;  3AE8 A;  3FXD B;  2WMN A;  3UUN A;  2A9U A;  2IDO B;  2E8I A;  2KSR A;  1YKE B;  2UXN B;  1XMQ T;  5LJM A;  3I0O A;  4PK4 A;  5CGM A;  1OED B;  2HHH T;  2LT3 A;  3FBZ A;  5AQM B;  5EZY E;  5FP3 A;  5J1G A;  5JR9 A;  1D1C A;  2BZB A;  3C4X A;  3U3I A;  3VRA A;  2X0L B;  3AEG A;  4EYU A;  5JTG A;  4TX5 A;  3I0Q A;  2JJ9 A;  5LHG B;  2GK9 A;  3GMI A;  2ODV A;  3OJA A;  3F31 A;  5HEJ A;  4QH1 A;  4JI4 T;  4LFC T;  4JYA T;  3GWH A;  4F8H A;  4PK5 A;  2BS4 A;  3RLF F;  5F3J A;  4O4I E;  2V7I A;  4P09 A;  2IC9 A;  3RKG A;  2CPT A;  2D9D A;  2LEH A;  3R6N A;  4V1A v;  2QRX A;  4BA9 A;  4CXX A;  5JDL A;  2NWB A;  2D0T A;  4U7I A;  3AE3 A;  2BS3 A;  2YOE A;  3LDQ B;  4ILC A;  3UQ4 A;  5ADX L;  4DV7 T;  2LM2 A;  1D1A A;  2P9B A;  4NUV A;  4P0B A;  2LSY A;  4X1Y E;  4DID B;  3SFE A;  4HWD A;  4UV8 B;  2XQ4 A;  3JAF A;  3MAC A;  3UUB A;  5L3F B;  3RIU A;  2DNX A;  5LGU B;  4I43 B;  2E9X B;  4GK5 E;  2CLY B;  1YW0 A;  2BDE A;  2D0U A;  5EK4 A;  3RC8 A;  1XDP A;  2YDR A;  4HN9 A;  2DI4 A;  2YU2 A;  3DP7 A;  2ZM6 T;  2XAH B;  2UXX B;  2Y48 B;  4AIS A;  3EHZ A;  1ZV4 X;  2XZE A;  4A97 A;  2YU1 A;  4BJN A;  4CI1 B;  4ZZC A;  3C51 A;  3PU8 A;  5AQH B;  3CPZ A;  1G73 A;  1HCI A;  2K5B B;  2Q9Q B;  1X9B A;  2ODU A;  2DLR A;  3RHW A;  5ABH A;  1KNZ A;  3ABV A;  4G63 A;  2L9Q A;  5L3E B;  1FJG T;  3M65 A;  2AXD S;  4ERR A;  1QLB A;  2UUC T;  4DR6 T;  4DR7 T;  3H3A A;  4HFE A;  2I59 A;  3UU6 A;  2XM2 A;  1W0B A;  5DAB A;  5JDH A;  1IBM T;  1S94 A;  2A72 A;  2NW7 A;  3HA4 A;  3DJB A;  4GIW A;  5DQV A;  1DU2 A;  3KBU A;  4DVD A;  4EIW A;  2NW8 A;  4P1N A;  2PFV A;  3QUJ A;  4PFO A;  5FNV E;  5AQU B;  3UFG A;  4DV3 T;  4ZHQ E;  3ZMT B;  1E2A A;  1T72 A;  2VKJ A;  2VK9 A;  3Q5D A;  3ZT7 A;  3NBX X;  4EZH A;  4GOU A;  5L4E A;  3OBV E;  1ZOY A;  2CMR A;  3O1J A;  4HWC A;  2CE7 A;  4YLH A;  2CBJ A;  2YK0 A;  3AEC A;  3UUM A;  4DMW A;  2K9A A;  4AQY T;  2XAG B;  3NRY A;  1LKX A;  2JPF A;  2LE8 A;  3CKD A;  2V26 A;  2H88 A;  3IHR A;  3TLT A;  2WU2 A;  4GK0 E;  5L3B B;  2RP4 A;  5GON E;  3J9X 1;  5CA0 E;  4B3M T;  3N2G E;  2JRK A;  3FZH B;  5AQK B;  4LF6 T;  5LBM A;  4I4T E;  5IHY A;  1VRB A;  2WS3 A;  4PFP A;  2XQY A;  3TLU A;  3KV5 A;  1MIW A;  4YJ3 E;  1MMG A;  2NP9 A;  2CA5 A;  3NRX A;  5FXW A;  1L0V A;  4L9I A;  1NEK A;  3W15 B;  4GKK T;  1VOM A;  1UUR A;  3GN5 A;  1YXR A;  2PG8 A;  4EOZ B;  4UEL A;  4ZOL E;  5ABF A;  1ZEE A;  4JI8 T;  3AE4 A;  2JQK A;  2WDR A;  4HFH A;  2V5D A;  5AQS B;  4E7Z A;  5IWA T;  3AE7 A;  2LHN A;  3FHN A;  3N2K E;  5LGN B;  4YJ2 E;  3CX7 B;  4H9P C;  4JBW F;  4YSX A;  3LJC A;  1HS7 A;  3UQ7 A;  2YN6 A;  4TWD A;  2CWO A;  2A3D A;  3HKD E;  1WYB A;  2JIW A;  3P4W A;  4EXT A;  4MLK A;  2ES0 A;  2E9X A;  3NKZ A;  1UUS A;  2M6I A;  2CRB A;  2KND A;  4JI3 T;  2XSB A;  3A7M A;  2K3W A;  1HF8 A;  2ZM2 A;  4I0U A;  3UUX B;  3WAJ A;  5JQG E;  1YQ3 A;  2UUA T;  4DR4 T;  3FXE B;  4DV6 T;  2LLY A;  2V8S V;  3RQW A;  2JMK A;  3IF8 B;  2PJQ A;  3PUA A;  2SPC A;  3H3M A;  3KIN B;  4WBO A;  3V5S A;  1FMV A;  4UVC B;  5E0O A;  3ZC1 A;  1OED C;  4HFB A;  1Y01 A;  4HTE A;  2VKD A;  3LBX A;  1UX5 A;  4HFV A;  2WZI A;  3QNU A;  2V6X A;  4BAY B;  1FEW A;  2WM9 A;  4WW0 A;  3O9X A;  1CUN A;  2H7O A;  2XQ8 A;  2JMH A;  2ZM8 A;  4AKR B;  3AXJ A;  3MJX A;  3RX6 A;  5L3G B;  4K0K T;  2W61 A;  3ZEF B;  4ZI2 C;  1NWM X;  4U72 A;  4DR2 T;  1N34 T;  2EHO C;  4HEA A;  4PAG A;  4QWN B;  5AQL B;  3RPU A;  4P0A A;  4O4H E;  4JI5 T;  2FJD A;  4G2A A;  5HWY A;  5F5W A;  3HR0 A;  4IHJ E;  4IST A;  5FVK A;  4U33 A;  2I6H A;  2X0H A;  2KWH A;  3PV0 F;  2IC6 A;  3AA6 B;  2HPJ A;  1KK7 A;  1LRZ A;  3JC6 D;  1BR0 A;  4MFR A;  1HNZ T;  3VKG A;  2F4V T;  3KV6 A;  3FZF B;  4XZC A;  5FXZ A;  5HCJ A;  4QX8 B;  4DV1 T;  3PUG A;  5L2L A;  2BKP A;  5L3D B;  4DR1 T;  4Q25 A;  2KXP B;  3LG7 A;  2CBI A;  1IBL T;  3F2E A;  4QKN A;  4DR5 T;  5LYJ E;  4TNW A;  5KXJ A;  4DND A;  3O1I A;  3OYX A;  2C5J A;  2C5I T;  3ZMV B;  5LGT B;  2L8K A;  2XJ7 A;  3P4P A;  4X1I E;  3O1H A;  3AA0 B;  1M7K A;  3SRZ A;  5JRC A;  3MXZ A;  4BJM A;  2NTY A;  4IDN A;  4CN1 A;  2CXD A;  2LKG A;  3PTR B;  5J2T E;  3LFM A;  5AQJ B;  5AFU L;  2DHR A;  2WWV A;  4YY3 T;  3CQG B;  3E08 A;  3RI5 A;  2YDQ A;  3NVO A;  1EZ3 A;  4MHC A;  3N9M A;  3P50 A;  5HEO A;  1ZHC A;  3G06 A;  2Z6E A;  3AE6 A;  3VU7 H;  4M1P A;  4DBQ A;  2K48 A;  3A8Y C;  4WZX A;  2OA5 A;  2IHR 1;  3LBX B;  4ANJ A;  4KI0 F;  1H7C A;  3K3Q C;  5HAX A;  5C8Y E;  4IE7 A;  1D0Y A;  3EDU A;  4IE0 A;  2RPA A;  3AED A;  2X51 A;  2NOX A;  3F57 A;  1T7S A;  3OPC A;  4E7S A;  4DR3 T;  4LF5 T;  2BKO A;  2DWK A;  2XAQ B;  2YDS A;  3E0Z A;  2XHE B;  3K1S A;  3HKE E;  5HXC A;  1WCR A;  3ZT5 A;  3TLW A;  4U7Y A;  1MMN A;  3UU8 A;  1KNP A;  2CXF A;  3EI0 A;  4PW8 A;  2ACX A;  2V7J A;  3ANW A;  5HXR A;  3AE1 A;  2VQE T;  3QB5 A;  2E9X C;  4UVB B;  5LHH B;  2V7K A;  4EZ4 A;  2CXL A;  3P4Q A;  4X1K E;  4YXD A;  2HN2 A;  4UEM A;  4PNI A;  2MBG A;  3RRC A;  3AA7 B;  2X9W A;  4DUZ T;  4AI6 A;  2WZH A;  4QH4 A;  2FUP A;  3PE0 A;  4HFI A;  4X5T A;  5LBQ B;  3RYF E;  3IA3 A;  4C90 A;  1BR4 A;  2D2S A;  4IDZ A;  2JQ9 A;  2XQ6 A;  3V5U A;  3CIR A;  3L39 A;  3RF1 A;  2XAJ B;  2BG9 B;  1D1B A;  2BKN A;  2W67 A;  3SOL A;  4ILU A;  2VVN A;  1KEY A;  1B7T A;  3PJA A;  2W62 A;  2G0U A;  2J4G A;  5HEG A;  2YEV C;  4YFS A;  3Q5X A;  3IBP A;  3SS1 A;  3AAE B;  3EDV A;  5FYM A;  3ZJ2 A;  4CZZ B;  5A1L A;  4JI6 T;  1XNQ T;  4EED A;  4AKG A;  3CWZ B;  3RIA A;  3KVB A;  5LG3 A;  2HPL A;  3ZMZ B;  1XWM A;  1U5P A;  4YHJ A;  2E5V A;  4XBF B;  4LF8 T;  4IGU A;  3JAE A;  4TV9 E;  4OYJ A;  3UT5 E;  3KDS E;  1IJ6 A;  1MMD A;  3FB2 A;  4IL9 A;  1NEN A;  4A98 A;  3K8P C;  4JI0 T;  2M6B A;  4LFB T;  3Q5W A;  4GKJ T;  1Z8U A;  2VVS A;  5AQV B;  3AAA B;  2BG9 A;  2KWI B;  2VUR A;  3K3N A;  3N9L A;  1WR6 A;  1G8X A;  4JI7 T;  4U2Y A;  4ASK A;  4AKI A;  1VCS A;  3UUL A;  2QGS A;  2BBJ A;  2LOS A;  3C4Z A;  3PUV F;  4ZI3 C;  3AEB A;  4N78 D;  3UU5 A;  5EK2 A;  2NW9 A;  4LMJ A;  5FL0 A;  5IUX A;  2WDV A;  5LA6 E;  1J5E T;  3B5M A;  3MKD A;  3VR9 A;  5LG4 A;  5LMU T;  1D0X A;  4ADZ A;  2Y8D A;  4EB6 E;  2I0M A;  1N33 T;  4ILB A;  4KHZ F;  4NXM T;  4ZI3 D;  3OVU A;  3AEE A;  3GA8 A;  2KIN B;  3PJA J;  4HWF A;  2WDQ A;  4EV6 A;  1M62 A;  2LSK A;  1WYC A;  1XZY A;  3KV9 A;  2PTF A;  4ZI7 E;  3EAB A;  1HR0 T;  2OLT A;  3KVA A;  1OXZ A;  1W0A A;  5FXV A;  5C2T A;  5AQF B;  3OYZ A;  3RRW A;  3SFD A;  5HYA A;  3MZK B;  2LSG A;  2VL8 A;  3T8O A;  3QOF A;  1I6Z A;  4IDQ A;  5FY1 A;  3RH3 A;  2X9H A;  4K0U A;  4JI1 T;  3ZC0 A;  3MA9 A;  3LK3 B;  1N32 T;  4X62 T;  4QXC B;  1YQ4 A;  4UF0 A;  4UIG A;  4B6X A;  5BR8 T;  3QK6 A;  3T1H T;  4LF9 T;  2C0S A;  2RA1 A;  1KNR A;  3N9Q A;  3AE5 A;  1SHZ C;  5LJN A;  5LP6 E;  2W2U A;  2CHN A;  3CVR A;  5CJ5 A;  3I9W A;  4WBN E;  2X68 A;  2V7M A;  3PUR A;  4H63 H;  4QXH B;  1UGO A;  4TWF A;  4QHO A;  3O4X E;  3BQL A;  4JI2 T;  4DV4 T;  5JR9 C;  2XQ5 A;  2BS2 A;  2FBW A;  2LJL A;  3AEA A;  2L3L A;  1FIO A;  1IZN B;  2LSI A;  3L8R A;  3JCF A;  2OV9 A;  3PUW F;  4DV5 T;  5AQQ B;  3ZYL A;  5JDG A;  2WB5 A;  4UR9 A;  2EHO B;  3EUH A;  4WYV A;  2ZM0 A;  4ZS3 A;  2CCQ A;  3WAK A;  2UU9 T;  5DJQ C;  3PUZ F;  2MOZ A;  3ZST A;  2JQH A;  3FZK B;  3LK2 B;  4JUY A;  4U3C A;  2VKH A;  4H9N C;  4JLE A;  5H6Q B;  1CHU A;  2N9D A;  3K3O A;  4IT4 A;  1T8B A;  4O8S A;  3I9Y A;  3AE9 A;  1SUM B;  2CLY C;  3QB5 K;  3ONJ A;  1J5W A;  1R8I A;  5HXE A;  4JV5 T;  1FMW A;  1Y64 B;  2VL0 A;  3KBT A;  5JDN A;  4COF A;  2X66 A;  3CQC B;  3U78 A;  2VAS A;  1V9D A;  2WBL A;  2WWU A;  5CA1 E;  1IBK T;  5ABF B;  2Q9Q C;  5LCY A;  4NPP A;  3BQK A;  3D0T A;  2XTL A;  3AVR A;  4WNK A;  3P8C D;  3C64 A;  3ZLI A;  4IDO A;  4A5X A;  3VKH A;  5LHI B;  4PJJ A;  1HNX T;  3HKB E;  2KT9 A;  4PK6 A;  5FY0 A;  1HX8 A;  3ONX A;  1MIY A;  1VCT A;  4LML A;  2LOP A;  4H9S E;  4A56 A;  4CQI A;  4U31 A;  1W09 A;  2DCF A;  3J7Y q;  1SA0 E;  1WRD A;  3UU4 A;  4O4L E;  3OTO T;  3C4W A;  4L5G A;  4PJL A;  1GQE A;  4OHF A;  4OYK A;  4YSY A;  3FZL B;  4O2B E;  3C50 A;  4QH5 A;  3ZKR A;  4LFA T;  2UXC T;  1SE7 A;  4I50 E;  3RIF A;  5JRC B;  2N2N A;  2MAW A;  2CM0 A;  2IAK A;  4OK0 A;  5FXX A;  5HCM A;  3EAM A;  3BK9 A;  3VRB A;  4ZEY A;  2XUE A;  1WR0 A;  4KX6 A;  5BMV E;  1OWA A;  2WCA A;  2AE9 A;  2XAS B;  3C98 B;  3BQI A;  4JEU B;  1HG2 A;  4Z8X A;  3ZYK A;  3ZSS A;  2WU5 A;  4LF7 T;  2D5U A;  1UK5 A;  1O3X A;  2MTQ A;  2W00 A;  4OFZ A;  2WP9 A;  5ABE A;  5HXH A;  5TAO A;  1OED E;  1S35 A;  2X9X A;  2LSJ A;  2DWG A;  3NWI A;  3RKO A;  2LKH A;  3A5X A;  2UXD T;  5FY7 A;  2WAU A;  3P4S A;  4IDP A;  3AXJ B;  4FI5 A;  5FKY A;  5ABG A;  2W66 A;  3CX6 B;  3DTO A;  5HWX A;  2CWY A;  3E22 E;  3ONL C;  3T1Y T;  1E7P A;  2WSS V;  3KFW X;  3Q5E A;  2V1D B;  1OED A;  2KZ7 B;  4EAH A;  4YTP A;  2XY8 B;  1MNE A;  4HGA A;  4ZS2 A;  5HEU A;  4AKL A;  4H9R C;  4CN4 A;  3ZMU B;  4KUM B;  2BVM A;  4PJN A;  5KDM C;  3H37 A;  2UXB T;  5AQP B;  2DL1 A;  4CXY A;  1YD8 G;  2BG9 C;  4X64 T;  4AQF C;  3AB3 B;  4EYY R;  1UX4 A;  2V7L A;  2ACZ A;  2XQA A;  5AQI B;  3ZN0 B;  1JNZ A;  4YTM A;  3UFE A;  3ETV A;  4IL4 A;  4DV0 T;  1HX1 B;  1U4Q A;  1WLX A;  1XDO A;  3AE2 A;  2HH7 A;  4C91 A;  4KHP T;  3ZCJ A;  5M4Y A;  4CXW A;  5AQG B;  2V5C A;  4NXN T;  2XQ3 A;  1QUU A;  1BR2 A;  3KV4 A;  4L0R A;  2XSA A;  3RGL A;  3UU3 A;  2N1G A;  4X20 E;  3ZN1 B;  2QVA A;  2KMF A;  2XQ7 A;  3ESL A;  2EHO A;  2M67 A;  2ZMA A;  3CQX C;  2B76 A;  3HI2 A;  3PUS A;  4O4J E;  4Z91 A;  3CML A;  3ZT6 A;  4FJO A;  1NAF A;  5AQO B;  4O2A E;  2YKS A;  5AQT B;  2E2A A;  4IE4 A;  1Z0P A;  2H7V C;  3TLS A;  2VB6 A;  3PU3 A;  5JR9 B;  3GN5 B;  4H9Q C;  4LMK A;  4TN7 B;  5KX5 E;  1XNR T;  3AEF A;  4DO0 A;  2W63 A;  2X0Y A;  3Q2M A;  1MMA A;  3FZM B;  2IIU A;  3B57 A;  2ZLY A;  4ILA A;  4AKH A;  2WY2 A;  1KF6 A;  4H63 V;  3LSV A;  2VQF T;  3PUQ A;  4UF0 B;  4IE5 A;  2IW5 B;  3RIU C;  2WMO A;  3FBL A;  2B1E A;  3MK7 C;  2BVL A;  5JH7 E;  2BBH A;  3N9P A;  4ZXL A;  5LMN T;  2E9X D;  2V6Y A;  2K24 A;  3IEE A;  4DUY T;  4UXN B;  3ZMS B;  2CHO A;  5JVD E;  2C5K T;  4HFD A;  1MIV A;  3RYI E;  4CI2 B;  2NTX A;  4CN6 A;  3HKC E;  3VHL A;  5KMG P;  2UUB T;  4XAX B;  2VWA A;  2BG9 E;  3AAI A;  4IIJ E; 
#chains in the Genus database with same CATH homology
 4X66 T;  1FJG T;  2UUC T;  4DR6 T;  4DR7 T;  4JV5 T;  1I94 T;  1N36 T;  4YHH T;  4DR3 T;  1IBM T;  4LF5 T;  1IBK T;  4DV3 T;  4B3T T;  2VQE T;  4LF4 T;  1HNX T;  4AQY T;  4B3S T;  4DUZ T;  3OTO T;  4B3M T;  4B3R T;  4LF6 T;  2UXC T;  4K0K T;  4GKK T;  4JI8 T;  5IWA T;  4JI6 T;  1XNQ T;  4LF7 T;  4LFA T;  4LF8 T;  4X65 T;  4OX9 T;  2UXD T;  3T1Y T;  1IBL T;  4JI3 T;  4JI0 T;  4LFB T;  2UUA T;  4GKJ T;  4DR4 T;  4DV6 T;  4JI7 T;  1HNW T;  2UXB T;  2E5L T;  4X64 T;  1J5E T;  5LMU T;  4DV2 T;  1XMO T;  1N33 T;  4NXM T;  4DV0 T;  1N34 T;  4KHP T;  4DR2 T;  1XMQ T;  4JI5 T;  4NXN T;  2HHH T;  1HR0 T;  1HNZ T;  2F4V T;  4LFC T;  4JI4 T;  4JI1 T;  4JYA T;  4DV1 T;  1N32 T;  4X62 T;  4DR1 T;  1XNR T;  4LF9 T;  5BR8 T;  4DR5 T;  3T1H T;  4DV7 T;  2VQF T;  4JI2 T;  4DV4 T;  4DV5 T;  5LMN T;  4DUY T;  4YY3 T;  2ZM6 T;  2UUB T;  2UU9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...