1XNZA

Crystal structure of mn(ii) form of e. coli. methionine aminopeptidase in complex with 5-(2-chlorophenyl)furan-2-carboxylic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metalloform-Selective Inhibitors of Escherichia coli Methionine Aminopeptidase and X-ray Structure of a Mn(II)-Form Enzyme Complexed with an Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xnzA00
2GA2A 5CNXA 3IU9A 2BHCA 1MATA 4PNCA 1WL9A 2GU5A 4U6ZA 5CIKA 2Q93A 1PV9A 4U6WA 2P99A 5JI6A 4S00A 1YW9A 3PKEA 1WKMA 2ADUA 3MR1A 5CDLA 4U1BA 4ZWOA 1C23A 4RGZ1 5D6EA 4U76A 1N51A 3PKAA 1B59A 1YVMA 2Q8KA 2MATA 2BWTA 5CLSA 2BHAA 2BWXA 1WBQA 1QXYA 3FM3A 2Q96A 3L7GA 4U6JA 2EVCA 4KM3A 4PV4A 4U75A 1WN1A 4IU6A 2P9AA 4JUQA 3Q6DA 4MATA 4S2TP 1QXZA 1R58A 2V3ZA 2BWSA 1YJ3A 3TAVA 1WLRA 5D6FA 1BOAA 2BHBA 5CDVA 2B3LA 3PKDA 1QZYA 2GG9A 4IECA 1KQ9A 3BIQA 4FLJA 5CDEA 5FCFA 1XGSA 4ZWPA 1XGNA 1KP0A 2GU4A 4U69A 1W2MA 3CTZA 5CE6A 3IU7A 2B3HA 1WL6A 2GTXA 2BH3A 2GG5A 4A6WA 1XGOA 1C27A 2OAZA 4HXXA 2EVMA 2GG7A 2HOWA 3CB5A 2ZSGA 4IKTA 2Q92A 3BIPA 4R60A 2BN7A 2BWYA 2EA4A 3RVAA 1M35A 2GU7A 4IKSA 4RZYA 4U70A 3TB5A 1CHMA 2BWVA 2V6CA 1W7VA 3L24A 2DFIA 3CB6A 2IW2A 3BITA 4IKRA 4ZNGA 3PKBA 2EVOA 4QR8A 4IKUA 4B28A 4EGEA 2GG0A 1O0XA 2NQ6A 4U73A 1KQ0A 1QXWA 3RORA 4A6VA 3S6BA 3PKCA 1WY2A 2GGBA 4FO8A 5JFRA 4Z7MA 1R5HA 1YW8A 4U6EA 3FMQA 1XGMA 4FO7A 1C21A 2P98A 2EA2A 2GZ5A 1C24A 4IF7A 4U71A 1BN5A 4FUKA 2BB7A 2BWWA 1C22A 4FLIA 2BHDA 1R5GA 2V3XA 5JHUA 4IDYA 2BWUA 1JAWA 1B6AA 2Q94A 3IG4A 4FLLA 4U6CA 2B3KA 2GG2A 4S01A 2GG3A 5E5BA 2GGCA 2NQ7A 2GU6A 3D27A 1A16A 2GG8A 3IU8A 4IPAA 4FLKA 1YW7A 1Y1NA 5FCHA 2OKNA 3MATA 4S2RP 4ZWUA 2V3YA 3FMRA 4FKCA 2G6PA 4RZZA 4OOKA 2Q95A 3MX6A 1XNZA
chains in the Genus database with same CATH superfamily
2GA2A 5CNXA 3IU9A 2BHCA 1MATA 4PNCA 1WL9A 2GU5A 4U6ZA 5CIKA 2Q93A 1PV9A 4U6WA 2P99A 5JI6A 4S00A 1YW9A 3PKEA 1WKMA 2ADUA 3MR1A 5CDLA 4U1BA 4ZWOA 1C23A 4RGZ1 5D6EA 4U76A 1N51A 3PKAA 1B59A 1YVMA 2Q8KA 2MATA 2BWTA 5CLSA 2BHAA 2BWXA 1WBQA 1QXYA 3FM3A 2Q96A 3L7GA 4U6JA 2EVCA 4KM3A 4PV4A 4U75A 1WN1A 4IU6A 2P9AA 4JUQA 3Q6DA 4MATA 4S2TP 1QXZA 1R58A 2V3ZA 2BWSA 1YJ3A 3TAVA 1WLRA 5D6FA 1BOAA 2BHBA 5CDVA 2B3LA 3PKDA 1QZYA 2GG9A 4IECA 1KQ9A 3BIQA 4FLJA 5CDEA 5FCFA 1XGSA 4ZWPA 1XGNA 1KP0A 2GU4A 4U69A 1W2MA 3CTZA 5CE6A 3IU7A 2B3HA 1WL6A 2GTXA 2BH3A 2GG5A 4A6WA 1XGOA 1C27A 2OAZA 4HXXA 2EVMA 2GG7A 2HOWA 3CB5A 2ZSGA 4IKTA 2Q92A 3BIPA 4R60A 2BN7A 2BWYA 2EA4A 3RVAA 1M35A 2GU7A 4IKSA 4RZYA 4U70A 3TB5A 1CHMA 2BWVA 2V6CA 1W7VA 3L24A 2DFIA 3CB6A 2IW2A 3BITA 4IKRA 4ZNGA 3PKBA 2EVOA 4QR8A 4IKUA 4B28A 4EGEA 2GG0A 1O0XA 2NQ6A 4U73A 1KQ0A 1QXWA 3RORA 4A6VA 3S6BA 3PKCA 1WY2A 2GGBA 4FO8A 5JFRA 4Z7MA 1R5HA 1YW8A 4U6EA 3FMQA 1XGMA 4FO7A 1C21A 2P98A 2EA2A 2GZ5A 1C24A 4IF7A 4U71A 1BN5A 4FUKA 2BB7A 2BWWA 1C22A 4FLIA 2BHDA 1R5GA 2V3XA 5JHUA 4IDYA 2BWUA 1JAWA 1B6AA 2Q94A 3IG4A 4FLLA 4U6CA 2B3KA 2GG2A 4S01A 2GG3A 5E5BA 2GGCA 2NQ7A 2GU6A 3D27A 1A16A 2GG8A 3IU8A 4IPAA 4FLKA 1YW7A 1Y1NA 5FCHA 2OKNA 3MATA 4S2RP 4ZWUA 2V3YA 3FMRA 4FKCA 2G6PA 4RZZA 4OOKA 2Q95A 3MX6A 1XNZA
chains in the Genus database with same CATH topology
2GA2A 5CNXA 3IU9A 2BHCA 1MATA 4PNCA 1WL9A 2GU5A 4U6ZA 5CIKA 2Q93A 1PV9A 4U6WA 2P99A 5JI6A 4S00A 1YW9A 3PKEA 1WKMA 2ADUA 3MR1A 5CDLA 4U1BA 4ZWOA 1C23A 4RGZ1 5D6EA 4U76A 1N51A 3PKAA 1B59A 1YVMA 2Q8KA 2MATA 2BWTA 5CLSA 2BHAA 2BWXA 1WBQA 1QXYA 3FM3A 2Q96A 3L7GA 4U6JA 2EVCA 4KM3A 4PV4A 4U75A 1WN1A 4IU6A 2P9AA 4JUQA 3Q6DA 4MATA 4S2TP 1QXZA 1R58A 2V3ZA 2BWSA 1YJ3A 3TAVA 1WLRA 5D6FA 1BOAA 2BHBA 5CDVA 2B3LA 3PKDA 1QZYA 2GG9A 4IECA 1KQ9A 3BIQA 4FLJA 5CDEA 5FCFA 1XGSA 4ZWPA 1XGNA 1KP0A 2GU4A 4U69A 1W2MA 3CTZA 5CE6A 3IU7A 2B3HA 1WL6A 2GTXA 2BH3A 2GG5A 4A6WA 1XGOA 1C27A 2OAZA 4HXXA 2EVMA 2GG7A 2HOWA 3CB5A 2ZSGA 4IKTA 2Q92A 3BIPA 4R60A 2BN7A 2BWYA 2EA4A 3RVAA 1M35A 2GU7A 4IKSA 4RZYA 4U70A 3TB5A 1CHMA 2BWVA 2V6CA 1W7VA 3L24A 2DFIA 3CB6A 2IW2A 3BITA 4IKRA 4ZNGA 3PKBA 2EVOA 4QR8A 4IKUA 4B28A 4EGEA 2GG0A 1O0XA 2NQ6A 4U73A 1KQ0A 1QXWA 3RORA 4A6VA 3S6BA 3PKCA 1WY2A 2GGBA 4FO8A 5JFRA 4Z7MA 1R5HA 1YW8A 4U6EA 3FMQA 1XGMA 4FO7A 1C21A 2P98A 2EA2A 2GZ5A 1C24A 4IF7A 4U71A 1BN5A 4FUKA 2BB7A 2BWWA 1C22A 4FLIA 2BHDA 1R5GA 2V3XA 5JHUA 4IDYA 2BWUA 1JAWA 1B6AA 2Q94A 3IG4A 4FLLA 4U6CA 2B3KA 2GG2A 4S01A 2GG3A 5E5BA 2GGCA 2NQ7A 2GU6A 3D27A 1A16A 2GG8A 3IU8A 4IPAA 4FLKA 1YW7A 1Y1NA 5FCHA 2OKNA 3MATA 4S2RP 4ZWUA 2V3YA 3FMRA 4FKCA 2G6PA 4RZZA 4OOKA 2Q95A 3MX6A 1XNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  5CNX A;  3IU9 A;  2BHC A;  1MAT A;  4PNC A;  1WL9 A;  2GU5 A;  4U6Z A;  5CIK A;  2Q93 A;  1PV9 A;  4U6W A;  2P99 A;  5JI6 A;  4S00 A;  1YW9 A;  3PKE A;  1WKM A;  2ADU A;  3MR1 A;  5CDL A;  4U1B A;  4ZWO A;  1C23 A;  4RGZ 1;  5D6E A;  4U76 A;  1N51 A;  3PKA A;  1B59 A;  1YVM A;  2Q8K A;  2MAT A;  2BWT A;  5CLS A;  2BHA A;  2BWX A;  1WBQ A;  1QXY A;  3FM3 A;  2Q96 A;  3L7G A;  4U6J A;  2EVC A;  4KM3 A;  4PV4 A;  4U75 A;  1WN1 A;  4IU6 A;  2P9A A;  4JUQ A;  3Q6D A;  4MAT A;  4S2T P;  1QXZ A;  1R58 A;  2V3Z A;  2BWS A;  1YJ3 A;  3TAV A;  1WLR A;  5D6F A;  1BOA A;  2BHB A;  5CDV A;  2B3L A;  3PKD A;  1QZY A;  2GG9 A;  4IEC A;  1KQ9 A;  3BIQ A;  4FLJ A;  5CDE A;  5FCF A;  1XGS A;  4ZWP A;  1XGN A;  1KP0 A;  2GU4 A;  4U69 A;  1W2M A;  3CTZ A;  5CE6 A;  3IU7 A;  2B3H A;  1WL6 A;  2GTX A;  2BH3 A;  2GG5 A;  4A6W A;  1XGO A;  1C27 A;  2OAZ A;  4HXX A;  2EVM A;  2GG7 A;  2HOW A;  3CB5 A;  2ZSG A;  4IKT A;  2Q92 A;  3BIP A;  4R60 A;  2BN7 A;  2BWY A;  2EA4 A;  3RVA A;  1M35 A;  2GU7 A;  4IKS A;  4RZY A;  4U70 A;  3TB5 A;  1CHM A;  2BWV A;  2V6C A;  1W7V A;  3L24 A;  2DFI A;  3CB6 A;  2IW2 A;  3BIT A;  4IKR A;  4ZNG A;  3PKB A;  2EVO A;  4QR8 A;  4IKU A;  4B28 A;  4EGE A;  2GG0 A;  1O0X A;  2NQ6 A;  4U73 A;  1KQ0 A;  1QXW A;  3ROR A;  4A6V A;  3S6B A;  3PKC A;  1WY2 A;  2GGB A;  4FO8 A;  5JFR A;  4Z7M A;  1R5H A;  1YW8 A;  4U6E A;  3FMQ A;  1XGM A;  4FO7 A;  1C21 A;  2P98 A;  2EA2 A;  2GZ5 A;  1C24 A;  4IF7 A;  4U71 A;  1BN5 A;  4FUK A;  2BB7 A;  2BWW A;  1C22 A;  4FLI A;  2BHD A;  1R5G A;  2V3X A;  5JHU A;  4IDY A;  2BWU A;  1JAW A;  1B6A A;  2Q94 A;  3IG4 A;  4FLL A;  4U6C A;  2B3K A;  2GG2 A;  4S01 A;  2GG3 A;  5E5B A;  2GGC A;  2NQ7 A;  2GU6 A;  3D27 A;  1A16 A;  2GG8 A;  3IU8 A;  4IPA A;  4FLK A;  1YW7 A;  1Y1N A;  5FCH A;  2OKN A;  3MAT A;  4S2R P;  4ZWU A;  2V3Y A;  3FMR A;  4FKC A;  2G6P A;  4RZZ A;  4OOK A;  2Q95 A;  3MX6 A;  1XNZ A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  5CNX A;  3IU9 A;  2BHC A;  1MAT A;  4PNC A;  1WL9 A;  2GU5 A;  4U6Z A;  5CIK A;  2Q93 A;  1PV9 A;  4U6W A;  2P99 A;  5JI6 A;  4S00 A;  1YW9 A;  3PKE A;  1WKM A;  2ADU A;  3MR1 A;  5CDL A;  4U1B A;  4ZWO A;  1C23 A;  4RGZ 1;  5D6E A;  4U76 A;  1N51 A;  3PKA A;  1B59 A;  1YVM A;  2Q8K A;  2MAT A;  2BWT A;  5CLS A;  2BHA A;  2BWX A;  1WBQ A;  1QXY A;  3FM3 A;  2Q96 A;  3L7G A;  4U6J A;  2EVC A;  4KM3 A;  4PV4 A;  4U75 A;  1WN1 A;  4IU6 A;  2P9A A;  4JUQ A;  3Q6D A;  4MAT A;  4S2T P;  1QXZ A;  1R58 A;  2V3Z A;  2BWS A;  1YJ3 A;  3TAV A;  1WLR A;  5D6F A;  1BOA A;  2BHB A;  5CDV A;  2B3L A;  3PKD A;  1QZY A;  2GG9 A;  4IEC A;  1KQ9 A;  3BIQ A;  4FLJ A;  5CDE A;  5FCF A;  1XGS A;  4ZWP A;  1XGN A;  1KP0 A;  2GU4 A;  4U69 A;  1W2M A;  3CTZ A;  5CE6 A;  3IU7 A;  2B3H A;  1WL6 A;  2GTX A;  2BH3 A;  2GG5 A;  4A6W A;  1XGO A;  1C27 A;  2OAZ A;  4HXX A;  2EVM A;  2GG7 A;  2HOW A;  3CB5 A;  2ZSG A;  4IKT A;  2Q92 A;  3BIP A;  4R60 A;  2BN7 A;  2BWY A;  2EA4 A;  3RVA A;  1M35 A;  2GU7 A;  4IKS A;  4RZY A;  4U70 A;  3TB5 A;  1CHM A;  2BWV A;  2V6C A;  1W7V A;  3L24 A;  2DFI A;  3CB6 A;  2IW2 A;  3BIT A;  4IKR A;  4ZNG A;  3PKB A;  2EVO A;  4QR8 A;  4IKU A;  4B28 A;  4EGE A;  2GG0 A;  1O0X A;  2NQ6 A;  4U73 A;  1KQ0 A;  1QXW A;  3ROR A;  4A6V A;  3S6B A;  3PKC A;  1WY2 A;  2GGB A;  4FO8 A;  5JFR A;  4Z7M A;  1R5H A;  1YW8 A;  4U6E A;  3FMQ A;  1XGM A;  4FO7 A;  1C21 A;  2P98 A;  2EA2 A;  2GZ5 A;  1C24 A;  4IF7 A;  4U71 A;  1BN5 A;  4FUK A;  2BB7 A;  2BWW A;  1C22 A;  4FLI A;  2BHD A;  1R5G A;  2V3X A;  5JHU A;  4IDY A;  2BWU A;  1JAW A;  1B6A A;  2Q94 A;  3IG4 A;  4FLL A;  4U6C A;  2B3K A;  2GG2 A;  4S01 A;  2GG3 A;  5E5B A;  2GGC A;  2NQ7 A;  2GU6 A;  3D27 A;  1A16 A;  2GG8 A;  3IU8 A;  4IPA A;  4FLK A;  1YW7 A;  1Y1N A;  5FCH A;  2OKN A;  3MAT A;  4S2R P;  4ZWU A;  2V3Y A;  3FMR A;  4FKC A;  2G6P A;  4RZZ A;  4OOK A;  2Q95 A;  3MX6 A;  1XNZ A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  5CNX A;  3IU9 A;  2BHC A;  1MAT A;  4PNC A;  1WL9 A;  2GU5 A;  4U6Z A;  5CIK A;  2Q93 A;  1PV9 A;  4U6W A;  2P99 A;  5JI6 A;  4S00 A;  1YW9 A;  3PKE A;  1WKM A;  2ADU A;  3MR1 A;  5CDL A;  4U1B A;  4ZWO A;  1C23 A;  4RGZ 1;  5D6E A;  4U76 A;  1N51 A;  3PKA A;  1B59 A;  1YVM A;  2Q8K A;  2MAT A;  2BWT A;  5CLS A;  2BHA A;  2BWX A;  1WBQ A;  1QXY A;  3FM3 A;  2Q96 A;  3L7G A;  4U6J A;  2EVC A;  4KM3 A;  4PV4 A;  4U75 A;  1WN1 A;  4IU6 A;  2P9A A;  4JUQ A;  3Q6D A;  4MAT A;  4S2T P;  1QXZ A;  1R58 A;  2V3Z A;  2BWS A;  1YJ3 A;  3TAV A;  1WLR A;  5D6F A;  1BOA A;  2BHB A;  5CDV A;  2B3L A;  3PKD A;  1QZY A;  2GG9 A;  4IEC A;  1KQ9 A;  3BIQ A;  4FLJ A;  5CDE A;  5FCF A;  1XGS A;  4ZWP A;  1XGN A;  1KP0 A;  2GU4 A;  4U69 A;  1W2M A;  3CTZ A;  5CE6 A;  3IU7 A;  2B3H A;  1WL6 A;  2GTX A;  2BH3 A;  2GG5 A;  4A6W A;  1XGO A;  1C27 A;  2OAZ A;  4HXX A;  2EVM A;  2GG7 A;  2HOW A;  3CB5 A;  2ZSG A;  4IKT A;  2Q92 A;  3BIP A;  4R60 A;  2BN7 A;  2BWY A;  2EA4 A;  3RVA A;  1M35 A;  2GU7 A;  4IKS A;  4RZY A;  4U70 A;  3TB5 A;  1CHM A;  2BWV A;  2V6C A;  1W7V A;  3L24 A;  2DFI A;  3CB6 A;  2IW2 A;  3BIT A;  4IKR A;  4ZNG A;  3PKB A;  2EVO A;  4QR8 A;  4IKU A;  4B28 A;  4EGE A;  2GG0 A;  1O0X A;  2NQ6 A;  4U73 A;  1KQ0 A;  1QXW A;  3ROR A;  4A6V A;  3S6B A;  3PKC A;  1WY2 A;  2GGB A;  4FO8 A;  5JFR A;  4Z7M A;  1R5H A;  1YW8 A;  4U6E A;  3FMQ A;  1XGM A;  4FO7 A;  1C21 A;  2P98 A;  2EA2 A;  2GZ5 A;  1C24 A;  4IF7 A;  4U71 A;  1BN5 A;  4FUK A;  2BB7 A;  2BWW A;  1C22 A;  4FLI A;  2BHD A;  1R5G A;  2V3X A;  5JHU A;  4IDY A;  2BWU A;  1JAW A;  1B6A A;  2Q94 A;  3IG4 A;  4FLL A;  4U6C A;  2B3K A;  2GG2 A;  4S01 A;  2GG3 A;  5E5B A;  2GGC A;  2NQ7 A;  2GU6 A;  3D27 A;  1A16 A;  2GG8 A;  3IU8 A;  4IPA A;  4FLK A;  1YW7 A;  1Y1N A;  5FCH A;  2OKN A;  3MAT A;  4S2R P;  4ZWU A;  2V3Y A;  3FMR A;  4FKC A;  2G6P A;  4RZZ A;  4OOK A;  2Q95 A;  3MX6 A;  1XNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...