1XNZA

Crystal structure of mn(ii) form of e. coli. methionine aminopeptidase in complex with 5-(2-chlorophenyl)furan-2-carboxylic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metalloform-Selective Inhibitors of Escherichia coli Methionine Aminopeptidase and X-ray Structure of a Mn(II)-Form Enzyme Complexed with an Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xnzA00
5JI6A 4PNCA 1QXYA 3CB6A 1C23A 4FLLA 4RZYA 1B6AA 1Y1NA 3MATA 3IU8A 3L24A 3TAVA 4IDYA 4U71A 3BITA 4Z7MA 4ZWUA 1C21A 2NQ6A 1MATA 5CNXA 2BHBA 2GU4A 2BWVA 1KQ9A 4KM3A 4PV4A 4FO7A 5D6EA 2P9AA 2EA4A 1C27A 2NQ7A 3FMQA 1QZYA 1CHMA 1W2MA 5FCHA 2EVCA 3BIQA 4ZNGA 1C24A 1JAWA 2V3YA 1XGNA 1YJ3A 3FMRA 1BOAA 5CDLA 1WL9A 2GA2A 2GG5A 2DFIA 1M35A 4U69A 4A6WA 1N51A 3PKAA 2GG8A 2ZSGA 4IU6A 1W7VA 2GG0A 2EVOA 3RORA 2BWUA 3IU9A 5CIKA 2GU7A 2P98A 3PKBA 5E5BA 3Q6DA 5CLSA 2B3KA 2EVMA 2BHDA 3IG4A 5D6FA 1BN5A 1YW7A 2Q96A 3PKCA 4IKTA 1R58A 2G6PA 1WN1A 2BHCA 4RZZA 3RVAA 3D27A 4U73A 4U6ZA 2Q92A 2BWTA 2GTXA 5CDEA 2Q8KA 3BIPA 2BWYA 1WLRA 4ZWPA 3S6BA 3PKDA 4MATA 1XGOA 2EA2A 2OKNA 2BN7A 4B28A 1QXWA 1PV9A 1YW8A 4IECA 4FO8A 4IKUA 4S00A 2GU5A 4R60A 1C22A 2BH3A 4S01A 4FLIA 5CE6A 2Q93A 2GG3A 2HOWA 4EGEA 1KP0A 2GG7A 2IW2A 2V6CA 4FKCA 2GZ5A 4U1BA 3TB5A 4U75A 4IF7A 4HXXA 4RGZ1 4S2TP 4QR8A 2BHAA 2GU6A 2BWSA 1R5HA 1B59A 4U6EA 2BB7A 1R5GA 1XGSA 2V3XA 4U6CA 1YW9A 1XGMA 2GGCA 1O0XA 5JFRA 4FUKA 5CDVA 5FCFA 4IKRA 4JUQA 2GG9A 4U6WA 4U70A 2Q95A 2BWWA 1A16A 3L7GA 1WL6A 3CTZA 2MATA 4FLJA 1WKMA 2GG2A 1WY2A 2OAZA 4U6JA 3MX6A 1XNZA 2Q94A 3PKEA 2ADUA 4FLKA 4IKSA 4A6VA 4OOKA 2BWXA 2P99A 1KQ0A 4U76A 4S2RP 2B3LA 5JHUA 2GGBA 3IU7A 1YVMA 2B3HA 4ZWOA 3FM3A 1WBQA 3CB5A 3MR1A 4IPAA 2V3ZA 1QXZA
chains in the Genus database with same CATH superfamily
5JI6A 4PNCA 1QXYA 3CB6A 1C23A 4FLLA 4RZYA 1B6AA 1Y1NA 3MATA 3IU8A 3L24A 3TAVA 4IDYA 4U71A 3BITA 4Z7MA 4ZWUA 1C21A 2NQ6A 1MATA 5CNXA 2BHBA 2GU4A 2BWVA 1KQ9A 4KM3A 4PV4A 4FO7A 5D6EA 2P9AA 2EA4A 1C27A 2NQ7A 3FMQA 1QZYA 1CHMA 1W2MA 5FCHA 2EVCA 3BIQA 4ZNGA 1C24A 1JAWA 2V3YA 1XGNA 1YJ3A 3FMRA 1BOAA 5CDLA 1WL9A 2GA2A 2GG5A 2DFIA 1M35A 4U69A 4A6WA 1N51A 3PKAA 2GG8A 2ZSGA 4IU6A 1W7VA 2GG0A 2EVOA 3RORA 2BWUA 3IU9A 5CIKA 2GU7A 2P98A 3PKBA 5E5BA 3Q6DA 5CLSA 2B3KA 2EVMA 2BHDA 3IG4A 5D6FA 1BN5A 1YW7A 2Q96A 3PKCA 4IKTA 1R58A 2G6PA 1WN1A 2BHCA 4RZZA 3RVAA 3D27A 4U73A 4U6ZA 2Q92A 2BWTA 2GTXA 5CDEA 2Q8KA 3BIPA 2BWYA 1WLRA 4ZWPA 3S6BA 3PKDA 4MATA 1XGOA 2EA2A 2OKNA 2BN7A 4B28A 1QXWA 1PV9A 1YW8A 4IECA 4FO8A 4IKUA 4S00A 2GU5A 4R60A 1C22A 2BH3A 4S01A 4FLIA 5CE6A 2Q93A 2GG3A 2HOWA 4EGEA 1KP0A 2GG7A 2IW2A 2V6CA 4FKCA 2GZ5A 4U1BA 3TB5A 4U75A 4IF7A 4HXXA 4RGZ1 4S2TP 4QR8A 2BHAA 2GU6A 2BWSA 1R5HA 1B59A 4U6EA 2BB7A 1R5GA 1XGSA 2V3XA 4U6CA 1YW9A 1XGMA 2GGCA 1O0XA 5JFRA 4FUKA 5CDVA 5FCFA 4IKRA 4JUQA 2GG9A 4U6WA 4U70A 2Q95A 2BWWA 1A16A 3L7GA 1WL6A 3CTZA 2MATA 4FLJA 1WKMA 2GG2A 1WY2A 2OAZA 4U6JA 3MX6A 1XNZA 2Q94A 3PKEA 2ADUA 4FLKA 4IKSA 4A6VA 4OOKA 2BWXA 2P99A 1KQ0A 4U76A 4S2RP 2B3LA 5JHUA 2GGBA 3IU7A 1YVMA 2B3HA 4ZWOA 3FM3A 1WBQA 3CB5A 3MR1A 4IPAA 2V3ZA 1QXZA
chains in the Genus database with same CATH topology
5JI6A 4PNCA 1QXYA 3CB6A 1C23A 4FLLA 4RZYA 1B6AA 1Y1NA 3MATA 3IU8A 3L24A 3TAVA 4IDYA 4U71A 3BITA 4Z7MA 4ZWUA 1C21A 2NQ6A 1MATA 5CNXA 2BHBA 2GU4A 2BWVA 1KQ9A 4KM3A 4PV4A 4FO7A 5D6EA 2P9AA 2EA4A 1C27A 2NQ7A 3FMQA 1QZYA 1CHMA 1W2MA 5FCHA 2EVCA 3BIQA 4ZNGA 1C24A 1JAWA 2V3YA 1XGNA 1YJ3A 3FMRA 1BOAA 5CDLA 1WL9A 2GA2A 2GG5A 2DFIA 1M35A 4U69A 4A6WA 1N51A 3PKAA 2GG8A 2ZSGA 4IU6A 1W7VA 2GG0A 2EVOA 3RORA 2BWUA 3IU9A 5CIKA 2GU7A 2P98A 3PKBA 5E5BA 3Q6DA 5CLSA 2B3KA 2EVMA 2BHDA 3IG4A 5D6FA 1BN5A 1YW7A 2Q96A 3PKCA 4IKTA 1R58A 2G6PA 1WN1A 2BHCA 4RZZA 3RVAA 3D27A 4U73A 4U6ZA 2Q92A 2BWTA 2GTXA 5CDEA 2Q8KA 3BIPA 2BWYA 1WLRA 4ZWPA 3S6BA 3PKDA 4MATA 1XGOA 2EA2A 2OKNA 2BN7A 4B28A 1QXWA 1PV9A 1YW8A 4IECA 4FO8A 4IKUA 4S00A 2GU5A 4R60A 1C22A 2BH3A 4S01A 4FLIA 5CE6A 2Q93A 2GG3A 2HOWA 4EGEA 1KP0A 2GG7A 2IW2A 2V6CA 4FKCA 2GZ5A 4U1BA 3TB5A 4U75A 4IF7A 4HXXA 4RGZ1 4S2TP 4QR8A 2BHAA 2GU6A 2BWSA 1R5HA 1B59A 4U6EA 2BB7A 1R5GA 1XGSA 2V3XA 4U6CA 1YW9A 1XGMA 2GGCA 1O0XA 5JFRA 4FUKA 5CDVA 5FCFA 4IKRA 4JUQA 2GG9A 4U6WA 4U70A 2Q95A 2BWWA 1A16A 3L7GA 1WL6A 3CTZA 2MATA 4FLJA 1WKMA 2GG2A 1WY2A 2OAZA 4U6JA 3MX6A 1XNZA 2Q94A 3PKEA 2ADUA 4FLKA 4IKSA 4A6VA 4OOKA 2BWXA 2P99A 1KQ0A 4U76A 4S2RP 2B3LA 5JHUA 2GGBA 3IU7A 1YVMA 2B3HA 4ZWOA 3FM3A 1WBQA 3CB5A 3MR1A 4IPAA 2V3ZA 1QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JI6 A;  4PNC A;  1QXY A;  3CB6 A;  1C23 A;  4FLL A;  4RZY A;  1B6A A;  1Y1N A;  3MAT A;  3IU8 A;  3L24 A;  3TAV A;  4IDY A;  4U71 A;  3BIT A;  4Z7M A;  4ZWU A;  1C21 A;  2NQ6 A;  1MAT A;  5CNX A;  2BHB A;  2GU4 A;  2BWV A;  1KQ9 A;  4KM3 A;  4PV4 A;  4FO7 A;  5D6E A;  2P9A A;  2EA4 A;  1C27 A;  2NQ7 A;  3FMQ A;  1QZY A;  1CHM A;  1W2M A;  5FCH A;  2EVC A;  3BIQ A;  4ZNG A;  1C24 A;  1JAW A;  2V3Y A;  1XGN A;  1YJ3 A;  3FMR A;  1BOA A;  5CDL A;  1WL9 A;  2GA2 A;  2GG5 A;  2DFI A;  1M35 A;  4U69 A;  4A6W A;  1N51 A;  3PKA A;  2GG8 A;  2ZSG A;  4IU6 A;  1W7V A;  2GG0 A;  2EVO A;  3ROR A;  2BWU A;  3IU9 A;  5CIK A;  2GU7 A;  2P98 A;  3PKB A;  5E5B A;  3Q6D A;  5CLS A;  2B3K A;  2EVM A;  2BHD A;  3IG4 A;  5D6F A;  1BN5 A;  1YW7 A;  2Q96 A;  3PKC A;  4IKT A;  1R58 A;  2G6P A;  1WN1 A;  2BHC A;  4RZZ A;  3RVA A;  3D27 A;  4U73 A;  4U6Z A;  2Q92 A;  2BWT A;  2GTX A;  5CDE A;  2Q8K A;  3BIP A;  2BWY A;  1WLR A;  4ZWP A;  3S6B A;  3PKD A;  4MAT A;  1XGO A;  2EA2 A;  2OKN A;  2BN7 A;  4B28 A;  1QXW A;  1PV9 A;  1YW8 A;  4IEC A;  4FO8 A;  4IKU A;  4S00 A;  2GU5 A;  4R60 A;  1C22 A;  2BH3 A;  4S01 A;  4FLI A;  5CE6 A;  2Q93 A;  2GG3 A;  2HOW A;  4EGE A;  1KP0 A;  2GG7 A;  2IW2 A;  2V6C A;  4FKC A;  2GZ5 A;  4U1B A;  3TB5 A;  4U75 A;  4IF7 A;  4HXX A;  4RGZ 1;  4S2T P;  4QR8 A;  2BHA A;  2GU6 A;  2BWS A;  1R5H A;  1B59 A;  4U6E A;  2BB7 A;  1R5G A;  1XGS A;  2V3X A;  4U6C A;  1YW9 A;  1XGM A;  2GGC A;  1O0X A;  5JFR A;  4FUK A;  5CDV A;  5FCF A;  4IKR A;  4JUQ A;  2GG9 A;  4U6W A;  4U70 A;  2Q95 A;  2BWW A;  1A16 A;  3L7G A;  1WL6 A;  3CTZ A;  2MAT A;  4FLJ A;  1WKM A;  2GG2 A;  1WY2 A;  2OAZ A;  4U6J A;  3MX6 A;  1XNZ A;  2Q94 A;  3PKE A;  2ADU A;  4FLK A;  4IKS A;  4A6V A;  4OOK A;  2BWX A;  2P99 A;  1KQ0 A;  4U76 A;  4S2R P;  2B3L A;  5JHU A;  2GGB A;  3IU7 A;  1YVM A;  2B3H A;  4ZWO A;  3FM3 A;  1WBQ A;  3CB5 A;  3MR1 A;  4IPA A;  2V3Z A;  1QXZ A; 
#chains in the Genus database with same CATH topology
 5JI6 A;  4PNC A;  1QXY A;  3CB6 A;  1C23 A;  4FLL A;  4RZY A;  1B6A A;  1Y1N A;  3MAT A;  3IU8 A;  3L24 A;  3TAV A;  4IDY A;  4U71 A;  3BIT A;  4Z7M A;  4ZWU A;  1C21 A;  2NQ6 A;  1MAT A;  5CNX A;  2BHB A;  2GU4 A;  2BWV A;  1KQ9 A;  4KM3 A;  4PV4 A;  4FO7 A;  5D6E A;  2P9A A;  2EA4 A;  1C27 A;  2NQ7 A;  3FMQ A;  1QZY A;  1CHM A;  1W2M A;  5FCH A;  2EVC A;  3BIQ A;  4ZNG A;  1C24 A;  1JAW A;  2V3Y A;  1XGN A;  1YJ3 A;  3FMR A;  1BOA A;  5CDL A;  1WL9 A;  2GA2 A;  2GG5 A;  2DFI A;  1M35 A;  4U69 A;  4A6W A;  1N51 A;  3PKA A;  2GG8 A;  2ZSG A;  4IU6 A;  1W7V A;  2GG0 A;  2EVO A;  3ROR A;  2BWU A;  3IU9 A;  5CIK A;  2GU7 A;  2P98 A;  3PKB A;  5E5B A;  3Q6D A;  5CLS A;  2B3K A;  2EVM A;  2BHD A;  3IG4 A;  5D6F A;  1BN5 A;  1YW7 A;  2Q96 A;  3PKC A;  4IKT A;  1R58 A;  2G6P A;  1WN1 A;  2BHC A;  4RZZ A;  3RVA A;  3D27 A;  4U73 A;  4U6Z A;  2Q92 A;  2BWT A;  2GTX A;  5CDE A;  2Q8K A;  3BIP A;  2BWY A;  1WLR A;  4ZWP A;  3S6B A;  3PKD A;  4MAT A;  1XGO A;  2EA2 A;  2OKN A;  2BN7 A;  4B28 A;  1QXW A;  1PV9 A;  1YW8 A;  4IEC A;  4FO8 A;  4IKU A;  4S00 A;  2GU5 A;  4R60 A;  1C22 A;  2BH3 A;  4S01 A;  4FLI A;  5CE6 A;  2Q93 A;  2GG3 A;  2HOW A;  4EGE A;  1KP0 A;  2GG7 A;  2IW2 A;  2V6C A;  4FKC A;  2GZ5 A;  4U1B A;  3TB5 A;  4U75 A;  4IF7 A;  4HXX A;  4RGZ 1;  4S2T P;  4QR8 A;  2BHA A;  2GU6 A;  2BWS A;  1R5H A;  1B59 A;  4U6E A;  2BB7 A;  1R5G A;  1XGS A;  2V3X A;  4U6C A;  1YW9 A;  1XGM A;  2GGC A;  1O0X A;  5JFR A;  4FUK A;  5CDV A;  5FCF A;  4IKR A;  4JUQ A;  2GG9 A;  4U6W A;  4U70 A;  2Q95 A;  2BWW A;  1A16 A;  3L7G A;  1WL6 A;  3CTZ A;  2MAT A;  4FLJ A;  1WKM A;  2GG2 A;  1WY2 A;  2OAZ A;  4U6J A;  3MX6 A;  1XNZ A;  2Q94 A;  3PKE A;  2ADU A;  4FLK A;  4IKS A;  4A6V A;  4OOK A;  2BWX A;  2P99 A;  1KQ0 A;  4U76 A;  4S2R P;  2B3L A;  5JHU A;  2GGB A;  3IU7 A;  1YVM A;  2B3H A;  4ZWO A;  3FM3 A;  1WBQ A;  3CB5 A;  3MR1 A;  4IPA A;  2V3Z A;  1QXZ A; 
#chains in the Genus database with same CATH homology
 5JI6 A;  4PNC A;  1QXY A;  3CB6 A;  1C23 A;  4FLL A;  4RZY A;  1B6A A;  1Y1N A;  3MAT A;  3IU8 A;  3L24 A;  3TAV A;  4IDY A;  4U71 A;  3BIT A;  4Z7M A;  4ZWU A;  1C21 A;  2NQ6 A;  1MAT A;  5CNX A;  2BHB A;  2GU4 A;  2BWV A;  1KQ9 A;  4KM3 A;  4PV4 A;  4FO7 A;  5D6E A;  2P9A A;  2EA4 A;  1C27 A;  2NQ7 A;  3FMQ A;  1QZY A;  1CHM A;  1W2M A;  5FCH A;  2EVC A;  3BIQ A;  4ZNG A;  1C24 A;  1JAW A;  2V3Y A;  1XGN A;  1YJ3 A;  3FMR A;  1BOA A;  5CDL A;  1WL9 A;  2GA2 A;  2GG5 A;  2DFI A;  1M35 A;  4U69 A;  4A6W A;  1N51 A;  3PKA A;  2GG8 A;  2ZSG A;  4IU6 A;  1W7V A;  2GG0 A;  2EVO A;  3ROR A;  2BWU A;  3IU9 A;  5CIK A;  2GU7 A;  2P98 A;  3PKB A;  5E5B A;  3Q6D A;  5CLS A;  2B3K A;  2EVM A;  2BHD A;  3IG4 A;  5D6F A;  1BN5 A;  1YW7 A;  2Q96 A;  3PKC A;  4IKT A;  1R58 A;  2G6P A;  1WN1 A;  2BHC A;  4RZZ A;  3RVA A;  3D27 A;  4U73 A;  4U6Z A;  2Q92 A;  2BWT A;  2GTX A;  5CDE A;  2Q8K A;  3BIP A;  2BWY A;  1WLR A;  4ZWP A;  3S6B A;  3PKD A;  4MAT A;  1XGO A;  2EA2 A;  2OKN A;  2BN7 A;  4B28 A;  1QXW A;  1PV9 A;  1YW8 A;  4IEC A;  4FO8 A;  4IKU A;  4S00 A;  2GU5 A;  4R60 A;  1C22 A;  2BH3 A;  4S01 A;  4FLI A;  5CE6 A;  2Q93 A;  2GG3 A;  2HOW A;  4EGE A;  1KP0 A;  2GG7 A;  2IW2 A;  2V6C A;  4FKC A;  2GZ5 A;  4U1B A;  3TB5 A;  4U75 A;  4IF7 A;  4HXX A;  4RGZ 1;  4S2T P;  4QR8 A;  2BHA A;  2GU6 A;  2BWS A;  1R5H A;  1B59 A;  4U6E A;  2BB7 A;  1R5G A;  1XGS A;  2V3X A;  4U6C A;  1YW9 A;  1XGM A;  2GGC A;  1O0X A;  5JFR A;  4FUK A;  5CDV A;  5FCF A;  4IKR A;  4JUQ A;  2GG9 A;  4U6W A;  4U70 A;  2Q95 A;  2BWW A;  1A16 A;  3L7G A;  1WL6 A;  3CTZ A;  2MAT A;  4FLJ A;  1WKM A;  2GG2 A;  1WY2 A;  2OAZ A;  4U6J A;  3MX6 A;  1XNZ A;  2Q94 A;  3PKE A;  2ADU A;  4FLK A;  4IKS A;  4A6V A;  4OOK A;  2BWX A;  2P99 A;  1KQ0 A;  4U76 A;  4S2R P;  2B3L A;  5JHU A;  2GGB A;  3IU7 A;  1YVM A;  2B3H A;  4ZWO A;  3FM3 A;  1WBQ A;  3CB5 A;  3MR1 A;  4IPA A;  2V3Z A;  1QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...