1XNZA

Crystal structure of mn(ii) form of e. coli. methionine aminopeptidase in complex with 5-(2-chlorophenyl)furan-2-carboxylic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metalloform-Selective Inhibitors of Escherichia coli Methionine Aminopeptidase and X-ray Structure of a Mn(II)-Form Enzyme Complexed with an Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xnzA00
2Q8KA 4S01A 3IU9A 2IW2A 1CHMA 2BWWA 4FLJA 2B3HA 4IU6A 2Q95A 2GU6A 4IECA 1O0XA 2BWYA 4IF7A 2P98A 2GU5A 1WY2A 2BN7A 3FMRA 5CIKA 4EGEA 5CNXA 1BN5A 1WKMA 1C21A 4S2RP 3BITA 3TB5A 1R58A 5CLSA 1R5HA 5CDEA 1QXZA 2BHCA 4ZWUA 3D27A 2EA4A 4U6ZA 2GU4A 3Q6DA 2BWTA 2GG7A 4U73A 2GA2A 2GGBA 1XNZA 1WLRA 4B28A 4U75A 4MATA 5FCFA 4ZWOA 1YJ3A 4RZYA 2BWVA 2V3ZA 5D6EA 2Q93A 3PKCA 3IU7A 4FUKA 1M35A 5E5BA 1MATA 3S6BA 3IG4A 4A6VA 3L7GA 1C24A 1QZYA 2GG9A 2HOWA 3RVAA 1A16A 2V3YA 2V3XA 4RGZ1 4U70A 2BH3A 1B59A 4PNCA 4Z7MA 1PV9A 2Q92A 3IU8A 5FCHA 4U6CA 1W2MA 3CB6A 4RZZA 2GG3A 4U71A 2GG0A 2B3LA 4U1BA 3FM3A 1KP0A 2GG2A 2BB7A 1C27A 1WL9A 3MR1A 1BOAA 2ZSGA 4FLIA 4A6WA 2ADUA 2EA2A 2OAZA 4IKSA 2B3KA 4FLKA 4S2TP 4U6JA 1YVMA 3RORA 1KQ9A 2DFIA 3MATA 1N51A 4FO8A 2GU7A 5JI6A 4HXXA 1YW7A 2GTXA 2NQ6A 2GZ5A 4QR8A 5CE6A 4IPAA 3TAVA 2MATA 5JHUA 3PKDA 1KQ0A 2P99A 1WN1A 4FO7A 1B6AA 5CDVA 2BHDA 1R5GA 2BHAA 4JUQA 4U6EA 4U76A 3PKBA 5D6FA 5CDLA 3L24A 3MX6A 2BWUA 1W7VA 3CTZA 1QXWA 2GGCA 2BWSA 4U69A 4OOKA 4U6WA 2Q94A 2GG8A 1JAWA 5JFRA 1C22A 1Y1NA 4ZNGA 1C23A 2NQ7A 4IDYA 4ZWPA 2BHBA 2EVMA 2EVOA 4IKRA 4R60A 1WBQA 4IKUA 3FMQA 2G6PA 2GG5A 3PKAA 4IKTA 1XGSA 4PV4A 2BWXA 2P9AA 3PKEA 4S00A 1XGNA 2Q96A 2OKNA 1XGOA 1YW8A 3BIQA 4FKCA 1YW9A 1WL6A 2EVCA 3CB5A 1QXYA 2V6CA 1XGMA 3BIPA 4KM3A 4FLLA
chains in the Genus database with same CATH superfamily
2Q8KA 4S01A 3IU9A 2IW2A 1CHMA 2BWWA 4FLJA 2B3HA 4IU6A 2Q95A 2GU6A 4IECA 1O0XA 2BWYA 4IF7A 2P98A 2GU5A 1WY2A 2BN7A 3FMRA 5CIKA 4EGEA 5CNXA 1BN5A 1WKMA 1C21A 4S2RP 3BITA 3TB5A 1R58A 5CLSA 1R5HA 5CDEA 1QXZA 2BHCA 4ZWUA 3D27A 2EA4A 4U6ZA 2GU4A 3Q6DA 2BWTA 2GG7A 4U73A 2GA2A 2GGBA 1XNZA 1WLRA 4B28A 4U75A 4MATA 5FCFA 4ZWOA 1YJ3A 4RZYA 2BWVA 2V3ZA 5D6EA 2Q93A 3PKCA 3IU7A 4FUKA 1M35A 5E5BA 1MATA 3S6BA 3IG4A 4A6VA 3L7GA 1C24A 1QZYA 2GG9A 2HOWA 3RVAA 1A16A 2V3YA 2V3XA 4RGZ1 4U70A 2BH3A 1B59A 4PNCA 4Z7MA 1PV9A 2Q92A 3IU8A 5FCHA 4U6CA 1W2MA 3CB6A 4RZZA 2GG3A 4U71A 2GG0A 2B3LA 4U1BA 3FM3A 1KP0A 2GG2A 2BB7A 1C27A 1WL9A 3MR1A 1BOAA 2ZSGA 4FLIA 4A6WA 2ADUA 2EA2A 2OAZA 4IKSA 2B3KA 4FLKA 4S2TP 4U6JA 1YVMA 3RORA 1KQ9A 2DFIA 3MATA 1N51A 4FO8A 2GU7A 5JI6A 4HXXA 1YW7A 2GTXA 2NQ6A 2GZ5A 4QR8A 5CE6A 4IPAA 3TAVA 2MATA 5JHUA 3PKDA 1KQ0A 2P99A 1WN1A 4FO7A 1B6AA 5CDVA 2BHDA 1R5GA 2BHAA 4JUQA 4U6EA 4U76A 3PKBA 5D6FA 5CDLA 3L24A 3MX6A 2BWUA 1W7VA 3CTZA 1QXWA 2GGCA 2BWSA 4U69A 4OOKA 4U6WA 2Q94A 2GG8A 1JAWA 5JFRA 1C22A 1Y1NA 4ZNGA 1C23A 2NQ7A 4IDYA 4ZWPA 2BHBA 2EVMA 2EVOA 4IKRA 4R60A 1WBQA 4IKUA 3FMQA 2G6PA 2GG5A 3PKAA 4IKTA 1XGSA 4PV4A 2BWXA 2P9AA 3PKEA 4S00A 1XGNA 2Q96A 2OKNA 1XGOA 1YW8A 3BIQA 4FKCA 1YW9A 1WL6A 2EVCA 3CB5A 1QXYA 2V6CA 1XGMA 3BIPA 4KM3A 4FLLA
chains in the Genus database with same CATH topology
2Q8KA 4S01A 3IU9A 2IW2A 1CHMA 2BWWA 4FLJA 2B3HA 4IU6A 2Q95A 2GU6A 4IECA 1O0XA 2BWYA 4IF7A 2P98A 2GU5A 1WY2A 2BN7A 3FMRA 5CIKA 4EGEA 5CNXA 1BN5A 1WKMA 1C21A 4S2RP 3BITA 3TB5A 1R58A 5CLSA 1R5HA 5CDEA 1QXZA 2BHCA 4ZWUA 3D27A 2EA4A 4U6ZA 2GU4A 3Q6DA 2BWTA 2GG7A 4U73A 2GA2A 2GGBA 1XNZA 1WLRA 4B28A 4U75A 4MATA 5FCFA 4ZWOA 1YJ3A 4RZYA 2BWVA 2V3ZA 5D6EA 2Q93A 3PKCA 3IU7A 4FUKA 1M35A 5E5BA 1MATA 3S6BA 3IG4A 4A6VA 3L7GA 1C24A 1QZYA 2GG9A 2HOWA 3RVAA 1A16A 2V3YA 2V3XA 4RGZ1 4U70A 2BH3A 1B59A 4PNCA 4Z7MA 1PV9A 2Q92A 3IU8A 5FCHA 4U6CA 1W2MA 3CB6A 4RZZA 2GG3A 4U71A 2GG0A 2B3LA 4U1BA 3FM3A 1KP0A 2GG2A 2BB7A 1C27A 1WL9A 3MR1A 1BOAA 2ZSGA 4FLIA 4A6WA 2ADUA 2EA2A 2OAZA 4IKSA 2B3KA 4FLKA 4S2TP 4U6JA 1YVMA 3RORA 1KQ9A 2DFIA 3MATA 1N51A 4FO8A 2GU7A 5JI6A 4HXXA 1YW7A 2GTXA 2NQ6A 2GZ5A 4QR8A 5CE6A 4IPAA 3TAVA 2MATA 5JHUA 3PKDA 1KQ0A 2P99A 1WN1A 4FO7A 1B6AA 5CDVA 2BHDA 1R5GA 2BHAA 4JUQA 4U6EA 4U76A 3PKBA 5D6FA 5CDLA 3L24A 3MX6A 2BWUA 1W7VA 3CTZA 1QXWA 2GGCA 2BWSA 4U69A 4OOKA 4U6WA 2Q94A 2GG8A 1JAWA 5JFRA 1C22A 1Y1NA 4ZNGA 1C23A 2NQ7A 4IDYA 4ZWPA 2BHBA 2EVMA 2EVOA 4IKRA 4R60A 1WBQA 4IKUA 3FMQA 2G6PA 2GG5A 3PKAA 4IKTA 1XGSA 4PV4A 2BWXA 2P9AA 3PKEA 4S00A 1XGNA 2Q96A 2OKNA 1XGOA 1YW8A 3BIQA 4FKCA 1YW9A 1WL6A 2EVCA 3CB5A 1QXYA 2V6CA 1XGMA 3BIPA 4KM3A 4FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8K A;  4S01 A;  3IU9 A;  2IW2 A;  1CHM A;  2BWW A;  4FLJ A;  2B3H A;  4IU6 A;  2Q95 A;  2GU6 A;  4IEC A;  1O0X A;  2BWY A;  4IF7 A;  2P98 A;  2GU5 A;  1WY2 A;  2BN7 A;  3FMR A;  5CIK A;  4EGE A;  5CNX A;  1BN5 A;  1WKM A;  1C21 A;  4S2R P;  3BIT A;  3TB5 A;  1R58 A;  5CLS A;  1R5H A;  5CDE A;  1QXZ A;  2BHC A;  4ZWU A;  3D27 A;  2EA4 A;  4U6Z A;  2GU4 A;  3Q6D A;  2BWT A;  2GG7 A;  4U73 A;  2GA2 A;  2GGB A;  1XNZ A;  1WLR A;  4B28 A;  4U75 A;  4MAT A;  5FCF A;  4ZWO A;  1YJ3 A;  4RZY A;  2BWV A;  2V3Z A;  5D6E A;  2Q93 A;  3PKC A;  3IU7 A;  4FUK A;  1M35 A;  5E5B A;  1MAT A;  3S6B A;  3IG4 A;  4A6V A;  3L7G A;  1C24 A;  1QZY A;  2GG9 A;  2HOW A;  3RVA A;  1A16 A;  2V3Y A;  2V3X A;  4RGZ 1;  4U70 A;  2BH3 A;  1B59 A;  4PNC A;  4Z7M A;  1PV9 A;  2Q92 A;  3IU8 A;  5FCH A;  4U6C A;  1W2M A;  3CB6 A;  4RZZ A;  2GG3 A;  4U71 A;  2GG0 A;  2B3L A;  4U1B A;  3FM3 A;  1KP0 A;  2GG2 A;  2BB7 A;  1C27 A;  1WL9 A;  3MR1 A;  1BOA A;  2ZSG A;  4FLI A;  4A6W A;  2ADU A;  2EA2 A;  2OAZ A;  4IKS A;  2B3K A;  4FLK A;  4S2T P;  4U6J A;  1YVM A;  3ROR A;  1KQ9 A;  2DFI A;  3MAT A;  1N51 A;  4FO8 A;  2GU7 A;  5JI6 A;  4HXX A;  1YW7 A;  2GTX A;  2NQ6 A;  2GZ5 A;  4QR8 A;  5CE6 A;  4IPA A;  3TAV A;  2MAT A;  5JHU A;  3PKD A;  1KQ0 A;  2P99 A;  1WN1 A;  4FO7 A;  1B6A A;  5CDV A;  2BHD A;  1R5G A;  2BHA A;  4JUQ A;  4U6E A;  4U76 A;  3PKB A;  5D6F A;  5CDL A;  3L24 A;  3MX6 A;  2BWU A;  1W7V A;  3CTZ A;  1QXW A;  2GGC A;  2BWS A;  4U69 A;  4OOK A;  4U6W A;  2Q94 A;  2GG8 A;  1JAW A;  5JFR A;  1C22 A;  1Y1N A;  4ZNG A;  1C23 A;  2NQ7 A;  4IDY A;  4ZWP A;  2BHB A;  2EVM A;  2EVO A;  4IKR A;  4R60 A;  1WBQ A;  4IKU A;  3FMQ A;  2G6P A;  2GG5 A;  3PKA A;  4IKT A;  1XGS A;  4PV4 A;  2BWX A;  2P9A A;  3PKE A;  4S00 A;  1XGN A;  2Q96 A;  2OKN A;  1XGO A;  1YW8 A;  3BIQ A;  4FKC A;  1YW9 A;  1WL6 A;  2EVC A;  3CB5 A;  1QXY A;  2V6C A;  1XGM A;  3BIP A;  4KM3 A;  4FLL A; 
#chains in the Genus database with same CATH topology
 2Q8K A;  4S01 A;  3IU9 A;  2IW2 A;  1CHM A;  2BWW A;  4FLJ A;  2B3H A;  4IU6 A;  2Q95 A;  2GU6 A;  4IEC A;  1O0X A;  2BWY A;  4IF7 A;  2P98 A;  2GU5 A;  1WY2 A;  2BN7 A;  3FMR A;  5CIK A;  4EGE A;  5CNX A;  1BN5 A;  1WKM A;  1C21 A;  4S2R P;  3BIT A;  3TB5 A;  1R58 A;  5CLS A;  1R5H A;  5CDE A;  1QXZ A;  2BHC A;  4ZWU A;  3D27 A;  2EA4 A;  4U6Z A;  2GU4 A;  3Q6D A;  2BWT A;  2GG7 A;  4U73 A;  2GA2 A;  2GGB A;  1XNZ A;  1WLR A;  4B28 A;  4U75 A;  4MAT A;  5FCF A;  4ZWO A;  1YJ3 A;  4RZY A;  2BWV A;  2V3Z A;  5D6E A;  2Q93 A;  3PKC A;  3IU7 A;  4FUK A;  1M35 A;  5E5B A;  1MAT A;  3S6B A;  3IG4 A;  4A6V A;  3L7G A;  1C24 A;  1QZY A;  2GG9 A;  2HOW A;  3RVA A;  1A16 A;  2V3Y A;  2V3X A;  4RGZ 1;  4U70 A;  2BH3 A;  1B59 A;  4PNC A;  4Z7M A;  1PV9 A;  2Q92 A;  3IU8 A;  5FCH A;  4U6C A;  1W2M A;  3CB6 A;  4RZZ A;  2GG3 A;  4U71 A;  2GG0 A;  2B3L A;  4U1B A;  3FM3 A;  1KP0 A;  2GG2 A;  2BB7 A;  1C27 A;  1WL9 A;  3MR1 A;  1BOA A;  2ZSG A;  4FLI A;  4A6W A;  2ADU A;  2EA2 A;  2OAZ A;  4IKS A;  2B3K A;  4FLK A;  4S2T P;  4U6J A;  1YVM A;  3ROR A;  1KQ9 A;  2DFI A;  3MAT A;  1N51 A;  4FO8 A;  2GU7 A;  5JI6 A;  4HXX A;  1YW7 A;  2GTX A;  2NQ6 A;  2GZ5 A;  4QR8 A;  5CE6 A;  4IPA A;  3TAV A;  2MAT A;  5JHU A;  3PKD A;  1KQ0 A;  2P99 A;  1WN1 A;  4FO7 A;  1B6A A;  5CDV A;  2BHD A;  1R5G A;  2BHA A;  4JUQ A;  4U6E A;  4U76 A;  3PKB A;  5D6F A;  5CDL A;  3L24 A;  3MX6 A;  2BWU A;  1W7V A;  3CTZ A;  1QXW A;  2GGC A;  2BWS A;  4U69 A;  4OOK A;  4U6W A;  2Q94 A;  2GG8 A;  1JAW A;  5JFR A;  1C22 A;  1Y1N A;  4ZNG A;  1C23 A;  2NQ7 A;  4IDY A;  4ZWP A;  2BHB A;  2EVM A;  2EVO A;  4IKR A;  4R60 A;  1WBQ A;  4IKU A;  3FMQ A;  2G6P A;  2GG5 A;  3PKA A;  4IKT A;  1XGS A;  4PV4 A;  2BWX A;  2P9A A;  3PKE A;  4S00 A;  1XGN A;  2Q96 A;  2OKN A;  1XGO A;  1YW8 A;  3BIQ A;  4FKC A;  1YW9 A;  1WL6 A;  2EVC A;  3CB5 A;  1QXY A;  2V6C A;  1XGM A;  3BIP A;  4KM3 A;  4FLL A; 
#chains in the Genus database with same CATH homology
 2Q8K A;  4S01 A;  3IU9 A;  2IW2 A;  1CHM A;  2BWW A;  4FLJ A;  2B3H A;  4IU6 A;  2Q95 A;  2GU6 A;  4IEC A;  1O0X A;  2BWY A;  4IF7 A;  2P98 A;  2GU5 A;  1WY2 A;  2BN7 A;  3FMR A;  5CIK A;  4EGE A;  5CNX A;  1BN5 A;  1WKM A;  1C21 A;  4S2R P;  3BIT A;  3TB5 A;  1R58 A;  5CLS A;  1R5H A;  5CDE A;  1QXZ A;  2BHC A;  4ZWU A;  3D27 A;  2EA4 A;  4U6Z A;  2GU4 A;  3Q6D A;  2BWT A;  2GG7 A;  4U73 A;  2GA2 A;  2GGB A;  1XNZ A;  1WLR A;  4B28 A;  4U75 A;  4MAT A;  5FCF A;  4ZWO A;  1YJ3 A;  4RZY A;  2BWV A;  2V3Z A;  5D6E A;  2Q93 A;  3PKC A;  3IU7 A;  4FUK A;  1M35 A;  5E5B A;  1MAT A;  3S6B A;  3IG4 A;  4A6V A;  3L7G A;  1C24 A;  1QZY A;  2GG9 A;  2HOW A;  3RVA A;  1A16 A;  2V3Y A;  2V3X A;  4RGZ 1;  4U70 A;  2BH3 A;  1B59 A;  4PNC A;  4Z7M A;  1PV9 A;  2Q92 A;  3IU8 A;  5FCH A;  4U6C A;  1W2M A;  3CB6 A;  4RZZ A;  2GG3 A;  4U71 A;  2GG0 A;  2B3L A;  4U1B A;  3FM3 A;  1KP0 A;  2GG2 A;  2BB7 A;  1C27 A;  1WL9 A;  3MR1 A;  1BOA A;  2ZSG A;  4FLI A;  4A6W A;  2ADU A;  2EA2 A;  2OAZ A;  4IKS A;  2B3K A;  4FLK A;  4S2T P;  4U6J A;  1YVM A;  3ROR A;  1KQ9 A;  2DFI A;  3MAT A;  1N51 A;  4FO8 A;  2GU7 A;  5JI6 A;  4HXX A;  1YW7 A;  2GTX A;  2NQ6 A;  2GZ5 A;  4QR8 A;  5CE6 A;  4IPA A;  3TAV A;  2MAT A;  5JHU A;  3PKD A;  1KQ0 A;  2P99 A;  1WN1 A;  4FO7 A;  1B6A A;  5CDV A;  2BHD A;  1R5G A;  2BHA A;  4JUQ A;  4U6E A;  4U76 A;  3PKB A;  5D6F A;  5CDL A;  3L24 A;  3MX6 A;  2BWU A;  1W7V A;  3CTZ A;  1QXW A;  2GGC A;  2BWS A;  4U69 A;  4OOK A;  4U6W A;  2Q94 A;  2GG8 A;  1JAW A;  5JFR A;  1C22 A;  1Y1N A;  4ZNG A;  1C23 A;  2NQ7 A;  4IDY A;  4ZWP A;  2BHB A;  2EVM A;  2EVO A;  4IKR A;  4R60 A;  1WBQ A;  4IKU A;  3FMQ A;  2G6P A;  2GG5 A;  3PKA A;  4IKT A;  1XGS A;  4PV4 A;  2BWX A;  2P9A A;  3PKE A;  4S00 A;  1XGN A;  2Q96 A;  2OKN A;  1XGO A;  1YW8 A;  3BIQ A;  4FKC A;  1YW9 A;  1WL6 A;  2EVC A;  3CB5 A;  1QXY A;  2V6C A;  1XGM A;  3BIP A;  4KM3 A;  4FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...