1XO3A

Solution structure of ubiquitin like protein from mus musculus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2900073H19
publication title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xo3A00
1FRDA 1NEKB 2CJOA 3B2GA 1JALA 1N63A 4JWSC 3B2FA 3AEAB 3CWIA 2FBWB 3LB8C 1DGJA 1JW9D 2AX5A 1YJJA 3AH7A 1JWAD 2KAJA 4ZOHC 2WDRB 4C80A 2MJEA 3AE1B 4WWMA 2E3TA 1ZOYB 2M19A 2WDVB 3DWGC 1VLBA 4WQMA 5G5HA 2N0SB 3RPFC 1ZXIA 1N5XA 2G1EA 1T3QA 1JWBD 3AE2B 1R7SA 3AE5B 1FFVA 3ABVB 1DOXA 1CJEA 1ZP0B 2WS3B 3AE4B 1N5WA 2HTME 1OQQA 2H88B 5G5GA 2QIEB 1FXIA 1ROEA 2H89B 1KFYB 2DBYA 2WQYB 3FAHA 3HUIA 1NYRA 1VJKA 1OFFA 1V8CA 1YQ4B 1JQ4A 3NRZA 2MJDA 1DOIA 2DWQA 2W3RA 1TKEA 3PO0A 2PVOD 1AWDA 1FFUA 2BS2B 1NYQA 4YTPB 1NENB 2K9XA 5H8YE 4HRSA 1UWMA 2B76B 4P6VF 3VRAB 1RWSA 2K22A 4YTMB 1F0ZA 3B9JA 3SFDB 3AE8B 1N61A 1DOYA 1RFKA 5EE9A 4USAA 1FIQA 3SFEB 1N62A 2WLBA 2WU2B 5C3JB 1TKGA 3AEDB 2Q5WD 3VRBB 2PKOA 2K5PA 2KMMA 4JWUC 1XLPA 1PUTA 1V97A 4YSXB 2L52A 3KWLA 1E7PB 1E9MA 3BIID 2BS4B 2ACZB 4IDIA 1E0ZA 1KF6B 4LTUA 1GAQB 5AUIA 1XO3A 2LEKA 3NVWA 4US8A 4YSYB 4N6EB 4HROA 1J7BA 4A9AA 4KX6B 3EUB2 5EE3A 3P4PB 1AYFA 2WDQB 1XLNA 5GXGB 3AEGB 1QOBA 4ZHPA 2W55A 3HVZA 1L0VB 1FXAA 3L4PA 1E10A 1L5PA 1PFDA 2PVGC 1WRIA 2CU3A 3P4RB 1WWTA 3ETRA 3NVVA 3AE6B 3P4QB 5AUKA 1RM6C 3AN1A 4ZHOA 5MPOA 3AE9B 4JX1C 1B9RA 3AEEB 1XLOA 2BT6A 1NI3A 1PDXA 4ITKA 1QF6A 2BS3B 3FC4A 3VR8B 1FRRA 1FM0D 1WGKA 1J7CA 1L6UA 3HRDD 1FO4A 4YTNB 3AV8A 2MH7A 3AEFB 2JQRB 1OQRA 1JROA 1ZUD2 1KRHA 2CJNA 2W54A 1QOGA 3NVZA 4N58A 2QJLA 4YSZB 1E6EB 2OHFA 3W5UB 1CZPA 3NS1A 1WYGA 1JRPA 3AEBB 3VR9B 1QLBB 1IUEA 2EKIA 3AE7B 1FMAD 1QOFA 3P4SB 3ZYYX 4YXDB 4C7ZA 1NVID 1A70A 1SF0A 1EWYC 2JX5A 2W3SA 1VDVA 2M56B 2MJ3A 3LXFA 3AB5A 5C2TB 2PIAA 3P63A 5H92C 4C7YA 3WCQA 2L83A 2WP9B 2Y5CA 4N59A 3P1MA 1GPXA 1QOAA 4US9A 1TYGB 3AECB 1QT9A 1XLQA 3DWMA 1TKYA 2WU5B 3AM9A 1RYJA 3W9CB 3SR6A 1SIJA 1WXQA 3AMZA 3W5VB 1J7AA 1I7HA 3NVYA 4YT0B 1SB3C 1YQ3B 5EE0A 1TJEA 3AE3B 5EE1A 1L6VA 1YJIA 4FXCA 3CIRB 1N60A
chains in the Genus database with same CATH superfamily
2KWUB 2PE9A 2MJEA 1BUIC 4DXAB 1VLBA 2AQ3B 3DHGC 1TZOA 4RNAA 3CMMB 1D5XC 2LFIA 3AE5B 2NS5A 2LXAA 4ZRIA 3ENEA 1OQQA 2LJ5A 1UGMA 4MGZE 3UIOB 2MJDA 3RFZB 3DVNV 1UF0A 4L2YA 3WANA 1WH3A 1XCQL 2K22A 2OEDA 3QX1A 3RNAC 1PYWD 4GOCA 4JWUC 2O6VB 2L52A 4OW0A 1GAQB 1I4GA 1R4NB 4WQOB 3KH0A 2KXJA 3PLVA 3U8ZA 3I57A 2CU3A 2IO3B 2QEJC 3VVWB 3ETRA 5BO4B 4KKJA 3CSFA 3AEEB 1XLOA 4W9KA 1GG3A 2O2VA 1J7CA 5HFYA 2J53A 4HPMB 2OJRA 1YQBA 4YSZB 2DAFA 3A4SC 2MWSB 1VCBA 3NUHB 3NY5A 2NPTA 1TS5A 1VZ6A 3ZYYX 4MSMB 4S17A 1NVID 1LQBA 3AB5A 2KC2A 2Z0DB 2K39A 3M95A 1QOAA 1CQVA 1QQRA 1TYGB 3RUIB 3QJZA 3W9CB 2LGSA 2E6XA 1E7UA 1WGGA 2KVRA 2LGDA 5EE1A 1YJIA 1SGHA 3OWEB 2LVQA 1JALA 1SIFA 1T6BX 3DBHI 4YXDB 2N0SB 2D5GA 4II2B 2LASA 4HPLB 3Q8AA 2K8BA 1FFVA 3AE4B 2KFKB 5JZEB 3KUZA 2HDEA 1OEYA 5D2MB 4D2KA 1B1ZA 4RM9A 2WXOA 4MSQB 4DWFA 1WX9A 3DQVA 4BOSC 2L0FA 3BZDB 2IO0B 1V6EA 4OVVA 4K7WA 4RGTA 4IG7B 3Q3OC 2EELA 4A3PA 5E6PA 1R4MI 5C23A 3VXWA 2L8JA 5D94A 3TCAA 1PQSA 2GMIC 1XQQA 4NAMA 4HWIB 1WSPA 4I6LB 2DENB 3APFA 4NY0A 3IG3A 2JWZA 1D4BA 2NVUI 1T0QC 5JH5C 3SU8X 2JQRB 1OQRA 3HIZA 3IHPC 1E6EB 1YD8U 4S0RA 4GDKA 3D32A 4G0NB 3WAMA 4W9DA 3LXFA 5CHWA 2O6VD 2MJ3A 1MJDA 1Z2MA 2Y5CA 2JU6X 2WWZA 2AL3A 4RMAA 3VUWA 3RD2A 3CIRB 2DX5B 3A1QB 2LI5A 1FRDA 2KX0A 3B2FA 4DHJB 3LB8C 2KAJA 2WDRB 2N1WA 5G5HA 4A3OA 3B1LX 2ONQA 2LD9A 1WR6E 3M3JA 2G1EA 1JWBD 2DZMA 3V3XA 2K0PA 3ABVB 1N5WA 2JYTA 1WR1A 1VJKA 2M1MA 1MFWA 1TKEA 2J4XA 3ZLZA 1AWDA 1A5RA 4BOZB 3B9JA 5HHDG 2NBWB 3SFEB 2WLBA 4GU2A 4BVUC 3PSEB 3PRZA 3H7PB 3W1SA 5LLIA 3MC8A 3ML9A 4MM3B 4MH8A 2L05A 4MJSB 1CK1A 4R3DA 4HJGE 1P1AA 4KV2A 2PVGC 4ANUA 3NVVA 2K6QA 2IZVB 5IOIA 3H6NA 3X0WA 2KYWA 5BMGA 3TSSA 1B9RA 2YVCA 1UNSA 4BKSA 4WWPA 3Q3FA 1L6UA 3L16A 1SEBD 1RFAA 5T8IA 1ACCA 4CO7A 4MH0E 2JXTA 4G3XB 3BYTB 3EA6A 3RNGC 1IUEA 2EKIA 4C7ZA 1SF0A 5DPSA 2RD0A 3WCQA 2WP9B 3AECB 1C4CA 3DWMA 1SIJA 3Q3JA 3PV1A 4IM2A 3MP9A 3T3NA 2DYBA 3I3TB 3WALA 2CJOA 3PREA 4IWQA 3KUCB 4P7IA 1J0GA 3AE1B 2WDVB 1IYFA 3RCZA 2MSED 3RPFC 2RR9A 4BAXA 2H88B 5G5GA 2V1YA 2WQYB 2JPHA 2RGFA 1V8CA 1YMHE 2YEPF 3GB1A 1UELA 2PVOD 1PGXA 2L00B 2JSVX 3W1YA 2J52A 2GLSA 1WE6A 4NJ6A 4KIKB 1WGDA 3B08A 3TBLD 2PKOA 4JPSA 1E9MA 4MGIE 1HZ5A 3P2BA 5TSSA 1HTOA 1KLGD 2RPQA 2N7DA 1YNTE 4HKZE 2KO3A 2V3SA 1GUAB 4DHJD 3HK0A 5EE3A 2ZEQA 4M0WA 3BYYB 2WXLA 3AEGB 1TS3A 5E6OA 1E10A 1EWCA 5BYRA 4C4VB 2LUMA 1F52A 3TJPA 1NI3A 2ZCBA 4HEA1 1XCTL 1FRRA 3R2TA 4JQWC 1LXDA 2I1JA 3BINA 1WE7A 3NVZA 1WGHA 3RNBC 2D3AA 1WY8A 2WYQA 1J19A 1VR9A 1HE8A 2D07B 2QCZA 2MBOA 1VDVA 3BK1A 2LMCA 4WWOA 3C8YA 3SDLC 3H1UA 4JL9A 2DAJA 1LM8B 4FBJB 1F1HA 5IKCM 5E6JA 1EF5A 3MJ5A 4W9HA 1D5ZC 2CHXA 4JWSC 1V86A 2AX5A 2X8XX 1N6ZA 4WURA 4C80A 1JWAD 1T0RC 3DBHB 1AN8A 3KVFB 2AWTA 2BB6A 2KDEB 3ZXRA 3LJ3A 3WIMA 4HLEA 2WS3B 4RF1A 2KOXA 2GOWA 3Q8FA 2KX3A 1Q0WB 4L1BA 3FAHA 4FHKA 1Z5SB 2QSDA 4YTPB 2YLMA 1K8RB 3ZQ4A 2KWDA 4F7ZA 1UGJA 1E7VA 2AQ2B 4NJCA 3ZTCA 2KMMA 5KHQA 2BPSA 3SD5A 3X23A 1R4MB 3KUDB 4ZYNA 4X57B 2KJHB 3Q8CA 4KX6B 1FNVA 2BW2A 2FAZA 1XLNA 2W55A 3DPDA 1FNUA 1WI0A 2G45B 3ZNHB 3JW0X 2VH2A 4FJZA 2IPKD 1UUPA 1ISNA 2GI9A 3ZW3A 3WA0A 2FCQA 4HDOA 4WJNA 2DLBA 2FCSA 4ITKA 4C56C 4KKIA 3E9SA 3O13A 1T0YA 3B0AA 2RDHA 3BVMA 4N9F4 3N1ZC 1JRPA 1QOFA 5FK9C 3U30A 2LGIA 1ET9A 2V3NA 1P98A 4KZ0A 1OQYA 2K1FA 3QIJA 3IXSA 1QILA 2KTFA 4OZAA 4TUUA 3PHWB 2WU5B 3TEXA 2V9HA 3R7RA 3VTUA 5JHBA 3GS2A 3JSVB 1KLUD 3DBLI 1N60A 3A4RA 3ZGZA 4DQOC 4TQ0A 3ZJUA 3CWIA 2MA9B 3V6CB 2K6DB 4XZ4A 4RGMA 3N1YC 1GB1A 3FILB 1WX8A 4LNOA 1V1PB 2L32A 3OLMD 1MI0A 3EHVA 1NBFC 2Y3AA 3JVZX 5D3IB 3Q3NC 2GBJA 1FFUA 1EUVB 1NI2A 3ZIMA 2K25A 3WAPA 1YN5A 2MBBB 3SFDB 4IM0A 2IYDB 2QILA 2NTTA 4MGYE 1F9JA 2DZIA 3VRBB 3EGRA 4I6NB 2WXKA 1C9FA 1WYWB 4PT5A 2AL6A 1Q1OA 4A55A 1TS4A 2WXPA 1C79A 2LEKA 4US8A 5D7GA 2KQ7A 2PW9A 2BKRB 2EMSA 5AUKA 1TS2A 1I4QA 4JX1C 3C0RB 3A9JB 1WZ0A 1XEEA 4EE2A 3WAOA 1ZDVA 3HRDD 5AZHA 1JWMD 2R2QA 3AV8A 4ZDVA 1ZUD2 3K9PB 3PVLA 1QOGA 4ZRPA 4NAWB 1CZPA 2DYMA 3JYUA 2JF5A 4IW0A 1A70A 3Q14C 2WXMA 2L3ZA 3R8BA 1IBXB 2PEAA 2KLGA 2KFKA 1KM7A 4M8NA 4LDTB 3TEYA 2VRRB 2FCNA 3NVYA 1SB3C 4B6WA 5IO9A 3DBRI 1L6VA 4KSKC 3PTFC 4AUQC 4FHJA 3PPAA 1J8CA 2V4IB 1WXAA 2Z8LA 2RMMA 2G4DB 3TL5A 5HI1A 3R2IA 4MGKE 2LUEA 1N5XA 2HE7A 2N9EB 4LLGM 3MHSD 1DOXA 3QQ8B 4DHZE 2PE6B 2K3UA 1P0RA 1KFYB 2BYTA 1LFDA 4HPPA 4MEMA 3NRZA 3EECA 3ML8A 4BBNF 3M63B 1D5MC 1NENB 2K9XA 2B76B 1PGBA 2UWQA 3VRAB 2NCNA 2L7RA 3QWZB 2XN9C 3NZ3A 2W9NA 4OVZA 1VRAB 1KOTA 2N1VA 4YSXB 4M01A 2G9HD 4J6IA 1I4PA 2PLPA 2WDQB 3VH4B 4ZYSA 3P4RB 1WWTA 2INCC 1V81A 4W9CA 2JRIB 3AE6B 3RYTA 2GB1A 3T8MA 3AU4A 2FE8A 4EUTA 5BYSA 1UD7A 2W54A 2IGHA 2I2YA 3CF6E 2NPTB 1MHHE 2LHEA 3VHTC 1FMAD 4JIOU 2W3SA 2JX5A 3P63A 5CHVC 4PS8A 1KTKA 4KSLC 4GIVA 3UF8A 1P3QU 3KWVA 1GJZA 3AXCA 1JRUA 4ARIA 2LGXA 3B2GA 4NJ7A 1ZOYB 4K1RB 1WF9A 2ZCCA 3ZJVA 2JZ3B 2HTME 3RZFA 2DHZA 1FXIA 1ROEA 3TEWA 1NYRA 1KH0A 1WXMA 3TMPB 5EDSA 1NYQA 2OJWA 2Z0EB 1IGCA 4P6VF 4FJYA 3KLSX 4K7UA 2V3PA 4USAA 2C7NB 2WU2B 2N9LA 4WAAA 4LDTD 1KJTA 4F8CB 2KWCA 2ACZB 2KVZA 3EC8A 4AWJA 1XT9B 3ZRFA 2N7JA 5FR6A 3U2SC 3PGEA 3EFCA 3L4PA 1L5PA 4DK5A 1FCCC 4B0EA 4EFOA 2MRPA 3W1SC 1I42A 1OGWA 2JWUA 3ZDMC 4L23A 2MP2A 3VR8B 2KMAA 3QA8A 4DXFA 2AEHA 4ARCA 2FUHB 2J0JA 3APCA 3PS6A 3AEBB 1QLBB 3PLUA 4HCPB 2M4NA 3EFUA 5G2NA 3VQIA 4NQKE 2C5LC 3P1MA 1QT9A 4XX5A 4W9JA 1WXQA 3LYYA 2KZRA 2JYEA 2NBUA 4XDDA 3MJWA 1WGKA 3DBLB 2D3BA 3BY4B 5KHOA 1IP9A 1P9DU 2BGFA 3DOWA 4ZHPA 1FPYA 2KDBA 1IPGA 3V05A 4K3CA 1P7EA 3I9V1 4UDUC 1T0SC 4E71A 3UI3A 1GC6A 1V5OA 1WGYA 2DBYA 2CR5A 3S2AA 2AQ1B 4W9FA 3BVGA 1OTRB 3VH3B 3GP7A 3IT4B 1XF5L 2JZZA 2WXIA 4B95A 1S1QB 2K5PA 4NNJB 2BBCA 2KLCA 1E7PB 2BS4B 1WGRA 1WMHA 3L08A 3Q6BA 5BMHA 1I4HA 5JHAA 1XO3A 4YSYB 1LO5D 2IGGA 3EUB2 2J7QB 4O1NA 3A33B 3SHQA 3ZNGC 1EU4A 1RM6C 3AN1A 2LWPA 2IO2B 3RNFC 1VD2A 3URYA 2BT6A 5J18A 4KGTA 2FNJB 1JROA 4XYCA 1GB4A 4ICUA 3NS1A 2LRWA 4ACFA 4CQNA 2INNE 1ZW7A 4HKQA 4I6PA 3KW5B 2MEKA 1TBEA 1YQ3B 1ZDXA 3SEBA 1BXTA 3R66C 2NR2A 3DBRB 1L4ZB 2KN5A 1N63A 2XK5A 4JLCA 2VH1A 4KGSA 2M19A 4WQMA 2LXCA 4II3B 2ZZPB 5DPWA 2KJRA 2L1AA 3PRMB 1FD6A 3AU5A 2QIEB 1C1YB 3HUIA 1F2RI 2DWQA 1MPEA 3O65B 1EO6A 4FULA 2JUOA 4GGQA 1RWSA 3UQBA 1SE3A 1F0ZA 5BMIA 1HEZE 4ICVA 2IY0B 2ICIA 2Q5WD 1EU3A 3H8HA 1XLPA 1TZ1A 1IGDA 4MT5A 3DVGY 1CMXB 4LCDE 1K51A 2WNMA 1J7BA 5E6NA 2I1KA 2I38A 2ZW1A 4EKUA 3MC9A 2KTRA 4RH6A 2RDBC 4M02A 4F1SA 2GBNA 1YX6B 3NS8A 2V4LA 2D3CA 3ALBA 5G55A 1UBIA 1ZPSA 3DVGX 3A9KB 2D2QA 3QCAA 2N9XA 4DXGA 4GDLA 3ZVVA 3T9LA 4EZJA 4PS3A 3N32A 4W9GA 2IO1B 2KN4A 1KRHA 4N58A 2QJLA 2WDTB 4B0MA 1WZ3A 2PJHA 4ANXA 4AJYB 2KK8A 5IAAC 5TR5A 3ZKJC 2JRHA 1EWYC 4A6QA 3TIXA 2PPHA 4N59A 1GPXA 1WJ4A 4WJOA 4OVUA 4FA6A 2ZJDA 4XGAB 1V1PA 5DPTA 4IKGA 4BKGA 3PZDA 5EE0A 2ZPYA 2C60A 4FXCA 1YIWA 3C19A 4ZOHC 1DGJA 2B3AA 4WWMA 3QC8B 4NPNA 2NMQA 4EZLA 1ZXIA 4J3OD 4MELA 1MG8A 2J0MA 1V1OA 3DCGA 1CJEA 1E5WA 4FJVB 2DYOA 2WX0A 4AP4C 4HXDA 1ZE3D 4GN1A 3PO0A 2KQ4X 3PHXB 1TY2A 4FN2A 3VTVA 1SJED 3I5JC 2GBKA 3V61A 4YTMB 5CTRC 3NG0A 4PK1A 2V0GA 1FEHA 2X38A 5C3JB 1I4RA 3AEDB 3IBEA 4EEWA 2N7EA 2O6VA 1V97A 4OZCA 3KWLA 2MQJA 2WX1A 2KFJA 5AUIA 3IT6B 4TSSA 1HA5A 4A8XC 3P4PB 2MBEA 2WXQA 3ZTDA 2BVCA 2DZKA 1T5XD 3N30A 4WWNA 2IJ0A 1VZ7A 3UQAA 5J17A 4K81A 3ECIA 4HCNB 4G50A 4TQ1A 4RCOA 1FM0D 1FO4A 3VAWA 1SBBB 2HD5B 4E74A 3KYCD 1UH6A 4AOFA 3GOEA 2K8CA 2QC8A 3VR9B 4CHKA 3NZSA 3AE7B 2PIAA 3RT3B 1TKYA 1WX7A 3AM9A 5LNK1 1GOZA 1SE2A 2KC1A 4E3CA 2SAKA 4EOYA 4HJKA 4ZHOA 1SE9A 2E3TA 3PT2B 2VZKB 1H4RA 3V60A 5I4DA 3BWUD 2YEPB 2QDFA 3UIPB 3Q3MC 2KQSA 2C7HA 1TGZB 3UGBB 1YQ4B 1OFFA 2N4FA 2XNAC 2JZPA 2NBVB 1L7YA 1UWMA 2HTHA 4LJOB 2ZPNA 2MBHA 2BB5A 3HVDA 3KYDD 4PYZA 2A5UA 2NTSA 2LJIA 1ENFA 4K3BA 4EZKA 2J42A 3ZRCA 1F2RC 4WAFA 4HVBA 2KMCA 4MACA 4OHJA 3L13A 4A9AA 3HHMA 1AYFA 1QOBA 2L0TA 4JE3B 4LNKA 4RF0A 3VTWA 5HG2A 3R7QA 3GE8C 2WXGA 5D6JB 2RSUA 5MPOA 2M0XA 3AE9B 3QAQA 3T3OA 3MC0B 2WXJA 4W9LA 1JMLA 3VDZA 1QF6A 3L54A 2EMTA 2JY6A 3J9CA 3OJ3A 2RDGA 2GBMA 2CHZA 2Z59B 4JGHB 2OHFA 3FKYA 1WYGA 4YWGG 1ESFA 3U7DA 4HK2A 4RM8A 4W9IA 2FUG1 5CHFA 4Q2JA 3V62A 2L83A 4IC7B 2EKEC 4ANWA 3Q8BA 1JWUD 1XLQA 3VUXA 1RYJA 2GRIA 2O2VB 1E8XA 2ZVNA 4GLSC 4NZLB 1TJEA 1GNUA 1C3TA 3RULA 3A1QA 3RNEC 4M00A 5BYQA 5FKAC 3V6EB 2IY1B 2RPVA 3N1XC 4WJPA 1TT5B 3IAM1 1MG4A 1T3QA 3RN9C 1R7SA 2G4SA 1X1MA 5LXHA 3DVNU 2M17A 4DBGA 3N3KB 2H89B 4BKTA 1JQ4A 3OAWA 4REZA 2KHWB 3NZUA 1HTQA 2IBIB 1L0YB 1ZXHA 2JVCA 5AZGA 4KDLB 5EE9A 1FIQA 1N62A 1WJ6A 1AARA 1TKGA 3GZNI 1TIFA 4ANVA 1FNWA 1PUTA 2MBQA 3IFWB 2BYFA 1C78A 3H7PA 1JWSD 1QKZA 1KF6B 1GC7A 1ZKHA 4MM3A 1FXTB 4MJSA 3KQ4A 3HVZA 1L0VB 1WRIA 4WJQA 1Q5WB 2CHWA 3U52E 2CU1A 2VZKD 1C4AA 4XWWA 4P1BC 1D6EC 1Y56A 1PDXA 4OZBA 1V49A 2BS3B 3H9DA 2BYEA 1H8CA 1XXGA 2D3GA 3GE3C 1E8ZA 2N9KA 2WXRA 3P4SB 4YL8A 2WGSA 1MVKA 4C7YA 2MX2A 3PZ8A 1C4PA 4IWOA 1M4VA 2CKHB 4US9A 2KNBA 2N9PC 2W82A 3HM6X 3OJ4B 1WM3A 1J7AA 4G11A 4YT0B 4GSWA 3DHHC 4LJPB 1OEYJ 1L2NA 1TY0A 1NEKB 2XBBC 4GDKB 1K52A 2HJ1A 1XD3B 2G3QB 3MHZA 2KDIA 2BWES 1F77A 3IVFA 3TUOA 1WRDB 1WXSA 2PMVA 5IN7A 2IDYA 3QHTA 4KIKA 4TMAB 1EM7A 1N61A 3AE8B 1SE4A 1HXYD 4LNIA 2FIFA 2KT7A 2LGYA 2LHDA 4ZRKA 4BBNC 1AW7A 1D3ZA 2IGDA 2KJ6A 2ZVOA 1I4XA 2REXA 3Q2AC 4BZAA 3NVWA 2Y5PA 1R4NI 2D10A 1KLVA 5CX3A 3Q69A 5JXVA 1PFDA 1E8WA 1UZXB 1WM2A 4W9EA 1V2YA 1BT0A 2BF8B 4BFRA 3UINB 3M62B 4C4VA 1C77A 2FCMA 2AYOB 2MP2B 3FC4A 2KDFB 1NDDA 1DYQA 4YTNB 3CSTA 4ASWC 1STEA 5IA7A 3AEFB 2MHJA 5IP4D 2CJNA 4QAYA 3W5UB 3U7ZA 4XE0A 1G6JA 1RLFA 4RGNA 2ZNVC 3NJTA 2R2OA 5J2RA 2LZ6A 1Y8RC 5H92C 3BK2A 5L95C 5LXIB 2PTLA 2MLBA 4IUMB 1WXVA 3AMZA 3DBSA 3RNCC 2QMTA 2ASQA 3E56A 2UYZB 2C9WB 4AS1A 4K7SA 3AEAB 2M0AA 2FBWB 1WJNA 1JW9D 2Y5BB 1YJJA 3RMKC 4DDID 2MW5A 1JCKB 4WH4A 3RI7C 5D3DA 1SSNA 1TTNA 1WFYA 1WIAA 3LDZE 4M8MA 3ZXVA 1ZP0B 4FADA 3I63C 1QZEA 1VZ8A 4KZCA 3Q8EA 2LVOA 2M8SA 2KKCA 3ZUNA 3BVZA 1DOIA 5H8YE 3RZWC 1BMLC 2J0KA 1ET6A 4CYEA 4GMVA 4URKA 1DOYA 1RFKA 4KGRA 1M94A 2ZW0A 4RFBA 3AULA 3A9KA 3MFGA 3BIID 1WMHB 1E0ZA 3ZO5B 4AJWA 5AZFA 4LTUA 3APDA 4HROA 5L83A 2INPE 2WHIA 4IOIE 1P7FA 2LVPA 3N20C 3OG5A 3P4QB 3L17A 1S3SG 4P1CC 4IM3A 1V9JA 2ZNVB 2K8HA 4A20A 4GB9A 1ZGUB 2LRUA 2BWFA 3MTNB 2SEBD 3ZNZB 2UU7A 3QK0A 3PRPB 4TKNA 4M0WB 4LK0M 3L0WB 5DPRA 1YN4A 1UBQA 1V80A 2BTEA 5C2TB 2M56B 2D11A 4C00A 3P42A 1Q10A 3VUYA 4GXBA 4P16A 2WXNA 1SXTA 3AI5A 3JSVA 1I35A 4LNNA 2WXHA 4KDIC 1YN3A 1L0XB 4HDQA 1YJ1A 3R3MA 2BQQA 2XK5B 3K9OB 3AH7A 5GMVA 3DWGC 1E90A 4PS7A 3AE2B 1YX5B 2DNFA 2JXXA 5HKHA 2GBRA 3FILA 2L76A 3H7SA 4NQLB 2QHOA 4TV3A 2XEWA 3QARA 1C76A 1U4AA 2W3RA 4XC2A 1RAXA 3HM3A 2BS2B 2BKFA 4HRSA 2R61A 3ZJTA 3DHIC 2CS4A 3ZDTA 2C7MB 1EF1A 2ON8A 3GZNB 3IAS1 4BKSD 4XDCA 3W2DA 4RGOS 2KDMA 4IDIA 3TEZA 1WJUA 4B9KA 4IWPA 3DDCB 4N6EB 4A90A 4AQ7A 2OOBB 5GXGB 2DZJA 1FCLA 1FXAA 1MHXA 3ZNID 3PZ7A 2INDC 2KTRB 2KANA 4KVGB 1SJHD 5C1ZA 3A9JA 1YOVB 3VFKA 4DHZB 1UWXA 4FLHA 2MCNB 2JT4B 4XWTA 4GDLB 3ONSA 2BYVE 2KACA 2MH7A 1PGAA 1K50A 1V5TA 1E8YA 3N9YC 4LNFA 4NAWA 1HZ6A 4ZRJA 1RRBA 3NOBA 2HJ8A 3L10B 4H2AA 5FR3A 4MDKE 1HQRD 4PYUA 3U4EG 5DCNA 1IBXA 5AEKB 3NHEB 4ZRQA 4DDGD 1LGRA 3SR6A 4WIPA 3W5VB 2A4ZA 1I7HA 2WXFA 2KD0A 3AE3B 1K53A 2FIDA 1L4DB 2TSSA 2KWVB
chains in the Genus database with same CATH topology
3MJ5A 5BYQA 1D5ZC 5FKAC 4JWSC 2RPVA 2AX5A 4ZHPA 4WURA 4C80A 1JWAD 2MJEA 1BUIC 3IAM1 1VLBA 3V05A 2AQ3B 1AN8A 1P7EA 1TZOA 3I9V1 4UDUC 4RNAA 1T3QA 2BB6A 1D5XC 2LFIA 1R7SA 3AE5B 2WS3B 3UI3A 4RF1A 1OQQA 3Q8FA 4L1BA 2H89B 2DBYA 3FAHA 2AQ1B 2QSDA 1JQ4A 2MJDA 3RFZB 3BVGA 4REZA 4L2YA 4YTPB 3GP7A 3IT4B 1XCQL 1XF5L 3ZQ4A 2KWDA 1L0YB 2K22A 1UGJA 1ZXHA 2WXIA 5EE9A 1FIQA 2OEDA 1N62A 1TKGA 1PYWD 2AQ2B 4NJCA 2K5PA 2KMMA 4JWUC 1FNWA 1PUTA 2BBCA 2L52A 1E7PB 1C78A 4OW0A 1JWSD 2BS4B 1QKZA 5BMHA 1I4HA 1KF6B 1GAQB 1XO3A 4YSYB 1LO5D 1I4GA 3Q8CA 2IGGA 3EUB2 4KX6B 1FNVA 2BW2A 2V0GA 1XLNA 3KQ4A 2W55A 3HVZA 1L0VB 4O1NA 1FNUA 1WRIA 2CU3A 3I57A 2QEJC 3ETRA 3U52E 2VZKD 1C4AA 4XWWA 1EU4A 1RM6C 2IPKD 3AN1A 1UUPA 4KKJA 1D6EC 1Y56A 2GI9A 3AEEB 1XLOA 3URYA 2BT6A 2DLBA 1PDXA 4ITKA 4OZBA 4KKIA 4C56C 2BS3B 3E9SA 3O13A 4KGTA 1J7CA 5HFYA 2J53A 1JROA 1XXGA 2RDHA 1GB4A 3BVMA 4YSZB 3NS1A 2N9KA 3NUHB 1JRPA 1TS5A 1VZ6A 1QOFA 5FK9C 2WXRA 3P4SB 3ZYYX 2LGIA 1ET9A 2V3NA 1NVID 4CQNA 1MVKA 2INNE 3AB5A 4C7YA 3IXSA 3PZ8A 1C4PA 1QILA 4HKQA 1QOAA 1CQVA 4OZAA 1M4VA 4US9A 1QQRA 1TYGB 2MEKA 2W82A 2WU5B 3W9CB 3TEXA 2E6XA 1J7AA 4YT0B 1YQ3B 1ZDXA 3GS2A 3SEBA 1BXTA 1KLUD 5EE1A 1YJIA 3ZGZA 1N60A 3OWEB 4DQOC 1L4ZB 1TY0A 4TQ0A 1NEKB 1JALA 1N63A 4GDKB 3ZJUA 3CWIA 1K52A 1T6BX 4YXDB 4KGSA 2M19A 4WQMA 2N0SB 2D5GA 3MHZA 2L1AA 3Q8AA 4RGMA 1F77A 1GB1A 1FFVA 3FILB 3AE4B 1FD6A 1V1PB 3TUOA 2L32A 2HDEA 1MI0A 2QIEB 3HUIA 1F2RI 2Y3AA 4D2KA 1B1ZA 5D3IB 2DWQA 1MPEA 1FFUA 2WXOA 2PMVA 2IDYA 1RWSA 1SE3A 1F0ZA 1YN5A 4TMAB 5BMIA 3BZDB 3SFDB 1EM7A 1N61A 1HEZE 3AE8B 1SE4A 2QILA 2NTTA 2ICIA 1HXYD 2Q5WD 3VRBB 4RGTA 3EGRA 1EU3A 2EELA 3H8HA 1XLPA 2WXKA 2LHDA 1AW7A 1C9FA 2IGDA 1I4XA 4PT5A 1IGDA 4NAMA 4MT5A 4A55A 1TS4A 1K51A 1C79A 2LEKA 2WXPA 3NVWA 4US8A 2WNMA 2Y5PA 1J7BA 1WSPA 5D7GA 2PW9A 2I38A 2ZW1A 3Q69A 5JXVA 1PFDA 4RH6A 5AUKA 1TS2A 1I4QA 4JX1C 1D4BA 1C77A 1XEEA 1ZPSA 4EE2A 4DXGA 3FC4A 1ZDVA 1DYQA 3HRDD 4YTNB 1JWMD 3AV8A 1STEA 3AEFB 2KN4A 2JQRB 1OQRA 2CJNA 1ZUD2 1KRHA 4N58A 1QOGA 2QJLA 1E6EB 4ZRPA 4B0MA 4NAWB 3W5UB 3U7ZA 1CZPA 2DYMA 4XE0A 3LXFA 1A70A 4RGNA 1EWYC 2WXMA 2MJ3A 4A6QA 5H92C 3BK2A 4N59A 2PTLA 2JU6X 2Y5CA 3R8BA 1GPXA 1IBXB 1V1PA 4IKGA 3TEYA 3AMZA 3NVYA 1SB3C 5EE0A 2QMTA 1L6VA 3E56A 4FXCA 3CIRB 4AS1A 1FRDA 2V4IB 2Z8LA 3B2FA 3AEAB 2M0AA 2FBWB 3LB8C 1DGJA 1JW9D 2RMMA 1YJJA 4ZOHC 2KAJA 2WDRB 4WWMA 1JCKB 5G5HA 5HI1A 3R2IA 2ONQA 4WH4A 2NMQA 1ZXIA 5D3DA 1N5XA 2G1EA 4J3OD 1JWBD 1SSNA 4LLGM 3V3XA 1V1OA 2K0PA 3ABVB 1DOXA 1CJEA 1ZP0B 1N5WA 2JYTA 2DYOA 1VZ8A 2K3UA 1KFYB 2BYTA 1VJKA 3Q8EA 1ZE3D 3NRZA 3BVZA 1DOIA 1TKEA 2KQ4X 2J4XA 3PO0A 1TY2A 1AWDA 5H8YE 1D5MC 1NENB 2K9XA 1BMLC 1ET6A 2B76B 1PGBA 3VRAB 1SJED 4YTMB 3B9JA 5HHDG 1DOYA 1RFKA 4KGRA 3SFEB 2XN9C 3NZ3A 4OVZA 2WLBA 1FEHA 1VRAB 2X38A 1I4RA 2ZW0A 3AEDB 4RFBA 5C3JB 1V97A 4YSXB 4OZCA 3KWLA 2G9HD 3MFGA 3BIID 3W1SA 1E0ZA 4LTUA 1I4PA 5AUIA 4MM3B 3IT6B 4HROA 4TSSA 2INPE 1HA5A 4A8XC 3P4PB 2PLPA 2WDQB 2WXQA 4MH8A 4IOIE 1P7FA 1CK1A 4R3DA 4HJGE 4ZYSA 2PVGC 3P4RB 1WWTA 1T5XD 3NVVA 3AE6B 3P4QB 3TSSA 5BMGA 2GB1A 2IJ0A 1VZ7A 1B9RA 1UNSA 2FE8A 4TQ1A 4RCOA 1FM0D 1L6UA 1FO4A 5BYSA 1SBBB 1SEBD 2SEBD 2W54A 5T8IA 1ACCA 2IGHA 2JXTA 2I2YA 4LK0M 3BYTB 3EA6A 3VR9B 1MHHE 1YN4A 2LHEA 1IUEA 2EKIA 3AE7B 1FMAD 4C7ZA 2BTEA 1SF0A 2W3SA 2JX5A 5C2TB 2M56B 2PIAA 3P63A 3WCQA 2WP9B 3P42A 1Q10A 1KTKA 3AECB 1C4CA 3DWMA 1TKYA 3AM9A 1SIJA 4P16A 5LNK1 2WXNA 1SXTA 3KWVA 3MP9A 1GOZA 1SE2A 3T3NA 2WXHA 4ARIA 1YN3A 2SAKA 1L0XB 3B2GA 2CJOA 4ZHOA 3AH7A 3AE1B 2E3TA 1ZOYB 2WDVB 3DWGC 3RPFC 2VZKB 3AE2B 3ZJVA 3FILA 5I4DA 3BWUD 2YEPB 2HTME 4XDDA 2H88B 5G5GA 1FXIA 1ROEA 2WQYB 3TEWA 1NYRA 1YQ4B 1OFFA 1V8CA 1YMHE 2YEPF 3GB1A 1KH0A 2XNAC 1C76A 2W3RA 2PVOD 1PGXA 2BS2B 1NYQA 2JSVX 2JZPA 4HRSA 2J52A 1UWMA 2R61A 1IGCA 4P6VF 3KLSX 3ZJTA 2V3PA 4USAA 2BB5A 2WU2B 3HVDA 2N9LA 2NTSA 2ON8A 2PKOA 3IAS1 4XDCA 2LJIA 1ENFA 3W2DA 4RGOS 4JPSA 2J42A 2KDMA 1E9MA 1HZ5A 1F2RC 2ACZB 4IDIA 1KLGD 4WAFA 5TSSA 3TEZA 1YNTE 4HKZE 4MACA 2N7JA 4OHJA 4N6EB 3U2SC 4A90A 4AQ7A 4A9AA 5EE3A 1AYFA 4M0WA 3BYYB 2WXLA 5GXGB 3AEGB 1QOBA 1FCLA 1TS3A 3L4PA 1FXAA 1MHXA 4JE3B 1E10A 3PZ7A 1L5PA 1EWCA 1FCCC 4RF0A 4B0EA 5HG2A 5BYRA 2WXGA 5MPOA 3AE9B 1SJHD 3T3OA 2LUMA 3MC0B 2WXJA 2JWUA 1JMLA 1UWXA 1QF6A 1NI3A 4L23A 4HEA1 1XCTL 4XWTA 3VR8B 1FRRA 3R2TA 4GDLB 3J9CA 2KACA 2MH7A 4DXFA 1PGAA 4ARCA 1K50A 2RDGA 3NVZA 3N9YC 1HZ6A 2OHFA 1WYGA 4YWGG 3AEBB 1QLBB 1ESFA 1VR9A 3VQIA 2FUG1 4H2AA 1VDVA 4Q2JA 3BK1A 5FR3A 1HQRD 2L83A 3U4EG 3P1MA 1IBXA 3Q8BA 1QT9A 1JWUD 1XLQA 2LMCA 4ZRQA 1RYJA 3C8YA 2GRIA 1WXQA 3LYYA 4WIPA 3SR6A 3W5VB 1I7HA 2WXFA 2JYEA 4GLSC 4NZLB 1TJEA 3AE3B 1K53A 5E6JA 1L4DB 1WGKA 2TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  1NEK B;  2CJO A;  3B2G A;  1JAL A;  1N63 A;  4JWS C;  3B2F A;  3AEA B;  3CWI A;  2FBW B;  3LB8 C;  1DGJ A;  1JW9 D;  2AX5 A;  1YJJ A;  3AH7 A;  1JWA D;  2KAJ A;  4ZOH C;  2WDR B;  4C80 A;  2MJE A;  3AE1 B;  4WWM A;  2E3T A;  1ZOY B;  2M19 A;  2WDV B;  3DWG C;  1VLB A;  4WQM A;  5G5H A;  2N0S B;  3RPF C;  1ZXI A;  1N5X A;  2G1E A;  1T3Q A;  1JWB D;  3AE2 B;  1R7S A;  3AE5 B;  1FFV A;  3ABV B;  1DOX A;  1CJE A;  1ZP0 B;  2WS3 B;  3AE4 B;  1N5W A;  2HTM E;  1OQQ A;  2H88 B;  5G5G A;  2QIE B;  1FXI A;  1ROE A;  2H89 B;  1KFY B;  2DBY A;  2WQY B;  3FAH A;  3HUI A;  1NYR A;  1VJK A;  1OFF A;  1V8C A;  1YQ4 B;  1JQ4 A;  3NRZ A;  2MJD A;  1DOI A;  2DWQ A;  2W3R A;  1TKE A;  3PO0 A;  2PVO D;  1AWD A;  1FFU A;  2BS2 B;  1NYQ A;  4YTP B;  1NEN B;  2K9X A;  5H8Y E;  4HRS A;  1UWM A;  2B76 B;  4P6V F;  3VRA B;  1RWS A;  2K22 A;  4YTM B;  1F0Z A;  3B9J A;  3SFD B;  3AE8 B;  1N61 A;  1DOY A;  1RFK A;  5EE9 A;  4USA A;  1FIQ A;  3SFE B;  1N62 A;  2WLB A;  2WU2 B;  5C3J B;  1TKG A;  3AED B;  2Q5W D;  3VRB B;  2PKO A;  2K5P A;  2KMM A;  4JWU C;  1XLP A;  1PUT A;  1V97 A;  4YSX B;  2L52 A;  3KWL A;  1E7P B;  1E9M A;  3BII D;  2BS4 B;  2ACZ B;  4IDI A;  1E0Z A;  1KF6 B;  4LTU A;  1GAQ B;  5AUI A;  1XO3 A;  2LEK A;  3NVW A;  4US8 A;  4YSY B;  4N6E B;  4HRO A;  1J7B A;  4A9A A;  4KX6 B;  3EUB 2;  5EE3 A;  3P4P B;  1AYF A;  2WDQ B;  1XLN A;  5GXG B;  3AEG B;  1QOB A;  4ZHP A;  2W55 A;  3HVZ A;  1L0V B;  1FXA A;  3L4P A;  1E10 A;  1L5P A;  1PFD A;  2PVG C;  1WRI A;  2CU3 A;  3P4R B;  1WWT A;  3ETR A;  3NVV A;  3AE6 B;  3P4Q B;  5AUK A;  1RM6 C;  3AN1 A;  4ZHO A;  5MPO A;  3AE9 B;  4JX1 C;  1B9R A;  3AEE B;  1XLO A;  2BT6 A;  1NI3 A;  1PDX A;  4ITK A;  1QF6 A;  2BS3 B;  3FC4 A;  3VR8 B;  1FRR A;  1FM0 D;  1WGK A;  1J7C A;  1L6U A;  3HRD D;  1FO4 A;  4YTN B;  3AV8 A;  2MH7 A;  3AEF B;  2JQR B;  1OQR A;  1JRO A;  1ZUD 2;  1KRH A;  2CJN A;  2W54 A;  1QOG A;  3NVZ A;  4N58 A;  2QJL A;  4YSZ B;  1E6E B;  2OHF A;  3W5U B;  1CZP A;  3NS1 A;  1WYG A;  1JRP A;  3AEB B;  3VR9 B;  1QLB B;  1IUE A;  2EKI A;  3AE7 B;  1FMA D;  1QOF A;  3P4S B;  3ZYY X;  4YXD B;  4C7Z A;  1NVI D;  1A70 A;  1SF0 A;  1EWY C;  2JX5 A;  2W3S A;  1VDV A;  2M56 B;  2MJ3 A;  3LXF A;  3AB5 A;  5C2T B;  2PIA A;  3P63 A;  5H92 C;  4C7Y A;  3WCQ A;  2L83 A;  2WP9 B;  2Y5C A;  4N59 A;  3P1M A;  1GPX A;  1QOA A;  4US9 A;  1TYG B;  3AEC B;  1QT9 A;  1XLQ A;  3DWM A;  1TKY A;  2WU5 B;  3AM9 A;  1RYJ A;  3W9C B;  3SR6 A;  1SIJ A;  1WXQ A;  3AMZ A;  3W5V B;  1J7A A;  1I7H A;  3NVY A;  4YT0 B;  1SB3 C;  1YQ3 B;  5EE0 A;  1TJE A;  3AE3 B;  5EE1 A;  1L6V A;  1YJI A;  4FXC A;  3CIR B;  1N60 A; 
#chains in the Genus database with same CATH topology
 2KWU B;  2PE9 A;  2MJE A;  1BUI C;  4DXA B;  1VLB A;  2AQ3 B;  3DHG C;  1TZO A;  4RNA A;  3CMM B;  1D5X C;  2LFI A;  3AE5 B;  2NS5 A;  2LXA A;  4ZRI A;  3ENE A;  1OQQ A;  2LJ5 A;  1UGM A;  4MGZ E;  3UIO B;  2MJD A;  3RFZ B;  3DVN V;  1UF0 A;  4L2Y A;  3WAN A;  1WH3 A;  1XCQ L;  2K22 A;  2OED A;  3QX1 A;  3RNA C;  1PYW D;  4GOC A;  4JWU C;  2O6V B;  2L52 A;  4OW0 A;  1GAQ B;  1I4G A;  1R4N B;  4WQO B;  3KH0 A;  2KXJ A;  3PLV A;  3U8Z A;  3I57 A;  2CU3 A;  2IO3 B;  2QEJ C;  3VVW B;  3ETR A;  5BO4 B;  4KKJ A;  3CSF A;  3AEE B;  1XLO A;  4W9K A;  1GG3 A;  2O2V A;  1J7C A;  5HFY A;  2J53 A;  4HPM B;  2OJR A;  1YQB A;  4YSZ B;  2DAF A;  3A4S C;  2MWS B;  1VCB A;  3NUH B;  3NY5 A;  2NPT A;  1TS5 A;  1VZ6 A;  3ZYY X;  4MSM B;  4S17 A;  1NVI D;  1LQB A;  3AB5 A;  2KC2 A;  2Z0D B;  2K39 A;  3M95 A;  1QOA A;  1CQV A;  1QQR A;  1TYG B;  3RUI B;  3QJZ A;  3W9C B;  2LGS A;  2E6X A;  1E7U A;  1WGG A;  2KVR A;  2LGD A;  5EE1 A;  1YJI A;  1SGH A;  3OWE B;  2LVQ A;  1JAL A;  1SIF A;  1T6B X;  3DBH I;  4YXD B;  2N0S B;  2D5G A;  4II2 B;  2LAS A;  4HPL B;  3Q8A A;  2K8B A;  1FFV A;  3AE4 B;  2KFK B;  5JZE B;  3KUZ A;  2HDE A;  1OEY A;  5D2M B;  4D2K A;  1B1Z A;  4RM9 A;  2WXO A;  4MSQ B;  4DWF A;  1WX9 A;  3DQV A;  4BOS C;  2L0F A;  3BZD B;  2IO0 B;  1V6E A;  4OVV A;  4K7W A;  4RGT A;  4IG7 B;  3Q3O C;  2EEL A;  4A3P A;  5E6P A;  1R4M I;  5C23 A;  3VXW A;  2L8J A;  5D94 A;  3TCA A;  1PQS A;  2GMI C;  1XQQ A;  4NAM A;  4HWI B;  1WSP A;  4I6L B;  2DEN B;  3APF A;  4NY0 A;  3IG3 A;  2JWZ A;  1D4B A;  2NVU I;  1T0Q C;  5JH5 C;  3SU8 X;  2JQR B;  1OQR A;  3HIZ A;  3IHP C;  1E6E B;  1YD8 U;  4S0R A;  4GDK A;  3D32 A;  4G0N B;  3WAM A;  4W9D A;  3LXF A;  5CHW A;  2O6V D;  2MJ3 A;  1MJD A;  1Z2M A;  2Y5C A;  2JU6 X;  2WWZ A;  2AL3 A;  4RMA A;  3VUW A;  3RD2 A;  3CIR B;  2DX5 B;  3A1Q B;  2LI5 A;  1FRD A;  2KX0 A;  3B2F A;  4DHJ B;  3LB8 C;  2KAJ A;  2WDR B;  2N1W A;  5G5H A;  4A3O A;  3B1L X;  2ONQ A;  2LD9 A;  1WR6 E;  3M3J A;  2G1E A;  1JWB D;  2DZM A;  3V3X A;  2K0P A;  3ABV B;  1N5W A;  2JYT A;  1WR1 A;  1VJK A;  2M1M A;  1MFW A;  1TKE A;  2J4X A;  3ZLZ A;  1AWD A;  1A5R A;  4BOZ B;  3B9J A;  5HHD G;  2NBW B;  3SFE B;  2WLB A;  4GU2 A;  4BVU C;  3PSE B;  3PRZ A;  3H7P B;  3W1S A;  5LLI A;  3MC8 A;  3ML9 A;  4MM3 B;  4MH8 A;  2L05 A;  4MJS B;  1CK1 A;  4R3D A;  4HJG E;  1P1A A;  4KV2 A;  2PVG C;  4ANU A;  3NVV A;  2K6Q A;  2IZV B;  5IOI A;  3H6N A;  3X0W A;  2KYW A;  5BMG A;  3TSS A;  1B9R A;  2YVC A;  1UNS A;  4BKS A;  4WWP A;  3Q3F A;  1L6U A;  3L16 A;  1SEB D;  1RFA A;  5T8I A;  1ACC A;  4CO7 A;  4MH0 E;  2JXT A;  4G3X B;  3BYT B;  3EA6 A;  3RNG C;  1IUE A;  2EKI A;  4C7Z A;  1SF0 A;  5DPS A;  2RD0 A;  3WCQ A;  2WP9 B;  3AEC B;  1C4C A;  3DWM A;  1SIJ A;  3Q3J A;  3PV1 A;  4IM2 A;  3MP9 A;  3T3N A;  2DYB A;  3I3T B;  3WAL A;  2CJO A;  3PRE A;  4IWQ A;  3KUC B;  4P7I A;  1J0G A;  3AE1 B;  2WDV B;  1IYF A;  3RCZ A;  2MSE D;  3RPF C;  2RR9 A;  4BAX A;  2H88 B;  5G5G A;  2V1Y A;  2WQY B;  2JPH A;  2RGF A;  1V8C A;  1YMH E;  2YEP F;  3GB1 A;  1UEL A;  2PVO D;  1PGX A;  2L00 B;  2JSV X;  3W1Y A;  2J52 A;  2GLS A;  1WE6 A;  4NJ6 A;  4KIK B;  1WGD A;  3B08 A;  3TBL D;  2PKO A;  4JPS A;  1E9M A;  4MGI E;  1HZ5 A;  3P2B A;  5TSS A;  1HTO A;  1KLG D;  2RPQ A;  2N7D A;  1YNT E;  4HKZ E;  2KO3 A;  2V3S A;  1GUA B;  4DHJ D;  3HK0 A;  5EE3 A;  2ZEQ A;  4M0W A;  3BYY B;  2WXL A;  3AEG B;  1TS3 A;  5E6O A;  1E10 A;  1EWC A;  5BYR A;  4C4V B;  2LUM A;  1F52 A;  3TJP A;  1NI3 A;  2ZCB A;  4HEA 1;  1XCT L;  1FRR A;  3R2T A;  4JQW C;  1LXD A;  2I1J A;  3BIN A;  1WE7 A;  3NVZ A;  1WGH A;  3RNB C;  2D3A A;  1WY8 A;  2WYQ A;  1J19 A;  1VR9 A;  1HE8 A;  2D07 B;  2QCZ A;  2MBO A;  1VDV A;  3BK1 A;  2LMC A;  4WWO A;  3C8Y A;  3SDL C;  3H1U A;  4JL9 A;  2DAJ A;  1LM8 B;  4FBJ B;  1F1H A;  5IKC M;  5E6J A;  1EF5 A;  3MJ5 A;  4W9H A;  1D5Z C;  2CHX A;  4JWS C;  1V86 A;  2AX5 A;  2X8X X;  1N6Z A;  4WUR A;  4C80 A;  1JWA D;  1T0R C;  3DBH B;  1AN8 A;  3KVF B;  2AWT A;  2BB6 A;  2KDE B;  3ZXR A;  3LJ3 A;  3WIM A;  4HLE A;  2WS3 B;  4RF1 A;  2KOX A;  2GOW A;  3Q8F A;  2KX3 A;  1Q0W B;  4L1B A;  3FAH A;  4FHK A;  1Z5S B;  2QSD A;  4YTP B;  2YLM A;  1K8R B;  3ZQ4 A;  2KWD A;  4F7Z A;  1UGJ A;  1E7V A;  2AQ2 B;  4NJC A;  3ZTC A;  2KMM A;  5KHQ A;  2BPS A;  3SD5 A;  3X23 A;  1R4M B;  3KUD B;  4ZYN A;  4X57 B;  2KJH B;  3Q8C A;  4KX6 B;  1FNV A;  2BW2 A;  2FAZ A;  1XLN A;  2W55 A;  3DPD A;  1FNU A;  1WI0 A;  2G45 B;  3ZNH B;  3JW0 X;  2VH2 A;  4FJZ A;  2IPK D;  1UUP A;  1ISN A;  2GI9 A;  3ZW3 A;  3WA0 A;  2FCQ A;  4HDO A;  4WJN A;  2DLB A;  2FCS A;  4ITK A;  4C56 C;  4KKI A;  3E9S A;  3O13 A;  1T0Y A;  3B0A A;  2RDH A;  3BVM A;  4N9F 4;  3N1Z C;  1JRP A;  1QOF A;  5FK9 C;  3U30 A;  2LGI A;  1ET9 A;  2V3N A;  1P98 A;  4KZ0 A;  1OQY A;  2K1F A;  3QIJ A;  3IXS A;  1QIL A;  2KTF A;  4OZA A;  4TUU A;  3PHW B;  2WU5 B;  3TEX A;  2V9H A;  3R7R A;  3VTU A;  5JHB A;  3GS2 A;  3JSV B;  1KLU D;  3DBL I;  1N60 A;  3A4R A;  3ZGZ A;  4DQO C;  4TQ0 A;  3ZJU A;  3CWI A;  2MA9 B;  3V6C B;  2K6D B;  4XZ4 A;  4RGM A;  3N1Y C;  1GB1 A;  3FIL B;  1WX8 A;  4LNO A;  1V1P B;  2L32 A;  3OLM D;  1MI0 A;  3EHV A;  1NBF C;  2Y3A A;  3JVZ X;  5D3I B;  3Q3N C;  2GBJ A;  1FFU A;  1EUV B;  1NI2 A;  3ZIM A;  2K25 A;  3WAP A;  1YN5 A;  2MBB B;  3SFD B;  4IM0 A;  2IYD B;  2QIL A;  2NTT A;  4MGY E;  1F9J A;  2DZI A;  3VRB B;  3EGR A;  4I6N B;  2WXK A;  1C9F A;  1WYW B;  4PT5 A;  2AL6 A;  1Q1O A;  4A55 A;  1TS4 A;  2WXP A;  1C79 A;  2LEK A;  4US8 A;  5D7G A;  2KQ7 A;  2PW9 A;  2BKR B;  2EMS A;  5AUK A;  1TS2 A;  1I4Q A;  4JX1 C;  3C0R B;  3A9J B;  1WZ0 A;  1XEE A;  4EE2 A;  3WAO A;  1ZDV A;  3HRD D;  5AZH A;  1JWM D;  2R2Q A;  3AV8 A;  4ZDV A;  1ZUD 2;  3K9P B;  3PVL A;  1QOG A;  4ZRP A;  4NAW B;  1CZP A;  2DYM A;  3JYU A;  2JF5 A;  4IW0 A;  1A70 A;  3Q14 C;  2WXM A;  2L3Z A;  3R8B A;  1IBX B;  2PEA A;  2KLG A;  2KFK A;  1KM7 A;  4M8N A;  4LDT B;  3TEY A;  2VRR B;  2FCN A;  3NVY A;  1SB3 C;  4B6W A;  5IO9 A;  3DBR I;  1L6V A;  4KSK C;  3PTF C;  4AUQ C;  4FHJ A;  3PPA A;  1J8C A;  2V4I B;  1WXA A;  2Z8L A;  2RMM A;  2G4D B;  3TL5 A;  5HI1 A;  3R2I A;  4MGK E;  2LUE A;  1N5X A;  2HE7 A;  2N9E B;  4LLG M;  3MHS D;  1DOX A;  3QQ8 B;  4DHZ E;  2PE6 B;  2K3U A;  1P0R A;  1KFY B;  2BYT A;  1LFD A;  4HPP A;  4MEM A;  3NRZ A;  3EEC A;  3ML8 A;  4BBN F;  3M63 B;  1D5M C;  1NEN B;  2K9X A;  2B76 B;  1PGB A;  2UWQ A;  3VRA B;  2NCN A;  2L7R A;  3QWZ B;  2XN9 C;  3NZ3 A;  2W9N A;  4OVZ A;  1VRA B;  1KOT A;  2N1V A;  4YSX B;  4M01 A;  2G9H D;  4J6I A;  1I4P A;  2PLP A;  2WDQ B;  3VH4 B;  4ZYS A;  3P4R B;  1WWT A;  2INC C;  1V81 A;  4W9C A;  2JRI B;  3AE6 B;  3RYT A;  2GB1 A;  3T8M A;  3AU4 A;  2FE8 A;  4EUT A;  5BYS A;  1UD7 A;  2W54 A;  2IGH A;  2I2Y A;  3CF6 E;  2NPT B;  1MHH E;  2LHE A;  3VHT C;  1FMA D;  4JIO U;  2W3S A;  2JX5 A;  3P63 A;  5CHV C;  4PS8 A;  1KTK A;  4KSL C;  4GIV A;  3UF8 A;  1P3Q U;  3KWV A;  1GJZ A;  3AXC A;  1JRU A;  4ARI A;  2LGX A;  3B2G A;  4NJ7 A;  1ZOY B;  4K1R B;  1WF9 A;  2ZCC A;  3ZJV A;  2JZ3 B;  2HTM E;  3RZF A;  2DHZ A;  1FXI A;  1ROE A;  3TEW A;  1NYR A;  1KH0 A;  1WXM A;  3TMP B;  5EDS A;  1NYQ A;  2OJW A;  2Z0E B;  1IGC A;  4P6V F;  4FJY A;  3KLS X;  4K7U A;  2V3P A;  4USA A;  2C7N B;  2WU2 B;  2N9L A;  4WAA A;  4LDT D;  1KJT A;  4F8C B;  2KWC A;  2ACZ B;  2KVZ A;  3EC8 A;  4AWJ A;  1XT9 B;  3ZRF A;  2N7J A;  5FR6 A;  3U2S C;  3PGE A;  3EFC A;  3L4P A;  1L5P A;  4DK5 A;  1FCC C;  4B0E A;  4EFO A;  2MRP A;  3W1S C;  1I42 A;  1OGW A;  2JWU A;  3ZDM C;  4L23 A;  2MP2 A;  3VR8 B;  2KMA A;  3QA8 A;  4DXF A;  2AEH A;  4ARC A;  2FUH B;  2J0J A;  3APC A;  3PS6 A;  3AEB B;  1QLB B;  3PLU A;  4HCP B;  2M4N A;  3EFU A;  5G2N A;  3VQI A;  4NQK E;  2C5L C;  3P1M A;  1QT9 A;  4XX5 A;  4W9J A;  1WXQ A;  3LYY A;  2KZR A;  2JYE A;  2NBU A;  4XDD A;  3MJW A;  1WGK A;  3DBL B;  2D3B A;  3BY4 B;  5KHO A;  1IP9 A;  1P9D U;  2BGF A;  3DOW A;  4ZHP A;  1FPY A;  2KDB A;  1IPG A;  3V05 A;  4K3C A;  1P7E A;  3I9V 1;  4UDU C;  1T0S C;  4E71 A;  3UI3 A;  1GC6 A;  1V5O A;  1WGY A;  2DBY A;  2CR5 A;  3S2A A;  2AQ1 B;  4W9F A;  3BVG A;  1OTR B;  3VH3 B;  3GP7 A;  3IT4 B;  1XF5 L;  2JZZ A;  2WXI A;  4B95 A;  1S1Q B;  2K5P A;  4NNJ B;  2BBC A;  2KLC A;  1E7P B;  2BS4 B;  1WGR A;  1WMH A;  3L08 A;  3Q6B A;  5BMH A;  1I4H A;  5JHA A;  1XO3 A;  4YSY B;  1LO5 D;  2IGG A;  3EUB 2;  2J7Q B;  4O1N A;  3A33 B;  3SHQ A;  3ZNG C;  1EU4 A;  1RM6 C;  3AN1 A;  2LWP A;  2IO2 B;  3RNF C;  1VD2 A;  3URY A;  2BT6 A;  5J18 A;  4KGT A;  2FNJ B;  1JRO A;  4XYC A;  1GB4 A;  4ICU A;  3NS1 A;  2LRW A;  4ACF A;  4CQN A;  2INN E;  1ZW7 A;  4HKQ A;  4I6P A;  3KW5 B;  2MEK A;  1TBE A;  1YQ3 B;  1ZDX A;  3SEB A;  1BXT A;  3R66 C;  2NR2 A;  3DBR B;  1L4Z B;  2KN5 A;  1N63 A;  2XK5 A;  4JLC A;  2VH1 A;  4KGS A;  2M19 A;  4WQM A;  2LXC A;  4II3 B;  2ZZP B;  5DPW A;  2KJR A;  2L1A A;  3PRM B;  1FD6 A;  3AU5 A;  2QIE B;  1C1Y B;  3HUI A;  1F2R I;  2DWQ A;  1MPE A;  3O65 B;  1EO6 A;  4FUL A;  2JUO A;  4GGQ A;  1RWS A;  3UQB A;  1SE3 A;  1F0Z A;  5BMI A;  1HEZ E;  4ICV A;  2IY0 B;  2ICI A;  2Q5W D;  1EU3 A;  3H8H A;  1XLP A;  1TZ1 A;  1IGD A;  4MT5 A;  3DVG Y;  1CMX B;  4LCD E;  1K51 A;  2WNM A;  1J7B A;  5E6N A;  2I1K A;  2I38 A;  2ZW1 A;  4EKU A;  3MC9 A;  2KTR A;  4RH6 A;  2RDB C;  4M02 A;  4F1S A;  2GBN A;  1YX6 B;  3NS8 A;  2V4L A;  2D3C A;  3ALB A;  5G55 A;  1UBI A;  1ZPS A;  3DVG X;  3A9K B;  2D2Q A;  3QCA A;  2N9X A;  4DXG A;  4GDL A;  3ZVV A;  3T9L A;  4EZJ A;  4PS3 A;  3N32 A;  4W9G A;  2IO1 B;  2KN4 A;  1KRH A;  4N58 A;  2QJL A;  2WDT B;  4B0M A;  1WZ3 A;  2PJH A;  4ANX A;  4AJY B;  2KK8 A;  5IAA C;  5TR5 A;  3ZKJ C;  2JRH A;  1EWY C;  4A6Q A;  3TIX A;  2PPH A;  4N59 A;  1GPX A;  1WJ4 A;  4WJO A;  4OVU A;  4FA6 A;  2ZJD A;  4XGA B;  1V1P A;  5DPT A;  4IKG A;  4BKG A;  3PZD A;  5EE0 A;  2ZPY A;  2C60 A;  4FXC A;  1YIW A;  3C19 A;  4ZOH C;  1DGJ A;  2B3A A;  4WWM A;  3QC8 B;  4NPN A;  2NMQ A;  4EZL A;  1ZXI A;  4J3O D;  4MEL A;  1MG8 A;  2J0M A;  1V1O A;  3DCG A;  1CJE A;  1E5W A;  4FJV B;  2DYO A;  2WX0 A;  4AP4 C;  4HXD A;  1ZE3 D;  4GN1 A;  3PO0 A;  2KQ4 X;  3PHX B;  1TY2 A;  4FN2 A;  3VTV A;  1SJE D;  3I5J C;  2GBK A;  3V61 A;  4YTM B;  5CTR C;  3NG0 A;  4PK1 A;  2V0G A;  1FEH A;  2X38 A;  5C3J B;  1I4R A;  3AED B;  3IBE A;  4EEW A;  2N7E A;  2O6V A;  1V97 A;  4OZC A;  3KWL A;  2MQJ A;  2WX1 A;  2KFJ A;  5AUI A;  3IT6 B;  4TSS A;  1HA5 A;  4A8X C;  3P4P B;  2MBE A;  2WXQ A;  3ZTD A;  2BVC A;  2DZK A;  1T5X D;  3N30 A;  4WWN A;  2IJ0 A;  1VZ7 A;  3UQA A;  5J17 A;  4K81 A;  3ECI A;  4HCN B;  4G50 A;  4TQ1 A;  4RCO A;  1FM0 D;  1FO4 A;  3VAW A;  1SBB B;  2HD5 B;  4E74 A;  3KYC D;  1UH6 A;  4AOF A;  3GOE A;  2K8C A;  2QC8 A;  3VR9 B;  4CHK A;  3NZS A;  3AE7 B;  2PIA A;  3RT3 B;  1TKY A;  1WX7 A;  3AM9 A;  5LNK 1;  1GOZ A;  1SE2 A;  2KC1 A;  4E3C A;  2SAK A;  4EOY A;  4HJK A;  4ZHO A;  1SE9 A;  2E3T A;  3PT2 B;  2VZK B;  1H4R A;  3V60 A;  5I4D A;  3BWU D;  2YEP B;  2QDF A;  3UIP B;  3Q3M C;  2KQS A;  2C7H A;  1TGZ B;  3UGB B;  1YQ4 B;  1OFF A;  2N4F A;  2XNA C;  2JZP A;  2NBV B;  1L7Y A;  1UWM A;  2HTH A;  4LJO B;  2ZPN A;  2MBH A;  2BB5 A;  3HVD A;  3KYD D;  4PYZ A;  2A5U A;  2NTS A;  2LJI A;  1ENF A;  4K3B A;  4EZK A;  2J42 A;  3ZRC A;  1F2R C;  4WAF A;  4HVB A;  2KMC A;  4MAC A;  4OHJ A;  3L13 A;  4A9A A;  3HHM A;  1AYF A;  1QOB A;  2L0T A;  4JE3 B;  4LNK A;  4RF0 A;  3VTW A;  5HG2 A;  3R7Q A;  3GE8 C;  2WXG A;  5D6J B;  2RSU A;  5MPO A;  2M0X A;  3AE9 B;  3QAQ A;  3T3O A;  3MC0 B;  2WXJ A;  4W9L A;  1JML A;  3VDZ A;  1QF6 A;  3L54 A;  2EMT A;  2JY6 A;  3J9C A;  3OJ3 A;  2RDG A;  2GBM A;  2CHZ A;  2Z59 B;  4JGH B;  2OHF A;  3FKY A;  1WYG A;  4YWG G;  1ESF A;  3U7D A;  4HK2 A;  4RM8 A;  4W9I A;  2FUG 1;  5CHF A;  4Q2J A;  3V62 A;  2L83 A;  4IC7 B;  2EKE C;  4ANW A;  3Q8B A;  1JWU D;  1XLQ A;  3VUX A;  1RYJ A;  2GRI A;  2O2V B;  1E8X A;  2ZVN A;  4GLS C;  4NZL B;  1TJE A;  1GNU A;  1C3T A;  3RUL A;  3A1Q A;  3RNE C;  4M00 A;  5BYQ A;  5FKA C;  3V6E B;  2IY1 B;  2RPV A;  3N1X C;  4WJP A;  1TT5 B;  3IAM 1;  1MG4 A;  1T3Q A;  3RN9 C;  1R7S A;  2G4S A;  1X1M A;  5LXH A;  3DVN U;  2M17 A;  4DBG A;  3N3K B;  2H89 B;  4BKT A;  1JQ4 A;  3OAW A;  4REZ A;  2KHW B;  3NZU A;  1HTQ A;  2IBI B;  1L0Y B;  1ZXH A;  2JVC A;  5AZG A;  4KDL B;  5EE9 A;  1FIQ A;  1N62 A;  1WJ6 A;  1AAR A;  1TKG A;  3GZN I;  1TIF A;  4ANV A;  1FNW A;  1PUT A;  2MBQ A;  3IFW B;  2BYF A;  1C78 A;  3H7P A;  1JWS D;  1QKZ A;  1KF6 B;  1GC7 A;  1ZKH A;  4MM3 A;  1FXT B;  4MJS A;  3KQ4 A;  3HVZ A;  1L0V B;  1WRI A;  4WJQ A;  1Q5W B;  2CHW A;  3U52 E;  2CU1 A;  2VZK D;  1C4A A;  4XWW A;  4P1B C;  1D6E C;  1Y56 A;  1PDX A;  4OZB A;  1V49 A;  2BS3 B;  3H9D A;  2BYE A;  1H8C A;  1XXG A;  2D3G A;  3GE3 C;  1E8Z A;  2N9K A;  2WXR A;  3P4S B;  4YL8 A;  2WGS A;  1MVK A;  4C7Y A;  2MX2 A;  3PZ8 A;  1C4P A;  4IWO A;  1M4V A;  2CKH B;  4US9 A;  2KNB A;  2N9P C;  2W82 A;  3HM6 X;  3OJ4 B;  1WM3 A;  1J7A A;  4G11 A;  4YT0 B;  4GSW A;  3DHH C;  4LJP B;  1OEY J;  1L2N A;  1TY0 A;  1NEK B;  2XBB C;  4GDK B;  1K52 A;  2HJ1 A;  1XD3 B;  2G3Q B;  3MHZ A;  2KDI A;  2BWE S;  1F77 A;  3IVF A;  3TUO A;  1WRD B;  1WXS A;  2PMV A;  5IN7 A;  2IDY A;  3QHT A;  4KIK A;  4TMA B;  1EM7 A;  1N61 A;  3AE8 B;  1SE4 A;  1HXY D;  4LNI A;  2FIF A;  2KT7 A;  2LGY A;  2LHD A;  4ZRK A;  4BBN C;  1AW7 A;  1D3Z A;  2IGD A;  2KJ6 A;  2ZVO A;  1I4X A;  2REX A;  3Q2A C;  4BZA A;  3NVW A;  2Y5P A;  1R4N I;  2D10 A;  1KLV A;  5CX3 A;  3Q69 A;  5JXV A;  1PFD A;  1E8W A;  1UZX B;  1WM2 A;  4W9E A;  1V2Y A;  1BT0 A;  2BF8 B;  4BFR A;  3UIN B;  3M62 B;  4C4V A;  1C77 A;  2FCM A;  2AYO B;  2MP2 B;  3FC4 A;  2KDF B;  1NDD A;  1DYQ A;  4YTN B;  3CST A;  4ASW C;  1STE A;  5IA7 A;  3AEF B;  2MHJ A;  5IP4 D;  2CJN A;  4QAY A;  3W5U B;  3U7Z A;  4XE0 A;  1G6J A;  1RLF A;  4RGN A;  2ZNV C;  3NJT A;  2R2O A;  5J2R A;  2LZ6 A;  1Y8R C;  5H92 C;  3BK2 A;  5L95 C;  5LXI B;  2PTL A;  2MLB A;  4IUM B;  1WXV A;  3AMZ A;  3DBS A;  3RNC C;  2QMT A;  2ASQ A;  3E56 A;  2UYZ B;  2C9W B;  4AS1 A;  4K7S A;  3AEA B;  2M0A A;  2FBW B;  1WJN A;  1JW9 D;  2Y5B B;  1YJJ A;  3RMK C;  4DDI D;  2MW5 A;  1JCK B;  4WH4 A;  3RI7 C;  5D3D A;  1SSN A;  1TTN A;  1WFY A;  1WIA A;  3LDZ E;  4M8M A;  3ZXV A;  1ZP0 B;  4FAD A;  3I63 C;  1QZE A;  1VZ8 A;  4KZC A;  3Q8E A;  2LVO A;  2M8S A;  2KKC A;  3ZUN A;  3BVZ A;  1DOI A;  5H8Y E;  3RZW C;  1BML C;  2J0K A;  1ET6 A;  4CYE A;  4GMV A;  4URK A;  1DOY A;  1RFK A;  4KGR A;  1M94 A;  2ZW0 A;  4RFB A;  3AUL A;  3A9K A;  3MFG A;  3BII D;  1WMH B;  1E0Z A;  3ZO5 B;  4AJW A;  5AZF A;  4LTU A;  3APD A;  4HRO A;  5L83 A;  2INP E;  2WHI A;  4IOI E;  1P7F A;  2LVP A;  3N20 C;  3OG5 A;  3P4Q B;  3L17 A;  1S3S G;  4P1C C;  4IM3 A;  1V9J A;  2ZNV B;  2K8H A;  4A20 A;  4GB9 A;  1ZGU B;  2LRU A;  2BWF A;  3MTN B;  2SEB D;  3ZNZ B;  2UU7 A;  3QK0 A;  3PRP B;  4TKN A;  4M0W B;  4LK0 M;  3L0W B;  5DPR A;  1YN4 A;  1UBQ A;  1V80 A;  2BTE A;  5C2T B;  2M56 B;  2D11 A;  4C00 A;  3P42 A;  1Q10 A;  3VUY A;  4GXB A;  4P16 A;  2WXN A;  1SXT A;  3AI5 A;  3JSV A;  1I35 A;  4LNN A;  2WXH A;  4KDI C;  1YN3 A;  1L0X B;  4HDQ A;  1YJ1 A;  3R3M A;  2BQQ A;  2XK5 B;  3K9O B;  3AH7 A;  5GMV A;  3DWG C;  1E90 A;  4PS7 A;  3AE2 B;  1YX5 B;  2DNF A;  2JXX A;  5HKH A;  2GBR A;  3FIL A;  2L76 A;  3H7S A;  4NQL B;  2QHO A;  4TV3 A;  2XEW A;  3QAR A;  1C76 A;  1U4A A;  2W3R A;  4XC2 A;  1RAX A;  3HM3 A;  2BS2 B;  2BKF A;  4HRS A;  2R61 A;  3ZJT A;  3DHI C;  2CS4 A;  3ZDT A;  2C7M B;  1EF1 A;  2ON8 A;  3GZN B;  3IAS 1;  4BKS D;  4XDC A;  3W2D A;  4RGO S;  2KDM A;  4IDI A;  3TEZ A;  1WJU A;  4B9K A;  4IWP A;  3DDC B;  4N6E B;  4A90 A;  4AQ7 A;  2OOB B;  5GXG B;  2DZJ A;  1FCL A;  1FXA A;  1MHX A;  3ZNI D;  3PZ7 A;  2IND C;  2KTR B;  2KAN A;  4KVG B;  1SJH D;  5C1Z A;  3A9J A;  1YOV B;  3VFK A;  4DHZ B;  1UWX A;  4FLH A;  2MCN B;  2JT4 B;  4XWT A;  4GDL B;  3ONS A;  2BYV E;  2KAC A;  2MH7 A;  1PGA A;  1K50 A;  1V5T A;  1E8Y A;  3N9Y C;  4LNF A;  4NAW A;  1HZ6 A;  4ZRJ A;  1RRB A;  3NOB A;  2HJ8 A;  3L10 B;  4H2A A;  5FR3 A;  4MDK E;  1HQR D;  4PYU A;  3U4E G;  5DCN A;  1IBX A;  5AEK B;  3NHE B;  4ZRQ A;  4DDG D;  1LGR A;  3SR6 A;  4WIP A;  3W5V B;  2A4Z A;  1I7H A;  2WXF A;  2KD0 A;  3AE3 B;  1K53 A;  2FID A;  1L4D B;  2TSS A;  2KWV B; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  5BYQ A;  1D5Z C;  5FKA C;  4JWS C;  2RPV A;  2AX5 A;  4ZHP A;  4WUR A;  4C80 A;  1JWA D;  2MJE A;  1BUI C;  3IAM 1;  1VLB A;  3V05 A;  2AQ3 B;  1AN8 A;  1P7E A;  1TZO A;  3I9V 1;  4UDU C;  4RNA A;  1T3Q A;  2BB6 A;  1D5X C;  2LFI A;  1R7S A;  3AE5 B;  2WS3 B;  3UI3 A;  4RF1 A;  1OQQ A;  3Q8F A;  4L1B A;  2H89 B;  2DBY A;  3FAH A;  2AQ1 B;  2QSD A;  1JQ4 A;  2MJD A;  3RFZ B;  3BVG A;  4REZ A;  4L2Y A;  4YTP B;  3GP7 A;  3IT4 B;  1XCQ L;  1XF5 L;  3ZQ4 A;  2KWD A;  1L0Y B;  2K22 A;  1UGJ A;  1ZXH A;  2WXI A;  5EE9 A;  1FIQ A;  2OED A;  1N62 A;  1TKG A;  1PYW D;  2AQ2 B;  4NJC A;  2K5P A;  2KMM A;  4JWU C;  1FNW A;  1PUT A;  2BBC A;  2L52 A;  1E7P B;  1C78 A;  4OW0 A;  1JWS D;  2BS4 B;  1QKZ A;  5BMH A;  1I4H A;  1KF6 B;  1GAQ B;  1XO3 A;  4YSY B;  1LO5 D;  1I4G A;  3Q8C A;  2IGG A;  3EUB 2;  4KX6 B;  1FNV A;  2BW2 A;  2V0G A;  1XLN A;  3KQ4 A;  2W55 A;  3HVZ A;  1L0V B;  4O1N A;  1FNU A;  1WRI A;  2CU3 A;  3I57 A;  2QEJ C;  3ETR A;  3U52 E;  2VZK D;  1C4A A;  4XWW A;  1EU4 A;  1RM6 C;  2IPK D;  3AN1 A;  1UUP A;  4KKJ A;  1D6E C;  1Y56 A;  2GI9 A;  3AEE B;  1XLO A;  3URY A;  2BT6 A;  2DLB A;  1PDX A;  4ITK A;  4OZB A;  4KKI A;  4C56 C;  2BS3 B;  3E9S A;  3O13 A;  4KGT A;  1J7C A;  5HFY A;  2J53 A;  1JRO A;  1XXG A;  2RDH A;  1GB4 A;  3BVM A;  4YSZ B;  3NS1 A;  2N9K A;  3NUH B;  1JRP A;  1TS5 A;  1VZ6 A;  1QOF A;  5FK9 C;  2WXR A;  3P4S B;  3ZYY X;  2LGI A;  1ET9 A;  2V3N A;  1NVI D;  4CQN A;  1MVK A;  2INN E;  3AB5 A;  4C7Y A;  3IXS A;  3PZ8 A;  1C4P A;  1QIL A;  4HKQ A;  1QOA A;  1CQV A;  4OZA A;  1M4V A;  4US9 A;  1QQR A;  1TYG B;  2MEK A;  2W82 A;  2WU5 B;  3W9C B;  3TEX A;  2E6X A;  1J7A A;  4YT0 B;  1YQ3 B;  1ZDX A;  3GS2 A;  3SEB A;  1BXT A;  1KLU D;  5EE1 A;  1YJI A;  3ZGZ A;  1N60 A;  3OWE B;  4DQO C;  1L4Z B;  1TY0 A;  4TQ0 A;  1NEK B;  1JAL A;  1N63 A;  4GDK B;  3ZJU A;  3CWI A;  1K52 A;  1T6B X;  4YXD B;  4KGS A;  2M19 A;  4WQM A;  2N0S B;  2D5G A;  3MHZ A;  2L1A A;  3Q8A A;  4RGM A;  1F77 A;  1GB1 A;  1FFV A;  3FIL B;  3AE4 B;  1FD6 A;  1V1P B;  3TUO A;  2L32 A;  2HDE A;  1MI0 A;  2QIE B;  3HUI A;  1F2R I;  2Y3A A;  4D2K A;  1B1Z A;  5D3I B;  2DWQ A;  1MPE A;  1FFU A;  2WXO A;  2PMV A;  2IDY A;  1RWS A;  1SE3 A;  1F0Z A;  1YN5 A;  4TMA B;  5BMI A;  3BZD B;  3SFD B;  1EM7 A;  1N61 A;  1HEZ E;  3AE8 B;  1SE4 A;  2QIL A;  2NTT A;  2ICI A;  1HXY D;  2Q5W D;  3VRB B;  4RGT A;  3EGR A;  1EU3 A;  2EEL A;  3H8H A;  1XLP A;  2WXK A;  2LHD A;  1AW7 A;  1C9F A;  2IGD A;  1I4X A;  4PT5 A;  1IGD A;  4NAM A;  4MT5 A;  4A55 A;  1TS4 A;  1K51 A;  1C79 A;  2LEK A;  2WXP A;  3NVW A;  4US8 A;  2WNM A;  2Y5P A;  1J7B A;  1WSP A;  5D7G A;  2PW9 A;  2I38 A;  2ZW1 A;  3Q69 A;  5JXV A;  1PFD A;  4RH6 A;  5AUK A;  1TS2 A;  1I4Q A;  4JX1 C;  1D4B A;  1C77 A;  1XEE A;  1ZPS A;  4EE2 A;  4DXG A;  3FC4 A;  1ZDV A;  1DYQ A;  3HRD D;  4YTN B;  1JWM D;  3AV8 A;  1STE A;  3AEF B;  2KN4 A;  2JQR B;  1OQR A;  2CJN A;  1ZUD 2;  1KRH A;  4N58 A;  1QOG A;  2QJL A;  1E6E B;  4ZRP A;  4B0M A;  4NAW B;  3W5U B;  3U7Z A;  1CZP A;  2DYM A;  4XE0 A;  3LXF A;  1A70 A;  4RGN A;  1EWY C;  2WXM A;  2MJ3 A;  4A6Q A;  5H92 C;  3BK2 A;  4N59 A;  2PTL A;  2JU6 X;  2Y5C A;  3R8B A;  1GPX A;  1IBX B;  1V1P A;  4IKG A;  3TEY A;  3AMZ A;  3NVY A;  1SB3 C;  5EE0 A;  2QMT A;  1L6V A;  3E56 A;  4FXC A;  3CIR B;  4AS1 A;  1FRD A;  2V4I B;  2Z8L A;  3B2F A;  3AEA B;  2M0A A;  2FBW B;  3LB8 C;  1DGJ A;  1JW9 D;  2RMM A;  1YJJ A;  4ZOH C;  2KAJ A;  2WDR B;  4WWM A;  1JCK B;  5G5H A;  5HI1 A;  3R2I A;  2ONQ A;  4WH4 A;  2NMQ A;  1ZXI A;  5D3D A;  1N5X A;  2G1E A;  4J3O D;  1JWB D;  1SSN A;  4LLG M;  3V3X A;  1V1O A;  2K0P A;  3ABV B;  1DOX A;  1CJE A;  1ZP0 B;  1N5W A;  2JYT A;  2DYO A;  1VZ8 A;  2K3U A;  1KFY B;  2BYT A;  1VJK A;  3Q8E A;  1ZE3 D;  3NRZ A;  3BVZ A;  1DOI A;  1TKE A;  2KQ4 X;  2J4X A;  3PO0 A;  1TY2 A;  1AWD A;  5H8Y E;  1D5M C;  1NEN B;  2K9X A;  1BML C;  1ET6 A;  2B76 B;  1PGB A;  3VRA B;  1SJE D;  4YTM B;  3B9J A;  5HHD G;  1DOY A;  1RFK A;  4KGR A;  3SFE B;  2XN9 C;  3NZ3 A;  4OVZ A;  2WLB A;  1FEH A;  1VRA B;  2X38 A;  1I4R A;  2ZW0 A;  3AED B;  4RFB A;  5C3J B;  1V97 A;  4YSX B;  4OZC A;  3KWL A;  2G9H D;  3MFG A;  3BII D;  3W1S A;  1E0Z A;  4LTU A;  1I4P A;  5AUI A;  4MM3 B;  3IT6 B;  4HRO A;  4TSS A;  2INP E;  1HA5 A;  4A8X C;  3P4P B;  2PLP A;  2WDQ B;  2WXQ A;  4MH8 A;  4IOI E;  1P7F A;  1CK1 A;  4R3D A;  4HJG E;  4ZYS A;  2PVG C;  3P4R B;  1WWT A;  1T5X D;  3NVV A;  3AE6 B;  3P4Q B;  3TSS A;  5BMG A;  2GB1 A;  2IJ0 A;  1VZ7 A;  1B9R A;  1UNS A;  2FE8 A;  4TQ1 A;  4RCO A;  1FM0 D;  1L6U A;  1FO4 A;  5BYS A;  1SBB B;  1SEB D;  2SEB D;  2W54 A;  5T8I A;  1ACC A;  2IGH A;  2JXT A;  2I2Y A;  4LK0 M;  3BYT B;  3EA6 A;  3VR9 B;  1MHH E;  1YN4 A;  2LHE A;  1IUE A;  2EKI A;  3AE7 B;  1FMA D;  4C7Z A;  2BTE A;  1SF0 A;  2W3S A;  2JX5 A;  5C2T B;  2M56 B;  2PIA A;  3P63 A;  3WCQ A;  2WP9 B;  3P42 A;  1Q10 A;  1KTK A;  3AEC B;  1C4C A;  3DWM A;  1TKY A;  3AM9 A;  1SIJ A;  4P16 A;  5LNK 1;  2WXN A;  1SXT A;  3KWV A;  3MP9 A;  1GOZ A;  1SE2 A;  3T3N A;  2WXH A;  4ARI A;  1YN3 A;  2SAK A;  1L0X B;  3B2G A;  2CJO A;  4ZHO A;  3AH7 A;  3AE1 B;  2E3T A;  1ZOY B;  2WDV B;  3DWG C;  3RPF C;  2VZK B;  3AE2 B;  3ZJV A;  3FIL A;  5I4D A;  3BWU D;  2YEP B;  2HTM E;  4XDD A;  2H88 B;  5G5G A;  1FXI A;  1ROE A;  2WQY B;  3TEW A;  1NYR A;  1YQ4 B;  1OFF A;  1V8C A;  1YMH E;  2YEP F;  3GB1 A;  1KH0 A;  2XNA C;  1C76 A;  2W3R A;  2PVO D;  1PGX A;  2BS2 B;  1NYQ A;  2JSV X;  2JZP A;  4HRS A;  2J52 A;  1UWM A;  2R61 A;  1IGC A;  4P6V F;  3KLS X;  3ZJT A;  2V3P A;  4USA A;  2BB5 A;  2WU2 B;  3HVD A;  2N9L A;  2NTS A;  2ON8 A;  2PKO A;  3IAS 1;  4XDC A;  2LJI A;  1ENF A;  3W2D A;  4RGO S;  4JPS A;  2J42 A;  2KDM A;  1E9M A;  1HZ5 A;  1F2R C;  2ACZ B;  4IDI A;  1KLG D;  4WAF A;  5TSS A;  3TEZ A;  1YNT E;  4HKZ E;  4MAC A;  2N7J A;  4OHJ A;  4N6E B;  3U2S C;  4A90 A;  4AQ7 A;  4A9A A;  5EE3 A;  1AYF A;  4M0W A;  3BYY B;  2WXL A;  5GXG B;  3AEG B;  1QOB A;  1FCL A;  1TS3 A;  3L4P A;  1FXA A;  1MHX A;  4JE3 B;  1E10 A;  3PZ7 A;  1L5P A;  1EWC A;  1FCC C;  4RF0 A;  4B0E A;  5HG2 A;  5BYR A;  2WXG A;  5MPO A;  3AE9 B;  1SJH D;  3T3O A;  2LUM A;  3MC0 B;  2WXJ A;  2JWU A;  1JML A;  1UWX A;  1QF6 A;  1NI3 A;  4L23 A;  4HEA 1;  1XCT L;  4XWT A;  3VR8 B;  1FRR A;  3R2T A;  4GDL B;  3J9C A;  2KAC A;  2MH7 A;  4DXF A;  1PGA A;  4ARC A;  1K50 A;  2RDG A;  3NVZ A;  3N9Y C;  1HZ6 A;  2OHF A;  1WYG A;  4YWG G;  3AEB B;  1QLB B;  1ESF A;  1VR9 A;  3VQI A;  2FUG 1;  4H2A A;  1VDV A;  4Q2J A;  3BK1 A;  5FR3 A;  1HQR D;  2L83 A;  3U4E G;  3P1M A;  1IBX A;  3Q8B A;  1QT9 A;  1JWU D;  1XLQ A;  2LMC A;  4ZRQ A;  1RYJ A;  3C8Y A;  2GRI A;  1WXQ A;  3LYY A;  4WIP A;  3SR6 A;  3W5V B;  1I7H A;  2WXF A;  2JYE A;  4GLS C;  4NZL B;  1TJE A;  3AE3 B;  1K53 A;  5E6J A;  1L4D B;  1WGK A;  2TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...