1XO3A

Solution structure of ubiquitin like protein from mus musculus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2900073H19
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xo3A00
1L6VA 1PDXA 2QIEB 3NRZA 4C7ZA 2BT6A 2WDQB 2QJLA 1WGKA 3AB5A 3AECB 3CWIA 3SFDB 1ROEA 1N5WA 2WDVB 4N6EB 1KFYB 5EE0A 1GAQB 1QLBB 4C7YA 5EE9A 1N61A 3AE2B 4C80A 3AM9A 3P63A 3RPFC 3NVZA 3EUB2 2W3SA 3HVZA 2W54A 1FXIA 2EKIA 1A70A 3BIID 1AWDA 2L83A 3AE9B 3AEDB 1DOXA 1JRPA 1SF0A 2CJNA 2KMMA 2MJEA 2MJDA 1N60A 2K9XA 1DOIA 2W55A 4YSYB 2H88B 1E6EB 1GPXA 2WP9B 1FFUA 4ZHPA 1J7BA 4YTNB 1ZP0B 3AMZA 3W9CB 2LEKA 4HROA 1QF6A 3LXFA 5C2TB 1B9RA 3P4RB 1OQQA 3AE8B 3NVVA 4A9AA 1WRIA 1FM0D 1FO4A 1F0ZA 4HRSA 3AH7A 1JWAD 1VJKA 1YQ4B 1L5PA 3VRAB 1V8CA 3WCQA 3VR9B 1FRRA 4KX6B 3B2FA 2AX5A 5GXGB 1DOYA 3AE3B 4P6VF 3CIRB 1N62A 5EE3A 1SB3C 4YTPB 3FC4A 4YXDB 5MPOA 2CU3A 3FAHA 1NYQA 3HRDD 1ZUD2 1R7SA 3P4SB 3AEBB 1J7AA 2WU2B 5G5HA 1N63A 1QT9A 2OHFA 2PVOD 3ETRA 1XLQA 4LTUA 5EE1A 2BS2B 1PUTA 1N5XA 1UWMA 1IUEA 1RM6C 4YSZB 1SIJA 1CZPA 5G5GA 4YSXB 3NS1A 2K22A 4ZHOA 3SR6A 1FRDA 1KF6B 2WDRB 2BS4B 2KAJA 5AUIA 1V97A 1VDVA 3AE5B 1TKGA 3AEGB 1NVID 2HTME 1J7CA 1VLBA 2M19A 3KWLA 1ZXIA 2PKOA 1OFFA 3NVWA 1TJEA 4FXCA 4N59A 4YT0B 1OQRA 3NVYA 1E0ZA 2ACZB 4JWUC 3ZYYX 1FIQA 1E7PB 2CJOA 1FMAD 2M56B 1NENB 2FBWB 1QOGA 2E3TA 1JALA 2W3RA 1T3QA 1TKYA 2WU5B 1YJIA 2PVGC 1EWYC 1PFDA 1XLNA 3PO0A 5H92C 3VRBB 2G1EA 3VR8B 2L52A 3SFEB 5C3JB 1I7HA 1TKEA 3AE4B 1QOBA 1WYGA 2WLBA 1CJEA 1JW9D 4US8A 1JQ4A 3AEFB 1JWBD 1QOFA 3HUIA 4US9A 2PIAA 3DWGC 2N0SB 4JWSC 1KRHA 3AE1B 1E9MA 4ITKA 3LB8C 1XO3A 1YQ3B 2B76B 2Y5CA 3P1MA 5AUKA 3W5UB 2WS3B 3AE6B 2JX5A 2JQRB 3P4PB 1TYGB 3L4PA 1RYJA 1XLOA 1YJJA 1RWSA 2DWQA 3AEEB 1NEKB 1FXAA 3AEAB 3P4QB 1E10A 2BS3B 1AYFA 2DBYA 3B2GA 4USAA 4JX1C 2WQYB 1NI3A 2Q5WD 3B9JA 3DWMA 2MJ3A 1DGJA 1ZOYB 3AV8A 1NYRA 1WXQA 4N58A 3AN1A 4WQMA 2K5PA 2MH7A 3ABVB 4WWMA 1QOAA 1L0VB 1L6UA 4YTMB 3AE7B 1RFKA 1JROA 1FFVA 4ZOHC 3W5VB 1XLPA 2H89B 4IDIA 5H8YE 1WWTA
chains in the Genus database with same CATH superfamily
1R4NB 2KQ4X 2WXLA 2V4IB 4M01A 4N6EB 5EE0A 1F77A 1GAQB 4FN2A 2GBMA 1M94A 2MSED 3NVZA 3TMPB 3DBHB 2IO1B 1I4PA 5TSSA 1XT9B 3Q14C 3IT4B 4EE2A 3NZUA 4HVBA 3U2SC 2KN4A 3NVVA 3AE8B 2FIDA 1XD3B 2ZNVC 4JE3B 2LVQA 2UYZB 2DYMA 4JQWC 4L23A 1LM8B 3VR9B 1SSNA 4NY0A 5E6NA 3RULA 3QQ8B 2D3AA 4S0RA 4ZYNA 4XX5A 4KIKB 1CK1A 1EM7A 1XQQA 3R7QA 3T3OA 1UUPA 1WGHA 4MELA 2KHWB 3HHMA 2YEPB 5G5GA 4BKSA 1KF6B 2D3GA 4AOFA 2M19A 1SBBB 2AYOB 3ONSA 1C78A 2L05A 5E6OA 3NVWA 3ZXRA 4DDGD 2WWZA 1IGCA 2KANA 2HDEA 2KXJA 5DPWA 4YL8A 3HIZA 1NENB 1ZDVA 1YJIA 3PTFC 1WM2A 3VR8B 3ZLZA 4LLGM 5C3JB 3RZWC 3HM6X 3NY5A 1JWUD 4AP4C 4DWFA 4ITKA 1H8CA 5T8IA 1KJTA 2JX5A 4XGAB 2KFKA 3CMMB 1FXAA 4II2B 1E10A 1PGXA 1RFAA 4B95A 4AQ7A 2CR5A 4J3OD 2WXMA 2QMTA 1WYWB 3B9JA 3U8ZA 1L4ZB 2KJRA 1C1YB 4KV2A 1M4VA 2AQ3B 2EMSA 2N9EB 2K8HA 2IGGA 2H89B 3AB5A 1LFDA 1UWXA 2L8JA 2N9LA 2O6VA 1N5WA 2K1FA 4URKA 4MSQB 4WJOA 3A9KB 2ZVOA 3R7RA 2PE6B 3OAWA 3X23A 2W82A 4OVVA 3SHQA 1TT5B 4PS8A 2KT7A 4ZHPA 2FCQA 2KN5A 2KK8A 4YTNB 3SD5A 4HROA 4C4VA 2J7QB 2EKEC 4P7IA 4HRSA 3E56A 1JWAD 2KJHB 2NTTA 3DQVA 3DBRB 3A4RA 2BB5A 4KX6B 3EFUA 4A3PA 2BYTA 5L95C 4AS1A 1CZPA 4ZHOA 2FCNA 5AZFA 3W1SC 1P3QU 1JWSD 3I63C 1TKGA 2HTME 2G9HD 3BK1A 1TJEA 2RSUA 3JYUA 3APCA 3IAS1 2INCC 1FMAD 2J42A 4W9KA 4IWOA 2HTHA 1EWYC 4MM3A 4PT5A 3ECIA 2FIFA 2WXFA 1JW9D 1D3ZA 5FR3A 2VH2A 4K3BA 3DWGC 1C4AA 2K8CA 2UWQA 1E8XA 2LRWA 4DHJB 1XO3A 2QSDA 5LLIA 3KWVA 1EU4A 2IJ0A 3Q69A 3ZKJC 2MBBB 1I4XA 1RYJA 2GBJA 4B0EA 1BMLC 2KWVB 2RPQA 1IBXB 1D5ZC 4AJYB 2N9XA 1T6BX 4G50A 4H2AA 3M63B 2KOXA 3FILB 5DPSA 2IGDA 2IYDB 3NRZA 3RD2A 4C7ZA 3BK2A 1AARA 2MRPA 3UINB 4ARIA 1WX8A 4FULA 1TY2A 1N61A 5BMHA 4BOZB 4TSSA 3O65B 4GGQA 2WGSA 4Q2JA 1DOXA 2CJNA 1DYQA 4GSWA 4YSYB 1E6EB 2C7NB 4P1BC 3U7DA 3ENEA 3PSEB 2I2YA 1C9FA 1OQQA 2RDHA 2RD0A 1FM0D 3CSFA 2WXKA 1C79A 3TEZA 1WY8A 1FRRA 1MHXA 2CU1A 4K7UA 1P1AA 3IBEA 1JWMD 2C5LC 3BYYB 3IHPC 4K3CA 4WQOB 2QHOA 3BVZA 2OHFA 2MHJA 3ZW3A 5DPTA 2KZRA 3N1XC 5DCNA 4HKZE 3AEGB 1WXVA 2PKOA 3ALBA 4GLSC 2JZ3B 1RLFA 2NPTB 1OQYA 1YQBA 2BB6A 2GI9A 3QIJA 3PVLA 1Z5SB 1Z2MA 1SEBD 5H92C 2M8SA 3VRBB 4HDQA 2INNE 2AQ2B 5HKHA 1QOBA 1KH0A 3MC8A 5IP4D 3DBHI 2V0GA 4DK5A 4GDLA 5KHQA 3NZ3A 3P4PB 2DWQA 5FKAC 2KYWA 4RCOA 1GOZA 2CHXA 2GOWA 2I1JA 2LGXA 2QCZA 1WR6E 1R4NI 2L76A 4N58A 1L0VB 2FUG1 5DPRA 2GBRA 3R2TA 3NG0A 2WDVB 2DHZA 3QARA 3VTWA 2WX1A 5EE9A 2JYTA 3BVMA 2WXGA 4GN1A 3GE3C 1A70A 4A55A 1AWDA 2L83A 1E8WA 1WJNA 2BPSA 3OJ4B 3C19A 1EF1A 1UGJA 1FFUA 4W9EA 2I1KA 4DHZE 4HPPA 5D94A 3DPDA 3V3XA 4IOIE 4ANWA 5CX3A 5E6JA 2V3PA 3AE3B 3URYA 2FE8A 5EE3A 2XBBC 3HRDD 1JMLA 3H6NA 3WALA 4AWJA 4YSZB 2AQ1B 3SR6A 1V97A 1VDVA 2MLBA 4LNOA 2JT4B 2GMIC 1MG8A 3RI7C 3SDLC 3I57A 2ZW0A 3ZTCA 4DDID 3UF8A 1WR1A 2W3RA 3VVWB 1EF5A 1UBIA 4NAWA 4WAAA 3E9SA 4HEA1 1GJZA 4EUTA 3VH3B 3APDA 3MJ5A 2JF5A 2LUEA 5CHWA 2ZZPB 4FHKA 4KGRA 4XDCA 2JQRB 5L83A 2KTRB 4F1SA 3P4QB 1CMXB 4B9KA 1LO5D 2L0TA 4ANXA 1P7FA 2NBVB 1IPGA 1CQVA 2Q5WD 3HK0A 4FADA 1PYWD 2M0AA 5LNK1 3SU8X 1FFVA 3DHGC 4EZJA 3RPFC 4HPLB 3L13A 3KUZA 4ASWC 3U52E 3I5JC 5D6JB 1I4QA 2IO3B 2WXJA 3AEDB 4IC7B 2WHIA 3KYDD 1WRIA 1V8CA 4LNFA 2LHEA 2VZKB 3M95A 1HXYD 4JGHB 2JUOA 2X38A 3PREA 1ZGUB 1RAXA 4LDTD 4GDLB 1YN5A 4LTUA 3UIPB 4CO7A 4W9LA 1WXAA 4NJCA 4N9F4 2LJIA 2KX3A 3Q8EA 2BTEA 4F7ZA 1QZEA 2KO3A 1VLBA 1OFFA 1P9DU 2CKHB 3BWUD 1EWCA 3Q3FA 3IXSA 2KKCA 3ZQ4A 3Q6BA 3VTVA 2JU6X 4KKIA 2LXCA 4RGNA 1LQBA 2KX0A 3SFEB 2A4ZA 2IBIB 3AE4B 2WLBA 2Z0DB 1V1PB 3RN9C 3V6EB 3LB8C 3AE6B 3KUCB 3LDZE 2NCNA 3VH4B 2O2VB 2VH1A 3Q8FA 2GBKA 2N7DA 1VD2A 4IM0A 4XE0A 4B6WA 5JH5C 3UQBA 4MGIE 1WJ4A 2KWCA 1L6UA 1BXTA 2XN9C 4ZOHC 1T0QC 2YEPF 5JZEB 5GMVA 4MACA 3VAWA 1WRDB 3H8HA 3PHXB 3EA6A 3Q8BA 3P2BA 3R3MA 1DOIA 2Z59B 4ZRIA 2TSSA 1ENFA 1STEA 1ZP0B 3W9CB 3BZDB 2XEWA 4A9AA 1WGYA 3RCZA 1SE4A 1IYFA 2D3CA 2WXQA 4XWWA 1WXSA 2DYBA 4BKTA 2YLMA 1WSPA 4A6QA 1WFYA 1HZ6A 4I6PA 5C23A 5BYQA 2G3QB 2IO0B 4CYEA 3NZSA 2LD9A 1WGRA 1HQRD 3MC0B 3BY4B 1YD8U 2WXIA 1HTOA 4UDUC 3RNEC 1EUVB 3W1SA 2CS4A 2M56B 2MBEA 1D4BA 2Y5PA 2I38A 3TUOA 2DYOA 3UIOB 2C9WB 1ET9A 4WJQA 1BUIC 3HUIA 1YNTE 3ZTDA 1FD6A 4BFRA 2PTLA 1GNUA 3AE1B 4CQNA 4MSMB 2KD0A 1FNVA 1YQ3B 4JIOU 1SXTA 2MBOA 1XLOA 1YJJA 1ZPSA 4OVZA 3MJWA 1NEKB 3AEAB 1E5WA 1AYFA 1C77A 1ISNA 1I4HA 2RMMA 3L0WB 1R4MB 5CHFA 3SEBA 1FCCC 3QJZA 3ZIMA 2WX0A 2YVCA 4OW0A 3MP9A 2JRHA 3IVFA 2MX2A 3PZ7A 1V86A 2QJLA 3SFDB 2KTFA 1SE2A 1QLBB 2XNAC 5G55A 3QHTA 1L2NA 4WURA 3EUB2 1ACCA 2W3SA 3NS8A 1I35A 1FEHA 2KMMA 3IFWB 3W1YA 2KWUB 1MFWA 1F52A 4YWGG 1GPXA 2REXA 2D2QA 3ML8A 1QF6A 3ZJTA 2ZCBA 1YMHE 4W9CA 4GMVA 3BYTB 2L7RA 3QK0A 4XDDA 4CHKA 1V1PA 2QC8A 5J18A 2SAKA 2MCNB 2WU2B 1QT9A 4IG7B 3JSVA 3N32A 3KLSX 5I4DA 5AEKB 3AE5B 4HCPB 5BMGA 1WF9A 2KDMA 2QDFA 4MEMA 4JWUC 4TKNA 1FIQA 2KMAA 2KWDA 1F9JA 2QILA 1SJED 3D32A 4I6NB 1UZXB 2WU5B 4C56C 2L52A 1JQ4A 3KH0A 2XK5A 3DBLB 5HG2A 2UU7A 2M17A 4R3DA 4IUMB 1H4RA 3LJ3A 2V3SA 2L1AA 2JWUA 4DBGA 4BVUC 5IO9A 3IAM1 3MTNB 2JSVX 3AEEB 3QX1A 4KGTA 1NI3A 2MEKA 1T0RC 3H9DA 1G6JA 2BKRB 3DHIC 1L4DB 2JWZA 1XLPA 3K9PB 4IDIA 1V81A 3CF6E 5EDSA 2KDEB 4KZ0A 2PLPA 3TEXA 3Q8AA 3KW5B 4IWPA 4NJ6A 5FR6A 1GC7A 2D07B 2K9XA 1ZE3D 2BW2A 3DVNV 2GRIA 2PE9A 3VHTC 5KHOA 1FNUA 3I9V1 3OJ3A 5C2TB 3QAQA 4ZRJA 2A5UA 3AULA 1JCKB 3PLUA 1YIWA 1V1OA 3DBRI 1GG3A 2DLBA 2V3NA 3B2FA 1BT0A 2BWFA 4DHJD 4IM2A 5MPOA 2MBHA 3AU5A 1R7SA 3M62B 2GB1A 2J53A 3JW0X 3PRPB 1K51A 2BS2B 2PJHA 3B08A 1YN3A 1SIJA 4YSXB 3A4SC 2DZIA 4ZRQA 2LASA 4GXBA 3OG5A 2HJ1A 2RPVA 1E0ZA 2MWSB 1N6ZA 1OQRA 1MVKA 1QKZA 2ACZB 1SIFA 4W9FA 4G3XB 4RFBA 2DZMA 3MHSD 5AZHA 1JALA 4E3CA 2PVGC 1PFDA 1UF0A 1XLNA 1P0RA 3PO0A 4LNNA 1TKEA 4RGTA 3S2AA 1WGGA 3DDCB 5D3IB 3PRMB 2KNBA 2Y5CA 2NS5A 3WIMA 5D2MB 3PZ8A 4C00A 4BKSD 1VZ8A 2KQSA 1DGJA 3NHEB 1WXQA 2MP2B 3NOBA 1WI0A 3ZRFA 2BYEA 2MH7A 4EZKA 1TS4A 3W5VB 3RNGC 3VDZA 1ROEA 2N9PC 3PS6A 2ICIA 4KIKA 4NNJB 1OEYA 3OWEB 3JSVB 3TIXA 3HVZA 2EKIA 3AE9B 2JYEA 4M0WA 1WH3A 2MBQA 1VCBA 2AL3A 2C7MB 4HJGE 2RDBC 3L54A 1V5OA 3VUWA 2N1VA 3MC9A 2R61A 4DXFA 2LI5A 4BAXA 3VRAB 4LCDE 4FJZA 3WAOA 2L0FA 3DOWA 3H7PA 5JHBA 5HFYA 1V80A 2M0XA 2PW9A 4KDLB 2IY0B 3N1ZC 1L0XB 2NBUA 1P7EA 1EU3A 1RM6C 2WYQA 4IW0A 2K22A 2D10A 5LXHA 3EGRA 3V6CB 1SGHA 2L32A 3A1QA 3EFCA 3ZDMC 3N20C 2E3TA 2JZZA 1J0GA 1T3QA 4A8XC 4XYCA 3GE8C 4E71A 1WYGA 2JXXA 4US8A 4FBJB 4XC2A 2BVCA 3IT6B 1FCLA 3VQIA 2ZCCA 2JVCA 2LGIA 1V6EA 2WQYB 2G4SA 2FNJB 1WXMA 4HXDA 4K1RB 3AN1A 4WWOA 3AE7B 4D2KA 1L6VA 1RRBA 3P42A 3Q2AC 2FCSA 3FKYA 3H1UA 2BYFA 2M1MA 1J8CA 1X1MA 2VRRB 1D6EC 3J9CA 4RH6A 3O13A 4BOSC 4LK0M 1SF0A 3AXCA 4MH8A 2H88B 2KFKB 5IA7A 4WJPA 2LVPA 2KC2A 4MM3B 1YQ4B 4ANVA 3L16A 3T8MA 3L08A 5GXGB 2HE7A 4W9JA 3RNCC 1EO6A 1Q0WB 3QCAA 1PGBA 5CTRC 1GB4A 3LYYA 1P98A 2O6VB 3AEBB 5G5HA 3DVNU 1MJDA 1UWMA 3EECA 2DENB 3ZDTA 3U4EG 1IBXA 1TS5A 5AUIA 4W9GA 1J7CA 3BINA 4MGYE 2N9KA 3ZYYX 1WZ0A 3GS2A 2GBNA 1Q1OA 2OJWA 3MHZA 1QOGA 4L2YA 1E90A 1B1ZA 3KVFB 1I7HA 1UH6A 1IP9A 4RNAA 2HD5B 2K39A 3DCGA 4M0WB 3W2DA 2BF8B 4GB9A 1E9MA 2ASQA 4HLEA 4IWQA 2JPHA 5AUKA 3TEYA 2ZNVB 3PZDA 3L4PA 2BQQA 2N1WA 2KDBA 3ZNZB 3GP7A 3DWMA 2MJ3A 3RUIB 2IPKD 2VZKD 2FUHB 2NTSA 4YTMB 3H7PB 1WWTA 4PS7A 4TQ0A 3ZO5B 4M8NA 3PPAA 4KKJA 1L7YA 3P63A 1QQRA 1SJHD 1XCQL 1NBFC 1VRAB 2KACA 2BGFA 2MJEA 4K7WA 2SEBD 4GU2A 3A1QB 2WP9B 3HVDA 2LEKA 2FAZA 4JL9A 3P4RB 4M02A 1T0SC 2PEAA 4OVUA 3FILA 4NQLB 3ZRCA 4OZAA 2K6DB 4WIPA 1R4MI 3FC4A 4YTPB 2CU3A 2JZPA 4G11A 5E6PA 5C1ZA 2RDGA 3PT2B 5EE1A 2J4XA 4GDKA 2WDRB 2KAJA 2CHZA 3KWLA 3VXWA 2PPHA 4TUUA 1PQSA 3RNFC 4N59A 2DNFA 2INPE 1I42A 4W9IA 3PRZA 2M4NA 4RM9A 2G1EA 3RFZB 1CJEA 2KVRA 2K6QA 3AEFB 4QAYA 2NR2A 2PIAA 4FJVB 1HA5A 1FXTB 2LRUA 2B76B 2KFJA 3W5UB 2AL6A 4MDKE 3Q3MC 3TSSA 1PGAA 2AEHA 3B2GA 4ZYSA 2WXOA 1OGWA 1Y56A 2V1YA 1V2YA 3IG3A 1YX6B 4WH4A 2K5PA 2J0KA 2AWTA 3HM3A 4W9HA 2ZJDA 4TV3A 2K0PA 2NPTA 2QIEB 2LGYA 4PYUA 2WDQB 1YJ1A 3CWIA 4ICUA 4ZRKA 4FA6A 2WDTB 2J52A 3ZXVA 3VFKA 4KVGB 2KLGA 2LXAA 3ZNGC 2IO2B 3DVGY 3CSTA 2INDC 1J7BA 1TS2A 1B9RA 4TQ1A 1SE9A 1LXDA 2N7JA 3T9LA 3WCQA 1WE6A 1L0YB 3ZGZA 2BBCA 3MFGA 1YX5B 1ZDXA 4LDTB 1VZ7A 4LNKA 4RGOS 1T5XD 4EZLA 2X8XX 2W9NA 2Y5BB 3EC8A 1GC6A 4NAMA 2LMCA 4A20A 1I4GA 3N30A 4AJWA 1AN8A 1FPYA 2D5GA 2RR9A 2BKFA 3NVYA 4M00A 2BYVE 4MGKE 2LGSA 4FLHA 2K8BA 2ZPYA 3WA0A 4TMAB 1E8ZA 4K7SA 4JPSA 1HZ5A 2D3BA 1V9JA 3Q3JA 1ZW7A 3BVGA 2DX5B 2N0SB 4HWIB 3N1YC 3TJPA 3WAMA 4ACFA 3P1MA 4MT5A 4LJPB 4WWNA 1MI0A 2KC1A 4M8MA 4ZRPA 2DBYA 4HKQA 4JX1C 1ET6A 4HK2A 3H7SA 2GLSA 5J17A 1VR9A 2ZW1A 1RFKA 5J2RA 1DOYA 3ZNID 1PDXA 4A3OA 4BZAA 3TL5A 2KLCA 5HI1A 4C7YA 4WJNA 4NAWB 1C4PA 1WM3A 4GOCA 3C8YA 3Q8CA 3AE2B 4C80A 3AM9A 4GDKB 1NI2A 5BO4B 3BIID 1LGRA 3K9OB 4HJKA 4DXGA 4EFOA 2MJDA 4HCNB 3U7ZA 1A5RA 3C0RB 4DXAB 2KTRA 3GB1A 3UI3A 2PMVA 2WXHA 4AUQC 2NBWB 3R2IA 1K50A 2LGDA 2FCMA 1XEEA 1JRUA 1ZUD2 2E6XA 1IGDA 3ETRA 4I6LB 2O2VA 1S1QB 2ON8A 1HEZE 2NVUI 1C4CA 1NVID 1MPEA 4KSKC 3U30A 3QWZB 2K3UA 1YOVB 3APFA 2DZJA 1TKYA 4O1NA 4KDIC 3EHVA 2Z0EB 3JVZX 4IKGA 2LZ6A 4WWPA 4ICVA 3A33B 3KQ4A 1WX7A 1JWBD 1F1HA 1QOFA 1XCTL 3GOEA 4US9A 4BKGA 4JWSC 3DHHC 4OZBA 2MQJA 4FJYA 1UBQA 2HJ8A 1UD7A 3RNBC 1WX9A 4MJSA 2R2OA 3KYCD 1C3TA 1ZOYB 2QEJC 1GB1A 4WQMA 2WXNA 1UELA 1QOAA 4OHJA 1JROA 2BT6A 1MG4A 3QC8B 3L10B 2KMCA 3TEWA 2W54A 2LJ5A 1FXIA 3WANA 4ANUA 1JRPA 2ZEQA 5JHAA 2OJRA 1N60A 2C60A 2R2QA 3GZNB 5BYSA 1OTRB 2K25A 3DVGX 5IAAC 3PGEA 1KLVA 3LXFA 4ZDVA 3AU4A 3A9JB 2JXTA 3PHWB 4DHZB 1WJUA 2RGFA 2D11A 3Q3NC 3AH7A 4F8CB 4KGSA 3Q3OC 3CIRB 1N62A 1YN4A 1HTQA 1AW7A 3R66C 3FAHA 3R8BA 3P4SB 2DAJA 4J6IA 1XLQA 1SE3A 1KM7A 1N5XA 1KTKA 1FNWA 1NDDA 2KDIA 5CHVC 1KLGD 2JY6A 3UQAA 5BYRA 4A90A 4YT0B 4MGZE 2DZKA 3B0AA 2FBWB 2O6VD 2V4LA 2MA9B 4REZA 3V62A 1I4RA 1WMHA 5D7GA 4ARCA 2Y3AA 4K81A 3PLVA 3WAPA 3OLMD 1HE8A 2N7EA 2C7HA 3QA8A 1K8RB 4RM8A 2IZVB 1TYGB 1XF5L 1UGMA 1RWSA 2LHDA 5AZGA 1WE7A 2JRIB 4II3B 3ZJUA 2KVZA 3AV8A 4RMAA 3TCAA 4HPMB 3ABVB 2EELA 2OOBB 3TBLD 3N3KB 5H8YE 1VZ6A 2EMTA 2G4DB 2WXRA 1KFYB 2N4FA 3B1LX 5JXVA 1K52A 4E74A 1TY0A 3V05A 3N9YC 1D5MC 2G45B 3UGBB 3ZJVA 4BBNC 1ESFA 4XWTA 3V60A 2KQ7A 3VUYA 1F2RC 1FO4A 3DBLI 3L17A 3RYTA 2XK5B 1T0YA 2IDYA 2AX5A 3V61A 1SB3C 1NYQA 2MW5A 1U4AA 4WAFA 1J7AA 2BWES 4W9DA 5FK9C 1IUEA 3KUDB 4GIVA 1FRDA 1V49A 4MJSB 4B0MA 1WJ6A 2ZVNA 2L00B 1GUAB 2J0JA 4S17A 4G0NB 5IN7A 4FXCA 2CJOA 3T3NA 3ZNHB 1OEYJ 2Z8LA 1Q5WB 4LJOB 2V9HA 1D5XC 4JLCA 1Q10A 3VUXA 4EKUA 4L1BA 1J19A 3M3JA 4IM3A 1KRHA 3X0WA 2WXPA 1WIAA 3ZVVA 1UNSA 3RT3B 3DBSA 5IOIA 1TZ1A 3A9JA 1TTNA 2B3AA 4USAA 4FHJA 1TS3A 2DAFA 1F2RI 1NYRA 3RNAC 4WWMA 4LNIA 2LUMA 4BBNF 1Y8RC 4YXDB 4NQKE 4HDOA 3AECB 1WGKA 4RF1A 3ML9A 4PK1A 1E7UA 4KZCA 4P16A 4XZ4A 2ZPNA 4EEWA 4PS3A 1MHHE 4NJ7A 2W55A 5BMIA 3AMZA 3GZNI 1TZOA 4X57B 1F0ZA 5G2NA 1VJKA 1L5PA 1WMHB 1S3SG 4DQOC 4P6VF 3PV1A 4P1CC 2WNMA 4EOYA 1N63A 2PVOD 1K53A 1V5TA 3A9KA 1PUTA 3AI5A 3NS1A 2NMQA 4NZLB 4NPNA 5HHDG 2BS4B 2KJ6A 1WGDA 2L3ZA 4KSLC 4MH0E 5TR5A 2IGHA 1WZ3A 1ZXIA 2MP2A 1ZKHA 1ZXHA 3ZUNA 3NUHB 3NJTA 1E7PB 2LWPA 2LFIA 2LVOA 1E7VA 1TBEA 4C4VB 4RF0A 1XXGA 3RZFA 1TIFA 2ONQA 2IY1B 1KLUD 1QILA 1KOTA 4RGMA 5D3DA 3RMKC 1C76A 4OZCA 2WS3B 1E8YA 2OEDA 4PYZA 2BS3B 3VTUA 2J0MA 2CHWA 2KDFB 5LXIB 5IKCM 1TGZB 3I3TB
chains in the Genus database with same CATH topology
1PDXA 2KQ4X 2WXLA 2V4IB 1ROEA 4N6EB 5EE0A 1F77A 2ICIA 1GAQB 5HI1A 4C7YA 4NAWB 1C4PA 3OWEB 3U52E 3C8YA 3Q8CA 3AE2B 4C80A 3AM9A 1I4QA 4GDKB 3NVZA 3HVZA 2EKIA 3BIID 2WXJA 3AE9B 2JYEA 4DXGA 3AEDB 4M0WA 2MJDA 3U7ZA 1I4PA 5TSSA 3IT4B 4EE2A 4HJGE 3U2SC 2KN4A 3NVVA 3AE8B 3GB1A 3UI3A 2PMVA 1WRIA 2R61A 4JE3B 2WXHA 4DXFA 2DYMA 3R2IA 4L23A 1V8CA 3VRAB 2LHEA 2VZKB 3VR9B 1HXYD 1DOYA 1K50A 1SSNA 2X38A 5HFYA 1XEEA 2PW9A 1ZUD2 1L0XB 2E6XA 1IGDA 4GDLB 1YN5A 4LTUA 3ETRA 1CK1A 1EM7A 2ON8A 1HEZE 3T3OA 1P7EA 1EU3A 1RM6C 1UUPA 4NJCA 5G5GA 2LJIA 2YEPB 2K22A 1KF6B 3Q8EA 2BTEA 1C4CA 3EGRA 1NVID 1MPEA 2M19A 1VLBA 1SBBB 1C78A 2K3UA 1OFFA 3NVWA 1IGCA 2L32A 2HDEA 1EWCA 3BWUD 3IXSA 3ZQ4A 1NENB 2E3TA 1ZDVA 2JU6X 1T3QA 1TKYA 4KKIA 4O1NA 1YJIA 4RGNA 4A8XC 3VR8B 4LLGM 3SFEB 4IKGA 5C3JB 3AE4B 2WLBA 1WYGA 4US8A 3KQ4A 1JWBD 1QOFA 1V1PB 1XCTL 4US9A 1JWUD 4JWSC 4OZBA 4ITKA 3LB8C 3IT6B 5T8IA 3AE6B 1FCLA 3VQIA 2JX5A 3Q8FA 1FXAA 1E10A 1PGXA 2LGIA 4AQ7A 4J3OD 2WQYB 2WXMA 4XE0A 2QMTA 3B9JA 1ZOYB 2QEJC 1GB1A 1L4ZB 3AN1A 4WQMA 2WXNA 1M4VA 1QOAA 2AQ3B 1L6UA 1BXTA 2XN9C 3AE7B 4OHJA 1JROA 2IGGA 4ZOHC 2H89B 3AB5A 4D2KA 1L6VA 1UWXA 2BT6A 2YEPF 3P42A 2N9LA 4MACA 1N5WA 1D6EC 3J9CA 4RH6A 3TEWA 2W54A 3O13A 3H8HA 1FXIA 3EA6A 2W82A 4LK0M 1JRPA 1SF0A 3Q8BA 1N60A 1DOIA 2TSSA 4MH8A 2H88B 1ENFA 5BYSA 1STEA 4ZHPA 4YTNB 1ZP0B 3W9CB 4HROA 3LXFA 3BZDB 2JXTA 4A9AA 1SE4A 4HRSA 3E56A 4MM3B 3AH7A 1JWAD 1YQ4B 2NTTA 4KGSA 2BB5A 5GXGB 4KX6B 2WXQA 4XWWA 3CIRB 1N62A 1YN4A 1GB4A 1PGBA 1AW7A 3LYYA 3FAHA 1WSPA 3R8BA 3P4SB 4A6QA 1HZ6A 3AEBB 5G5HA 2BYTA 5BYQA 1XLQA 1SE3A 4AS1A 1N5XA 1UWMA 1KTKA 1CZPA 1FNWA 3U4EG 4ZHOA 1IBXA 1TS5A 5AUIA 1JWSD 1HQRD 1KLGD 3MC0B 1TKGA 2HTME 1J7CA 2WXIA 5BYRA 2G9HD 4A90A 4YT0B 3BK1A 1TJEA 2N9KA 4UDUC 3IAS1 3W1SA 3ZYYX 3GS2A 3MHZA 1FMAD 2M56B 2FBWB 1QOGA 2J42A 2Y5PA 4L2YA 1D4BA 1EWYC 2I38A 3TUOA 4REZA 1I4RA 1B1ZA 2DYOA 4PT5A 1I7HA 4ARCA 5D7GA 2WXFA 1ET9A 1JW9D 4RNAA 5FR3A 1BUIC 3HUIA 1YNTE 3DWGC 2Y3AA 1FD6A 1C4AA 3W2DA 2PTLA 3AE1B 4CQNA 1E9MA 1FNVA 1XO3A 2QSDA 1YQ3B 5AUKA 3TEYA 1SXTA 3KWVA 1EU4A 2IJ0A 3Q69A 1TYGB 1XF5L 3L4PA 1I4XA 1RYJA 1XLOA 1YJJA 1RWSA 1ZPSA 4B0EA 1NEKB 3AEAB 4OVZA 1BMLC 1AYFA 2LHDA 1C77A 1I4HA 1IBXB 1D5ZC 2RMMA 3GP7A 3SEBA 3DWMA 2MJ3A 3ZJUA 1FCCC 3AV8A 1T6BX 2IPKD 2VZKD 4H2AA 3ABVB 2NTSA 4YTMB 4OW0A 2EELA 3MP9A 3FILB 2IGDA 5H8YE 1WWTA 4TQ0A 1VZ6A 3NRZA 3PZ7A 4C7ZA 2QJLA 3BK2A 3SFDB 2WXRA 1KFYB 1SE2A 1QLBB 4KKJA 4ARIA 2XNAC 1TY2A 1N61A 3P63A 5JXVA 4WURA 5BMHA 3EUB2 1ACCA 1K52A 1QQRA 1SJHD 1XCQL 2W3SA 4TSSA 1TY0A 3V05A 3N9YC 1D5MC 1VRAB 3ZJVA 1FEHA 4Q2JA 1DOXA 2KACA 2CJNA 2KMMA 2MJEA 2SEBD 1DYQA 1ESFA 4YSYB 4XWTA 1E6EB 4YWGG 1GPXA 2WP9B 1QF6A 3HVDA 2I2YA 2LEKA 3ZJTA 1YMHE 1C9FA 3P4RB 1OQQA 1F2RC 2RDHA 1FM0D 3BYTB 1FO4A 2WXKA 1C79A 4XDDA 3TEZA 1FRRA 1MHXA 1V1PA 2AX5A 2IDYA 1JWMD 3FILA 4OZAA 1SB3C 4WIPA 3BYYB 3FC4A 4YTPB 2CU3A 1NYQA 2JZPA 2SAKA 4WAFA 1J7AA 2WU2B 3BVZA 1QT9A 2OHFA 2RDGA 5EE1A 5FK9C 2J4XA 1IUEA 1FRDA 3KLSX 2WDRB 5I4DA 2KAJA 4B0MA 4HKZE 3AE5B 3AEGB 5BMGA 3KWLA 2KDMA 2PKOA 4GLSC 4FXCA 4N59A 4JWUC 2INPE 1FIQA 2CJOA 2KWDA 2QILA 1SJED 2BB6A 3T3NA 2GI9A 2Z8LA 2WU5B 1D5XC 1SEBD 4C56C 1Q10A 5H92C 3VRBB 2G1EA 2INNE 2L52A 3RFZB 2AQ2B 1QOBA 1KH0A 1CJEA 1JQ4A 3AEFB 2PIAA 5HG2A 4L1BA 1HA5A 1KRHA 4R3DA 2WXPA 2L1AA 2JWUA 2V0GA 1UNSA 2B76B 3W5UB 3NZ3A 3P4PB 3IAM1 2DWQA 2JSVX 3AEEB 5FKAC 4RCOA 3TSSA 1PGAA 1GOZA 4KGTA 3B2GA 4ZYSA 2WXOA 4USAA 1Y56A 1NI3A 2MEKA 1TS3A 1F2RI 1NYRA 4N58A 4WH4A 2K5PA 4WWMA 1L0VB 1L4DB 2LUMA 2FUG1 4YXDB 1XLPA 2K0PA 4IDIA 2QIEB 3R2TA 2WDQB 3AECB 3CWIA 1WGKA 2PLPA 4RF1A 2WDVB 3TEXA 3Q8AA 5EE9A 2J52A 2JYTA 3BVMA 2WXGA 4P16A 1A70A 4A55A 1AWDA 2L83A 2K9XA 1MHHE 1ZE3D 2BW2A 2GRIA 2W55A 1UGJA 5BMIA 1FFUA 1J7BA 1FNUA 3AMZA 1TS2A 3I9V1 5C2TB 1B9RA 1TZOA 4TQ1A 1JCKB 3V3XA 4IOIE 2N7JA 1F0ZA 1VJKA 1V1OA 1L5PA 3WCQA 2DLBA 5E6JA 4DQOC 2V3NA 3B2FA 1L0YB 3ZGZA 2V3PA 3AE3B 2BBCA 4P6VF 3MFGA 3URYA 2FE8A 5EE3A 1ZDXA 1VZ7A 2WNMA 5MPOA 3HRDD 1JMLA 1R7SA 4RGOS 1T5XD 2GB1A 1N63A 2PVOD 1K53A 2J53A 1K51A 2BS2B 1PUTA 1YN3A 4YSZB 1SIJA 4YSXB 2AQ1B 3NS1A 2NMQA 3SR6A 4NZLB 4ZRQA 5HHDG 2BS4B 1V97A 1VDVA 4NAMA 2LMCA 1I4GA 2IGHA 1AN8A 1ZXIA 2D5GA 2RPVA 1ZXHA 3I57A 1E0ZA 1OQRA 1QKZA 1MVKA 2ZW0A 3NVYA 2ACZB 3NUHB 4RFBA 1E7PB 2LFIA 1JALA 2W3RA 4RF0A 1XXGA 2PVGC 1PFDA 1XLNA 3PO0A 3E9SA 4TMAB 4HEA1 2ONQA 4JPSA 1TKEA 4RGTA 1HZ5A 1KLUD 1QILA 3BVGA 5D3IB 3MJ5A 2N0SB 4RGMA 4KGRA 5D3DA 2Y5CA 3P1MA 1C76A 4MT5A 4OZCA 2WS3B 4XDCA 2OEDA 2JQRB 3PZ8A 1MI0A 3P4QB 1LO5D 2BS3B 4ZRPA 2DBYA 4HKQA 1P7FA 4JX1C 1VZ8A 1CQVA 1ET6A 2Q5WD 1DGJA 1WXQA 1PYWD 2MH7A 1VR9A 2M0AA 5LNK1 2ZW1A 1RFKA 1FFVA 1TS4A 3W5VB 3RPFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6V A;  1PDX A;  2QIE B;  3NRZ A;  4C7Z A;  2BT6 A;  2WDQ B;  2QJL A;  1WGK A;  3AB5 A;  3AEC B;  3CWI A;  3SFD B;  1ROE A;  1N5W A;  2WDV B;  4N6E B;  1KFY B;  5EE0 A;  1GAQ B;  1QLB B;  4C7Y A;  5EE9 A;  1N61 A;  3AE2 B;  4C80 A;  3AM9 A;  3P63 A;  3RPF C;  3NVZ A;  3EUB 2;  2W3S A;  3HVZ A;  2W54 A;  1FXI A;  2EKI A;  1A70 A;  3BII D;  1AWD A;  2L83 A;  3AE9 B;  3AED B;  1DOX A;  1JRP A;  1SF0 A;  2CJN A;  2KMM A;  2MJE A;  2MJD A;  1N60 A;  2K9X A;  1DOI A;  2W55 A;  4YSY B;  2H88 B;  1E6E B;  1GPX A;  2WP9 B;  1FFU A;  4ZHP A;  1J7B A;  4YTN B;  1ZP0 B;  3AMZ A;  3W9C B;  2LEK A;  4HRO A;  1QF6 A;  3LXF A;  5C2T B;  1B9R A;  3P4R B;  1OQQ A;  3AE8 B;  3NVV A;  4A9A A;  1WRI A;  1FM0 D;  1FO4 A;  1F0Z A;  4HRS A;  3AH7 A;  1JWA D;  1VJK A;  1YQ4 B;  1L5P A;  3VRA B;  1V8C A;  3WCQ A;  3VR9 B;  1FRR A;  4KX6 B;  3B2F A;  2AX5 A;  5GXG B;  1DOY A;  3AE3 B;  4P6V F;  3CIR B;  1N62 A;  5EE3 A;  1SB3 C;  4YTP B;  3FC4 A;  4YXD B;  5MPO A;  2CU3 A;  3FAH A;  1NYQ A;  3HRD D;  1ZUD 2;  1R7S A;  3P4S B;  3AEB B;  1J7A A;  2WU2 B;  5G5H A;  1N63 A;  1QT9 A;  2OHF A;  2PVO D;  3ETR A;  1XLQ A;  4LTU A;  5EE1 A;  2BS2 B;  1PUT A;  1N5X A;  1UWM A;  1IUE A;  1RM6 C;  4YSZ B;  1SIJ A;  1CZP A;  5G5G A;  4YSX B;  3NS1 A;  2K22 A;  4ZHO A;  3SR6 A;  1FRD A;  1KF6 B;  2WDR B;  2BS4 B;  2KAJ A;  5AUI A;  1V97 A;  1VDV A;  3AE5 B;  1TKG A;  3AEG B;  1NVI D;  2HTM E;  1J7C A;  1VLB A;  2M19 A;  3KWL A;  1ZXI A;  2PKO A;  1OFF A;  3NVW A;  1TJE A;  4FXC A;  4N59 A;  4YT0 B;  1OQR A;  3NVY A;  1E0Z A;  2ACZ B;  4JWU C;  3ZYY X;  1FIQ A;  1E7P B;  2CJO A;  1FMA D;  2M56 B;  1NEN B;  2FBW B;  1QOG A;  2E3T A;  1JAL A;  2W3R A;  1T3Q A;  1TKY A;  2WU5 B;  1YJI A;  2PVG C;  1EWY C;  1PFD A;  1XLN A;  3PO0 A;  5H92 C;  3VRB B;  2G1E A;  3VR8 B;  2L52 A;  3SFE B;  5C3J B;  1I7H A;  1TKE A;  3AE4 B;  1QOB A;  1WYG A;  2WLB A;  1CJE A;  1JW9 D;  4US8 A;  1JQ4 A;  3AEF B;  1JWB D;  1QOF A;  3HUI A;  4US9 A;  2PIA A;  3DWG C;  2N0S B;  4JWS C;  1KRH A;  3AE1 B;  1E9M A;  4ITK A;  3LB8 C;  1XO3 A;  1YQ3 B;  2B76 B;  2Y5C A;  3P1M A;  5AUK A;  3W5U B;  2WS3 B;  3AE6 B;  2JX5 A;  2JQR B;  3P4P B;  1TYG B;  3L4P A;  1RYJ A;  1XLO A;  1YJJ A;  1RWS A;  2DWQ A;  3AEE B;  1NEK B;  1FXA A;  3AEA B;  3P4Q B;  1E10 A;  2BS3 B;  1AYF A;  2DBY A;  3B2G A;  4USA A;  4JX1 C;  2WQY B;  1NI3 A;  2Q5W D;  3B9J A;  3DWM A;  2MJ3 A;  1DGJ A;  1ZOY B;  3AV8 A;  1NYR A;  1WXQ A;  4N58 A;  3AN1 A;  4WQM A;  2K5P A;  2MH7 A;  3ABV B;  4WWM A;  1QOA A;  1L0V B;  1L6U A;  4YTM B;  3AE7 B;  1RFK A;  1JRO A;  1FFV A;  4ZOH C;  3W5V B;  1XLP A;  2H89 B;  4IDI A;  5H8Y E;  1WWT A; 
#chains in the Genus database with same CATH topology
 1R4N B;  2KQ4 X;  2WXL A;  2V4I B;  4M01 A;  4N6E B;  5EE0 A;  1F77 A;  1GAQ B;  4FN2 A;  2GBM A;  1M94 A;  2MSE D;  3NVZ A;  3TMP B;  3DBH B;  2IO1 B;  1I4P A;  5TSS A;  1XT9 B;  3Q14 C;  3IT4 B;  4EE2 A;  3NZU A;  4HVB A;  3U2S C;  2KN4 A;  3NVV A;  3AE8 B;  2FID A;  1XD3 B;  2ZNV C;  4JE3 B;  2LVQ A;  2UYZ B;  2DYM A;  4JQW C;  4L23 A;  1LM8 B;  3VR9 B;  1SSN A;  4NY0 A;  5E6N A;  3RUL A;  3QQ8 B;  2D3A A;  4S0R A;  4ZYN A;  4XX5 A;  4KIK B;  1CK1 A;  1EM7 A;  1XQQ A;  3R7Q A;  3T3O A;  1UUP A;  1WGH A;  4MEL A;  2KHW B;  3HHM A;  2YEP B;  5G5G A;  4BKS A;  1KF6 B;  2D3G A;  4AOF A;  2M19 A;  1SBB B;  2AYO B;  3ONS A;  1C78 A;  2L05 A;  5E6O A;  3NVW A;  3ZXR A;  4DDG D;  2WWZ A;  1IGC A;  2KAN A;  2HDE A;  2KXJ A;  5DPW A;  4YL8 A;  3HIZ A;  1NEN B;  1ZDV A;  1YJI A;  3PTF C;  1WM2 A;  3VR8 B;  3ZLZ A;  4LLG M;  5C3J B;  3RZW C;  3HM6 X;  3NY5 A;  1JWU D;  4AP4 C;  4DWF A;  4ITK A;  1H8C A;  5T8I A;  1KJT A;  2JX5 A;  4XGA B;  2KFK A;  3CMM B;  1FXA A;  4II2 B;  1E10 A;  1PGX A;  1RFA A;  4B95 A;  4AQ7 A;  2CR5 A;  4J3O D;  2WXM A;  2QMT A;  1WYW B;  3B9J A;  3U8Z A;  1L4Z B;  2KJR A;  1C1Y B;  4KV2 A;  1M4V A;  2AQ3 B;  2EMS A;  2N9E B;  2K8H A;  2IGG A;  2H89 B;  3AB5 A;  1LFD A;  1UWX A;  2L8J A;  2N9L A;  2O6V A;  1N5W A;  2K1F A;  4URK A;  4MSQ B;  4WJO A;  3A9K B;  2ZVO A;  3R7R A;  2PE6 B;  3OAW A;  3X23 A;  2W82 A;  4OVV A;  3SHQ A;  1TT5 B;  4PS8 A;  2KT7 A;  4ZHP A;  2FCQ A;  2KN5 A;  2KK8 A;  4YTN B;  3SD5 A;  4HRO A;  4C4V A;  2J7Q B;  2EKE C;  4P7I A;  4HRS A;  3E56 A;  1JWA D;  2KJH B;  2NTT A;  3DQV A;  3DBR B;  3A4R A;  2BB5 A;  4KX6 B;  3EFU A;  4A3P A;  2BYT A;  5L95 C;  4AS1 A;  1CZP A;  4ZHO A;  2FCN A;  5AZF A;  3W1S C;  1P3Q U;  1JWS D;  3I63 C;  1TKG A;  2HTM E;  2G9H D;  3BK1 A;  1TJE A;  2RSU A;  3JYU A;  3APC A;  3IAS 1;  2INC C;  1FMA D;  2J42 A;  4W9K A;  4IWO A;  2HTH A;  1EWY C;  4MM3 A;  4PT5 A;  3ECI A;  2FIF A;  2WXF A;  1JW9 D;  1D3Z A;  5FR3 A;  2VH2 A;  4K3B A;  3DWG C;  1C4A A;  2K8C A;  2UWQ A;  1E8X A;  2LRW A;  4DHJ B;  1XO3 A;  2QSD A;  5LLI A;  3KWV A;  1EU4 A;  2IJ0 A;  3Q69 A;  3ZKJ C;  2MBB B;  1I4X A;  1RYJ A;  2GBJ A;  4B0E A;  1BML C;  2KWV B;  2RPQ A;  1IBX B;  1D5Z C;  4AJY B;  2N9X A;  1T6B X;  4G50 A;  4H2A A;  3M63 B;  2KOX A;  3FIL B;  5DPS A;  2IGD A;  2IYD B;  3NRZ A;  3RD2 A;  4C7Z A;  3BK2 A;  1AAR A;  2MRP A;  3UIN B;  4ARI A;  1WX8 A;  4FUL A;  1TY2 A;  1N61 A;  5BMH A;  4BOZ B;  4TSS A;  3O65 B;  4GGQ A;  2WGS A;  4Q2J A;  1DOX A;  2CJN A;  1DYQ A;  4GSW A;  4YSY B;  1E6E B;  2C7N B;  4P1B C;  3U7D A;  3ENE A;  3PSE B;  2I2Y A;  1C9F A;  1OQQ A;  2RDH A;  2RD0 A;  1FM0 D;  3CSF A;  2WXK A;  1C79 A;  3TEZ A;  1WY8 A;  1FRR A;  1MHX A;  2CU1 A;  4K7U A;  1P1A A;  3IBE A;  1JWM D;  2C5L C;  3BYY B;  3IHP C;  4K3C A;  4WQO B;  2QHO A;  3BVZ A;  2OHF A;  2MHJ A;  3ZW3 A;  5DPT A;  2KZR A;  3N1X C;  5DCN A;  4HKZ E;  3AEG B;  1WXV A;  2PKO A;  3ALB A;  4GLS C;  2JZ3 B;  1RLF A;  2NPT B;  1OQY A;  1YQB A;  2BB6 A;  2GI9 A;  3QIJ A;  3PVL A;  1Z5S B;  1Z2M A;  1SEB D;  5H92 C;  2M8S A;  3VRB B;  4HDQ A;  2INN E;  2AQ2 B;  5HKH A;  1QOB A;  1KH0 A;  3MC8 A;  5IP4 D;  3DBH I;  2V0G A;  4DK5 A;  4GDL A;  5KHQ A;  3NZ3 A;  3P4P B;  2DWQ A;  5FKA C;  2KYW A;  4RCO A;  1GOZ A;  2CHX A;  2GOW A;  2I1J A;  2LGX A;  2QCZ A;  1WR6 E;  1R4N I;  2L76 A;  4N58 A;  1L0V B;  2FUG 1;  5DPR A;  2GBR A;  3R2T A;  3NG0 A;  2WDV B;  2DHZ A;  3QAR A;  3VTW A;  2WX1 A;  5EE9 A;  2JYT A;  3BVM A;  2WXG A;  4GN1 A;  3GE3 C;  1A70 A;  4A55 A;  1AWD A;  2L83 A;  1E8W A;  1WJN A;  2BPS A;  3OJ4 B;  3C19 A;  1EF1 A;  1UGJ A;  1FFU A;  4W9E A;  2I1K A;  4DHZ E;  4HPP A;  5D94 A;  3DPD A;  3V3X A;  4IOI E;  4ANW A;  5CX3 A;  5E6J A;  2V3P A;  3AE3 B;  3URY A;  2FE8 A;  5EE3 A;  2XBB C;  3HRD D;  1JML A;  3H6N A;  3WAL A;  4AWJ A;  4YSZ B;  2AQ1 B;  3SR6 A;  1V97 A;  1VDV A;  2MLB A;  4LNO A;  2JT4 B;  2GMI C;  1MG8 A;  3RI7 C;  3SDL C;  3I57 A;  2ZW0 A;  3ZTC A;  4DDI D;  3UF8 A;  1WR1 A;  2W3R A;  3VVW B;  1EF5 A;  1UBI A;  4NAW A;  4WAA A;  3E9S A;  4HEA 1;  1GJZ A;  4EUT A;  3VH3 B;  3APD A;  3MJ5 A;  2JF5 A;  2LUE A;  5CHW A;  2ZZP B;  4FHK A;  4KGR A;  4XDC A;  2JQR B;  5L83 A;  2KTR B;  4F1S A;  3P4Q B;  1CMX B;  4B9K A;  1LO5 D;  2L0T A;  4ANX A;  1P7F A;  2NBV B;  1IPG A;  1CQV A;  2Q5W D;  3HK0 A;  4FAD A;  1PYW D;  2M0A A;  5LNK 1;  3SU8 X;  1FFV A;  3DHG C;  4EZJ A;  3RPF C;  4HPL B;  3L13 A;  3KUZ A;  4ASW C;  3U52 E;  3I5J C;  5D6J B;  1I4Q A;  2IO3 B;  2WXJ A;  3AED B;  4IC7 B;  2WHI A;  3KYD D;  1WRI A;  1V8C A;  4LNF A;  2LHE A;  2VZK B;  3M95 A;  1HXY D;  4JGH B;  2JUO A;  2X38 A;  3PRE A;  1ZGU B;  1RAX A;  4LDT D;  4GDL B;  1YN5 A;  4LTU A;  3UIP B;  4CO7 A;  4W9L A;  1WXA A;  4NJC A;  4N9F 4;  2LJI A;  2KX3 A;  3Q8E A;  2BTE A;  4F7Z A;  1QZE A;  2KO3 A;  1VLB A;  1OFF A;  1P9D U;  2CKH B;  3BWU D;  1EWC A;  3Q3F A;  3IXS A;  2KKC A;  3ZQ4 A;  3Q6B A;  3VTV A;  2JU6 X;  4KKI A;  2LXC A;  4RGN A;  1LQB A;  2KX0 A;  3SFE B;  2A4Z A;  2IBI B;  3AE4 B;  2WLB A;  2Z0D B;  1V1P B;  3RN9 C;  3V6E B;  3LB8 C;  3AE6 B;  3KUC B;  3LDZ E;  2NCN A;  3VH4 B;  2O2V B;  2VH1 A;  3Q8F A;  2GBK A;  2N7D A;  1VD2 A;  4IM0 A;  4XE0 A;  4B6W A;  5JH5 C;  3UQB A;  4MGI E;  1WJ4 A;  2KWC A;  1L6U A;  1BXT A;  2XN9 C;  4ZOH C;  1T0Q C;  2YEP F;  5JZE B;  5GMV A;  4MAC A;  3VAW A;  1WRD B;  3H8H A;  3PHX B;  3EA6 A;  3Q8B A;  3P2B A;  3R3M A;  1DOI A;  2Z59 B;  4ZRI A;  2TSS A;  1ENF A;  1STE A;  1ZP0 B;  3W9C B;  3BZD B;  2XEW A;  4A9A A;  1WGY A;  3RCZ A;  1SE4 A;  1IYF A;  2D3C A;  2WXQ A;  4XWW A;  1WXS A;  2DYB A;  4BKT A;  2YLM A;  1WSP A;  4A6Q A;  1WFY A;  1HZ6 A;  4I6P A;  5C23 A;  5BYQ A;  2G3Q B;  2IO0 B;  4CYE A;  3NZS A;  2LD9 A;  1WGR A;  1HQR D;  3MC0 B;  3BY4 B;  1YD8 U;  2WXI A;  1HTO A;  4UDU C;  3RNE C;  1EUV B;  3W1S A;  2CS4 A;  2M56 B;  2MBE A;  1D4B A;  2Y5P A;  2I38 A;  3TUO A;  2DYO A;  3UIO B;  2C9W B;  1ET9 A;  4WJQ A;  1BUI C;  3HUI A;  1YNT E;  3ZTD A;  1FD6 A;  4BFR A;  2PTL A;  1GNU A;  3AE1 B;  4CQN A;  4MSM B;  2KD0 A;  1FNV A;  1YQ3 B;  4JIO U;  1SXT A;  2MBO A;  1XLO A;  1YJJ A;  1ZPS A;  4OVZ A;  3MJW A;  1NEK B;  3AEA B;  1E5W A;  1AYF A;  1C77 A;  1ISN A;  1I4H A;  2RMM A;  3L0W B;  1R4M B;  5CHF A;  3SEB A;  1FCC C;  3QJZ A;  3ZIM A;  2WX0 A;  2YVC A;  4OW0 A;  3MP9 A;  2JRH A;  3IVF A;  2MX2 A;  3PZ7 A;  1V86 A;  2QJL A;  3SFD B;  2KTF A;  1SE2 A;  1QLB B;  2XNA C;  5G55 A;  3QHT A;  1L2N A;  4WUR A;  3EUB 2;  1ACC A;  2W3S A;  3NS8 A;  1I35 A;  1FEH A;  2KMM A;  3IFW B;  3W1Y A;  2KWU B;  1MFW A;  1F52 A;  4YWG G;  1GPX A;  2REX A;  2D2Q A;  3ML8 A;  1QF6 A;  3ZJT A;  2ZCB A;  1YMH E;  4W9C A;  4GMV A;  3BYT B;  2L7R A;  3QK0 A;  4XDD A;  4CHK A;  1V1P A;  2QC8 A;  5J18 A;  2SAK A;  2MCN B;  2WU2 B;  1QT9 A;  4IG7 B;  3JSV A;  3N32 A;  3KLS X;  5I4D A;  5AEK B;  3AE5 B;  4HCP B;  5BMG A;  1WF9 A;  2KDM A;  2QDF A;  4MEM A;  4JWU C;  4TKN A;  1FIQ A;  2KMA A;  2KWD A;  1F9J A;  2QIL A;  1SJE D;  3D32 A;  4I6N B;  1UZX B;  2WU5 B;  4C56 C;  2L52 A;  1JQ4 A;  3KH0 A;  2XK5 A;  3DBL B;  5HG2 A;  2UU7 A;  2M17 A;  4R3D A;  4IUM B;  1H4R A;  3LJ3 A;  2V3S A;  2L1A A;  2JWU A;  4DBG A;  4BVU C;  5IO9 A;  3IAM 1;  3MTN B;  2JSV X;  3AEE B;  3QX1 A;  4KGT A;  1NI3 A;  2MEK A;  1T0R C;  3H9D A;  1G6J A;  2BKR B;  3DHI C;  1L4D B;  2JWZ A;  1XLP A;  3K9P B;  4IDI A;  1V81 A;  3CF6 E;  5EDS A;  2KDE B;  4KZ0 A;  2PLP A;  3TEX A;  3Q8A A;  3KW5 B;  4IWP A;  4NJ6 A;  5FR6 A;  1GC7 A;  2D07 B;  2K9X A;  1ZE3 D;  2BW2 A;  3DVN V;  2GRI A;  2PE9 A;  3VHT C;  5KHO A;  1FNU A;  3I9V 1;  3OJ3 A;  5C2T B;  3QAQ A;  4ZRJ A;  2A5U A;  3AUL A;  1JCK B;  3PLU A;  1YIW A;  1V1O A;  3DBR I;  1GG3 A;  2DLB A;  2V3N A;  3B2F A;  1BT0 A;  2BWF A;  4DHJ D;  4IM2 A;  5MPO A;  2MBH A;  3AU5 A;  1R7S A;  3M62 B;  2GB1 A;  2J53 A;  3JW0 X;  3PRP B;  1K51 A;  2BS2 B;  2PJH A;  3B08 A;  1YN3 A;  1SIJ A;  4YSX B;  3A4S C;  2DZI A;  4ZRQ A;  2LAS A;  4GXB A;  3OG5 A;  2HJ1 A;  2RPV A;  1E0Z A;  2MWS B;  1N6Z A;  1OQR A;  1MVK A;  1QKZ A;  2ACZ B;  1SIF A;  4W9F A;  4G3X B;  4RFB A;  2DZM A;  3MHS D;  5AZH A;  1JAL A;  4E3C A;  2PVG C;  1PFD A;  1UF0 A;  1XLN A;  1P0R A;  3PO0 A;  4LNN A;  1TKE A;  4RGT A;  3S2A A;  1WGG A;  3DDC B;  5D3I B;  3PRM B;  2KNB A;  2Y5C A;  2NS5 A;  3WIM A;  5D2M B;  3PZ8 A;  4C00 A;  4BKS D;  1VZ8 A;  2KQS A;  1DGJ A;  3NHE B;  1WXQ A;  2MP2 B;  3NOB A;  1WI0 A;  3ZRF A;  2BYE A;  2MH7 A;  4EZK A;  1TS4 A;  3W5V B;  3RNG C;  3VDZ A;  1ROE A;  2N9P C;  3PS6 A;  2ICI A;  4KIK A;  4NNJ B;  1OEY A;  3OWE B;  3JSV B;  3TIX A;  3HVZ A;  2EKI A;  3AE9 B;  2JYE A;  4M0W A;  1WH3 A;  2MBQ A;  1VCB A;  2AL3 A;  2C7M B;  4HJG E;  2RDB C;  3L54 A;  1V5O A;  3VUW A;  2N1V A;  3MC9 A;  2R61 A;  4DXF A;  2LI5 A;  4BAX A;  3VRA B;  4LCD E;  4FJZ A;  3WAO A;  2L0F A;  3DOW A;  3H7P A;  5JHB A;  5HFY A;  1V80 A;  2M0X A;  2PW9 A;  4KDL B;  2IY0 B;  3N1Z C;  1L0X B;  2NBU A;  1P7E A;  1EU3 A;  1RM6 C;  2WYQ A;  4IW0 A;  2K22 A;  2D10 A;  5LXH A;  3EGR A;  3V6C B;  1SGH A;  2L32 A;  3A1Q A;  3EFC A;  3ZDM C;  3N20 C;  2E3T A;  2JZZ A;  1J0G A;  1T3Q A;  4A8X C;  4XYC A;  3GE8 C;  4E71 A;  1WYG A;  2JXX A;  4US8 A;  4FBJ B;  4XC2 A;  2BVC A;  3IT6 B;  1FCL A;  3VQI A;  2ZCC A;  2JVC A;  2LGI A;  1V6E A;  2WQY B;  2G4S A;  2FNJ B;  1WXM A;  4HXD A;  4K1R B;  3AN1 A;  4WWO A;  3AE7 B;  4D2K A;  1L6V A;  1RRB A;  3P42 A;  3Q2A C;  2FCS A;  3FKY A;  3H1U A;  2BYF A;  2M1M A;  1J8C A;  1X1M A;  2VRR B;  1D6E C;  3J9C A;  4RH6 A;  3O13 A;  4BOS C;  4LK0 M;  1SF0 A;  3AXC A;  4MH8 A;  2H88 B;  2KFK B;  5IA7 A;  4WJP A;  2LVP A;  2KC2 A;  4MM3 B;  1YQ4 B;  4ANV A;  3L16 A;  3T8M A;  3L08 A;  5GXG B;  2HE7 A;  4W9J A;  3RNC C;  1EO6 A;  1Q0W B;  3QCA A;  1PGB A;  5CTR C;  1GB4 A;  3LYY A;  1P98 A;  2O6V B;  3AEB B;  5G5H A;  3DVN U;  1MJD A;  1UWM A;  3EEC A;  2DEN B;  3ZDT A;  3U4E G;  1IBX A;  1TS5 A;  5AUI A;  4W9G A;  1J7C A;  3BIN A;  4MGY E;  2N9K A;  3ZYY X;  1WZ0 A;  3GS2 A;  2GBN A;  1Q1O A;  2OJW A;  3MHZ A;  1QOG A;  4L2Y A;  1E90 A;  1B1Z A;  3KVF B;  1I7H A;  1UH6 A;  1IP9 A;  4RNA A;  2HD5 B;  2K39 A;  3DCG A;  4M0W B;  3W2D A;  2BF8 B;  4GB9 A;  1E9M A;  2ASQ A;  4HLE A;  4IWQ A;  2JPH A;  5AUK A;  3TEY A;  2ZNV B;  3PZD A;  3L4P A;  2BQQ A;  2N1W A;  2KDB A;  3ZNZ B;  3GP7 A;  3DWM A;  2MJ3 A;  3RUI B;  2IPK D;  2VZK D;  2FUH B;  2NTS A;  4YTM B;  3H7P B;  1WWT A;  4PS7 A;  4TQ0 A;  3ZO5 B;  4M8N A;  3PPA A;  4KKJ A;  1L7Y A;  3P63 A;  1QQR A;  1SJH D;  1XCQ L;  1NBF C;  1VRA B;  2KAC A;  2BGF A;  2MJE A;  4K7W A;  2SEB D;  4GU2 A;  3A1Q B;  2WP9 B;  3HVD A;  2LEK A;  2FAZ A;  4JL9 A;  3P4R B;  4M02 A;  1T0S C;  2PEA A;  4OVU A;  3FIL A;  4NQL B;  3ZRC A;  4OZA A;  2K6D B;  4WIP A;  1R4M I;  3FC4 A;  4YTP B;  2CU3 A;  2JZP A;  4G11 A;  5E6P A;  5C1Z A;  2RDG A;  3PT2 B;  5EE1 A;  2J4X A;  4GDK A;  2WDR B;  2KAJ A;  2CHZ A;  3KWL A;  3VXW A;  2PPH A;  4TUU A;  1PQS A;  3RNF C;  4N59 A;  2DNF A;  2INP E;  1I42 A;  4W9I A;  3PRZ A;  2M4N A;  4RM9 A;  2G1E A;  3RFZ B;  1CJE A;  2KVR A;  2K6Q A;  3AEF B;  4QAY A;  2NR2 A;  2PIA A;  4FJV B;  1HA5 A;  1FXT B;  2LRU A;  2B76 B;  2KFJ A;  3W5U B;  2AL6 A;  4MDK E;  3Q3M C;  3TSS A;  1PGA A;  2AEH A;  3B2G A;  4ZYS A;  2WXO A;  1OGW A;  1Y56 A;  2V1Y A;  1V2Y A;  3IG3 A;  1YX6 B;  4WH4 A;  2K5P A;  2J0K A;  2AWT A;  3HM3 A;  4W9H A;  2ZJD A;  4TV3 A;  2K0P A;  2NPT A;  2QIE B;  2LGY A;  4PYU A;  2WDQ B;  1YJ1 A;  3CWI A;  4ICU A;  4ZRK A;  4FA6 A;  2WDT B;  2J52 A;  3ZXV A;  3VFK A;  4KVG B;  2KLG A;  2LXA A;  3ZNG C;  2IO2 B;  3DVG Y;  3CST A;  2IND C;  1J7B A;  1TS2 A;  1B9R A;  4TQ1 A;  1SE9 A;  1LXD A;  2N7J A;  3T9L A;  3WCQ A;  1WE6 A;  1L0Y B;  3ZGZ A;  2BBC A;  3MFG A;  1YX5 B;  1ZDX A;  4LDT B;  1VZ7 A;  4LNK A;  4RGO S;  1T5X D;  4EZL A;  2X8X X;  2W9N A;  2Y5B B;  3EC8 A;  1GC6 A;  4NAM A;  2LMC A;  4A20 A;  1I4G A;  3N30 A;  4AJW A;  1AN8 A;  1FPY A;  2D5G A;  2RR9 A;  2BKF A;  3NVY A;  4M00 A;  2BYV E;  4MGK E;  2LGS A;  4FLH A;  2K8B A;  2ZPY A;  3WA0 A;  4TMA B;  1E8Z A;  4K7S A;  4JPS A;  1HZ5 A;  2D3B A;  1V9J A;  3Q3J A;  1ZW7 A;  3BVG A;  2DX5 B;  2N0S B;  4HWI B;  3N1Y C;  3TJP A;  3WAM A;  4ACF A;  3P1M A;  4MT5 A;  4LJP B;  4WWN A;  1MI0 A;  2KC1 A;  4M8M A;  4ZRP A;  2DBY A;  4HKQ A;  4JX1 C;  1ET6 A;  4HK2 A;  3H7S A;  2GLS A;  5J17 A;  1VR9 A;  2ZW1 A;  1RFK A;  5J2R A;  1DOY A;  3ZNI D;  1PDX A;  4A3O A;  4BZA A;  3TL5 A;  2KLC A;  5HI1 A;  4C7Y A;  4WJN A;  4NAW B;  1C4P A;  1WM3 A;  4GOC A;  3C8Y A;  3Q8C A;  3AE2 B;  4C80 A;  3AM9 A;  4GDK B;  1NI2 A;  5BO4 B;  3BII D;  1LGR A;  3K9O B;  4HJK A;  4DXG A;  4EFO A;  2MJD A;  4HCN B;  3U7Z A;  1A5R A;  3C0R B;  4DXA B;  2KTR A;  3GB1 A;  3UI3 A;  2PMV A;  2WXH A;  4AUQ C;  2NBW B;  3R2I A;  1K50 A;  2LGD A;  2FCM A;  1XEE A;  1JRU A;  1ZUD 2;  2E6X A;  1IGD A;  3ETR A;  4I6L B;  2O2V A;  1S1Q B;  2ON8 A;  1HEZ E;  2NVU I;  1C4C A;  1NVI D;  1MPE A;  4KSK C;  3U30 A;  3QWZ B;  2K3U A;  1YOV B;  3APF A;  2DZJ A;  1TKY A;  4O1N A;  4KDI C;  3EHV A;  2Z0E B;  3JVZ X;  4IKG A;  2LZ6 A;  4WWP A;  4ICV A;  3A33 B;  3KQ4 A;  1WX7 A;  1JWB D;  1F1H A;  1QOF A;  1XCT L;  3GOE A;  4US9 A;  4BKG A;  4JWS C;  3DHH C;  4OZB A;  2MQJ A;  4FJY A;  1UBQ A;  2HJ8 A;  1UD7 A;  3RNB C;  1WX9 A;  4MJS A;  2R2O A;  3KYC D;  1C3T A;  1ZOY B;  2QEJ C;  1GB1 A;  4WQM A;  2WXN A;  1UEL A;  1QOA A;  4OHJ A;  1JRO A;  2BT6 A;  1MG4 A;  3QC8 B;  3L10 B;  2KMC A;  3TEW A;  2W54 A;  2LJ5 A;  1FXI A;  3WAN A;  4ANU A;  1JRP A;  2ZEQ A;  5JHA A;  2OJR A;  1N60 A;  2C60 A;  2R2Q A;  3GZN B;  5BYS A;  1OTR B;  2K25 A;  3DVG X;  5IAA C;  3PGE A;  1KLV A;  3LXF A;  4ZDV A;  3AU4 A;  3A9J B;  2JXT A;  3PHW B;  4DHZ B;  1WJU A;  2RGF A;  2D11 A;  3Q3N C;  3AH7 A;  4F8C B;  4KGS A;  3Q3O C;  3CIR B;  1N62 A;  1YN4 A;  1HTQ A;  1AW7 A;  3R66 C;  3FAH A;  3R8B A;  3P4S B;  2DAJ A;  4J6I A;  1XLQ A;  1SE3 A;  1KM7 A;  1N5X A;  1KTK A;  1FNW A;  1NDD A;  2KDI A;  5CHV C;  1KLG D;  2JY6 A;  3UQA A;  5BYR A;  4A90 A;  4YT0 B;  4MGZ E;  2DZK A;  3B0A A;  2FBW B;  2O6V D;  2V4L A;  2MA9 B;  4REZ A;  3V62 A;  1I4R A;  1WMH A;  5D7G A;  4ARC A;  2Y3A A;  4K81 A;  3PLV A;  3WAP A;  3OLM D;  1HE8 A;  2N7E A;  2C7H A;  3QA8 A;  1K8R B;  4RM8 A;  2IZV B;  1TYG B;  1XF5 L;  1UGM A;  1RWS A;  2LHD A;  5AZG A;  1WE7 A;  2JRI B;  4II3 B;  3ZJU A;  2KVZ A;  3AV8 A;  4RMA A;  3TCA A;  4HPM B;  3ABV B;  2EEL A;  2OOB B;  3TBL D;  3N3K B;  5H8Y E;  1VZ6 A;  2EMT A;  2G4D B;  2WXR A;  1KFY B;  2N4F A;  3B1L X;  5JXV A;  1K52 A;  4E74 A;  1TY0 A;  3V05 A;  3N9Y C;  1D5M C;  2G45 B;  3UGB B;  3ZJV A;  4BBN C;  1ESF A;  4XWT A;  3V60 A;  2KQ7 A;  3VUY A;  1F2R C;  1FO4 A;  3DBL I;  3L17 A;  3RYT A;  2XK5 B;  1T0Y A;  2IDY A;  2AX5 A;  3V61 A;  1SB3 C;  1NYQ A;  2MW5 A;  1U4A A;  4WAF A;  1J7A A;  2BWE S;  4W9D A;  5FK9 C;  1IUE A;  3KUD B;  4GIV A;  1FRD A;  1V49 A;  4MJS B;  4B0M A;  1WJ6 A;  2ZVN A;  2L00 B;  1GUA B;  2J0J A;  4S17 A;  4G0N B;  5IN7 A;  4FXC A;  2CJO A;  3T3N A;  3ZNH B;  1OEY J;  2Z8L A;  1Q5W B;  4LJO B;  2V9H A;  1D5X C;  4JLC A;  1Q10 A;  3VUX A;  4EKU A;  4L1B A;  1J19 A;  3M3J A;  4IM3 A;  1KRH A;  3X0W A;  2WXP A;  1WIA A;  3ZVV A;  1UNS A;  3RT3 B;  3DBS A;  5IOI A;  1TZ1 A;  3A9J A;  1TTN A;  2B3A A;  4USA A;  4FHJ A;  1TS3 A;  2DAF A;  1F2R I;  1NYR A;  3RNA C;  4WWM A;  4LNI A;  2LUM A;  4BBN F;  1Y8R C;  4YXD B;  4NQK E;  4HDO A;  3AEC B;  1WGK A;  4RF1 A;  3ML9 A;  4PK1 A;  1E7U A;  4KZC A;  4P16 A;  4XZ4 A;  2ZPN A;  4EEW A;  4PS3 A;  1MHH E;  4NJ7 A;  2W55 A;  5BMI A;  3AMZ A;  3GZN I;  1TZO A;  4X57 B;  1F0Z A;  5G2N A;  1VJK A;  1L5P A;  1WMH B;  1S3S G;  4DQO C;  4P6V F;  3PV1 A;  4P1C C;  2WNM A;  4EOY A;  1N63 A;  2PVO D;  1K53 A;  1V5T A;  3A9K A;  1PUT A;  3AI5 A;  3NS1 A;  2NMQ A;  4NZL B;  4NPN A;  5HHD G;  2BS4 B;  2KJ6 A;  1WGD A;  2L3Z A;  4KSL C;  4MH0 E;  5TR5 A;  2IGH A;  1WZ3 A;  1ZXI A;  2MP2 A;  1ZKH A;  1ZXH A;  3ZUN A;  3NUH B;  3NJT A;  1E7P B;  2LWP A;  2LFI A;  2LVO A;  1E7V A;  1TBE A;  4C4V B;  4RF0 A;  1XXG A;  3RZF A;  1TIF A;  2ONQ A;  2IY1 B;  1KLU D;  1QIL A;  1KOT A;  4RGM A;  5D3D A;  3RMK C;  1C76 A;  4OZC A;  2WS3 B;  1E8Y A;  2OED A;  4PYZ A;  2BS3 B;  3VTU A;  2J0M A;  2CHW A;  2KDF B;  5LXI B;  5IKC M;  1TGZ B;  3I3T B; 
#chains in the Genus database with same CATH homology
 1PDX A;  2KQ4 X;  2WXL A;  2V4I B;  1ROE A;  4N6E B;  5EE0 A;  1F77 A;  2ICI A;  1GAQ B;  5HI1 A;  4C7Y A;  4NAW B;  1C4P A;  3OWE B;  3U52 E;  3C8Y A;  3Q8C A;  3AE2 B;  4C80 A;  3AM9 A;  1I4Q A;  4GDK B;  3NVZ A;  3HVZ A;  2EKI A;  3BII D;  2WXJ A;  3AE9 B;  2JYE A;  4DXG A;  3AED B;  4M0W A;  2MJD A;  3U7Z A;  1I4P A;  5TSS A;  3IT4 B;  4EE2 A;  4HJG E;  3U2S C;  2KN4 A;  3NVV A;  3AE8 B;  3GB1 A;  3UI3 A;  2PMV A;  1WRI A;  2R61 A;  4JE3 B;  2WXH A;  4DXF A;  2DYM A;  3R2I A;  4L23 A;  1V8C A;  3VRA B;  2LHE A;  2VZK B;  3VR9 B;  1HXY D;  1DOY A;  1K50 A;  1SSN A;  2X38 A;  5HFY A;  1XEE A;  2PW9 A;  1ZUD 2;  1L0X B;  2E6X A;  1IGD A;  4GDL B;  1YN5 A;  4LTU A;  3ETR A;  1CK1 A;  1EM7 A;  2ON8 A;  1HEZ E;  3T3O A;  1P7E A;  1EU3 A;  1RM6 C;  1UUP A;  4NJC A;  5G5G A;  2LJI A;  2YEP B;  2K22 A;  1KF6 B;  3Q8E A;  2BTE A;  1C4C A;  3EGR A;  1NVI D;  1MPE A;  2M19 A;  1VLB A;  1SBB B;  1C78 A;  2K3U A;  1OFF A;  3NVW A;  1IGC A;  2L32 A;  2HDE A;  1EWC A;  3BWU D;  3IXS A;  3ZQ4 A;  1NEN B;  2E3T A;  1ZDV A;  2JU6 X;  1T3Q A;  1TKY A;  4KKI A;  4O1N A;  1YJI A;  4RGN A;  4A8X C;  3VR8 B;  4LLG M;  3SFE B;  4IKG A;  5C3J B;  3AE4 B;  2WLB A;  1WYG A;  4US8 A;  3KQ4 A;  1JWB D;  1QOF A;  1V1P B;  1XCT L;  4US9 A;  1JWU D;  4JWS C;  4OZB A;  4ITK A;  3LB8 C;  3IT6 B;  5T8I A;  3AE6 B;  1FCL A;  3VQI A;  2JX5 A;  3Q8F A;  1FXA A;  1E10 A;  1PGX A;  2LGI A;  4AQ7 A;  4J3O D;  2WQY B;  2WXM A;  4XE0 A;  2QMT A;  3B9J A;  1ZOY B;  2QEJ C;  1GB1 A;  1L4Z B;  3AN1 A;  4WQM A;  2WXN A;  1M4V A;  1QOA A;  2AQ3 B;  1L6U A;  1BXT A;  2XN9 C;  3AE7 B;  4OHJ A;  1JRO A;  2IGG A;  4ZOH C;  2H89 B;  3AB5 A;  4D2K A;  1L6V A;  1UWX A;  2BT6 A;  2YEP F;  3P42 A;  2N9L A;  4MAC A;  1N5W A;  1D6E C;  3J9C A;  4RH6 A;  3TEW A;  2W54 A;  3O13 A;  3H8H A;  1FXI A;  3EA6 A;  2W82 A;  4LK0 M;  1JRP A;  1SF0 A;  3Q8B A;  1N60 A;  1DOI A;  2TSS A;  4MH8 A;  2H88 B;  1ENF A;  5BYS A;  1STE A;  4ZHP A;  4YTN B;  1ZP0 B;  3W9C B;  4HRO A;  3LXF A;  3BZD B;  2JXT A;  4A9A A;  1SE4 A;  4HRS A;  3E56 A;  4MM3 B;  3AH7 A;  1JWA D;  1YQ4 B;  2NTT A;  4KGS A;  2BB5 A;  5GXG B;  4KX6 B;  2WXQ A;  4XWW A;  3CIR B;  1N62 A;  1YN4 A;  1GB4 A;  1PGB A;  1AW7 A;  3LYY A;  3FAH A;  1WSP A;  3R8B A;  3P4S B;  4A6Q A;  1HZ6 A;  3AEB B;  5G5H A;  2BYT A;  5BYQ A;  1XLQ A;  1SE3 A;  4AS1 A;  1N5X A;  1UWM A;  1KTK A;  1CZP A;  1FNW A;  3U4E G;  4ZHO A;  1IBX A;  1TS5 A;  5AUI A;  1JWS D;  1HQR D;  1KLG D;  3MC0 B;  1TKG A;  2HTM E;  1J7C A;  2WXI A;  5BYR A;  2G9H D;  4A90 A;  4YT0 B;  3BK1 A;  1TJE A;  2N9K A;  4UDU C;  3IAS 1;  3W1S A;  3ZYY X;  3GS2 A;  3MHZ A;  1FMA D;  2M56 B;  2FBW B;  1QOG A;  2J42 A;  2Y5P A;  4L2Y A;  1D4B A;  1EWY C;  2I38 A;  3TUO A;  4REZ A;  1I4R A;  1B1Z A;  2DYO A;  4PT5 A;  1I7H A;  4ARC A;  5D7G A;  2WXF A;  1ET9 A;  1JW9 D;  4RNA A;  5FR3 A;  1BUI C;  3HUI A;  1YNT E;  3DWG C;  2Y3A A;  1FD6 A;  1C4A A;  3W2D A;  2PTL A;  3AE1 B;  4CQN A;  1E9M A;  1FNV A;  1XO3 A;  2QSD A;  1YQ3 B;  5AUK A;  3TEY A;  1SXT A;  3KWV A;  1EU4 A;  2IJ0 A;  3Q69 A;  1TYG B;  1XF5 L;  3L4P A;  1I4X A;  1RYJ A;  1XLO A;  1YJJ A;  1RWS A;  1ZPS A;  4B0E A;  1NEK B;  3AEA B;  4OVZ A;  1BML C;  1AYF A;  2LHD A;  1C77 A;  1I4H A;  1IBX B;  1D5Z C;  2RMM A;  3GP7 A;  3SEB A;  3DWM A;  2MJ3 A;  3ZJU A;  1FCC C;  3AV8 A;  1T6B X;  2IPK D;  2VZK D;  4H2A A;  3ABV B;  2NTS A;  4YTM B;  4OW0 A;  2EEL A;  3MP9 A;  3FIL B;  2IGD A;  5H8Y E;  1WWT A;  4TQ0 A;  1VZ6 A;  3NRZ A;  3PZ7 A;  4C7Z A;  2QJL A;  3BK2 A;  3SFD B;  2WXR A;  1KFY B;  1SE2 A;  1QLB B;  4KKJ A;  4ARI A;  2XNA C;  1TY2 A;  1N61 A;  3P63 A;  5JXV A;  4WUR A;  5BMH A;  3EUB 2;  1ACC A;  1K52 A;  1QQR A;  1SJH D;  1XCQ L;  2W3S A;  4TSS A;  1TY0 A;  3V05 A;  3N9Y C;  1D5M C;  1VRA B;  3ZJV A;  1FEH A;  4Q2J A;  1DOX A;  2KAC A;  2CJN A;  2KMM A;  2MJE A;  2SEB D;  1DYQ A;  1ESF A;  4YSY B;  4XWT A;  1E6E B;  4YWG G;  1GPX A;  2WP9 B;  1QF6 A;  3HVD A;  2I2Y A;  2LEK A;  3ZJT A;  1YMH E;  1C9F A;  3P4R B;  1OQQ A;  1F2R C;  2RDH A;  1FM0 D;  3BYT B;  1FO4 A;  2WXK A;  1C79 A;  4XDD A;  3TEZ A;  1FRR A;  1MHX A;  1V1P A;  2AX5 A;  2IDY A;  1JWM D;  3FIL A;  4OZA A;  1SB3 C;  4WIP A;  3BYY B;  3FC4 A;  4YTP B;  2CU3 A;  1NYQ A;  2JZP A;  2SAK A;  4WAF A;  1J7A A;  2WU2 B;  3BVZ A;  1QT9 A;  2OHF A;  2RDG A;  5EE1 A;  5FK9 C;  2J4X A;  1IUE A;  1FRD A;  3KLS X;  2WDR B;  5I4D A;  2KAJ A;  4B0M A;  4HKZ E;  3AE5 B;  3AEG B;  5BMG A;  3KWL A;  2KDM A;  2PKO A;  4GLS C;  4FXC A;  4N59 A;  4JWU C;  2INP E;  1FIQ A;  2CJO A;  2KWD A;  2QIL A;  1SJE D;  2BB6 A;  3T3N A;  2GI9 A;  2Z8L A;  2WU5 B;  1D5X C;  1SEB D;  4C56 C;  1Q10 A;  5H92 C;  3VRB B;  2G1E A;  2INN E;  2L52 A;  3RFZ B;  2AQ2 B;  1QOB A;  1KH0 A;  1CJE A;  1JQ4 A;  3AEF B;  2PIA A;  5HG2 A;  4L1B A;  1HA5 A;  1KRH A;  4R3D A;  2WXP A;  2L1A A;  2JWU A;  2V0G A;  1UNS A;  2B76 B;  3W5U B;  3NZ3 A;  3P4P B;  3IAM 1;  2DWQ A;  2JSV X;  3AEE B;  5FKA C;  4RCO A;  3TSS A;  1PGA A;  1GOZ A;  4KGT A;  3B2G A;  4ZYS A;  2WXO A;  4USA A;  1Y56 A;  1NI3 A;  2MEK A;  1TS3 A;  1F2R I;  1NYR A;  4N58 A;  4WH4 A;  2K5P A;  4WWM A;  1L0V B;  1L4D B;  2LUM A;  2FUG 1;  4YXD B;  1XLP A;  2K0P A;  4IDI A;  2QIE B;  3R2T A;  2WDQ B;  3AEC B;  3CWI A;  1WGK A;  2PLP A;  4RF1 A;  2WDV B;  3TEX A;  3Q8A A;  5EE9 A;  2J52 A;  2JYT A;  3BVM A;  2WXG A;  4P16 A;  1A70 A;  4A55 A;  1AWD A;  2L83 A;  2K9X A;  1MHH E;  1ZE3 D;  2BW2 A;  2GRI A;  2W55 A;  1UGJ A;  5BMI A;  1FFU A;  1J7B A;  1FNU A;  3AMZ A;  1TS2 A;  3I9V 1;  5C2T B;  1B9R A;  1TZO A;  4TQ1 A;  1JCK B;  3V3X A;  4IOI E;  2N7J A;  1F0Z A;  1VJK A;  1V1O A;  1L5P A;  3WCQ A;  2DLB A;  5E6J A;  4DQO C;  2V3N A;  3B2F A;  1L0Y B;  3ZGZ A;  2V3P A;  3AE3 B;  2BBC A;  4P6V F;  3MFG A;  3URY A;  2FE8 A;  5EE3 A;  1ZDX A;  1VZ7 A;  2WNM A;  5MPO A;  3HRD D;  1JML A;  1R7S A;  4RGO S;  1T5X D;  2GB1 A;  1N63 A;  2PVO D;  1K53 A;  2J53 A;  1K51 A;  2BS2 B;  1PUT A;  1YN3 A;  4YSZ B;  1SIJ A;  4YSX B;  2AQ1 B;  3NS1 A;  2NMQ A;  3SR6 A;  4NZL B;  4ZRQ A;  5HHD G;  2BS4 B;  1V97 A;  1VDV A;  4NAM A;  2LMC A;  1I4G A;  2IGH A;  1AN8 A;  1ZXI A;  2D5G A;  2RPV A;  1ZXH A;  3I57 A;  1E0Z A;  1OQR A;  1QKZ A;  1MVK A;  2ZW0 A;  3NVY A;  2ACZ B;  3NUH B;  4RFB A;  1E7P B;  2LFI A;  1JAL A;  2W3R A;  4RF0 A;  1XXG A;  2PVG C;  1PFD A;  1XLN A;  3PO0 A;  3E9S A;  4TMA B;  4HEA 1;  2ONQ A;  4JPS A;  1TKE A;  4RGT A;  1HZ5 A;  1KLU D;  1QIL A;  3BVG A;  5D3I B;  3MJ5 A;  2N0S B;  4RGM A;  4KGR A;  5D3D A;  2Y5C A;  3P1M A;  1C76 A;  4MT5 A;  4OZC A;  2WS3 B;  4XDC A;  2OED A;  2JQR B;  3PZ8 A;  1MI0 A;  3P4Q B;  1LO5 D;  2BS3 B;  4ZRP A;  2DBY A;  4HKQ A;  1P7F A;  4JX1 C;  1VZ8 A;  1CQV A;  1ET6 A;  2Q5W D;  1DGJ A;  1WXQ A;  1PYW D;  2MH7 A;  1VR9 A;  2M0A A;  5LNK 1;  2ZW1 A;  1RFK A;  1FFV A;  1TS4 A;  3W5V B;  3RPF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...