1XO3A

Solution structure of ubiquitin like protein from mus musculus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2900073H19
publication title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xo3A00
1EWYC 4JX1C 5C3JB 1SIJA 2KMMA 2LEKA 2WQYB 5H92C 1L5PA 1JALA 1AWDA 3AV8A 2WS3B 1N5WA 2MH7A 1SB3C 1ZOYB 3AE7B 1DGJA 2M19A 5AUKA 3EUB2 3B2FA 1XLPA 1IUEA 4C7ZA 4LTUA 1N61A 4KX6B 3P4QB 1N62A 1TKGA 3AM9A 2WDQB 1TYGB 1YQ3B 2N0SB 1E6EB 3P1MA 3AE3B 3P63A 4C80A 3NVYA 1F0ZA 1FFVA 2CJNA 1XLQA 1WWTA 1WXQA 3HRDD 4YTPB 1E7PB 5C2TB 3FAHA 1N5XA 2AX5A 1NYRA 3FC4A 3VRAB 4YXDB 5MPOA 1CZPA 1XLOA 2EKIA 2W3RA 2K22A 1JW9D 1ZXIA 3AEAB 1VLBA 3AE9B 2H89B 2W55A 3DWMA 5G5HA 3LB8C 5EE3A 1E9MA 4JWSC 1JROA 5EE9A 4A9AA 3AE1B 4USAA 2WP9B 3KWLA 3AEBB 4HROA 5EE1A 2BT6A 2DWQA 4IDIA 1PFDA 1DOXA 3W5VB 4P6VF 3CWIA 5EE0A 3AEDB 2MJDA 2WDRB 3PO0A 2PKOA 4ZOHC 4YSYB 4YTMB 3AECB 5H8YE 1E10A 5AUIA 1RFKA 1WGKA 2WU2B 3SR6A 1TJEA 4ITKA 3AE8B 1QOGA 2BS2B 3P4PB 1CJEA 1FO4A 1OFFA 5GXGB 4ZHOA 3HVZA 4YSXB 1E0ZA 1JRPA 1FRDA 2E3TA 1FIQA 1KF6B 2K5PA 2WU5B 3P4RB 1QF6A 2DBYA 1AYFA 1N63A 1DOIA 2QIEB 2W3SA 1DOYA 1A70A 1OQRA 1PUTA 1KFYB 1FMAD 2L52A 2MJ3A 3AE2B 3AEEB 3AMZA 3NVVA 1TKYA 1T3QA 1RM6C 1GAQB 2PVGC 5G5GA 2QJLA 2L83A 1JQ4A 1J7BA 3NS1A 3AEGB 1ZP0B 2PIAA 2WDVB 1SF0A 1UWMA 3DWGC 4FXCA 1PDXA 2B76B 2WLBA 1NI3A 3W9CB 2JQRB 2Y5CA 3BIID 2H88B 1RYJA 1WRIA 1OQQA 1XO3A 2BS4B 3CIRB 4JWUC 1GPXA 1YJJA 2KAJA 1N60A 4ZHPA 1L6VA 1L0VB 2Q5WD 2G1EA 3NVZA 1VDVA 4US8A 1FM0D 2W54A 3LXFA 1QOBA 4N59A 3VRBB 3VR9B 3WCQA 1QOAA 4WQMA 3AE5B 1I7HA 1FXAA 1QOFA 3AE6B 1V8CA 2CJOA 3B2GA 4YSZB 4N6EB 2FBWB 3AN1A 4WWMA 1JWAD 4US9A 1NYQA 3AE4B 1J7AA 1JWBD 4N58A 3ABVB 1L6UA 3AEFB 1QT9A 2HTME 1J7CA 1FFUA 2OHFA 2PVOD 1RWSA 3B9JA 3NVWA 3AH7A 1FRRA 1QLBB 1XLNA 1FXIA 1NEKB 2K9XA 3ETRA 3L4PA 3NRZA 4YTNB 3SFDB 4C7YA 2MJEA 3ZYYX 1V97A 1YJIA 3AB5A 1KRHA 1NVID 1TKEA 2M56B 3VR8B 2JX5A 3P4SB 2CU3A 3RPFC 3HUIA 1B9RA 3SFEB 1WYGA 1ROEA 4HRSA 1VJKA 2ACZB 4YT0B 2BS3B 1YQ4B 1NENB 1ZUD2 1R7SA 3W5UB
chains in the Genus database with same CATH superfamily
4JX1C 2K1FA 2NVUI 4W9HA 1L5PA 3EC8A 4K3CA 1WH3A 1N5WA 1VZ7A 1JRUA 1JWSD 1PQSA 2K25A 4A20A 5CTRC 2OJRA 3V60A 3QWZB 5J2RA 1ZGUB 3BYTB 1E7PB 1XEEA 3FC4A 4CHKA 3GZNB 2AYOB 1JWMD 1JW9D 1FCLA 2RMMA 2W55A 2JRIB 3L17A 5G5HA 4W9FA 5EE3A 4DXFA 1T0RC 1KOTA 3N3KB 3VVWB 1PFDA 3NZ3A 2PKOA 2PW9A 2R2QA 4KSKC 2NTSA 4KVGB 1VRAB 2RD0A 2ZCBA 1WJ6A 1T6BX 1XCTL 1P9DU 4KIKB 4AS1A 4RNAA 1Q0WB 1E5WA 2W3SA 1RFAA 2L1AA 1PUTA 3OG5A 3V6CB 1HTQA 4IKGA 4BKSD 2MBOA 1D5XC 2QJLA 1IYFA 2KO3A 2WXJA 3E56A 1TY2A 4M0WB 2C5LC 2DYOA 2RPVA 2JPHA 5BMGA 1GPXA 4IW0A 1E8ZA 3QAQA 2AQ2B 3IBEA 2M0XA 3PT2B 1Y56A 3IG3A 3KVFB 1IGCA 3DHGC 3B2GA 1QT9A 2Z59B 4MT5A 1NBFC 3AH7A 1UBQA 2XNAC 1FXIA 1NEKB 2MHJA 2KN5A 3RNCC 1WZ0A 3VR8B 1RRBA 2KX3A 4WWOA 2NBUA 4A3PA 1EF5A 4KIKA 4GB9A 4ANWA 1IPGA 1JALA 1C78A 4N9F4 1RLFA 2JT4B 2XK5B 2GBKA 4M0WA 1WR6E 3P4QB 2HTHA 3GB1A 3P1MA 4B95A 5D7GA 3HRDD 3FAHA 1HQRD 2JYTA 2V1YA 4FN2A 2R2OA 3RNBC 3PRZA 1Q5WB 2BKFA 2L7RA 2EKEC 2H89B 3V3XA 5E6NA 2K3UA 3WANA 4A9AA 2AWTA 2R61A 4IWPA 4XDCA 3S2AA 1WSPA 4YTMB 1TTNA 4EZKA 2WU2B 4NQKE 5C1ZA 2DZJA 2M0AA 3RYTA 1QILA 1NDDA 4I6LB 4BAXA 4J3OD 4NAMA 1IGDA 4URKA 4CYEA 2SEBD 3ZW3A 1JQ4A 4FJZA 2XK5A 2GBJA 2ZNVC 4G3XB 3MP9A 1PDXA 4MEMA 2H88B 1WRIA 2AQ1B 1XQQA 1X1MA 4P7IA 1C77A 2HDEA 1OTRB 2LFIA 4LNFA 4KGSA 2DENB 1SE9A 2IY1B 1D6EC 2FCSA 2N9XA 2IO2B 1FRRA 3ZRCA 4JLCA 3ZYYX 4ICUA 2M56B 4B0MA 1E7VA 1FNUA 1C4AA 2BS3B 2KMMA 1MFWA 2MQJA 2VH2A 3DCGA 5BYQA 1LGRA 1N62A 2EMTA 5FK9C 3NVYA 3ZNGC 2KANA 2LZ6A 5G55A 2OEDA 3MTNB 4A55A 2V0GA 1MJDA 1ZXIA 4XWWA 4C00A 2Z8LA 2UYZB 3T8MA 3ZIMA 4W9IA 3LB8C 2DAFA 2N1VA 1JROA 3VTWA 3GS2A 3RT3B 1GB1A 2DWQA 4GMVA 4IDIA 1DOXA 3UQAA 4UDUC 1SXTA 1YX5B 5BMHA 4TV3A 3AE8B 4WAAA 2Y5BB 1I4RA 1SE4A 1FRDA 4JPSA 4X57B 1KLGD 3RCZA 5G5GA 1JMLA 1VCBA 3NS1A 1ZP0B 2KDEB 5LLIA 3TEZA 4NJCA 2D10A 3KH0A 4G0NB 2BS4B 1XO3A 1TS3A 3ZNID 1C9FA 3NG0A 2N4FA 1SJED 2WXGA 1QOAA 1GNUA 2Y3AA 3L16A 4EZJA 2KWCA 1NYQA 3PRMB 4K81A 5DPRA 5TSSA 1SIFA 3ETRA 3IAS1 4KZCA 1XF5L 2V3NA 3DVNU 2JWZA 3KLSX 1Y8RC 1WYWB 3RNGC 2WXPA 3MC9A 3VTUA 1WXMA 2WXKA 5C3JB 3VAWA 3AV8A 2QDFA 2KHWB 1YNTE 1WGDA 1GB4A 1ZOYB 3D32A 3H8HA 4FJVB 1TBEA 3J9CA 4WH4A 4ASWC 4LCDE 3RNAC 1SBBB 1WJUA 1XLQA 4C56C 1ET6A 1VZ8A 2J0MA 2C9WB 3GE8C 5MPOA 3H9DA 1ZE3D 1VLBA 1I4GA 4RF0A 3KYCD 2TSSA 1V49A 4DDGD 4E71A 5E6PA 3BWUD 3KWLA 4P6VF 4NY0A 2GBNA 2WDRB 3TJPA 3WIMA 4WQOB 2IY0B 2KWUB 3JSVB 4MH0E 3BK2A 3ECIA 3WAOA 1ISNA 1KF6B 1QF6A 4AOFA 2K8CA 3K9PB 3T9LA 1V80A 2LXAA 4IWOA 2N9EB 1GC7A 3BK1A 3M95A 1WI0A 2BB6A 4EKUA 2WNMA 1WY8A 1OGWA 4CQNA 3PS6A 4JWUC 3MFGA 1G6JA 2K39A 2LUEA 4NNJB 4L2YA 2LGIA 3E9SA 4N59A 3QA8A 1KLUD 3ML8A 2BYEA 4N6EB 3Q3OC 1WX9A 3SDLC 3FILB 4OVUA 4KZ0A 3JYUA 3PREA 1DYQA 1ZW7A 4LJPB 4TKNA 5JZEB 2IYDB 2KZRA 3JSVA 1YN4A 2WGSA 3UIPB 3HM3A 4BKTA 4NZLB 2NR2A 1STEA 1SIJA 3PZDA 2HJ8A 3WALA 2VRRB 2PPHA 2NPTB 5TR5A 3SEBA 2JSVX 5AUKA 3I3TB 4C7ZA 4PK1A 1XXGA 2ZEQA 4YTPB 4CO7A 2WX1A 2KJRA 4NQLB 5IOIA 3FILA 2YLMA 3W1YA 4RH6A 2BT6A 4LLGM 3CMMB 2D3AA 3KUDB 3PO0A 4BBNF 2IZVB 2KFJA 4KGRA 1A5RA 2BF8B 5I4DA 4FLHA 4DHZB 1BT0A 2K8BA 1WJ4A 2QIEB 3A1QB 3Q8AA 1A70A 2GBMA 2MJ3A 1T3QA 3IT4B 2NPTA 3W1SA 2I1JA 2D07B 1OEYA 4QAYA 2LGYA 1T0YA 2LGXA 4HDQA 2AL6A 3DOWA 3A4RA 3ZKJC 2G1EA 3MC0B 4OZAA 3MJWA 4ACFA 4YSZB 2FBWB 2NTTA 2CHZA 1PGBA 2HTME 3NZSA 3NVWA 1QLBB 2BBCA 5G2NA 2N1WA 4RGNA 1XD3B 3APCA 4HEA1 5D94A 3UI3A 4HJKA 1VJKA 3IXSA 1WIAA 2V4IB 1NENB 4WWPA 4GDKB 3A1QA 4LK0M 2DLBA 4IOIE 4WJOA 3O65B 3CSTA 2IO1B 2KN4A 3EHVA 3L0WB 4BOSC 2LHEA 2GMIC 5L95C 1TYGB 1YIWA 2QHOA 4C80A 3PHWB 2KQSA 2LJ5A 4HPMB 2NMQA 4ZRKA 2KFKB 4ZYSA 1P7EA 4HWIB 4OVZA 5IAAC 2YEPB 4K7WA 4HROA 4AUQC 4I6PA 5C23A 3Q3NC 2IGDA 3DQVA 3GE3C 5DCNA 2BGFA 4EFOA 4XC2A 2GBRA 1LQBA 1V1OA 3K9OB 3R2TA 2LRUA 1I4QA 2VZKD 1ESFA 4WIPA 4GDKA 3AU5A 2AQ3B 2INNE 4XZ4A 3EGRA 1GAQB 1FNVA 2PVGC 4MJSB 3IHPC 2PIAA 1SF0A 3ALBA 4S17A 5LXIB 2INDC 1UUPA 2FUHB 2BPSA 2DX5B 1F9JA 2BKRB 2J53A 3MJ5A 1WM2A 1QOFA 1FXAA 2DZIA 1ET9A 3EFCA 2KFKA 5HHDG 1L7YA 2E6XA 1F77A 3NZUA 1UWXA 4LDTD 3QIJA 2JRHA 2LXCA 1YN5A 1H4RA 3VH4B 2PMVA 3WAMA 2C7MB 4S0RA 3AXCA 5AZGA 2LEKA 5LXHA 1J19A 2IGHA 4REZA 2WS3B 2ZW0A 1KLVA 5D2MB 5J18A 3B2FA 3P42A 4MJSA 1S1QB 2V3PA 5BYRA 3AM9A 1YQ3B 2INCC 1WXQA 4KKIA 2O6VB 1WF9A 2K0PA 2LVPA 3R3MA 4H2AA 5CHWA 3KUZA 3AEAB 4P1CC 4TQ0A 1WX7A 4M01A 4HXDA 2KLGA 1YD8U 2HD5B 1VZ6A 3URYA 5H8YE 2KDBA 1RFKA 1CJEA 2PJHA 3ENEA 2KX0A 3HVZA 1FIQA 3ZTCA 2DAJA 1DOYA 4LNIA 4IM3A 3AMZA 1FMAD 2BTEA 1R4MI 1E8XA 3PZ8A 1FPYA 2KXJA 5D6JB 4ZDVA 3U4EG 2WLBA 3CIRB 1RYJA 2AL3A 3ZJVA 4A90A 3L13A 4ZRPA 2BYFA 2J0KA 4R3DA 3R7RA 2O6VA 1VDVA 4B0EA 2N9KA 4YL8A 2J42A 2NS5A 3WCQA 4BKGA 1YMHE 1R4NI 3PLUA 2KJ6A 2Z0DB 2PVOD 3B9JA 4YTNB 2K9XA 2G9HD 3I5JC 2RPQA 4XGAB 1I4PA 3CSFA 2KMAA 3QX1A 1F1HA 2JX5A 1FNWA 2CU3A 2VH1A 3SD5A 2JUOA 4XDDA 3SFEB 5HG2A 5HI1A 4YT0B 3PSEB 4NJ6A 1ACCA 3VH3B 1WWTA 4GOCA 4OZCA 3GOEA 2N9PC 2MLBA 2C60A 4JIOU 2KK8A 3VUXA 2MH7A 2LVQA 3AE7B 2DZKA 1HXYD 3T3NA 1K53A 3C8YA 3BVZA 3P63A 1FFVA 2WXFA 4IM0A 5T8IA 2G4DB 1C76A 4KKJA 4RF1A 2GLSA 4FHKA 1FEHA 3DBHI 2KDMA 4YSYB 4LNNA 1C79A 4XX5A 3SR6A 3U7ZA 2BS2B 1UZXB 1FO4A 1FXTB 4LDTB 4TUUA 2DBYA 3AU4A 4II2B 1L4ZB 2CHXA 1P7FA 1B1ZA 4WWNA 2FUG1 3APFA 4JQWC 2AEHA 2JQRB 2YVCA 4JE3B 3DVGY 2PE6B 3GZNI 4C4VB 1P1AA 2ZVOA 1P3QU 1HTOA 3Q69A 1EF1A 3H6NA 3VRAB 1JWBD 1L6UA 1CK1A 3N30A 3L4PA 1V97A 2M17A 4ZYNA 2WX0A 1V1PB 3H7SA 2MBEA 2KTRB 1BUIC 1TS2A 3WAPA 2ACZB 2RDHA 4NJ7A 4RGOS 4BKSA 3N9YC 2LJIA 1MG4A 4MSMB 4MGYE 2D3GA 1SB3C 4IUMB 4JL9A 2ZVNA 1XLPA 4EZLA 2WXRA 1TKGA 3V05A 2N0SB 2WXNA 4GN1A 1WGHA 4A6QA 4C4VA 1P0RA 1HZ5A 2CHWA 3ZDMC 3VUYA 3KQ4A 1JWUD 5JXVA 4B9KA 5EDSA 1E90A 2ZPYA 2BW2A 4MM3B 2MX2A 2M4NA 3DBLB 2MRPA 5EE0A 1V1PA 3KYDD 2ONQA 4W9LA 2KTRA 3RI7C 3P4PB 1TY0A 2PEAA 4DHZE 2DHZA 1YJ1A 2WU5B 2E3TA 3P4RB 3X0WA 1F52A 1N63A 2C7HA 1AW7A 1L0YB 3AEEB 4K7UA 4A8XC 1WE6A 3RULA 1NI3A 2JXTA 3KWVA 1YJJA 2KDIA 3L54A 1L6VA 4FBJB 4US8A 1K8RB 2IBIB 4RGMA 4AJYB 2B3AA 3U52E 2KVZA 3DHHC 4WWMA 1H8CA 4N58A 3AEFB 3IAM1 1K51A 1FFUA 2OHFA 1MHHE 4MM3A 5KHQA 3SFDB 1ZPSA 1EU4A 1HEZE 1YJIA 2BWFA 2PLPA 3ZNHB 1WR1A 2WXHA 1B9RA 1WZ3A 1WYGA 2FAZA 1L2NA 3B0AA 1WXAA 1ZDXA 1KTKA 2KC2A 1I35A 3MC8A 2WQYB 1WFYA 2MA9B 3V61A 1I42A 1S3SG 2KYWA 3EUB2 2LASA 2INPE 3Q2AC 4F8CB 3TL5A 4L1BA 1GUAB 4F1SA 2MW5A 4A3OA 2JU6X 5C2TB 3Q8EA 3DPDA 1WX8A 1OQYA 2AX5A 4M00A 2FCQA 2NBVB 1D3ZA 2XN9C 3DVNV 3Q6BA 4WURA 4PS3A 5D3IB 4E74A 3W5VB 1MVKA 3AEDB 4MH8A 3QJZA 2D2QA 1WJNA 1QOGA 1V6EA 4G11A 1OFFA 5GXGB 2J52A 1E0ZA 4FADA 4BBNC 4MELA 1Q1OA 1D5ZC 4RGTA 3RD2A 1I4XA 2QCZA 1KFYB 1SEBD 2KACA 2JWUA 1TKYA 3ZRFA 3BY4B 3IFWB 1VD2A 3CF6E 2WDVB 1WGRA 3W9CB 2QILA 3BVMA 2UWQA 3N32A 4E3CA 2WXMA 5J17A 3LYYA 1V81A 2KD0A 2WXQA 3AE5B 3V6EB 5BMIA 1GOZA 1TZ1A 4PS7A 3FKYA 2BQQA 2KT7A 4II3B 3HVDA 1WM3A 2KOXA 1UD7A 2IGGA 3UIOB 1KH0A 3R7QA 3W2DA 3KW5B 4L23A 1HE8A 1MI0A 2WWZA 2WXLA 3TSSA 2G45B 1ZUD2 2A4ZA 1UGJA 2IO3B 1WMHB 5H92C 2L3ZA 2M1MA 2L32A 2KQ7A 2N7EA 4JGHB 3U2SC 2LGSA 1C4PA 3EECA 5CHFA 1J0GA 3N1ZC 4EE2A 2N7JA 1MG8A 2JY6A 2ZNVB 4BOZB 2PE9A 2IPKD 4D2KA 1UBIA 3AULA 2ZJDA 4GIVA 3TMPB 3LJ3A 3HK0A 3SHQA 1UNSA 1N6ZA 2WYQA 3U30A 1WE7A 2RSUA 5E6JA 4K7SA 3TIXA 1YN3A 2K6DB 4WJQA 3ZXRA 3U8ZA 2XBBC 1IBXA 4DWFA 5AUIA 4ARCA 1PGAA 2WXOA 2G3QB 2QEJC 1V2YA 3P2BA 1WMHA 3Q8CA 1DOIA 2L8JA 4W9EA 4DXAB 1Z5SB 1LXDA 2Z0EB 3BYYB 4MGIE 4DXGA 1RM6C 3DBLI 1SSNA 4HPLB 1WXVA 2SAKA 3C19A 1UWMA 4I6NB 1EM7A 2L05A 1V86A 3EA6A 5HKHA 1N60A 4LNOA 5GMVA 2EELA 3TEWA 3R8BA 3VR9B 1FD6A 4KV2A 3PV1A 2CJOA 3GP7A 2ZPNA 1JWAD 4US9A 4EUTA 5IA7A 1J7AA 3PHXB 4P1BC 3TEXA 2BB5A 1TS5A 3ZQ4A 1RWSA 4MGKE 1K52A 3NRZA 2D3BA 3HHMA 2NCNA 1NVID 1TKEA 3ZGZA 3DDCB 3MHZA 3H1UA 4KDIC 1YQ4B 4M02A 4ANXA 1ENFA 2ZZPB 1MPEA 2DYMA 1WXSA 4ANUA 2FNJB 1DGJA 2WHIA 4KX6B 3ZJTA 3OLMD 4M8MA 4DHJD 3AE3B 1F0ZA 4MSQB 4OVVA 1C4CA 2K6QA 5FKAC 2Y5PA 4AQ7A 1XT9B 2W9NA 3SU8X 2I38A 4EEWA 3QARA 2N7DA 5EE1A 2LI5A 3AEBB 1KJTA 5AZHA 2GRIA 4AJWA 3JVZX 3V62A 4HCPB 1SGHA 4W9DA 1TJEA 4ITKA 4MACA 1P98A 3RNEC 3QC8B 4PYUA 4MGZE 3AE2B 5D3DA 3W1SC 5BO4B 1E7UA 2L00B 3B08A 4PT5A 4HKZE 4FXCA 5DPTA 2B76B 1SJHD 2D5GA 1EO6A 2ZCCA 3OJ3A 1OQQA 4GDLB 3OWEB 2BYVE 3RNFC 1VR9A 1L0VB 2LUMA 3UQBA 1QOBA 2CS4A 4HKQA 3ZNZB 3VHTC 1I7HA 1TZOA 3KUCB 3PZ7A 3AN1A 3AE4B 4WJNA 3MHSD 3NUHB 3U7DA 2MJEA 1GJZA 3AB5A 4FULA 2JXXA 2IO0B 3OAWA 3TCAA 1ZKHA 2M8SA 4HRSA 4IC7B 1IP9A 4ANVA 2OOBB 3ZVVA 4GXBA 5BYSA 1R7SA 3PPAA 3UGBB 4RM8A 3H7PB 4HDOA 4RCOA 2ASQA 2V3SA 4W9GA 2A5UA 2J0JA 2JVCA 2WDTB 5IP4D 2X8XX 3L08A 4LJOB 4ICVA 4LTUA 3NHEB 2LHDA 4GDLA 5HFYA 3PRPB 1D4BA 1E8YA 1I4HA 1XLOA 1U4AA 2FIDA 2K22A 1NI2A 2REXA 2O2VB 3AE9B 3PTFC 3VUWA 3ZDTA 5AEKB 4USAA 2WP9B 2KKCA 2UU7A 4WJPA 2FCNA 4KDLB 3M62B 2V4LA 3I9V1 2VZKB 3ZTDA 1JCKB 4YSXB 4RM9A 1QQRA 2CKHB 1AYFA 3H7PA 1QZEA 1T5XD 3Q3MC 2L52A 3ZO5B 3R66C 2J7QB 2RDBC 2DNFA 2KTFA 2LD9A 3DBSA 2KVRA 3DWGC 3Q8BA 1RAXA 1UGMA 2Y5CA 3BIID 3C0RB 1OEYJ 2XEWA 3NVZA 2W54A 1CQVA 1WGYA 3AE6B 1V8CA 2O2VA 3UF8A 3N1YC 2JZ3B 3Q8FA 3DBRB 4EOYA 4DHJB 4HVBA 4KSLC 1LO5D 1TGZB 1XLNA 4OW0A 4C7YA 1M4VA 1MHXA 1ZDVA 1SE3A 3RPFC 2MEKA 3HUIA 5JHBA 3QCAA 2RDGA 2D3CA 2YEPF 3N1XC 1LFDA 1AWDA 3EFUA 2KWDA 4RMAA 1XCQL 1HZ6A 2LGDA 1N61A 3APDA 3DHIC 1T0SC 4K3BA 1E6EB 1C3TA 2MWSB 2L0TA 4TMAB 3A9JB 2C7NB 4HCNB 1FCCC 4Q2JA 4AWJA 4NAWB 5AZFA 1E9MA 5EE9A 2ZW1A 2PTLA 1UF0A 2RGFA 4IG7B 4OZBA 2NBWB 3NS8A 2FE8A 3NJTA 4ZHOA 4IM2A 5IN7A 1JRPA 3A9KB 5LNK1 3I57A 1TT5B 3RFZB 4DK5A 2GB1A 2GOWA 1TIFA 3R2IA 2JZPA 2QSDA 3L10B 4G50A 1T0QC 3A9JA 1FM0D 4J6IA 4PYZA 3LXFA 3VRBB 5KHOA 4NAWA 2WXIA 2LMCA 4ZOHC 4NPNA 1KM7A 3ABVB 3ZUNA 4B6WA 4XYCA 4FHJA 3NY5A 3QQ8B 1AARA 4TSSA 4FJYA 3P4SB 3ML9A 3VDZA 1ROEA 1PGXA 2LVOA 2KJHB 4XE0A 3RZFA 2BYTA 1YX6B 3BVGA 4YWGG 1EWYC 1V5TA 1V5OA 3A9KA 2KWVB 3ONSA 4BFRA 4W9JA 3HM6X 4F7ZA 1YQBA 3NOBA 3T3OA 2KC1A 2KLCA 3A4SC 2WDQB 3TBLD 5JHAA 2FIFA 2W82A 4ZRQA 1D5MC 1NYRA 2DZMA 4YXDB 1CZPA 2EKIA 4GGQA 2CR5A 4GSWA 1QKZA 3DWMA 4JWSC 3AE1B 4GLSC 2IDYA 1EUVB 1E8WA 3LDZE 3O13A 3TEYA 2MSED 1M94A 3AECB 2I2YA 2MP2B 1EWCA 1Z2MA 4PS8A 4O1NA 2MBQA 3WA0A 1SE2A 3ZXVA 2MCNB 2K5PA 1L0XB 2KDFB 3M3JA 1OQRA 4LNKA 1YOVB 1CMXB 2MBHA 1EU3A 2JZZA 4W9CA 3AEGB 4XWTA 3OJ4B 1PYWD 1C1YB 3Q3JA 2IJ0A 1WRDB 3QHTA 4GU2A 3UINB 4WAFA 2V9HA 4FA6A 4OHJA 4KGTA 4HPPA 3RN9C 2FCMA 2DYBA 3AI5A 2L0FA 5DPSA 4ZHPA 1WGGA 4M8NA 3I63C 2HE7A 4K1RB 1KRHA 2ON8A 2KNBA 2MP2A 3DVGX 3JW0X 5E6OA 4ZRIA 5CX3A 3HIZA 2OJWA 3DBRI 3W5UB 3PGEA 1TS4A 2EMSA 2D11A 1HA5A 1L4DB 4RFBA 4BVUC 3QK0A 4ARIA 1R4MB 3VFKA 5IKCM 2M19A 1IUEA 1AN8A 4HJGE 4TQ1A 3RMKC 4HK2A 3Q14C 1IBXB 2CJNA 1UH6A 1N5XA 2W3RA 4DBGA 3PVLA 5JH5C 3BINA 3VTVA 2O6VD 3ZLZA 5CHVC 1R4NB 2QMTA 2LWPA 1UELA 3IT6B 4MDKE 2BVCA 2ICIA 1F2RI 3RZWC 4P16A 1F2RC 1V9JA 3X23A 3CWIA 2MJDA 1E10A 1WGKA 5FR6A 1BXTA 2JF5A 4BZAA 3TUOA 5DPWA 3M63B 4ZRJA 3N20C 3VQIA 5FR3A 3NVVA 4HLEA 4DQOC 2BWES 2K8HA 2L83A 1J7BA 2HJ1A 3A33B 2JYEA 2N9LA 3B1LX 1J8CA 1Q10A 3RUIB 1LM8B 4DDID 2KAJA 3VXWA 2I1KA 2Q5WD 2L76A 2MBBB 2QC8A 5L83A 4AP4C 2GI9A 4WQMA 1GC6A 2X38A 2CU1A 2J4XA 1J7CA 2RR9A 2KMCA 3Q3FA 4W9KA 3PLVA 4IWQA 3DBHB 3ZJUA 3IVFA 2G4SA 2KQ4X 1GG3A 1K50A 1ZXHA 3BZDB 2LRWA 5IO9A 1BMLC
chains in the Genus database with same CATH topology
4JX1C 1SIJA 2LJIA 1L5PA 4RCOA 1N5WA 1VZ7A 1SB3C 3SEBA 2JSVX 5AUKA 1XLPA 4C7ZA 4LTUA 1JWSD 2WXRA 1TKGA 2LHDA 3V05A 1XXGA 2N0SB 2WXNA 5HFYA 4YTPB 3BYTB 1E7PB 1XEEA 4A6QA 3FC4A 1D4BA 1HZ5A 1I4HA 1XLOA 2K22A 1JWMD 1JW9D 3KQ4A 1JWUD 3AE9B 2RMMA 1FCLA 2W55A 5JXVA 3FILA 5G5HA 5EE3A 4DXFA 2BW2A 4RH6A 2WP9B 4USAA 4MM3B 2BT6A 4LLGM 1PFDA 3NZ3A 5EE0A 1V1PA 3PO0A 2PKOA 2ONQA 2PW9A 3I9V1 2NTSA 2VZKB 1VRAB 4KGRA 1T6BX 1XCTL 3P4PB 1TY0A 5I4DA 1JCKB 4YSXB 1QQRA 2E3TA 2WU5B 3P4RB 4AS1A 1AYFA 1N63A 2QIEB 4RNAA 1T5XD 2L1AA 1A70A 2W3SA 1PUTA 3Q8AA 2MJ3A 2L52A 1AW7A 1L0YB 3AEEB 4IKGA 1T3QA 3IT4B 3W1SA 1D5XC 2QJLA 2WXJA 4A8XC 3E56A 1TY2A 2DYOA 2RPVA 3DWGC 3Q8BA 1NI3A 2Y5CA 5BMGA 2JXTA 3BIID 1GPXA 3KWVA 1YJJA 1L6VA 2AQ2B 2G1EA 3MC0B 3NVZA 4US8A 4OZAA 3N9YC 2W54A 1CQVA 1Y56A 4RGMA 1IGCA 3AE6B 3B2GA 3U52E 1V8CA 4YSZB 3Q8FA 4WWMA 2FBWB 2NTTA 4N58A 1PGBA 3AEFB 3IAM1 1QT9A 2HTME 1K51A 1FFUA 2OHFA 4MT5A 1LO5D 3NVWA 3AH7A 1MHHE 1QLBB 1XLNA 1FXIA 1NEKB 2BBCA 2XNAC 3SFDB 4OW0A 1ZPSA 4C7YA 1EU4A 1HEZE 1YJIA 4RGNA 1M4VA 1MHXA 3VR8B 2PLPA 1ZDVA 1SE3A 3RPFC 4HEA1 2MEKA 2WXHA 3HUIA 1WYGA 1B9RA 3UI3A 1VJKA 2RDGA 3IXSA 2V4IB 1ZDXA 1NENB 2YEPF 1KTKA 2WQYB 4GDKB 4LK0M 1JALA 1AWDA 2DLBA 4IOIE 2KWDA 1C78A 1XCQL 2KN4A 1HZ6A 3EUB2 2LHEA 2INPE 1N61A 4M0WA 3P4QB 4L1BA 1TYGB 3GB1A 1E6EB 3P1MA 5D7GA 2JU6X 4C80A 4TMAB 5C2TB 3Q8EA 3HRDD 3FAHA 1HQRD 2JYTA 2AX5A 1FCCC 4Q2JA 4NAWB 2H89B 2NMQA 3V3XA 2K3UA 2XN9C 4ZYSA 4WURA 1P7EA 1E9MA 4OVZA 5D3IB 5EE9A 4A9AA 2YEPB 4HROA 2R61A 2ZW1A 2PTLA 2IGDA 3W5VB 1MVKA 3AEDB 4XDCA 1WSPA 4YTMB 4MH8A 4OZBA 2WU2B 1QOGA 2M0AA 1QILA 2FE8A 1OFFA 5GXGB 1V1OA 2J52A 3R2TA 4ZHOA 1E0ZA 1JRPA 1I4QA 2VZKD 1ESFA 5LNK1 4J3OD 3I57A 1D5ZC 4RGTA 4WIPA 1I4XA 3RFZB 4NAMA 2AQ3B 1IGDA 1KFYB 1SEBD 2INNE 2GB1A 2KACA 2JWUA 1TKYA 3EGRA 1GAQB 1FNVA 2PVGC 2SEBD 3R2IA 2JZPA 2QSDA 1JQ4A 2PIAA 2WDVB 1SF0A 3MP9A 1PDXA 3W9CB 2QILA 3BVMA 2H88B 1WRIA 2AQ1B 1UUPA 2WXMA 3LYYA 1C77A 1FM0D 3LXFA 3VRBB 2HDEA 2J53A 2WXQA 2LFIA 3MJ5A 3AE5B 1QOFA 1FXAA 5BMIA 1GOZA 2WXIA 4KGSA 1ET9A 5HHDG 2LMCA 4ZOHC 2E6XA 1F77A 3ABVB 1D6EC 1UWXA 3HVDA 1FRRA 2IGGA 4TSSA 3ZYYX 1YN5A 1KH0A 3W2DA 2M56B 4B0MA 3P4SB 4L23A 1MI0A 2PMVA 1FNUA 1ROEA 1PGXA 1C4AA 2WXLA 4XE0A 2BYTA 3TSSA 2BS3B 3BVGA 1ZUD2 1UGJA 4YWGG 1EWYC 2KMMA 2LEKA 5H92C 2IGHA 4REZA 2L32A 2WS3B 3T3OA 3U2SC 2ZW0A 1C4PA 3B2FA 3P42A 4EE2A 2N7JA 2V3PA 5BYRA 5BYQA 2IPKD 1N62A 3AM9A 2WDQB 1YQ3B 4D2KA 5FK9C 3NVYA 1WXQA 4KKIA 2W82A 4ZRQA 2K0PA 2OEDA 1D5MC 1NYRA 4YXDB 1CZPA 2EKIA 4H2AA 4A55A 2V0GA 1UNSA 1ZXIA 4XWWA 3AEAB 2Z8LA 1QKZA 3DWMA 3LB8C 5E6JA 4TQ0A 4JWSC 1JROA 3GS2A 3AE1B 4GLSC 1GB1A 1YN3A 2IDYA 2DWQA 3O13A 4IDIA 1DOXA 1VZ6A 3TEYA 4UDUC 3URYA 1SXTA 5BMHA 3AECB 5H8YE 2I2YA 1IBXA 5AUIA 1RFKA 4ARCA 1EWCA 1PGAA 4O1NA 3AE8B 2WXOA 1CJEA 1SE2A 1I4RA 2QEJC 1SE4A 3HVZA 1FRDA 1FIQA 2K5PA 1L0XB 4JPSA 3Q8CA 1KLGD 1DOYA 1DOIA 1OQRA 3AMZA 1FMAD 2BTEA 3BYYB 4DXGA 1RM6C 5G5GA 1JMLA 1EU3A 3PZ8A 1SSNA 3NS1A 2SAKA 3AEGB 1ZP0B 4XWTA 1UWMA 3U4EG 3TEZA 2WLBA 4NJCA 1EM7A 3CIRB 1PYWD 1RYJA 2BS4B 1XO3A 3EA6A 1TS3A 3ZJVA 1C9FA 4A90A 1N60A 4ZRPA 2IJ0A 4R3DA 2EELA 3TEWA 1VDVA 4B0EA 2N9KA 3R8BA 1SJED 2J42A 3VR9B 3WCQA 2WXGA 1FD6A 1QOAA 4WAFA 1YMHE 2CJOA 2Y3AA 3GP7A 1JWAD 4US9A 1NYQA 1J7AA 4OHJA 3TEXA 4KGTA 5TSSA 2BB5A 1TS5A 2PVOD 3ZQ4A 1RWSA 3B9JA 1K52A 3ETRA 3NRZA 4YTNB 4ZHPA 2K9XA 2G9HD 1I4PA 1KRHA 3IAS1 1NVID 1XF5L 2V3NA 1TKEA 2ON8A 2JX5A 3KLSX 1FNWA 2CU3A 3ZGZA 4XDDA 3SFEB 5HG2A 3MHZA 4YT0B 5HI1A 1YQ4B 2WXPA 1ACCA 2WXKA 1WWTA 3W5UB 1TS4A 5C3JB 1ENFA 4OZCA 1HA5A 1L4DB 3AV8A 4RFBA 1MPEA 4ARIA 1YNTE 2DYMA 2MH7A 1GB4A 1ZOYB 3AE7B 3H8HA 1DGJA 1HXYD 2M19A 3T3NA 1IUEA 1K53A 3J9CA 4WH4A 4KX6B 3ZJTA 3C8YA 1AN8A 4HJGE 4TQ1A 1SBBB 3BVZA 3AE3B 3P63A 1F0ZA 1IBXB 1FFVA 2CJNA 1XLQA 2WXFA 4C56C 1ET6A 1VZ8A 5T8IA 1C76A 1N5XA 4KKJA 1C4CA 5MPOA 4RF1A 5FKAC 2W3RA 1ZE3D 2Y5PA 1VLBA 4AQ7A 1I4GA 4RF0A 2TSSA 2I38A 2QMTA 3IT6B 5EE1A 1FEHA 2ICIA 3AEBB 3BWUD 3KWLA 1F2RI 2KDMA 2GRIA 4P16A 1F2RC 4P6VF 3CWIA 2MJDA 2WDRB 1E10A 4YSYB 1C79A 1WGKA 3SR6A 1BXTA 1TJEA 4ITKA 4MACA 3U7ZA 2BS2B 3BK2A 1FO4A 3TUOA 1KF6B 1QF6A 2DBYA 3VQIA 3AE2B 1L4ZB 1P7FA 5FR3A 3NVVA 5D3DA 1B1ZA 4DQOC 3BK1A 2L83A 2BB6A 1J7BA 4PT5A 2FUG1 2JYEA 2WNMA 4HKZE 4FXCA 2B76B 1SJHD 2N9LA 2JQRB 2D5GA 4CQNA 1Q10A 1OQQA 4GDLB 4JE3B 4JWUC 3OWEB 2KAJA 3MFGA 1VR9A 4L2YA 1L0VB 2Q5WD 2LUMA 2LGIA 1QOBA 3E9SA 4N59A 4HKQA 2GI9A 4WQMA 1KLUD 1I7HA 1TZOA 2X38A 2J4XA 3PZ7A 3AN1A 3Q69A 4N6EB 3FILB 3AE4B 3VRAB 1JWBD 1L6UA 1CK1A 1J7CA 3NUHB 3L4PA 1DYQA 3ZJUA 2MJEA 1V97A 3AB5A 1V1PB 2KQ4X 1K50A 1YN4A 1ZXHA 1BUIC 4HRSA 1TS2A 2ACZB 1BMLC 2RDHA 3BZDB 4RGOS 4NZLB 5BYSA 1STEA 1R7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWY C;  4JX1 C;  5C3J B;  1SIJ A;  2KMM A;  2LEK A;  2WQY B;  5H92 C;  1L5P A;  1JAL A;  1AWD A;  3AV8 A;  2WS3 B;  1N5W A;  2MH7 A;  1SB3 C;  1ZOY B;  3AE7 B;  1DGJ A;  2M19 A;  5AUK A;  3EUB 2;  3B2F A;  1XLP A;  1IUE A;  4C7Z A;  4LTU A;  1N61 A;  4KX6 B;  3P4Q B;  1N62 A;  1TKG A;  3AM9 A;  2WDQ B;  1TYG B;  1YQ3 B;  2N0S B;  1E6E B;  3P1M A;  3AE3 B;  3P63 A;  4C80 A;  3NVY A;  1F0Z A;  1FFV A;  2CJN A;  1XLQ A;  1WWT A;  1WXQ A;  3HRD D;  4YTP B;  1E7P B;  5C2T B;  3FAH A;  1N5X A;  2AX5 A;  1NYR A;  3FC4 A;  3VRA B;  4YXD B;  5MPO A;  1CZP A;  1XLO A;  2EKI A;  2W3R A;  2K22 A;  1JW9 D;  1ZXI A;  3AEA B;  1VLB A;  3AE9 B;  2H89 B;  2W55 A;  3DWM A;  5G5H A;  3LB8 C;  5EE3 A;  1E9M A;  4JWS C;  1JRO A;  5EE9 A;  4A9A A;  3AE1 B;  4USA A;  2WP9 B;  3KWL A;  3AEB B;  4HRO A;  5EE1 A;  2BT6 A;  2DWQ A;  4IDI A;  1PFD A;  1DOX A;  3W5V B;  4P6V F;  3CWI A;  5EE0 A;  3AED B;  2MJD A;  2WDR B;  3PO0 A;  2PKO A;  4ZOH C;  4YSY B;  4YTM B;  3AEC B;  5H8Y E;  1E10 A;  5AUI A;  1RFK A;  1WGK A;  2WU2 B;  3SR6 A;  1TJE A;  4ITK A;  3AE8 B;  1QOG A;  2BS2 B;  3P4P B;  1CJE A;  1FO4 A;  1OFF A;  5GXG B;  4ZHO A;  3HVZ A;  4YSX B;  1E0Z A;  1JRP A;  1FRD A;  2E3T A;  1FIQ A;  1KF6 B;  2K5P A;  2WU5 B;  3P4R B;  1QF6 A;  2DBY A;  1AYF A;  1N63 A;  1DOI A;  2QIE B;  2W3S A;  1DOY A;  1A70 A;  1OQR A;  1PUT A;  1KFY B;  1FMA D;  2L52 A;  2MJ3 A;  3AE2 B;  3AEE B;  3AMZ A;  3NVV A;  1TKY A;  1T3Q A;  1RM6 C;  1GAQ B;  2PVG C;  5G5G A;  2QJL A;  2L83 A;  1JQ4 A;  1J7B A;  3NS1 A;  3AEG B;  1ZP0 B;  2PIA A;  2WDV B;  1SF0 A;  1UWM A;  3DWG C;  4FXC A;  1PDX A;  2B76 B;  2WLB A;  1NI3 A;  3W9C B;  2JQR B;  2Y5C A;  3BII D;  2H88 B;  1RYJ A;  1WRI A;  1OQQ A;  1XO3 A;  2BS4 B;  3CIR B;  4JWU C;  1GPX A;  1YJJ A;  2KAJ A;  1N60 A;  4ZHP A;  1L6V A;  1L0V B;  2Q5W D;  2G1E A;  3NVZ A;  1VDV A;  4US8 A;  1FM0 D;  2W54 A;  3LXF A;  1QOB A;  4N59 A;  3VRB B;  3VR9 B;  3WCQ A;  1QOA A;  4WQM A;  3AE5 B;  1I7H A;  1FXA A;  1QOF A;  3AE6 B;  1V8C A;  2CJO A;  3B2G A;  4YSZ B;  4N6E B;  2FBW B;  3AN1 A;  4WWM A;  1JWA D;  4US9 A;  1NYQ A;  3AE4 B;  1J7A A;  1JWB D;  4N58 A;  3ABV B;  1L6U A;  3AEF B;  1QT9 A;  2HTM E;  1J7C A;  1FFU A;  2OHF A;  2PVO D;  1RWS A;  3B9J A;  3NVW A;  3AH7 A;  1FRR A;  1QLB B;  1XLN A;  1FXI A;  1NEK B;  2K9X A;  3ETR A;  3L4P A;  3NRZ A;  4YTN B;  3SFD B;  4C7Y A;  2MJE A;  3ZYY X;  1V97 A;  1YJI A;  3AB5 A;  1KRH A;  1NVI D;  1TKE A;  2M56 B;  3VR8 B;  2JX5 A;  3P4S B;  2CU3 A;  3RPF C;  3HUI A;  1B9R A;  3SFE B;  1WYG A;  1ROE A;  4HRS A;  1VJK A;  2ACZ B;  4YT0 B;  2BS3 B;  1YQ4 B;  1NEN B;  1ZUD 2;  1R7S A;  3W5U B; 
#chains in the Genus database with same CATH topology
 4JX1 C;  2K1F A;  2NVU I;  4W9H A;  1L5P A;  3EC8 A;  4K3C A;  1WH3 A;  1N5W A;  1VZ7 A;  1JRU A;  1JWS D;  1PQS A;  2K25 A;  4A20 A;  5CTR C;  2OJR A;  3V60 A;  3QWZ B;  5J2R A;  1ZGU B;  3BYT B;  1E7P B;  1XEE A;  3FC4 A;  4CHK A;  3GZN B;  2AYO B;  1JWM D;  1JW9 D;  1FCL A;  2RMM A;  2W55 A;  2JRI B;  3L17 A;  5G5H A;  4W9F A;  5EE3 A;  4DXF A;  1T0R C;  1KOT A;  3N3K B;  3VVW B;  1PFD A;  3NZ3 A;  2PKO A;  2PW9 A;  2R2Q A;  4KSK C;  2NTS A;  4KVG B;  1VRA B;  2RD0 A;  2ZCB A;  1WJ6 A;  1T6B X;  1XCT L;  1P9D U;  4KIK B;  4AS1 A;  4RNA A;  1Q0W B;  1E5W A;  2W3S A;  1RFA A;  2L1A A;  1PUT A;  3OG5 A;  3V6C B;  1HTQ A;  4IKG A;  4BKS D;  2MBO A;  1D5X C;  2QJL A;  1IYF A;  2KO3 A;  2WXJ A;  3E56 A;  1TY2 A;  4M0W B;  2C5L C;  2DYO A;  2RPV A;  2JPH A;  5BMG A;  1GPX A;  4IW0 A;  1E8Z A;  3QAQ A;  2AQ2 B;  3IBE A;  2M0X A;  3PT2 B;  1Y56 A;  3IG3 A;  3KVF B;  1IGC A;  3DHG C;  3B2G A;  1QT9 A;  2Z59 B;  4MT5 A;  1NBF C;  3AH7 A;  1UBQ A;  2XNA C;  1FXI A;  1NEK B;  2MHJ A;  2KN5 A;  3RNC C;  1WZ0 A;  3VR8 B;  1RRB A;  2KX3 A;  4WWO A;  2NBU A;  4A3P A;  1EF5 A;  4KIK A;  4GB9 A;  4ANW A;  1IPG A;  1JAL A;  1C78 A;  4N9F 4;  1RLF A;  2JT4 B;  2XK5 B;  2GBK A;  4M0W A;  1WR6 E;  3P4Q B;  2HTH A;  3GB1 A;  3P1M A;  4B95 A;  5D7G A;  3HRD D;  3FAH A;  1HQR D;  2JYT A;  2V1Y A;  4FN2 A;  2R2O A;  3RNB C;  3PRZ A;  1Q5W B;  2BKF A;  2L7R A;  2EKE C;  2H89 B;  3V3X A;  5E6N A;  2K3U A;  3WAN A;  4A9A A;  2AWT A;  2R61 A;  4IWP A;  4XDC A;  3S2A A;  1WSP A;  4YTM B;  1TTN A;  4EZK A;  2WU2 B;  4NQK E;  5C1Z A;  2DZJ A;  2M0A A;  3RYT A;  1QIL A;  1NDD A;  4I6L B;  4BAX A;  4J3O D;  4NAM A;  1IGD A;  4URK A;  4CYE A;  2SEB D;  3ZW3 A;  1JQ4 A;  4FJZ A;  2XK5 A;  2GBJ A;  2ZNV C;  4G3X B;  3MP9 A;  1PDX A;  4MEM A;  2H88 B;  1WRI A;  2AQ1 B;  1XQQ A;  1X1M A;  4P7I A;  1C77 A;  2HDE A;  1OTR B;  2LFI A;  4LNF A;  4KGS A;  2DEN B;  1SE9 A;  2IY1 B;  1D6E C;  2FCS A;  2N9X A;  2IO2 B;  1FRR A;  3ZRC A;  4JLC A;  3ZYY X;  4ICU A;  2M56 B;  4B0M A;  1E7V A;  1FNU A;  1C4A A;  2BS3 B;  2KMM A;  1MFW A;  2MQJ A;  2VH2 A;  3DCG A;  5BYQ A;  1LGR A;  1N62 A;  2EMT A;  5FK9 C;  3NVY A;  3ZNG C;  2KAN A;  2LZ6 A;  5G55 A;  2OED A;  3MTN B;  4A55 A;  2V0G A;  1MJD A;  1ZXI A;  4XWW A;  4C00 A;  2Z8L A;  2UYZ B;  3T8M A;  3ZIM A;  4W9I A;  3LB8 C;  2DAF A;  2N1V A;  1JRO A;  3VTW A;  3GS2 A;  3RT3 B;  1GB1 A;  2DWQ A;  4GMV A;  4IDI A;  1DOX A;  3UQA A;  4UDU C;  1SXT A;  1YX5 B;  5BMH A;  4TV3 A;  3AE8 B;  4WAA A;  2Y5B B;  1I4R A;  1SE4 A;  1FRD A;  4JPS A;  4X57 B;  1KLG D;  3RCZ A;  5G5G A;  1JML A;  1VCB A;  3NS1 A;  1ZP0 B;  2KDE B;  5LLI A;  3TEZ A;  4NJC A;  2D10 A;  3KH0 A;  4G0N B;  2BS4 B;  1XO3 A;  1TS3 A;  3ZNI D;  1C9F A;  3NG0 A;  2N4F A;  1SJE D;  2WXG A;  1QOA A;  1GNU A;  2Y3A A;  3L16 A;  4EZJ A;  2KWC A;  1NYQ A;  3PRM B;  4K81 A;  5DPR A;  5TSS A;  1SIF A;  3ETR A;  3IAS 1;  4KZC A;  1XF5 L;  2V3N A;  3DVN U;  2JWZ A;  3KLS X;  1Y8R C;  1WYW B;  3RNG C;  2WXP A;  3MC9 A;  3VTU A;  1WXM A;  2WXK A;  5C3J B;  3VAW A;  3AV8 A;  2QDF A;  2KHW B;  1YNT E;  1WGD A;  1GB4 A;  1ZOY B;  3D32 A;  3H8H A;  4FJV B;  1TBE A;  3J9C A;  4WH4 A;  4ASW C;  4LCD E;  3RNA C;  1SBB B;  1WJU A;  1XLQ A;  4C56 C;  1ET6 A;  1VZ8 A;  2J0M A;  2C9W B;  3GE8 C;  5MPO A;  3H9D A;  1ZE3 D;  1VLB A;  1I4G A;  4RF0 A;  3KYC D;  2TSS A;  1V49 A;  4DDG D;  4E71 A;  5E6P A;  3BWU D;  3KWL A;  4P6V F;  4NY0 A;  2GBN A;  2WDR B;  3TJP A;  3WIM A;  4WQO B;  2IY0 B;  2KWU B;  3JSV B;  4MH0 E;  3BK2 A;  3ECI A;  3WAO A;  1ISN A;  1KF6 B;  1QF6 A;  4AOF A;  2K8C A;  3K9P B;  3T9L A;  1V80 A;  2LXA A;  4IWO A;  2N9E B;  1GC7 A;  3BK1 A;  3M95 A;  1WI0 A;  2BB6 A;  4EKU A;  2WNM A;  1WY8 A;  1OGW A;  4CQN A;  3PS6 A;  4JWU C;  3MFG A;  1G6J A;  2K39 A;  2LUE A;  4NNJ B;  4L2Y A;  2LGI A;  3E9S A;  4N59 A;  3QA8 A;  1KLU D;  3ML8 A;  2BYE A;  4N6E B;  3Q3O C;  1WX9 A;  3SDL C;  3FIL B;  4OVU A;  4KZ0 A;  3JYU A;  3PRE A;  1DYQ A;  1ZW7 A;  4LJP B;  4TKN A;  5JZE B;  2IYD B;  2KZR A;  3JSV A;  1YN4 A;  2WGS A;  3UIP B;  3HM3 A;  4BKT A;  4NZL B;  2NR2 A;  1STE A;  1SIJ A;  3PZD A;  2HJ8 A;  3WAL A;  2VRR B;  2PPH A;  2NPT B;  5TR5 A;  3SEB A;  2JSV X;  5AUK A;  3I3T B;  4C7Z A;  4PK1 A;  1XXG A;  2ZEQ A;  4YTP B;  4CO7 A;  2WX1 A;  2KJR A;  4NQL B;  5IOI A;  3FIL A;  2YLM A;  3W1Y A;  4RH6 A;  2BT6 A;  4LLG M;  3CMM B;  2D3A A;  3KUD B;  3PO0 A;  4BBN F;  2IZV B;  2KFJ A;  4KGR A;  1A5R A;  2BF8 B;  5I4D A;  4FLH A;  4DHZ B;  1BT0 A;  2K8B A;  1WJ4 A;  2QIE B;  3A1Q B;  3Q8A A;  1A70 A;  2GBM A;  2MJ3 A;  1T3Q A;  3IT4 B;  2NPT A;  3W1S A;  2I1J A;  2D07 B;  1OEY A;  4QAY A;  2LGY A;  1T0Y A;  2LGX A;  4HDQ A;  2AL6 A;  3DOW A;  3A4R A;  3ZKJ C;  2G1E A;  3MC0 B;  4OZA A;  3MJW A;  4ACF A;  4YSZ B;  2FBW B;  2NTT A;  2CHZ A;  1PGB A;  2HTM E;  3NZS A;  3NVW A;  1QLB B;  2BBC A;  5G2N A;  2N1W A;  4RGN A;  1XD3 B;  3APC A;  4HEA 1;  5D94 A;  3UI3 A;  4HJK A;  1VJK A;  3IXS A;  1WIA A;  2V4I B;  1NEN B;  4WWP A;  4GDK B;  3A1Q A;  4LK0 M;  2DLB A;  4IOI E;  4WJO A;  3O65 B;  3CST A;  2IO1 B;  2KN4 A;  3EHV A;  3L0W B;  4BOS C;  2LHE A;  2GMI C;  5L95 C;  1TYG B;  1YIW A;  2QHO A;  4C80 A;  3PHW B;  2KQS A;  2LJ5 A;  4HPM B;  2NMQ A;  4ZRK A;  2KFK B;  4ZYS A;  1P7E A;  4HWI B;  4OVZ A;  5IAA C;  2YEP B;  4K7W A;  4HRO A;  4AUQ C;  4I6P A;  5C23 A;  3Q3N C;  2IGD A;  3DQV A;  3GE3 C;  5DCN A;  2BGF A;  4EFO A;  4XC2 A;  2GBR A;  1LQB A;  1V1O A;  3K9O B;  3R2T A;  2LRU A;  1I4Q A;  2VZK D;  1ESF A;  4WIP A;  4GDK A;  3AU5 A;  2AQ3 B;  2INN E;  4XZ4 A;  3EGR A;  1GAQ B;  1FNV A;  2PVG C;  4MJS B;  3IHP C;  2PIA A;  1SF0 A;  3ALB A;  4S17 A;  5LXI B;  2IND C;  1UUP A;  2FUH B;  2BPS A;  2DX5 B;  1F9J A;  2BKR B;  2J53 A;  3MJ5 A;  1WM2 A;  1QOF A;  1FXA A;  2DZI A;  1ET9 A;  3EFC A;  2KFK A;  5HHD G;  1L7Y A;  2E6X A;  1F77 A;  3NZU A;  1UWX A;  4LDT D;  3QIJ A;  2JRH A;  2LXC A;  1YN5 A;  1H4R A;  3VH4 B;  2PMV A;  3WAM A;  2C7M B;  4S0R A;  3AXC A;  5AZG A;  2LEK A;  5LXH A;  1J19 A;  2IGH A;  4REZ A;  2WS3 B;  2ZW0 A;  1KLV A;  5D2M B;  5J18 A;  3B2F A;  3P42 A;  4MJS A;  1S1Q B;  2V3P A;  5BYR A;  3AM9 A;  1YQ3 B;  2INC C;  1WXQ A;  4KKI A;  2O6V B;  1WF9 A;  2K0P A;  2LVP A;  3R3M A;  4H2A A;  5CHW A;  3KUZ A;  3AEA B;  4P1C C;  4TQ0 A;  1WX7 A;  4M01 A;  4HXD A;  2KLG A;  1YD8 U;  2HD5 B;  1VZ6 A;  3URY A;  5H8Y E;  2KDB A;  1RFK A;  1CJE A;  2PJH A;  3ENE A;  2KX0 A;  3HVZ A;  1FIQ A;  3ZTC A;  2DAJ A;  1DOY A;  4LNI A;  4IM3 A;  3AMZ A;  1FMA D;  2BTE A;  1R4M I;  1E8X A;  3PZ8 A;  1FPY A;  2KXJ A;  5D6J B;  4ZDV A;  3U4E G;  2WLB A;  3CIR B;  1RYJ A;  2AL3 A;  3ZJV A;  4A90 A;  3L13 A;  4ZRP A;  2BYF A;  2J0K A;  4R3D A;  3R7R A;  2O6V A;  1VDV A;  4B0E A;  2N9K A;  4YL8 A;  2J42 A;  2NS5 A;  3WCQ A;  4BKG A;  1YMH E;  1R4N I;  3PLU A;  2KJ6 A;  2Z0D B;  2PVO D;  3B9J A;  4YTN B;  2K9X A;  2G9H D;  3I5J C;  2RPQ A;  4XGA B;  1I4P A;  3CSF A;  2KMA A;  3QX1 A;  1F1H A;  2JX5 A;  1FNW A;  2CU3 A;  2VH1 A;  3SD5 A;  2JUO A;  4XDD A;  3SFE B;  5HG2 A;  5HI1 A;  4YT0 B;  3PSE B;  4NJ6 A;  1ACC A;  3VH3 B;  1WWT A;  4GOC A;  4OZC A;  3GOE A;  2N9P C;  2MLB A;  2C60 A;  4JIO U;  2KK8 A;  3VUX A;  2MH7 A;  2LVQ A;  3AE7 B;  2DZK A;  1HXY D;  3T3N A;  1K53 A;  3C8Y A;  3BVZ A;  3P63 A;  1FFV A;  2WXF A;  4IM0 A;  5T8I A;  2G4D B;  1C76 A;  4KKJ A;  4RF1 A;  2GLS A;  4FHK A;  1FEH A;  3DBH I;  2KDM A;  4YSY B;  4LNN A;  1C79 A;  4XX5 A;  3SR6 A;  3U7Z A;  2BS2 B;  1UZX B;  1FO4 A;  1FXT B;  4LDT B;  4TUU A;  2DBY A;  3AU4 A;  4II2 B;  1L4Z B;  2CHX A;  1P7F A;  1B1Z A;  4WWN A;  2FUG 1;  3APF A;  4JQW C;  2AEH A;  2JQR B;  2YVC A;  4JE3 B;  3DVG Y;  2PE6 B;  3GZN I;  4C4V B;  1P1A A;  2ZVO A;  1P3Q U;  1HTO A;  3Q69 A;  1EF1 A;  3H6N A;  3VRA B;  1JWB D;  1L6U A;  1CK1 A;  3N30 A;  3L4P A;  1V97 A;  2M17 A;  4ZYN A;  2WX0 A;  1V1P B;  3H7S A;  2MBE A;  2KTR B;  1BUI C;  1TS2 A;  3WAP A;  2ACZ B;  2RDH A;  4NJ7 A;  4RGO S;  4BKS A;  3N9Y C;  2LJI A;  1MG4 A;  4MSM B;  4MGY E;  2D3G A;  1SB3 C;  4IUM B;  4JL9 A;  2ZVN A;  1XLP A;  4EZL A;  2WXR A;  1TKG A;  3V05 A;  2N0S B;  2WXN A;  4GN1 A;  1WGH A;  4A6Q A;  4C4V A;  1P0R A;  1HZ5 A;  2CHW A;  3ZDM C;  3VUY A;  3KQ4 A;  1JWU D;  5JXV A;  4B9K A;  5EDS A;  1E90 A;  2ZPY A;  2BW2 A;  4MM3 B;  2MX2 A;  2M4N A;  3DBL B;  2MRP A;  5EE0 A;  1V1P A;  3KYD D;  2ONQ A;  4W9L A;  2KTR A;  3RI7 C;  3P4P B;  1TY0 A;  2PEA A;  4DHZ E;  2DHZ A;  1YJ1 A;  2WU5 B;  2E3T A;  3P4R B;  3X0W A;  1F52 A;  1N63 A;  2C7H A;  1AW7 A;  1L0Y B;  3AEE B;  4K7U A;  4A8X C;  1WE6 A;  3RUL A;  1NI3 A;  2JXT A;  3KWV A;  1YJJ A;  2KDI A;  3L54 A;  1L6V A;  4FBJ B;  4US8 A;  1K8R B;  2IBI B;  4RGM A;  4AJY B;  2B3A A;  3U52 E;  2KVZ A;  3DHH C;  4WWM A;  1H8C A;  4N58 A;  3AEF B;  3IAM 1;  1K51 A;  1FFU A;  2OHF A;  1MHH E;  4MM3 A;  5KHQ A;  3SFD B;  1ZPS A;  1EU4 A;  1HEZ E;  1YJI A;  2BWF A;  2PLP A;  3ZNH B;  1WR1 A;  2WXH A;  1B9R A;  1WZ3 A;  1WYG A;  2FAZ A;  1L2N A;  3B0A A;  1WXA A;  1ZDX A;  1KTK A;  2KC2 A;  1I35 A;  3MC8 A;  2WQY B;  1WFY A;  2MA9 B;  3V61 A;  1I42 A;  1S3S G;  2KYW A;  3EUB 2;  2LAS A;  2INP E;  3Q2A C;  4F8C B;  3TL5 A;  4L1B A;  1GUA B;  4F1S A;  2MW5 A;  4A3O A;  2JU6 X;  5C2T B;  3Q8E A;  3DPD A;  1WX8 A;  1OQY A;  2AX5 A;  4M00 A;  2FCQ A;  2NBV B;  1D3Z A;  2XN9 C;  3DVN V;  3Q6B A;  4WUR A;  4PS3 A;  5D3I B;  4E74 A;  3W5V B;  1MVK A;  3AED B;  4MH8 A;  3QJZ A;  2D2Q A;  1WJN A;  1QOG A;  1V6E A;  4G11 A;  1OFF A;  5GXG B;  2J52 A;  1E0Z A;  4FAD A;  4BBN C;  4MEL A;  1Q1O A;  1D5Z C;  4RGT A;  3RD2 A;  1I4X A;  2QCZ A;  1KFY B;  1SEB D;  2KAC A;  2JWU A;  1TKY A;  3ZRF A;  3BY4 B;  3IFW B;  1VD2 A;  3CF6 E;  2WDV B;  1WGR A;  3W9C B;  2QIL A;  3BVM A;  2UWQ A;  3N32 A;  4E3C A;  2WXM A;  5J17 A;  3LYY A;  1V81 A;  2KD0 A;  2WXQ A;  3AE5 B;  3V6E B;  5BMI A;  1GOZ A;  1TZ1 A;  4PS7 A;  3FKY A;  2BQQ A;  2KT7 A;  4II3 B;  3HVD A;  1WM3 A;  2KOX A;  1UD7 A;  2IGG A;  3UIO B;  1KH0 A;  3R7Q A;  3W2D A;  3KW5 B;  4L23 A;  1HE8 A;  1MI0 A;  2WWZ A;  2WXL A;  3TSS A;  2G45 B;  1ZUD 2;  2A4Z A;  1UGJ A;  2IO3 B;  1WMH B;  5H92 C;  2L3Z A;  2M1M A;  2L32 A;  2KQ7 A;  2N7E A;  4JGH B;  3U2S C;  2LGS A;  1C4P A;  3EEC A;  5CHF A;  1J0G A;  3N1Z C;  4EE2 A;  2N7J A;  1MG8 A;  2JY6 A;  2ZNV B;  4BOZ B;  2PE9 A;  2IPK D;  4D2K A;  1UBI A;  3AUL A;  2ZJD A;  4GIV A;  3TMP B;  3LJ3 A;  3HK0 A;  3SHQ A;  1UNS A;  1N6Z A;  2WYQ A;  3U30 A;  1WE7 A;  2RSU A;  5E6J A;  4K7S A;  3TIX A;  1YN3 A;  2K6D B;  4WJQ A;  3ZXR A;  3U8Z A;  2XBB C;  1IBX A;  4DWF A;  5AUI A;  4ARC A;  1PGA A;  2WXO A;  2G3Q B;  2QEJ C;  1V2Y A;  3P2B A;  1WMH A;  3Q8C A;  1DOI A;  2L8J A;  4W9E A;  4DXA B;  1Z5S B;  1LXD A;  2Z0E B;  3BYY B;  4MGI E;  4DXG A;  1RM6 C;  3DBL I;  1SSN A;  4HPL B;  1WXV A;  2SAK A;  3C19 A;  1UWM A;  4I6N B;  1EM7 A;  2L05 A;  1V86 A;  3EA6 A;  5HKH A;  1N60 A;  4LNO A;  5GMV A;  2EEL A;  3TEW A;  3R8B A;  3VR9 B;  1FD6 A;  4KV2 A;  3PV1 A;  2CJO A;  3GP7 A;  2ZPN A;  1JWA D;  4US9 A;  4EUT A;  5IA7 A;  1J7A A;  3PHX B;  4P1B C;  3TEX A;  2BB5 A;  1TS5 A;  3ZQ4 A;  1RWS A;  4MGK E;  1K52 A;  3NRZ A;  2D3B A;  3HHM A;  2NCN A;  1NVI D;  1TKE A;  3ZGZ A;  3DDC B;  3MHZ A;  3H1U A;  4KDI C;  1YQ4 B;  4M02 A;  4ANX A;  1ENF A;  2ZZP B;  1MPE A;  2DYM A;  1WXS A;  4ANU A;  2FNJ B;  1DGJ A;  2WHI A;  4KX6 B;  3ZJT A;  3OLM D;  4M8M A;  4DHJ D;  3AE3 B;  1F0Z A;  4MSQ B;  4OVV A;  1C4C A;  2K6Q A;  5FKA C;  2Y5P A;  4AQ7 A;  1XT9 B;  2W9N A;  3SU8 X;  2I38 A;  4EEW A;  3QAR A;  2N7D A;  5EE1 A;  2LI5 A;  3AEB B;  1KJT A;  5AZH A;  2GRI A;  4AJW A;  3JVZ X;  3V62 A;  4HCP B;  1SGH A;  4W9D A;  1TJE A;  4ITK A;  4MAC A;  1P98 A;  3RNE C;  3QC8 B;  4PYU A;  4MGZ E;  3AE2 B;  5D3D A;  3W1S C;  5BO4 B;  1E7U A;  2L00 B;  3B08 A;  4PT5 A;  4HKZ E;  4FXC A;  5DPT A;  2B76 B;  1SJH D;  2D5G A;  1EO6 A;  2ZCC A;  3OJ3 A;  1OQQ A;  4GDL B;  3OWE B;  2BYV E;  3RNF C;  1VR9 A;  1L0V B;  2LUM A;  3UQB A;  1QOB A;  2CS4 A;  4HKQ A;  3ZNZ B;  3VHT C;  1I7H A;  1TZO A;  3KUC B;  3PZ7 A;  3AN1 A;  3AE4 B;  4WJN A;  3MHS D;  3NUH B;  3U7D A;  2MJE A;  1GJZ A;  3AB5 A;  4FUL A;  2JXX A;  2IO0 B;  3OAW A;  3TCA A;  1ZKH A;  2M8S A;  4HRS A;  4IC7 B;  1IP9 A;  4ANV A;  2OOB B;  3ZVV A;  4GXB A;  5BYS A;  1R7S A;  3PPA A;  3UGB B;  4RM8 A;  3H7P B;  4HDO A;  4RCO A;  2ASQ A;  2V3S A;  4W9G A;  2A5U A;  2J0J A;  2JVC A;  2WDT B;  5IP4 D;  2X8X X;  3L08 A;  4LJO B;  4ICV A;  4LTU A;  3NHE B;  2LHD A;  4GDL A;  5HFY A;  3PRP B;  1D4B A;  1E8Y A;  1I4H A;  1XLO A;  1U4A A;  2FID A;  2K22 A;  1NI2 A;  2REX A;  2O2V B;  3AE9 B;  3PTF C;  3VUW A;  3ZDT A;  5AEK B;  4USA A;  2WP9 B;  2KKC A;  2UU7 A;  4WJP A;  2FCN A;  4KDL B;  3M62 B;  2V4L A;  3I9V 1;  2VZK B;  3ZTD A;  1JCK B;  4YSX B;  4RM9 A;  1QQR A;  2CKH B;  1AYF A;  3H7P A;  1QZE A;  1T5X D;  3Q3M C;  2L52 A;  3ZO5 B;  3R66 C;  2J7Q B;  2RDB C;  2DNF A;  2KTF A;  2LD9 A;  3DBS A;  2KVR A;  3DWG C;  3Q8B A;  1RAX A;  1UGM A;  2Y5C A;  3BII D;  3C0R B;  1OEY J;  2XEW A;  3NVZ A;  2W54 A;  1CQV A;  1WGY A;  3AE6 B;  1V8C A;  2O2V A;  3UF8 A;  3N1Y C;  2JZ3 B;  3Q8F A;  3DBR B;  4EOY A;  4DHJ B;  4HVB A;  4KSL C;  1LO5 D;  1TGZ B;  1XLN A;  4OW0 A;  4C7Y A;  1M4V A;  1MHX A;  1ZDV A;  1SE3 A;  3RPF C;  2MEK A;  3HUI A;  5JHB A;  3QCA A;  2RDG A;  2D3C A;  2YEP F;  3N1X C;  1LFD A;  1AWD A;  3EFU A;  2KWD A;  4RMA A;  1XCQ L;  1HZ6 A;  2LGD A;  1N61 A;  3APD A;  3DHI C;  1T0S C;  4K3B A;  1E6E B;  1C3T A;  2MWS B;  2L0T A;  4TMA B;  3A9J B;  2C7N B;  4HCN B;  1FCC C;  4Q2J A;  4AWJ A;  4NAW B;  5AZF A;  1E9M A;  5EE9 A;  2ZW1 A;  2PTL A;  1UF0 A;  2RGF A;  4IG7 B;  4OZB A;  2NBW B;  3NS8 A;  2FE8 A;  3NJT A;  4ZHO A;  4IM2 A;  5IN7 A;  1JRP A;  3A9K B;  5LNK 1;  3I57 A;  1TT5 B;  3RFZ B;  4DK5 A;  2GB1 A;  2GOW A;  1TIF A;  3R2I A;  2JZP A;  2QSD A;  3L10 B;  4G50 A;  1T0Q C;  3A9J A;  1FM0 D;  4J6I A;  4PYZ A;  3LXF A;  3VRB B;  5KHO A;  4NAW A;  2WXI A;  2LMC A;  4ZOH C;  4NPN A;  1KM7 A;  3ABV B;  3ZUN A;  4B6W A;  4XYC A;  4FHJ A;  3NY5 A;  3QQ8 B;  1AAR A;  4TSS A;  4FJY A;  3P4S B;  3ML9 A;  3VDZ A;  1ROE A;  1PGX A;  2LVO A;  2KJH B;  4XE0 A;  3RZF A;  2BYT A;  1YX6 B;  3BVG A;  4YWG G;  1EWY C;  1V5T A;  1V5O A;  3A9K A;  2KWV B;  3ONS A;  4BFR A;  4W9J A;  3HM6 X;  4F7Z A;  1YQB A;  3NOB A;  3T3O A;  2KC1 A;  2KLC A;  3A4S C;  2WDQ B;  3TBL D;  5JHA A;  2FIF A;  2W82 A;  4ZRQ A;  1D5M C;  1NYR A;  2DZM A;  4YXD B;  1CZP A;  2EKI A;  4GGQ A;  2CR5 A;  4GSW A;  1QKZ A;  3DWM A;  4JWS C;  3AE1 B;  4GLS C;  2IDY A;  1EUV B;  1E8W A;  3LDZ E;  3O13 A;  3TEY A;  2MSE D;  1M94 A;  3AEC B;  2I2Y A;  2MP2 B;  1EWC A;  1Z2M A;  4PS8 A;  4O1N A;  2MBQ A;  3WA0 A;  1SE2 A;  3ZXV A;  2MCN B;  2K5P A;  1L0X B;  2KDF B;  3M3J A;  1OQR A;  4LNK A;  1YOV B;  1CMX B;  2MBH A;  1EU3 A;  2JZZ A;  4W9C A;  3AEG B;  4XWT A;  3OJ4 B;  1PYW D;  1C1Y B;  3Q3J A;  2IJ0 A;  1WRD B;  3QHT A;  4GU2 A;  3UIN B;  4WAF A;  2V9H A;  4FA6 A;  4OHJ A;  4KGT A;  4HPP A;  3RN9 C;  2FCM A;  2DYB A;  3AI5 A;  2L0F A;  5DPS A;  4ZHP A;  1WGG A;  4M8N A;  3I63 C;  2HE7 A;  4K1R B;  1KRH A;  2ON8 A;  2KNB A;  2MP2 A;  3DVG X;  3JW0 X;  5E6O A;  4ZRI A;  5CX3 A;  3HIZ A;  2OJW A;  3DBR I;  3W5U B;  3PGE A;  1TS4 A;  2EMS A;  2D11 A;  1HA5 A;  1L4D B;  4RFB A;  4BVU C;  3QK0 A;  4ARI A;  1R4M B;  3VFK A;  5IKC M;  2M19 A;  1IUE A;  1AN8 A;  4HJG E;  4TQ1 A;  3RMK C;  4HK2 A;  3Q14 C;  1IBX B;  2CJN A;  1UH6 A;  1N5X A;  2W3R A;  4DBG A;  3PVL A;  5JH5 C;  3BIN A;  3VTV A;  2O6V D;  3ZLZ A;  5CHV C;  1R4N B;  2QMT A;  2LWP A;  1UEL A;  3IT6 B;  4MDK E;  2BVC A;  2ICI A;  1F2R I;  3RZW C;  4P16 A;  1F2R C;  1V9J A;  3X23 A;  3CWI A;  2MJD A;  1E10 A;  1WGK A;  5FR6 A;  1BXT A;  2JF5 A;  4BZA A;  3TUO A;  5DPW A;  3M63 B;  4ZRJ A;  3N20 C;  3VQI A;  5FR3 A;  3NVV A;  4HLE A;  4DQO C;  2BWE S;  2K8H A;  2L83 A;  1J7B A;  2HJ1 A;  3A33 B;  2JYE A;  2N9L A;  3B1L X;  1J8C A;  1Q10 A;  3RUI B;  1LM8 B;  4DDI D;  2KAJ A;  3VXW A;  2I1K A;  2Q5W D;  2L76 A;  2MBB B;  2QC8 A;  5L83 A;  4AP4 C;  2GI9 A;  4WQM A;  1GC6 A;  2X38 A;  2CU1 A;  2J4X A;  1J7C A;  2RR9 A;  2KMC A;  3Q3F A;  4W9K A;  3PLV A;  4IWQ A;  3DBH B;  3ZJU A;  3IVF A;  2G4S A;  2KQ4 X;  1GG3 A;  1K50 A;  1ZXH A;  3BZD B;  2LRW A;  5IO9 A;  1BML C; 
#chains in the Genus database with same CATH homology
 4JX1 C;  1SIJ A;  2LJI A;  1L5P A;  4RCO A;  1N5W A;  1VZ7 A;  1SB3 C;  3SEB A;  2JSV X;  5AUK A;  1XLP A;  4C7Z A;  4LTU A;  1JWS D;  2WXR A;  1TKG A;  2LHD A;  3V05 A;  1XXG A;  2N0S B;  2WXN A;  5HFY A;  4YTP B;  3BYT B;  1E7P B;  1XEE A;  4A6Q A;  3FC4 A;  1D4B A;  1HZ5 A;  1I4H A;  1XLO A;  2K22 A;  1JWM D;  1JW9 D;  3KQ4 A;  1JWU D;  3AE9 B;  2RMM A;  1FCL A;  2W55 A;  5JXV A;  3FIL A;  5G5H A;  5EE3 A;  4DXF A;  2BW2 A;  4RH6 A;  2WP9 B;  4USA A;  4MM3 B;  2BT6 A;  4LLG M;  1PFD A;  3NZ3 A;  5EE0 A;  1V1P A;  3PO0 A;  2PKO A;  2ONQ A;  2PW9 A;  3I9V 1;  2NTS A;  2VZK B;  1VRA B;  4KGR A;  1T6B X;  1XCT L;  3P4P B;  1TY0 A;  5I4D A;  1JCK B;  4YSX B;  1QQR A;  2E3T A;  2WU5 B;  3P4R B;  4AS1 A;  1AYF A;  1N63 A;  2QIE B;  4RNA A;  1T5X D;  2L1A A;  1A70 A;  2W3S A;  1PUT A;  3Q8A A;  2MJ3 A;  2L52 A;  1AW7 A;  1L0Y B;  3AEE B;  4IKG A;  1T3Q A;  3IT4 B;  3W1S A;  1D5X C;  2QJL A;  2WXJ A;  4A8X C;  3E56 A;  1TY2 A;  2DYO A;  2RPV A;  3DWG C;  3Q8B A;  1NI3 A;  2Y5C A;  5BMG A;  2JXT A;  3BII D;  1GPX A;  3KWV A;  1YJJ A;  1L6V A;  2AQ2 B;  2G1E A;  3MC0 B;  3NVZ A;  4US8 A;  4OZA A;  3N9Y C;  2W54 A;  1CQV A;  1Y56 A;  4RGM A;  1IGC A;  3AE6 B;  3B2G A;  3U52 E;  1V8C A;  4YSZ B;  3Q8F A;  4WWM A;  2FBW B;  2NTT A;  4N58 A;  1PGB A;  3AEF B;  3IAM 1;  1QT9 A;  2HTM E;  1K51 A;  1FFU A;  2OHF A;  4MT5 A;  1LO5 D;  3NVW A;  3AH7 A;  1MHH E;  1QLB B;  1XLN A;  1FXI A;  1NEK B;  2BBC A;  2XNA C;  3SFD B;  4OW0 A;  1ZPS A;  4C7Y A;  1EU4 A;  1HEZ E;  1YJI A;  4RGN A;  1M4V A;  1MHX A;  3VR8 B;  2PLP A;  1ZDV A;  1SE3 A;  3RPF C;  4HEA 1;  2MEK A;  2WXH A;  3HUI A;  1WYG A;  1B9R A;  3UI3 A;  1VJK A;  2RDG A;  3IXS A;  2V4I B;  1ZDX A;  1NEN B;  2YEP F;  1KTK A;  2WQY B;  4GDK B;  4LK0 M;  1JAL A;  1AWD A;  2DLB A;  4IOI E;  2KWD A;  1C78 A;  1XCQ L;  2KN4 A;  1HZ6 A;  3EUB 2;  2LHE A;  2INP E;  1N61 A;  4M0W A;  3P4Q B;  4L1B A;  1TYG B;  3GB1 A;  1E6E B;  3P1M A;  5D7G A;  2JU6 X;  4C80 A;  4TMA B;  5C2T B;  3Q8E A;  3HRD D;  3FAH A;  1HQR D;  2JYT A;  2AX5 A;  1FCC C;  4Q2J A;  4NAW B;  2H89 B;  2NMQ A;  3V3X A;  2K3U A;  2XN9 C;  4ZYS A;  4WUR A;  1P7E A;  1E9M A;  4OVZ A;  5D3I B;  5EE9 A;  4A9A A;  2YEP B;  4HRO A;  2R61 A;  2ZW1 A;  2PTL A;  2IGD A;  3W5V B;  1MVK A;  3AED B;  4XDC A;  1WSP A;  4YTM B;  4MH8 A;  4OZB A;  2WU2 B;  1QOG A;  2M0A A;  1QIL A;  2FE8 A;  1OFF A;  5GXG B;  1V1O A;  2J52 A;  3R2T A;  4ZHO A;  1E0Z A;  1JRP A;  1I4Q A;  2VZK D;  1ESF A;  5LNK 1;  4J3O D;  3I57 A;  1D5Z C;  4RGT A;  4WIP A;  1I4X A;  3RFZ B;  4NAM A;  2AQ3 B;  1IGD A;  1KFY B;  1SEB D;  2INN E;  2GB1 A;  2KAC A;  2JWU A;  1TKY A;  3EGR A;  1GAQ B;  1FNV A;  2PVG C;  2SEB D;  3R2I A;  2JZP A;  2QSD A;  1JQ4 A;  2PIA A;  2WDV B;  1SF0 A;  3MP9 A;  1PDX A;  3W9C B;  2QIL A;  3BVM A;  2H88 B;  1WRI A;  2AQ1 B;  1UUP A;  2WXM A;  3LYY A;  1C77 A;  1FM0 D;  3LXF A;  3VRB B;  2HDE A;  2J53 A;  2WXQ A;  2LFI A;  3MJ5 A;  3AE5 B;  1QOF A;  1FXA A;  5BMI A;  1GOZ A;  2WXI A;  4KGS A;  1ET9 A;  5HHD G;  2LMC A;  4ZOH C;  2E6X A;  1F77 A;  3ABV B;  1D6E C;  1UWX A;  3HVD A;  1FRR A;  2IGG A;  4TSS A;  3ZYY X;  1YN5 A;  1KH0 A;  3W2D A;  2M56 B;  4B0M A;  3P4S B;  4L23 A;  1MI0 A;  2PMV A;  1FNU A;  1ROE A;  1PGX A;  1C4A A;  2WXL A;  4XE0 A;  2BYT A;  3TSS A;  2BS3 B;  3BVG A;  1ZUD 2;  1UGJ A;  4YWG G;  1EWY C;  2KMM A;  2LEK A;  5H92 C;  2IGH A;  4REZ A;  2L32 A;  2WS3 B;  3T3O A;  3U2S C;  2ZW0 A;  1C4P A;  3B2F A;  3P42 A;  4EE2 A;  2N7J A;  2V3P A;  5BYR A;  5BYQ A;  2IPK D;  1N62 A;  3AM9 A;  2WDQ B;  1YQ3 B;  4D2K A;  5FK9 C;  3NVY A;  1WXQ A;  4KKI A;  2W82 A;  4ZRQ A;  2K0P A;  2OED A;  1D5M C;  1NYR A;  4YXD B;  1CZP A;  2EKI A;  4H2A A;  4A55 A;  2V0G A;  1UNS A;  1ZXI A;  4XWW A;  3AEA B;  2Z8L A;  1QKZ A;  3DWM A;  3LB8 C;  5E6J A;  4TQ0 A;  4JWS C;  1JRO A;  3GS2 A;  3AE1 B;  4GLS C;  1GB1 A;  1YN3 A;  2IDY A;  2DWQ A;  3O13 A;  4IDI A;  1DOX A;  1VZ6 A;  3TEY A;  4UDU C;  3URY A;  1SXT A;  5BMH A;  3AEC B;  5H8Y E;  2I2Y A;  1IBX A;  5AUI A;  1RFK A;  4ARC A;  1EWC A;  1PGA A;  4O1N A;  3AE8 B;  2WXO A;  1CJE A;  1SE2 A;  1I4R A;  2QEJ C;  1SE4 A;  3HVZ A;  1FRD A;  1FIQ A;  2K5P A;  1L0X B;  4JPS A;  3Q8C A;  1KLG D;  1DOY A;  1DOI A;  1OQR A;  3AMZ A;  1FMA D;  2BTE A;  3BYY B;  4DXG A;  1RM6 C;  5G5G A;  1JML A;  1EU3 A;  3PZ8 A;  1SSN A;  3NS1 A;  2SAK A;  3AEG B;  1ZP0 B;  4XWT A;  1UWM A;  3U4E G;  3TEZ A;  2WLB A;  4NJC A;  1EM7 A;  3CIR B;  1PYW D;  1RYJ A;  2BS4 B;  1XO3 A;  3EA6 A;  1TS3 A;  3ZJV A;  1C9F A;  4A90 A;  1N60 A;  4ZRP A;  2IJ0 A;  4R3D A;  2EEL A;  3TEW A;  1VDV A;  4B0E A;  2N9K A;  3R8B A;  1SJE D;  2J42 A;  3VR9 B;  3WCQ A;  2WXG A;  1FD6 A;  1QOA A;  4WAF A;  1YMH E;  2CJO A;  2Y3A A;  3GP7 A;  1JWA D;  4US9 A;  1NYQ A;  1J7A A;  4OHJ A;  3TEX A;  4KGT A;  5TSS A;  2BB5 A;  1TS5 A;  2PVO D;  3ZQ4 A;  1RWS A;  3B9J A;  1K52 A;  3ETR A;  3NRZ A;  4YTN B;  4ZHP A;  2K9X A;  2G9H D;  1I4P A;  1KRH A;  3IAS 1;  1NVI D;  1XF5 L;  2V3N A;  1TKE A;  2ON8 A;  2JX5 A;  3KLS X;  1FNW A;  2CU3 A;  3ZGZ A;  4XDD A;  3SFE B;  5HG2 A;  3MHZ A;  4YT0 B;  5HI1 A;  1YQ4 B;  2WXP A;  1ACC A;  2WXK A;  1WWT A;  3W5U B;  1TS4 A;  5C3J B;  1ENF A;  4OZC A;  1HA5 A;  1L4D B;  3AV8 A;  4RFB A;  1MPE A;  4ARI A;  1YNT E;  2DYM A;  2MH7 A;  1GB4 A;  1ZOY B;  3AE7 B;  3H8H A;  1DGJ A;  1HXY D;  2M19 A;  3T3N A;  1IUE A;  1K53 A;  3J9C A;  4WH4 A;  4KX6 B;  3ZJT A;  3C8Y A;  1AN8 A;  4HJG E;  4TQ1 A;  1SBB B;  3BVZ A;  3AE3 B;  3P63 A;  1F0Z A;  1IBX B;  1FFV A;  2CJN A;  1XLQ A;  2WXF A;  4C56 C;  1ET6 A;  1VZ8 A;  5T8I A;  1C76 A;  1N5X A;  4KKJ A;  1C4C A;  5MPO A;  4RF1 A;  5FKA C;  2W3R A;  1ZE3 D;  2Y5P A;  1VLB A;  4AQ7 A;  1I4G A;  4RF0 A;  2TSS A;  2I38 A;  2QMT A;  3IT6 B;  5EE1 A;  1FEH A;  2ICI A;  3AEB B;  3BWU D;  3KWL A;  1F2R I;  2KDM A;  2GRI A;  4P16 A;  1F2R C;  4P6V F;  3CWI A;  2MJD A;  2WDR B;  1E10 A;  4YSY B;  1C79 A;  1WGK A;  3SR6 A;  1BXT A;  1TJE A;  4ITK A;  4MAC A;  3U7Z A;  2BS2 B;  3BK2 A;  1FO4 A;  3TUO A;  1KF6 B;  1QF6 A;  2DBY A;  3VQI A;  3AE2 B;  1L4Z B;  1P7F A;  5FR3 A;  3NVV A;  5D3D A;  1B1Z A;  4DQO C;  3BK1 A;  2L83 A;  2BB6 A;  1J7B A;  4PT5 A;  2FUG 1;  2JYE A;  2WNM A;  4HKZ E;  4FXC A;  2B76 B;  1SJH D;  2N9L A;  2JQR B;  2D5G A;  4CQN A;  1Q10 A;  1OQQ A;  4GDL B;  4JE3 B;  4JWU C;  3OWE B;  2KAJ A;  3MFG A;  1VR9 A;  4L2Y A;  1L0V B;  2Q5W D;  2LUM A;  2LGI A;  1QOB A;  3E9S A;  4N59 A;  4HKQ A;  2GI9 A;  4WQM A;  1KLU D;  1I7H A;  1TZO A;  2X38 A;  2J4X A;  3PZ7 A;  3AN1 A;  3Q69 A;  4N6E B;  3FIL B;  3AE4 B;  3VRA B;  1JWB D;  1L6U A;  1CK1 A;  1J7C A;  3NUH B;  3L4P A;  1DYQ A;  3ZJU A;  2MJE A;  1V97 A;  3AB5 A;  1V1P B;  2KQ4 X;  1K50 A;  1YN4 A;  1ZXH A;  1BUI C;  4HRS A;  1TS2 A;  2ACZ B;  1BML C;  2RDH A;  3BZD B;  4RGO S;  4NZL B;  5BYS A;  1STE A;  1R7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...