1XO3A

Solution structure of ubiquitin like protein from mus musculus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 2900073H19
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
pubmed doi rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xo3A00
3BIID 3SFEB 1QT9A 1RFKA 1SF0A 2PKOA 3KWLA 1FM0D 1PFDA 2WP9B 1QOFA 1PUTA 4N6EB 3NVYA 4LTUA 1RWSA 1FXIA 1YJJA 2HTME 3AEFB 4YSXB 2QIEB 1FXAA 1V97A 3AE5B 4JX1C 3ZYYX 1QOAA 5H92C 5C3JB 1PDXA 1B9RA 4IDIA 2LEKA 3P4PB 5EE9A 1WRIA 1RYJA 2B76B 2BS2B 3W5UB 2W3RA 2KMMA 2M56B 3AE1B 3WCQA 2DWQA 1FMAD 1ROEA 3AE6B 2JX5A 2OHFA 3FAHA 2AX5A 1DOYA 2K9XA 2WS3B 2MJ3A 1EWYC 2BS3B 1SIJA 4JWSC 1XLQA 3ABVB 3EUB2 4HRSA 2WDQB 3AN1A 1N61A 5EE1A 1FRDA 1OFFA 3HUIA 3DWGC 4C7ZA 3P4QB 4YXDB 1I7HA 3P63A 2ACZB 1NYRA 3VR9B 3AMZA 3AEGB 5G5GA 1ZUD2 1JWAD 1JQ4A 1WWTA 2WQYB 2MJDA 1IUEA 4YT0B 1QOGA 3AE8B 1N60A 2E3TA 1OQRA 4A9AA 4USAA 1KRHA 3AEBB 2QJLA 3CWIA 2H89B 1NYQA 1J7AA 3NS1A 4P6VF 3RPFC 1QLBB 1CJEA 5GXGB 1L0VB 2WU2B 3SR6A 2L83A 2L52A 1DOIA 2BS4B 2WLBA 3AE7B 1TYGB 3B2FA 2N0SB 3B9JA 1R7SA 1JALA 1RM6C 1XO3A 3AE9B 3NVWA 1XLPA 2JQRB 1JWBD 1QF6A 2WDRB 3AECB 2K5PA 3DWMA 1E7PB 2CU3A 4FXCA 3W5VB 1FRRA 2H88B 2PVGC 1KFYB 4YSZB 5C2TB 3NVVA 4YTPB 1A70A 3AEDB 1L6VA 1NEKB 1J7CA 1N62A 5EE0A 1F0ZA 2EKIA 1ZOYB 3W9CB 3AM9A 5AUIA 4YTMB 3CIRB 1SB3C 1XLOA 1YQ4B 3L4PA 1TKGA 3AEEB 5MPOA 1TKEA 2KAJA 4JWUC 5G5HA 1E10A 1AYFA 2G1EA 4HROA 1FFUA 2CJOA 3HVZA 4ITKA 1WXQA 3NVZA 3FC4A 1ZP0B 1WGKA 3AB5A 3AE4B 3AEAB 3AV8A 3PO0A 1GPXA 1E6EB 4YSYB 1JW9D 2W54A 3AH7A 1J7BA 2BT6A 4N59A 4WWMA 4N58A 1L6UA 2MJEA 2W3SA 3P4RB 1YQ3B 2PVOD 3LB8C 4C7YA 1KF6B 1E9MA 4C80A 1VLBA 3AE3B 1GAQB 1JRPA 1JROA 1WYGA 3ETRA 2DBYA 2K22A 1CZPA 2WDVB 1QOBA 1VJKA 1YJIA 2W55A 1FFVA 4ZHOA 1FIQA 1AWDA 1T3QA 2PIAA 2Q5WD 1VDVA 2Y5CA 1N63A 1FO4A 1DOXA 2WU5B 4ZOHC 5AUKA 1DGJA 5EE3A 3VRBB 1UWMA 1NI3A 2MH7A 3B2GA 3LXFA 3P4SB 3HRDD 4WQMA 1V8CA 2M19A 1N5XA 3AE2B 1N5WA 1NENB 4YTNB 1ZXIA 3NRZA 5H8YE 4KX6B 4US8A 4ZHPA 2FBWB 1OQQA 3VR8B 3SFDB 1TKYA 1NVID 1XLNA 2CJNA 1E0ZA 4US9A 1TJEA 1L5PA 3P1MA 3VRAB
chains in the Genus database with same CATH superfamily
3VUWA 2L0FA 2WXLA 1YQBA 1TS3A 2RPQA 1QOAA 2XK5B 2WWZA 2KO3A 2WGSA 3NZUA 3URYA 3TIXA 4S0RA 3TCAA 3MJWA 4K3BA 4C00A 1LFDA 1D4BA 2WXNA 2BB6A 1BXTA 3N20C 1ZUD2 1SIFA 3TEWA 2WXPA 3MC9A 1QOGA 3DQVA 2WXRA 1RRBA 1IP9A 2GBMA 2FAZA 4GOCA 2N0SB 3DBHB 4B0EA 3U7ZA 1AW7A 3JSVA 3OLMD 4WIPA 5AZGA 3QA8A 1SEBD 2WYQA 1FRRA 1UNSA 2H88B 3TEXA 1FNVA 1VRAB 1ZGUB 2WX0A 3MHZA 1IGDA 2NVUI 4WQOB 3N1ZC 2KQSA 3FC4A 1GPXA 2J0KA 2M0AA 3IAS1 4WWMA 4F1SA 3ZJVA 1E7UA 3LB8C 2YVCA 1MHXA 3QIJA 1BMLC 4X57B 2BWFA 4W9IA 3JVZX 3NJTA 1QILA 1C1YB 2XN9C 3ENEA 2TSSA 2GBNA 3T3OA 4P16A 4DWFA 4P1BC 1E8ZA 2FBWB 2KDBA 2Y5PA 3P2BA 3PS6A 1P0RA 2C9WB 2PPHA 1AARA 2BB5A 2K3UA 2IO3B 2N1WA 4WAAA 1Z2MA 2K6QA 3ZNHB 3H7SA 3RYTA 4MELA 1FXAA 4II3B 2KX0A 1I42A 3U52E 3W5UB 1C4PA 1WX7A 1SE4A 4DK5A 3DVGX 4TKNA 4P1CC 4UDUC 1C79A 2I38A 4LNNA 2MLBA 3VR9B 2DENB 2KFJA 3H9DA 4GLSC 4IKGA 2JRHA 3H7PA 2N9LA 1KRHA 2ZNVC 2K8CA 4ZRPA 5J17A 4HXDA 2WXFA 3VTVA 2DAFA 1QF6A 2WDRB 2C7MB 1UWXA 2N9KA 4EFOA 2MSED 1HTQA 1T0RC 2HJ8A 4NQKE 1PGXA 2BBCA 1NEKB 3UQAA 4PYUA 2EKIA 1ZOYB 2PEAA 3RULA 4HPMB 3I5JC 2K8BA 1K51A 1GG3A 4ITKA 2M17A 1C4AA 2R61A 2QC8A 2IDYA 1C76A 2LGDA 4DXGA 1V1OA 3FILB 4C7YA 4OZAA 3P42A 1VLBA 2DBYA 2KMAA 4LJOB 2MP2A 4II2B 2Q5WD 2OJWA 1FO4A 1KLUD 5IOIA 2JXTA 4ZHPA 3GE8C 2JT4B 3FILA 1E0ZA 3Q6BA 4DHJB 3EGRA 2V3SA 4FULA 5TSSA 3PSEB 4K7SA 1B1ZA 1C3TA 2VH1A 2KJRA 1H4RA 1RFAA 4MM3B 3BINA 1XCTL 4GB9A 3X23A 2INCC 2JX5A 1KJTA 3KYDD 1DOYA 2K9XA 3RZFA 3BVGA 1GOZA 1SJED 3AN1A 1Q0WB 1RAXA 4DDID 1OFFA 2KXJA 2QEJC 1SJHD 2ACZB 1TY2A 2Z0EB 4MJSA 2HE7A 1JWSD 4BOSC 4YT0B 4HJKA 3ZW3A 5GXGB 4RCOA 2KFKA 4GN1A 1MPEA 4RFBA 2AL3A 1WGRA 3UIPB 3Q3FA 3U7DA 4FBJB 4IG7B 4HDOA 2LUMA 2L00B 3SD5A 2KC1A 4KKIA 1J7CA 4BFRA 1UZXB 3ML9A 3ZJTA 1F2RI 3CF6E 1E7VA 3HM6X 4N9F4 4IW0A 1WJ4A 1FD6A 2BT6A 2QSDA 4RH6A 3R3MA 4WJNA 3R66C 2LD9A 4GGQA 3BK2A 2YEPF 5CHFA 1JCKB 4NZLB 3N32A 3A9JB 2O6VA 4ZHOA 5LXIB 5AUKA 1DGJA 3VRBB 4OZBA 3UI3A 1ESFA 4KX6B 5HKHA 4FLHA 2VZKD 4L23A 3P1MA 3MHSD 2KTFA 3N1YC 4LTUA 3DVNU 2HD5B 1FXIA 2C60A 3AEFB 1V97A 4XGAB 2IJ0A 1UD7A 1CQVA 2V9HA 2I2YA 2QDFA 3WCQA 4FA6A 3AE6B 4ZRIA 4HKQA 2J4XA 1WXMA 2RDHA 4JWSC 1WGYA 2MRPA 3EUB2 3B0AA 2GMIC 4J3OD 5D94A 4EZKA 4ZYSA 1C78A 5BO4B 2LGIA 3A4RA 4E71A 2OJRA 2KN4A 4WWNA 1N60A 1FEHA 5DPSA 2H89B 1NYQA 1MVKA 4CO7A 1YX5B 4HWIB 1TYGB 3BZDB 4K3CA 3AE9B 2AWTA 2YEPB 5AEKB 4M00A 3I9V1 3L08A 4XWWA 1WH3A 2GB1A 2NTSA 5TR5A 4HK2A 2UYZB 1ISNA 1WYWB 4HCPB 2J0JA 2DZJA 1OEYA 1GNUA 2KHWB 1VD2A 2KAJA 5G5HA 4IM3A 2UWQA 5KHOA 2DZMA 4DQOC 2KVZA 5CHVC 4FADA 1UF0A 2PTLA 3P4RB 4IC7B 3EC8A 1JROA 4DHJD 3O13A 1CMXB 3KW5B 2FNJB 1V81A 1VDVA 2SAKA 3V60A 4MJSB 1KM7A 4YSZB 3PTFC 3PV1A 2M19A 1N5XA 4ACFA 4WJOA 5LLIA 4MDKE 5T8IA 3Q2AC 4HLEA 1XQQA 3SFDB 1L4DB 3VR8B 4IM0A 3Q8EA 3KWLA 4B0MA 2OOBB 2L05A 1B9RA 4JX1C 2MQJA 2RDGA 4A55A 2BKFA 4BBNF 2NMQA 2ZZPB 3TJPA 4DHZE 1LO5D 2KWUB 4ZRJA 3BK1A 1WSPA 1TS2A 2WXMA 3BWUD 4GMVA 5CTRC 3JYUA 4AUQC 1UH6A 2MX2A 4AS1A 1EWYC 2KTRA 1WE7A 1WRDB 4ARIA 4XE0A 2D5GA 2PW9A 1EUVB 1FRDA 2IO1B 2ZPYA 1F2RC 4RM9A 1NYRA 2K39A 3AMZA 1STEA 3NG0A 2MJDA 1WI0A 3CWIA 3ZKJC 1QLBB 4I6PA 1R4NB 1GB4A 3AE7B 2IZVB 4EUTA 3PLVA 4W9CA 3KUCB 2D2QA 4PS7A 3GB1A 3AECB 2DNFA 1T0YA 1WM2A 1X1MA 3R7QA 2L3ZA 3VDZA 3W1YA 1QQRA 1E5WA 4YTMB 1KLGD 2MBOA 1WGDA 1WX8A 5MPOA 1ENFA 4HROA 3L54A 4RGNA 1WXQA 3AB5A 3VTWA 1MJDA 4YSYB 2LJIA 2K0PA 4GXBA 4CHKA 2JYEA 2O2VB 3QARA 2CHZA 1GC6A 1H8CA 3N1XC 2WDVB 2BYVE 1E8YA 1FIQA 3SDLC 2Y5CA 4NQLB 3T3NA 2GBJA 4MGZE 2AQ2B 3L10B 1ET6A 2HTHA 2JSVX 2WXKA 4FN2A 4ZRQA 3ML8A 3SEBA 3R8BA 4FHKA 2KD0A 1D6EC 3ZO5B 4LDTD 1VZ6A 2D3CA 1VZ7A 2GOWA 4KSKC 3OAWA 2GI9A 3DDCB 3AI5A 2GRIA 2JZ3B 3V6CB 1P9DU 4MT5A 2JZPA 2MA9B 1GJZA 3V61A 5JHBA 4KIKA 4A20A 2INNE 3VAWA 3KQ4A 4WAFA 4ZRKA 4URKA 3PREA 3NZ3A 5IO9A 3QJZA 1MG8A 3UIOB 1XXGA 2AQ3B 1XO3A 2Z8LA 3HM3A 1EM7A 5LNK1 2JWUA 2WXHA 2PVGC 2D10A 3DBSA 4KKJA 1N62A 4LNKA 3L4PA 3DBHI 4MACA 3AEEB 4KGRA 2CJOA 5E6OA 3W1SA 4MH8A 3AV8A 4AWJA 4CYEA 2LXCA 4M01A 1WXVA 2BGFA 1SE3A 4AOFA 5D6JB 3RFZB 4ZDVA 4LNFA 4I6LB 2N9EB 1T3QA 1KOTA 1L7YA 2EMSA 2G45B 5AZHA 4GDKA 1WJNA 3ZIMA 4IWOA 4NJ6A 2L1AA 4OHJA 4HPLB 3TEYA 1SF0A 1FM0D 1GC7A 2D11A 1PUTA 3AU5A 3HHMA 3RNGC 4LCDE 3L0WB 3U8ZA 3VQIA 3U30A 1A5RA 1XEEA 3A4SC 3MP9A 1M4VA 1OEYJ 5DCNA 1G6JA 3PPAA 1HE8A 5KHQA 3QHTA 4F7ZA 3GP7A 3N3KB 3RI7C 5CX3A 3DWGC 2KNBA 2RDBC 3KLSX 3RN9C 2Y5BB 4EZJA 1HXYD 2V4LA 1R4NI 2L32A 2O2VA 1FCCC 3PHXB 1R4MB 2QJLA 4OVVA 2MWSB 2WU2B 5D3DA 2L52A 2KWVB 4NAMA 3J9CA 3NZSA 5FR3A 4BZAA 4AQ7A 3W5VB 2HDEA 3DHIC 4ZYNA 4K81A 2KJ6A 1V6EA 3W1SC 5DPWA 3Q3OC 3O65B 1UUPA 4L1BA 4DXFA 2LI5A 1IBXA 4JWUC 4PT5A 5G2NA 1AN8A 4TV3A 2PJHA 2VRRB 5JHAA 1WZ3A 1V9JA 2IY0B 2QILA 3CMMB 5LXHA 2CS4A 1QOBA 1IPGA 1RLFA 3VXWA 2BYEA 5GMVA 2MH7A 3P4SB 4GIVA 2KX3A 2D3BA 4WJQA 4H2AA 3RUIB 3UINB 4OVZA 4FHJA 2YLMA 3NHEB 4US9A 3R2TA 1CK1A 4ANUA 1SXTA 1SE2A 2RMMA 4PS8A 1L0XB 2PKOA 2LZ6A 4N6EB 3BYTB 3TUOA 1SE9A 5AZFA 4MSMB 5C3JB 2UU7A 2MHJA 2B3AA 2L76A 2QMTA 1WRIA 2V3NA 4A8XC 1V5OA 1JWMD 3PVLA 4GDLB 2IY1B 2NCNA 2N9PC 4TQ1A 1N61A 3HUIA 5JXVA 5HFYA 5IAAC 1F9JA 2WQYB 2E3TA 2WHIA 1MI0A 1XT9B 1WMHA 2ZCCA 2L83A 4BKSD 2BS4B 4W9DA 2KDIA 2O6VD 4C4VB 1HQRD 3KUDB 2J0MA 2JXXA 4WWPA 2KTRB 2KKCA 4BAXA 1YX6B 2LWPA 1TT5B 1E7PB 2LVQA 4F8CB 3ZQ4A 2G3QB 3EECA 3AEDB 4ASWC 3A1QB 1BT0A 1V49A 4HPPA 3FKYA 3QWZB 1GUAB 1TKGA 3AULA 1TKEA 1I4GA 2J52A 1FFUA 5C23A 4W9JA 1SGHA 2KWCA 4N59A 1HZ6A 2PVOD 1JWUD 2BTEA 1TIFA 3ZNZB 2K22A 3ZXRA 1GB1A 1VJKA 3WANA 4ANVA 4EEWA 1TY0A 3LXFA 3PZDA 3AE2B 4ANWA 1XCQL 1ZXIA 1IGCA 4NAWA 1WXSA 3I3TB 3A9JA 3HK0A 3VRAB 3BIID 3MFGA 3RNEC 1JRUA 5L95C 1L4ZB 1K53A 3I57A 3Q69A 2JPHA 3E56A 2JUOA 3DVNV 3N30A 2ZW0A 2BS2B 4JE3B 3WAPA 3DHGC 2IYDB 1TGZB 2L7RA 2WNMA 1XLQA 1HEZE 2WXJA 5DPRA 3BYYB 4RGMA 1FNWA 4M0WA 3AE8B 3D32A 3AEBB 1J7AA 2KVRA 1CJEA 2KFKB 3SR6A 2FCMA 2ZEQA 4BKGA 4G50A 1WZ0A 2JQRB 4AP4C 2PE9A 1MFWA 3E9SA 1A70A 3A9KA 1L6VA 3RNFC 4W9KA 3AM9A 5AUIA 5FR6A 3U2SC 1E10A 3NVZA 1D5ZC 4M8MA 2ON8A 5I4DA 2FIFA 2W54A 3AH7A 3HVDA 3APCA 2I1JA 1N6ZA 5DPTA 1TBEA 4M8NA 2NR2A 2LFIA 1WYGA 2ZNVB 4W9EA 1M94A 3OJ3A 3DOWA 1WJUA 2DHZA 1MHHE 3TMPB 1F1HA 2LMCA 2GLSA 4O1NA 4ARCA 1UGMA 2WX1A 4JLCA 3V62A 3B2GA 3Q8CA 1L0YB 1V1PB 4K7WA 4LNIA 4W9LA 1WY8A 4K1RB 2BWES 2INPE 2JWZA 2MW5A 4AJYB 1FNUA 1QT9A 2LXAA 1RFKA 3EHVA 2LVPA 1VZ8A 2WXOA 4XC2A 3ZDMC 5BYRA 3AE5B 1K8RB 4E74A 3T9LA 1P1AA 3P4PB 5EE9A 2LHEA 1XF5L 1I4PA 2WXGA 2DYOA 1FMAD 1ROEA 2ZW1A 2MBEA 2AEHA 2JVCA 2OHFA 2KC2A 1LQBA 1EU4A 4OW0A 5BYSA 3L13A 3Q3NC 2V0GA 2GBKA 3AEGB 1F52A 5G5GA 2KDEB 2CU1A 1TS4A 1IUEA 1VCBA 3GZNI 4BOZB 2FCQA 4Q2JA 2ZCBA 4GDLA 2AQ1B 2NBVB 1D5MC 4D2KA 4NNJB 4PK1A 1KFYB 3M63B 2CKHB 2QHOA 3B08A 2N1VA 5EE0A 1NDDA 1YQ4B 2IPKD 3GZNB 4XYCA 2L8JA 2V3PA 1P7FA 3OJ4B 2IGHA 1EU3A 2KZRA 3KVFB 4IOIE 2W3SA 2IO2B 3H7PB 4FJZA 2FE8A 3R2IA 3DPDA 2KQ7A 1CZPA 3C0RB 1E8WA 1T0QC 4G11A 2PIAA 3JSVB 1WX9A 1ZW7A 4IUMB 4E3CA 1WIAA 1UWMA 2K1FA 3EFUA 2DZKA 4JQWC 1V8CA 2N7DA 1U4AA 5HHDG 1LXDA 4LJPB 2C7NB 4KVGB 4BBNC 2A5UA 4P7IA 2RD0A 4YL8A 3NVYA 5FKAC 2J7QB 1TS5A 1TTNA 2I1KA 4EOYA 3JW0X 3BY4B 1PDXA 2B76B 3WIMA 3AE1B 3TBLD 1T0SC 2LASA 2KQ4X 2BF8B 4XWTA 2BS3B 1SIJA 1ZXHA 4C4VA 3T8MA 5EE1A 1KH0A 1WWTA 5G55A 3IVFA 3OG5A 3VTUA 4P6VF 4GDKB 2KMCA 4NJCA 3UQBA 4WJPA 3B9JA 3B2FA 2ZVOA 2R2OA 1XLPA 1JWBD 3ZVVA 2DYMA 2G9HD 4FXCA 1WR6E 1UELA 1ZPSA 5C2TB 1C9FA 2OEDA 1P3QU 2BYFA 2ONQA 1F0ZA 4RMAA 4HJGE 4K7UA 1WJ6A 2JRIB 1BUIC 1V5TA 1OTRB 3C19A 2LRUA 4EE2A 1E6EB 2DAJA 4N58A 1YQ3B 3QQ8B 2R2QA 3PRPB 4C80A 3PRMB 2X8XX 2REXA 2LRWA 3Q14C 1YJIA 1S1QB 3MTNB 1AWDA 3WAOA 1YN3A 3VUYA 2G4DB 2WU5B 2IO0B 4EZLA 2M4NA 4DXAB 1HTOA 4W9HA 1T5XD 3U4EG 2M0XA 3VH4B 1XLNA 2BKRB 3OWEB 2LGXA 2LGSA 4KDIC 1I4HA 2LHDA 3NUHB 3C8YA 4LLGM 3MC0B 4NPNA 4TSSA 4GU2A 5BMGA 1YJJA 4WURA 2KOXA 1WFYA 3AXCA 5EDSA 2QIEB 5HG2A 4LNOA 3GOEA 5H92C 2KANA 2LEKA 3Q3MC 1Q10A 4RF0A 4WH4A 3MJ5A 2SEBD 4KZ0A 1ZDXA 2MJ3A 1WE6A 2MBHA 4LDTB 4XZ4A 3WA0A 1WXAA 3P4QB 4KIKB 2KN5A 3W2DA 4B6WA 4MGIE 1YN5A 4NJ7A 3ZNGC 2PMVA 1I4RA 3IAM1 3PRZA 3RMKC 5E6NA 2C7HA 3DBRB 3HIZA 1JALA 2IGDA 3RCZA 2FUG1 4I6NB 4RF1A 3H6NA 3RD2A 4YTPB 2NBUA 3R7RA 3W9CB 1YJ1A 3ZGZA 1SB3C 4RGOS 3IT4B 3HVZA 1WGGA 2CR5A 2VH2A 1FXTB 1L6UA 4FJVB 3Q3JA 1C4CA 2RPVA 2DYBA 4ICUA 2N4FA 3IFWB 3IXSA 3Q8AA 3QCAA 4IWPA 3EA6A 3DBLI 1E90A 3ZTCA 2MBBB 2KLGA 4TUUA 3ZDTA 5H8YE 4US8A 5IA7A 5D7GA 3DCGA 3BVZA 3K9PB 4B9KA 3PHWB 2G4SA 4BKSA 1PQSA 1QOFA 1Q1OA 4BKTA 1SSNA 2N7JA 3Q8FA 3A33B 3UF8A 4EKUA 5J18A 3AU4A 2RGFA 4TQ0A 2DWQA 1YIWA 3GS2A 1VR9A 3ABVB 4HRSA 1QZEA 1Z5SB 4KGSA 2KACA 3DHHC 3ZNID 3Q8BA 1P7EA 1V1PA 3M95A 3APDA 3ZXVA 1OQRA 3NS1A 1YN4A 3ALBA 2AYOB 2QCZA 4A3OA 2NBWB 3DWMA 1PYWD 3WALA 2KK8A 1HA5A 2M1MA 3IG3A 2V1YA 3PLUA 1Q5WB 1EF5A 1XLOA 2BQQA 2PLPA 1OGWA 1V80A 2DZIA 1YD8U 3TEZA 3RZWC 3M3JA 1T6BX 1WGKA 2WXIA 4QAYA 4IM2A 2W9NA 3K9OB 4M02A 4A90A 5JH5C 4XDDA 2MEKA 2E6XA 1KF6B 4GSWA 1D3ZA 4PS3A 3ETRA 3X0WA 5FK9C 3WAMA 1V2YA 1N63A 1DOXA 4ZOHC 2O6VB 4C56C 2EMTA 4R3DA 1UBIA 3NS8A 4PYZA 4G3XB 1N5WA 1Y8RC 3SHQA 1WF9A 1FPYA 3LYYA 4MM3A 3ZRCA 2D07B 1PGAA 2DX5B 3SFEB 1DYQA 2ICIA 2D3AA 2BYTA 2CHXA 2A4ZA 2LJ5A 3VH3B 3ZJUA 4IDIA 2ASQA 3V3XA 2MBQA 1RYJA 1EO6A 4DDGD 5HI1A 4ICVA 2X38A 4NAWB 2M8SA 2BW2A 1I35A 5BMIA 3VHTC 4C7ZA 3DBLB 5BMHA 1I7HA 3APFA 3CSFA 3IT6B 5BYQA 1LM8B 3RPFC 2D3GA 1Y56A 1DOIA 4NY0A 2INDC 1R7SA 2K25A 3NVWA 2FCNA 2Y3AA 5E6PA 2C5LC 3TL5A 3GE3C 2MCNB 4BVUC 2LGYA 1TZOA 3PGEA 2N9XA 5D3IB 1KTKA 3ZRFA 4JPSA 4JIOU 4KGTA 4AJWA 2WXQA 3PO0A 3QAQA 3PZ8A 5CHWA 2BPSA 2DLBA 4KV2A 1C77A 3A9KB 4HVBA 1YNTE 1FCLA 5IN7A 3AE3B 3RT3B 5JZEB 1K50A 1WMHB 3NY5A 4FJYA 1FFVA 1ACCA 2XEWA 2EKEC 4WQMA 3VUXA 1WGHA 3HRDD 3ONSA 1NI2A 3KH0A 4KDLB 3H1UA 4HDQA 1J0GA 1TKYA 4XDCA 1WR1A 3SU8X 2KLCA 1L5PA 2KYWA 1V86A 1KLVA 3S2AA 2J53A 2HJ1A 1RWSA 3NOBA 4XX5A 2HTME 4RM8A 2RSUA 3KWVA 3TSSA 3A1QA 2BVCA 4JL9A 2W3RA 2KMMA 3KYCD 4RGTA 1I4QA 4DHZB 3FAHA 2AX5A 1S3SG 1EF1A 5IKCM 3CSTA 2GBRA 4M0WB 3I63C 2IGGA 3P63A 1ET9A 4L2YA 3M62B 1JQ4A 2KDMA 2FIDA 4OVUA 3QK0A 4KSLC 2Z0DB 2XBBC 3H8HA 2PE6B 2JF5A 1L0VB 4J6IA 4HCNB 2FUHB 3N9YC 1WM3A 2ZJDA 1IBXB 1YOVB 2MP2B 3IHPC 1XD3B 2K5PA 2CU3A 2RR9A 1YMHE 3NVVA 3V05A 1J19A 3QC8B 3IBEA 2VZKB 2JU6X 2L0TA 1IYFA 3QX1A 1J8CA 3BVMA 1EWCA 1ZP0B 3AE4B 2XK5A 1D5XC 1JW9D 1J7BA 3B1LX 1ZE3D 5J2RA 3LDZE 1JMLA 3ECIA 4OZCA 1GAQB 1JRPA 4MSQB 2WDTB 2W55A 2KJHB 2KWDA 5EE3A 4ANXA 3NRZA 3MC8A 1HZ5A 2W82A 1OQQA 2CJNA 2LUEA 4HEA1 1PFDA 2WP9B 1P98A 3ZLZA 4YSXB 3ZYYX 3ZUNA 2JY6A 1UBQA 4HKZE 1ZDVA 4IWQA 2EELA 1R4MI 2M56B 3L17A 1F77A 2AL6A 2ZVNA 1NBFC 2NS5A 2WS3B 1OQYA 1L2NA 3DBRI 4TMAB 2KDFB 2LVOA 2WDQB 4MH0E 4YWGG 3RNAC 1QKZA 4YXDB 2KT7A 3V6EB 1JWAD 2K6DB 2V4IB 3DVGY 4A9AA 4USAA 4DBGA 4REZA 2IBIB 5C1ZA 1UGJA 2K8HA 1LGRA 2WLBA 5IP4D 2NPTA 1RM6C 2Z59B 2JYTA 1E8XA 3L16A 4LK0M 3UGBB 4S17A 5D2MB 4RNAA 2ZPNA 2NTTA 4A3PA 1PGBA 3VFKA 3RNCC 3CIRB 3VVWB 2J42A 4A6QA 3PT2B 2N7EA 5L83A 1AYFA 2G1EA 1TZ1A 5E6JA 2NPTB 3AEAB 3EFCA 4WWOA 2MJEA 4B95A 1E9MA 1I4XA 1SBBB 3RNBC 3PZ7A 4MGYE 4MEMA 2XNAC 3ZTDA 4W9FA 4CQNA 4JGHB 4G0NB 3KUZA 2JZZA 2CHWA 3LJ3A 4KZCA 1NI3A 1MG4A 4MGKE 1NENB 4YTNB 1ZKHA 2FCSA 1NVID 1TJEA 1K52A 4W9GA
chains in the Genus database with same CATH topology
3BIID 3MFGA 3KWLA 1QOFA 4B0MA 2WXLA 1SSNA 2N7JA 1L4ZB 1K53A 3I57A 3Q69A 1B9RA 1TS3A 4JX1C 3E56A 1QOAA 3Q8FA 2RDGA 4A55A 2ZW0A 2NMQA 2BS2B 1LO5D 4JE3B 3BK1A 4TQ0A 1WSPA 1TS2A 2WXMA 3BWUD 2DWQA 3URYA 4AS1A 1EWYC 3GS2A 1VR9A 2WNMA 3VRAB 1XLQA 3ABVB 4ARIA 4HRSA 4XE0A 1HEZE 2WXJA 2D5GA 2PW9A 1FRDA 4KGSA 3BYYB 2WXNA 2BB6A 2KACA 1D4BA 1BXTA 3Q8BA 1F2RC 1P7EA 1NYRA 1V1PA 3AMZA 1STEA 4RGMA 1ZUD2 1FNWA 3TEWA 4M0WA 2WXPA 2MJDA 1QOGA 3AE8B 1OQRA 2WXRA 3AEBB 3CWIA 3NS1A 1J7AA 1QLBB 1CJEA 3SR6A 1GB4A 1YN4A 3AE7B 2N0SB 4B0EA 3U7ZA 1AW7A 2JQRB 4WIPA 3GB1A 3AECB 3DWMA 1PYWD 1SEBD 1FRRA 1UNSA 2H88B 3TEXA 1FNVA 1A70A 3E9SA 1HA5A 1QQRA 1L6VA 1VRAB 3MHZA 3AM9A 5AUIA 4YTMB 1IGDA 1KLGD 1XLOA 2PLPA 3U2SC 5MPOA 1ENFA 1E10A 3TEZA 4HROA 4RGNA 1T6BX 1WXQA 1D5ZC 3FC4A 1WGKA 3AB5A 3NVZA 2WXIA 1GPXA 2ON8A 5I4DA 2M0AA 2LJIA 4YSYB 3IAS1 2W54A 3AH7A 4WWMA 3ZJVA 2K0PA 3HVDA 4A90A 2JYEA 3LB8C 4XDDA 2MEKA 2E6XA 1KF6B 1MHXA 1BMLC 2LFIA 1WYGA 3ETRA 5FK9C 2WDVB 1MHHE 2LMCA 4O1NA 1FIQA 4ARCA 2Y5CA 1QILA 1N63A 3T3NA 1DOXA 2XN9C 2AQ2B 4ZOHC 4C56C 2TSSA 4R3DA 3B2GA 1ET6A 3Q8CA 1L0YB 1V1PB 3T3OA 4P16A 1N5WA 3LYYA 2JSVX 2FBWB 2Y5PA 2WXKA 4ZRQA 3SEBA 2INPE 3R8BA 1PGAA 1FNUA 2BB5A 3SFEB 1DYQA 1QT9A 1RFKA 2K3UA 1VZ8A 1D6EC 2ICIA 2WXOA 1VZ6A 5BYRA 2BYTA 1VZ7A 3AE5B 1FXAA 3ZJUA 4IDIA 3V3XA 3P4PB 5EE9A 1RYJA 1XF5L 2LHEA 1I4PA 2WXGA 3U52E 3W5UB 1C4PA 2DYOA 2GI9A 1FMAD 1ROEA 2ZW1A 5HI1A 2OHFA 1SE4A 2GRIA 2X38A 4NAWB 1EU4A 4UDUC 2BW2A 4OW0A 1C79A 4MT5A 2JZPA 2I38A 5BYSA 5BMIA 2V0GA 4C7ZA 5BMHA 1I7HA 3VR9B 2INNE 3AEGB 5G5GA 4GLSC 3KQ4A 4WAFA 4IKGA 1TS4A 1IUEA 2N9LA 1KRHA 3IT6B 5BYQA 4Q2JA 3NZ3A 3RPFC 4ZRPA 1Y56A 1DOIA 2AQ1B 2WXFA 1XXGA 2AQ3B 1R7SA 1XO3A 3NVWA 2Y3AA 1QF6A 2WDRB 1D5MC 4D2KA 2Z8LA 1EM7A 1UWXA 2N9KA 5LNK1 2JWUA 2WXHA 2PVGC 1KFYB 4KKJA 1PGXA 2BBCA 1NEKB 1N62A 5EE0A 1TZOA 1ZOYB 2EKIA 5D3IB 1YQ4B 2IPKD 1KTKA 3L4PA 4MACA 4JPSA 3AEEB 1K51A 2V3PA 1P7FA 4KGTA 4KGRA 2CJOA 4ITKA 2WXQA 3W1SA 4MH8A 3AV8A 2R61A 1C4AA 2IGHA 3PO0A 1EU3A 3PZ8A 2IDYA 2DLBA 1C76A 4IOIE 1C77A 4DXGA 1SE3A 1V1OA 2W3SA 3FILB 1FCLA 1YNTE 4C7YA 3RFZB 2FE8A 3P42A 4OZAA 1VLBA 3R2IA 3AE3B 2DBYA 1K50A 1CZPA 1FFVA 2PIAA 1T3QA 2Q5WD 1FO4A 1ACCA 1KLUD 1UWMA 4WQMA 2JXTA 3HRDD 1V8CA 5HHDG 4ZHPA 3FILA 1E0ZA 1TKYA 4XDCA 2L1AA 4OHJA 1L5PA 3EGRA 1SF0A 3TEYA 1FM0D 5TSSA 1PUTA 3NVYA 2J53A 1RWSA 5FKAC 2HTME 3VQIA 1TS5A 3KWVA 3TSSA 1B1ZA 1XEEA 1PDXA 3MP9A 1M4VA 4MM3B 2B76B 1XCTL 2W3RA 2KMMA 4RGTA 3AE1B 1I4QA 3FAHA 2JX5A 2AX5A 1DOYA 2K9XA 2KQ4X 1GOZA 3BVGA 1SJED 4XWTA 2BS3B 1SIJA 1ZXHA 3GP7A 3AN1A 5EE1A 1OFFA 2IGGA 3DWGC 2QEJC 3P63A 1SJHD 2ACZB 3KLSX 1TY2A 1ET9A 1KH0A 4L2YA 1JQ4A 1WWTA 1HXYD 2KDMA 1JWSD 2L32A 1FCCC 4YT0B 2QJLA 4P6VF 4GDKB 3H8HA 5GXGB 1L0VB 2WU2B 4RCOA 4NJCA 5D3DA 2L52A 3B9JA 3B2FA 3N9YC 1MPEA 4NAMA 1IBXB 1XLPA 3J9CA 1JWBD 4RFBA 5FR3A 2DYMA 2K5PA 2G9HD 2CU3A 4AQ7A 4FXCA 3W5VB 2HDEA 2LUMA 1ZPSA 1YMHE 5C2TB 1C9FA 3NVVA 3V05A 4KKIA 2OEDA 1J7CA 2ONQA 1F0ZA 1UUPA 2VZKB 4HJGE 2JU6X 4L1BA 3ZJTA 4DXFA 1F2RI 1IBXA 4JWUC 3BVMA 1BUIC 4PT5A 1AN8A 1EWCA 1ZP0B 3AE4B 4EE2A 1E6EB 1D5XC 1JW9D 1FD6A 1J7BA 2BT6A 2QSDA 4RH6A 4N58A 1YQ3B 1ZE3D 2YEPF 3BK2A 4C80A 1JCKB 1JMLA 4NZLB 4OZCA 1GAQB 1JRPA 2QILA 1QOBA 1YJIA 2W55A 4ZHOA 1AWDA 1YN3A 2KWDA 2WU5B 5AUKA 1DGJA 5EE3A 3VRBB 2MH7A 3P4SB 4OZBA 3UI3A 3NRZA 1T5XD 4H2AA 1ESFA 4KX6B 1HZ5A 3U4EG 2W82A 2VZKD 1OQQA 4OVZA 1XLNA 2CJNA 3OWEB 4US9A 3R2TA 1CK1A 1I4HA 4L23A 3P1MA 2LHDA 1SXTA 1SE2A 3NUHB 3C8YA 2RMMA 4LLGM 1L0XB 2PKOA 4HEA1 1PFDA 3MC0B 2WP9B 4TSSA 4N6EB 5BMGA 3BYTB 4LTUA 3TUOA 1FXIA 1YJJA 4WURA 3AEFB 4YSXB 2QIEB 1V97A 5HG2A 3ZYYX 5H92C 5C3JB 2IJ0A 2LEKA 2QMTA 1Q10A 1CQVA 1WRIA 4HKZE 1ZDVA 3MJ5A 4RF0A 2SEBD 4WH4A 2I2YA 2EELA 2V3NA 2M56B 3WCQA 1ZDXA 1F77A 4A8XC 1JWMD 4GDLB 3AE6B 2WS3B 4HKQA 2MJ3A 2J4XA 2RDHA 4JWSC 4TMAB 3EUB2 4TQ1A 2WDQB 1N61A 4YWGG 4J3OD 3HUIA 4ZYSA 1QKZA 1C78A 3P4QB 4YXDB 2LGIA 5JXVA 5HFYA 1JWAD 2V4IB 3W2DA 2WQYB 2KN4A 1YN5A 1N60A 2E3TA 4A9AA 1FEHA 4USAA 2H89B 1NYQA 2PMVA 1MI0A 1I4RA 1MVKA 3IAM1 4REZA 1UGJA 2L83A 2BS4B 2WLBA 1TYGB 3BZDB 1RM6C 1JALA 3AE9B 1HQRD 2IGDA 2YEPB 2FUG1 2JYTA 1E7PB 4LK0M 3I9V1 4RF1A 4XWWA 2GB1A 3ZQ4A 2NTSA 4RNAA 4YTPB 2NTTA 3AEDB 1PGBA 3W9CB 3ZGZA 3CIRB 1SB3C 2J42A 4A6QA 1TKGA 4RGOS 1TKEA 1I4GA 2KAJA 3IT4B 5G5HA 2J52A 1AYFA 2G1EA 1FFUA 3HVZA 5E6JA 4DQOC 3AEAB 4N59A 1HZ6A 1L6UA 2MJEA 2PTLA 3P4RB 2PVOD 1JWUD 1E9MA 1I4XA 1SBBB 1C4CA 2RPVA 2BTEA 3PZ7A 2XNAC 1JROA 4CQNA 2K22A 3IXSA 3Q8AA 3O13A 1GB1A 1VJKA 3EA6A 1VDVA 2SAKA 4YSZB 1NI3A 1TY0A 3LXFA 2M19A 1N5XA 3AE2B 1NENB 4YTNB 1XCQL 1ZXIA 5H8YE 4US8A 5T8IA 1IGCA 5D7GA 3VR8B 3SFDB 1L4DB 1NVID 3BVZA 1TJEA 1K52A 3Q8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BII D;  3SFE B;  1QT9 A;  1RFK A;  1SF0 A;  2PKO A;  3KWL A;  1FM0 D;  1PFD A;  2WP9 B;  1QOF A;  1PUT A;  4N6E B;  3NVY A;  4LTU A;  1RWS A;  1FXI A;  1YJJ A;  2HTM E;  3AEF B;  4YSX B;  2QIE B;  1FXA A;  1V97 A;  3AE5 B;  4JX1 C;  3ZYY X;  1QOA A;  5H92 C;  5C3J B;  1PDX A;  1B9R A;  4IDI A;  2LEK A;  3P4P B;  5EE9 A;  1WRI A;  1RYJ A;  2B76 B;  2BS2 B;  3W5U B;  2W3R A;  2KMM A;  2M56 B;  3AE1 B;  3WCQ A;  2DWQ A;  1FMA D;  1ROE A;  3AE6 B;  2JX5 A;  2OHF A;  3FAH A;  2AX5 A;  1DOY A;  2K9X A;  2WS3 B;  2MJ3 A;  1EWY C;  2BS3 B;  1SIJ A;  4JWS C;  1XLQ A;  3ABV B;  3EUB 2;  4HRS A;  2WDQ B;  3AN1 A;  1N61 A;  5EE1 A;  1FRD A;  1OFF A;  3HUI A;  3DWG C;  4C7Z A;  3P4Q B;  4YXD B;  1I7H A;  3P63 A;  2ACZ B;  1NYR A;  3VR9 B;  3AMZ A;  3AEG B;  5G5G A;  1ZUD 2;  1JWA D;  1JQ4 A;  1WWT A;  2WQY B;  2MJD A;  1IUE A;  4YT0 B;  1QOG A;  3AE8 B;  1N60 A;  2E3T A;  1OQR A;  4A9A A;  4USA A;  1KRH A;  3AEB B;  2QJL A;  3CWI A;  2H89 B;  1NYQ A;  1J7A A;  3NS1 A;  4P6V F;  3RPF C;  1QLB B;  1CJE A;  5GXG B;  1L0V B;  2WU2 B;  3SR6 A;  2L83 A;  2L52 A;  1DOI A;  2BS4 B;  2WLB A;  3AE7 B;  1TYG B;  3B2F A;  2N0S B;  3B9J A;  1R7S A;  1JAL A;  1RM6 C;  1XO3 A;  3AE9 B;  3NVW A;  1XLP A;  2JQR B;  1JWB D;  1QF6 A;  2WDR B;  3AEC B;  2K5P A;  3DWM A;  1E7P B;  2CU3 A;  4FXC A;  3W5V B;  1FRR A;  2H88 B;  2PVG C;  1KFY B;  4YSZ B;  5C2T B;  3NVV A;  4YTP B;  1A70 A;  3AED B;  1L6V A;  1NEK B;  1J7C A;  1N62 A;  5EE0 A;  1F0Z A;  2EKI A;  1ZOY B;  3W9C B;  3AM9 A;  5AUI A;  4YTM B;  3CIR B;  1SB3 C;  1XLO A;  1YQ4 B;  3L4P A;  1TKG A;  3AEE B;  5MPO A;  1TKE A;  2KAJ A;  4JWU C;  5G5H A;  1E10 A;  1AYF A;  2G1E A;  4HRO A;  1FFU A;  2CJO A;  3HVZ A;  4ITK A;  1WXQ A;  3NVZ A;  3FC4 A;  1ZP0 B;  1WGK A;  3AB5 A;  3AE4 B;  3AEA B;  3AV8 A;  3PO0 A;  1GPX A;  1E6E B;  4YSY B;  1JW9 D;  2W54 A;  3AH7 A;  1J7B A;  2BT6 A;  4N59 A;  4WWM A;  4N58 A;  1L6U A;  2MJE A;  2W3S A;  3P4R B;  1YQ3 B;  2PVO D;  3LB8 C;  4C7Y A;  1KF6 B;  1E9M A;  4C80 A;  1VLB A;  3AE3 B;  1GAQ B;  1JRP A;  1JRO A;  1WYG A;  3ETR A;  2DBY A;  2K22 A;  1CZP A;  2WDV B;  1QOB A;  1VJK A;  1YJI A;  2W55 A;  1FFV A;  4ZHO A;  1FIQ A;  1AWD A;  1T3Q A;  2PIA A;  2Q5W D;  1VDV A;  2Y5C A;  1N63 A;  1FO4 A;  1DOX A;  2WU5 B;  4ZOH C;  5AUK A;  1DGJ A;  5EE3 A;  3VRB B;  1UWM A;  1NI3 A;  2MH7 A;  3B2G A;  3LXF A;  3P4S B;  3HRD D;  4WQM A;  1V8C A;  2M19 A;  1N5X A;  3AE2 B;  1N5W A;  1NEN B;  4YTN B;  1ZXI A;  3NRZ A;  5H8Y E;  4KX6 B;  4US8 A;  4ZHP A;  2FBW B;  1OQQ A;  3VR8 B;  3SFD B;  1TKY A;  1NVI D;  1XLN A;  2CJN A;  1E0Z A;  4US9 A;  1TJE A;  1L5P A;  3P1M A;  3VRA B; 
#chains in the Genus database with same CATH topology
 3VUW A;  2L0F A;  2WXL A;  1YQB A;  1TS3 A;  2RPQ A;  1QOA A;  2XK5 B;  2WWZ A;  2KO3 A;  2WGS A;  3NZU A;  3URY A;  3TIX A;  4S0R A;  3TCA A;  3MJW A;  4K3B A;  4C00 A;  1LFD A;  1D4B A;  2WXN A;  2BB6 A;  1BXT A;  3N20 C;  1ZUD 2;  1SIF A;  3TEW A;  2WXP A;  3MC9 A;  1QOG A;  3DQV A;  2WXR A;  1RRB A;  1IP9 A;  2GBM A;  2FAZ A;  4GOC A;  2N0S B;  3DBH B;  4B0E A;  3U7Z A;  1AW7 A;  3JSV A;  3OLM D;  4WIP A;  5AZG A;  3QA8 A;  1SEB D;  2WYQ A;  1FRR A;  1UNS A;  2H88 B;  3TEX A;  1FNV A;  1VRA B;  1ZGU B;  2WX0 A;  3MHZ A;  1IGD A;  2NVU I;  4WQO B;  3N1Z C;  2KQS A;  3FC4 A;  1GPX A;  2J0K A;  2M0A A;  3IAS 1;  4WWM A;  4F1S A;  3ZJV A;  1E7U A;  3LB8 C;  2YVC A;  1MHX A;  3QIJ A;  1BML C;  4X57 B;  2BWF A;  4W9I A;  3JVZ X;  3NJT A;  1QIL A;  1C1Y B;  2XN9 C;  3ENE A;  2TSS A;  2GBN A;  3T3O A;  4P16 A;  4DWF A;  4P1B C;  1E8Z A;  2FBW B;  2KDB A;  2Y5P A;  3P2B A;  3PS6 A;  1P0R A;  2C9W B;  2PPH A;  1AAR A;  2BB5 A;  2K3U A;  2IO3 B;  2N1W A;  4WAA A;  1Z2M A;  2K6Q A;  3ZNH B;  3H7S A;  3RYT A;  4MEL A;  1FXA A;  4II3 B;  2KX0 A;  1I42 A;  3U52 E;  3W5U B;  1C4P A;  1WX7 A;  1SE4 A;  4DK5 A;  3DVG X;  4TKN A;  4P1C C;  4UDU C;  1C79 A;  2I38 A;  4LNN A;  2MLB A;  3VR9 B;  2DEN B;  2KFJ A;  3H9D A;  4GLS C;  4IKG A;  2JRH A;  3H7P A;  2N9L A;  1KRH A;  2ZNV C;  2K8C A;  4ZRP A;  5J17 A;  4HXD A;  2WXF A;  3VTV A;  2DAF A;  1QF6 A;  2WDR B;  2C7M B;  1UWX A;  2N9K A;  4EFO A;  2MSE D;  1HTQ A;  1T0R C;  2HJ8 A;  4NQK E;  1PGX A;  2BBC A;  1NEK B;  3UQA A;  4PYU A;  2EKI A;  1ZOY B;  2PEA A;  3RUL A;  4HPM B;  3I5J C;  2K8B A;  1K51 A;  1GG3 A;  4ITK A;  2M17 A;  1C4A A;  2R61 A;  2QC8 A;  2IDY A;  1C76 A;  2LGD A;  4DXG A;  1V1O A;  3FIL B;  4C7Y A;  4OZA A;  3P42 A;  1VLB A;  2DBY A;  2KMA A;  4LJO B;  2MP2 A;  4II2 B;  2Q5W D;  2OJW A;  1FO4 A;  1KLU D;  5IOI A;  2JXT A;  4ZHP A;  3GE8 C;  2JT4 B;  3FIL A;  1E0Z A;  3Q6B A;  4DHJ B;  3EGR A;  2V3S A;  4FUL A;  5TSS A;  3PSE B;  4K7S A;  1B1Z A;  1C3T A;  2VH1 A;  2KJR A;  1H4R A;  1RFA A;  4MM3 B;  3BIN A;  1XCT L;  4GB9 A;  3X23 A;  2INC C;  2JX5 A;  1KJT A;  3KYD D;  1DOY A;  2K9X A;  3RZF A;  3BVG A;  1GOZ A;  1SJE D;  3AN1 A;  1Q0W B;  1RAX A;  4DDI D;  1OFF A;  2KXJ A;  2QEJ C;  1SJH D;  2ACZ B;  1TY2 A;  2Z0E B;  4MJS A;  2HE7 A;  1JWS D;  4BOS C;  4YT0 B;  4HJK A;  3ZW3 A;  5GXG B;  4RCO A;  2KFK A;  4GN1 A;  1MPE A;  4RFB A;  2AL3 A;  1WGR A;  3UIP B;  3Q3F A;  3U7D A;  4FBJ B;  4IG7 B;  4HDO A;  2LUM A;  2L00 B;  3SD5 A;  2KC1 A;  4KKI A;  1J7C A;  4BFR A;  1UZX B;  3ML9 A;  3ZJT A;  1F2R I;  3CF6 E;  1E7V A;  3HM6 X;  4N9F 4;  4IW0 A;  1WJ4 A;  1FD6 A;  2BT6 A;  2QSD A;  4RH6 A;  3R3M A;  4WJN A;  3R66 C;  2LD9 A;  4GGQ A;  3BK2 A;  2YEP F;  5CHF A;  1JCK B;  4NZL B;  3N32 A;  3A9J B;  2O6V A;  4ZHO A;  5LXI B;  5AUK A;  1DGJ A;  3VRB B;  4OZB A;  3UI3 A;  1ESF A;  4KX6 B;  5HKH A;  4FLH A;  2VZK D;  4L23 A;  3P1M A;  3MHS D;  2KTF A;  3N1Y C;  4LTU A;  3DVN U;  2HD5 B;  1FXI A;  2C60 A;  3AEF B;  1V97 A;  4XGA B;  2IJ0 A;  1UD7 A;  1CQV A;  2V9H A;  2I2Y A;  2QDF A;  3WCQ A;  4FA6 A;  3AE6 B;  4ZRI A;  4HKQ A;  2J4X A;  1WXM A;  2RDH A;  4JWS C;  1WGY A;  2MRP A;  3EUB 2;  3B0A A;  2GMI C;  4J3O D;  5D94 A;  4EZK A;  4ZYS A;  1C78 A;  5BO4 B;  2LGI A;  3A4R A;  4E71 A;  2OJR A;  2KN4 A;  4WWN A;  1N60 A;  1FEH A;  5DPS A;  2H89 B;  1NYQ A;  1MVK A;  4CO7 A;  1YX5 B;  4HWI B;  1TYG B;  3BZD B;  4K3C A;  3AE9 B;  2AWT A;  2YEP B;  5AEK B;  4M00 A;  3I9V 1;  3L08 A;  4XWW A;  1WH3 A;  2GB1 A;  2NTS A;  5TR5 A;  4HK2 A;  2UYZ B;  1ISN A;  1WYW B;  4HCP B;  2J0J A;  2DZJ A;  1OEY A;  1GNU A;  2KHW B;  1VD2 A;  2KAJ A;  5G5H A;  4IM3 A;  2UWQ A;  5KHO A;  2DZM A;  4DQO C;  2KVZ A;  5CHV C;  4FAD A;  1UF0 A;  2PTL A;  3P4R B;  4IC7 B;  3EC8 A;  1JRO A;  4DHJ D;  3O13 A;  1CMX B;  3KW5 B;  2FNJ B;  1V81 A;  1VDV A;  2SAK A;  3V60 A;  4MJS B;  1KM7 A;  4YSZ B;  3PTF C;  3PV1 A;  2M19 A;  1N5X A;  4ACF A;  4WJO A;  5LLI A;  4MDK E;  5T8I A;  3Q2A C;  4HLE A;  1XQQ A;  3SFD B;  1L4D B;  3VR8 B;  4IM0 A;  3Q8E A;  3KWL A;  4B0M A;  2OOB B;  2L05 A;  1B9R A;  4JX1 C;  2MQJ A;  2RDG A;  4A55 A;  2BKF A;  4BBN F;  2NMQ A;  2ZZP B;  3TJP A;  4DHZ E;  1LO5 D;  2KWU B;  4ZRJ A;  3BK1 A;  1WSP A;  1TS2 A;  2WXM A;  3BWU D;  4GMV A;  5CTR C;  3JYU A;  4AUQ C;  1UH6 A;  2MX2 A;  4AS1 A;  1EWY C;  2KTR A;  1WE7 A;  1WRD B;  4ARI A;  4XE0 A;  2D5G A;  2PW9 A;  1EUV B;  1FRD A;  2IO1 B;  2ZPY A;  1F2R C;  4RM9 A;  1NYR A;  2K39 A;  3AMZ A;  1STE A;  3NG0 A;  2MJD A;  1WI0 A;  3CWI A;  3ZKJ C;  1QLB B;  4I6P A;  1R4N B;  1GB4 A;  3AE7 B;  2IZV B;  4EUT A;  3PLV A;  4W9C A;  3KUC B;  2D2Q A;  4PS7 A;  3GB1 A;  3AEC B;  2DNF A;  1T0Y A;  1WM2 A;  1X1M A;  3R7Q A;  2L3Z A;  3VDZ A;  3W1Y A;  1QQR A;  1E5W A;  4YTM B;  1KLG D;  2MBO A;  1WGD A;  1WX8 A;  5MPO A;  1ENF A;  4HRO A;  3L54 A;  4RGN A;  1WXQ A;  3AB5 A;  3VTW A;  1MJD A;  4YSY B;  2LJI A;  2K0P A;  4GXB A;  4CHK A;  2JYE A;  2O2V B;  3QAR A;  2CHZ A;  1GC6 A;  1H8C A;  3N1X C;  2WDV B;  2BYV E;  1E8Y A;  1FIQ A;  3SDL C;  2Y5C A;  4NQL B;  3T3N A;  2GBJ A;  4MGZ E;  2AQ2 B;  3L10 B;  1ET6 A;  2HTH A;  2JSV X;  2WXK A;  4FN2 A;  4ZRQ A;  3ML8 A;  3SEB A;  3R8B A;  4FHK A;  2KD0 A;  1D6E C;  3ZO5 B;  4LDT D;  1VZ6 A;  2D3C A;  1VZ7 A;  2GOW A;  4KSK C;  3OAW A;  2GI9 A;  3DDC B;  3AI5 A;  2GRI A;  2JZ3 B;  3V6C B;  1P9D U;  4MT5 A;  2JZP A;  2MA9 B;  1GJZ A;  3V61 A;  5JHB A;  4KIK A;  4A20 A;  2INN E;  3VAW A;  3KQ4 A;  4WAF A;  4ZRK A;  4URK A;  3PRE A;  3NZ3 A;  5IO9 A;  3QJZ A;  1MG8 A;  3UIO B;  1XXG A;  2AQ3 B;  1XO3 A;  2Z8L A;  3HM3 A;  1EM7 A;  5LNK 1;  2JWU A;  2WXH A;  2PVG C;  2D10 A;  3DBS A;  4KKJ A;  1N62 A;  4LNK A;  3L4P A;  3DBH I;  4MAC A;  3AEE B;  4KGR A;  2CJO A;  5E6O A;  3W1S A;  4MH8 A;  3AV8 A;  4AWJ A;  4CYE A;  2LXC A;  4M01 A;  1WXV A;  2BGF A;  1SE3 A;  4AOF A;  5D6J B;  3RFZ B;  4ZDV A;  4LNF A;  4I6L B;  2N9E B;  1T3Q A;  1KOT A;  1L7Y A;  2EMS A;  2G45 B;  5AZH A;  4GDK A;  1WJN A;  3ZIM A;  4IWO A;  4NJ6 A;  2L1A A;  4OHJ A;  4HPL B;  3TEY A;  1SF0 A;  1FM0 D;  1GC7 A;  2D11 A;  1PUT A;  3AU5 A;  3HHM A;  3RNG C;  4LCD E;  3L0W B;  3U8Z A;  3VQI A;  3U30 A;  1A5R A;  1XEE A;  3A4S C;  3MP9 A;  1M4V A;  1OEY J;  5DCN A;  1G6J A;  3PPA A;  1HE8 A;  5KHQ A;  3QHT A;  4F7Z A;  3GP7 A;  3N3K B;  3RI7 C;  5CX3 A;  3DWG C;  2KNB A;  2RDB C;  3KLS X;  3RN9 C;  2Y5B B;  4EZJ A;  1HXY D;  2V4L A;  1R4N I;  2L32 A;  2O2V A;  1FCC C;  3PHX B;  1R4M B;  2QJL A;  4OVV A;  2MWS B;  2WU2 B;  5D3D A;  2L52 A;  2KWV B;  4NAM A;  3J9C A;  3NZS A;  5FR3 A;  4BZA A;  4AQ7 A;  3W5V B;  2HDE A;  3DHI C;  4ZYN A;  4K81 A;  2KJ6 A;  1V6E A;  3W1S C;  5DPW A;  3Q3O C;  3O65 B;  1UUP A;  4L1B A;  4DXF A;  2LI5 A;  1IBX A;  4JWU C;  4PT5 A;  5G2N A;  1AN8 A;  4TV3 A;  2PJH A;  2VRR B;  5JHA A;  1WZ3 A;  1V9J A;  2IY0 B;  2QIL A;  3CMM B;  5LXH A;  2CS4 A;  1QOB A;  1IPG A;  1RLF A;  3VXW A;  2BYE A;  5GMV A;  2MH7 A;  3P4S B;  4GIV A;  2KX3 A;  2D3B A;  4WJQ A;  4H2A A;  3RUI B;  3UIN B;  4OVZ A;  4FHJ A;  2YLM A;  3NHE B;  4US9 A;  3R2T A;  1CK1 A;  4ANU A;  1SXT A;  1SE2 A;  2RMM A;  4PS8 A;  1L0X B;  2PKO A;  2LZ6 A;  4N6E B;  3BYT B;  3TUO A;  1SE9 A;  5AZF A;  4MSM B;  5C3J B;  2UU7 A;  2MHJ A;  2B3A A;  2L76 A;  2QMT A;  1WRI A;  2V3N A;  4A8X C;  1V5O A;  1JWM D;  3PVL A;  4GDL B;  2IY1 B;  2NCN A;  2N9P C;  4TQ1 A;  1N61 A;  3HUI A;  5JXV A;  5HFY A;  5IAA C;  1F9J A;  2WQY B;  2E3T A;  2WHI A;  1MI0 A;  1XT9 B;  1WMH A;  2ZCC A;  2L83 A;  4BKS D;  2BS4 B;  4W9D A;  2KDI A;  2O6V D;  4C4V B;  1HQR D;  3KUD B;  2J0M A;  2JXX A;  4WWP A;  2KTR B;  2KKC A;  4BAX A;  1YX6 B;  2LWP A;  1TT5 B;  1E7P B;  2LVQ A;  4F8C B;  3ZQ4 A;  2G3Q B;  3EEC A;  3AED B;  4ASW C;  3A1Q B;  1BT0 A;  1V49 A;  4HPP A;  3FKY A;  3QWZ B;  1GUA B;  1TKG A;  3AUL A;  1TKE A;  1I4G A;  2J52 A;  1FFU A;  5C23 A;  4W9J A;  1SGH A;  2KWC A;  4N59 A;  1HZ6 A;  2PVO D;  1JWU D;  2BTE A;  1TIF A;  3ZNZ B;  2K22 A;  3ZXR A;  1GB1 A;  1VJK A;  3WAN A;  4ANV A;  4EEW A;  1TY0 A;  3LXF A;  3PZD A;  3AE2 B;  4ANW A;  1XCQ L;  1ZXI A;  1IGC A;  4NAW A;  1WXS A;  3I3T B;  3A9J A;  3HK0 A;  3VRA B;  3BII D;  3MFG A;  3RNE C;  1JRU A;  5L95 C;  1L4Z B;  1K53 A;  3I57 A;  3Q69 A;  2JPH A;  3E56 A;  2JUO A;  3DVN V;  3N30 A;  2ZW0 A;  2BS2 B;  4JE3 B;  3WAP A;  3DHG C;  2IYD B;  1TGZ B;  2L7R A;  2WNM A;  1XLQ A;  1HEZ E;  2WXJ A;  5DPR A;  3BYY B;  4RGM A;  1FNW A;  4M0W A;  3AE8 B;  3D32 A;  3AEB B;  1J7A A;  2KVR A;  1CJE A;  2KFK B;  3SR6 A;  2FCM A;  2ZEQ A;  4BKG A;  4G50 A;  1WZ0 A;  2JQR B;  4AP4 C;  2PE9 A;  1MFW A;  3E9S A;  1A70 A;  3A9K A;  1L6V A;  3RNF C;  4W9K A;  3AM9 A;  5AUI A;  5FR6 A;  3U2S C;  1E10 A;  3NVZ A;  1D5Z C;  4M8M A;  2ON8 A;  5I4D A;  2FIF A;  2W54 A;  3AH7 A;  3HVD A;  3APC A;  2I1J A;  1N6Z A;  5DPT A;  1TBE A;  4M8N A;  2NR2 A;  2LFI A;  1WYG A;  2ZNV B;  4W9E A;  1M94 A;  3OJ3 A;  3DOW A;  1WJU A;  2DHZ A;  1MHH E;  3TMP B;  1F1H A;  2LMC A;  2GLS A;  4O1N A;  4ARC A;  1UGM A;  2WX1 A;  4JLC A;  3V62 A;  3B2G A;  3Q8C A;  1L0Y B;  1V1P B;  4K7W A;  4LNI A;  4W9L A;  1WY8 A;  4K1R B;  2BWE S;  2INP E;  2JWZ A;  2MW5 A;  4AJY B;  1FNU A;  1QT9 A;  2LXA A;  1RFK A;  3EHV A;  2LVP A;  1VZ8 A;  2WXO A;  4XC2 A;  3ZDM C;  5BYR A;  3AE5 B;  1K8R B;  4E74 A;  3T9L A;  1P1A A;  3P4P B;  5EE9 A;  2LHE A;  1XF5 L;  1I4P A;  2WXG A;  2DYO A;  1FMA D;  1ROE A;  2ZW1 A;  2MBE A;  2AEH A;  2JVC A;  2OHF A;  2KC2 A;  1LQB A;  1EU4 A;  4OW0 A;  5BYS A;  3L13 A;  3Q3N C;  2V0G A;  2GBK A;  3AEG B;  1F52 A;  5G5G A;  2KDE B;  2CU1 A;  1TS4 A;  1IUE A;  1VCB A;  3GZN I;  4BOZ B;  2FCQ A;  4Q2J A;  2ZCB A;  4GDL A;  2AQ1 B;  2NBV B;  1D5M C;  4D2K A;  4NNJ B;  4PK1 A;  1KFY B;  3M63 B;  2CKH B;  2QHO A;  3B08 A;  2N1V A;  5EE0 A;  1NDD A;  1YQ4 B;  2IPK D;  3GZN B;  4XYC A;  2L8J A;  2V3P A;  1P7F A;  3OJ4 B;  2IGH A;  1EU3 A;  2KZR A;  3KVF B;  4IOI E;  2W3S A;  2IO2 B;  3H7P B;  4FJZ A;  2FE8 A;  3R2I A;  3DPD A;  2KQ7 A;  1CZP A;  3C0R B;  1E8W A;  1T0Q C;  4G11 A;  2PIA A;  3JSV B;  1WX9 A;  1ZW7 A;  4IUM B;  4E3C A;  1WIA A;  1UWM A;  2K1F A;  3EFU A;  2DZK A;  4JQW C;  1V8C A;  2N7D A;  1U4A A;  5HHD G;  1LXD A;  4LJP B;  2C7N B;  4KVG B;  4BBN C;  2A5U A;  4P7I A;  2RD0 A;  4YL8 A;  3NVY A;  5FKA C;  2J7Q B;  1TS5 A;  1TTN A;  2I1K A;  4EOY A;  3JW0 X;  3BY4 B;  1PDX A;  2B76 B;  3WIM A;  3AE1 B;  3TBL D;  1T0S C;  2LAS A;  2KQ4 X;  2BF8 B;  4XWT A;  2BS3 B;  1SIJ A;  1ZXH A;  4C4V A;  3T8M A;  5EE1 A;  1KH0 A;  1WWT A;  5G55 A;  3IVF A;  3OG5 A;  3VTU A;  4P6V F;  4GDK B;  2KMC A;  4NJC A;  3UQB A;  4WJP A;  3B9J A;  3B2F A;  2ZVO A;  2R2O A;  1XLP A;  1JWB D;  3ZVV A;  2DYM A;  2G9H D;  4FXC A;  1WR6 E;  1UEL A;  1ZPS A;  5C2T B;  1C9F A;  2OED A;  1P3Q U;  2BYF A;  2ONQ A;  1F0Z A;  4RMA A;  4HJG E;  4K7U A;  1WJ6 A;  2JRI B;  1BUI C;  1V5T A;  1OTR B;  3C19 A;  2LRU A;  4EE2 A;  1E6E B;  2DAJ A;  4N58 A;  1YQ3 B;  3QQ8 B;  2R2Q A;  3PRP B;  4C80 A;  3PRM B;  2X8X X;  2REX A;  2LRW A;  3Q14 C;  1YJI A;  1S1Q B;  3MTN B;  1AWD A;  3WAO A;  1YN3 A;  3VUY A;  2G4D B;  2WU5 B;  2IO0 B;  4EZL A;  2M4N A;  4DXA B;  1HTO A;  4W9H A;  1T5X D;  3U4E G;  2M0X A;  3VH4 B;  1XLN A;  2BKR B;  3OWE B;  2LGX A;  2LGS A;  4KDI C;  1I4H A;  2LHD A;  3NUH B;  3C8Y A;  4LLG M;  3MC0 B;  4NPN A;  4TSS A;  4GU2 A;  5BMG A;  1YJJ A;  4WUR A;  2KOX A;  1WFY A;  3AXC A;  5EDS A;  2QIE B;  5HG2 A;  4LNO A;  3GOE A;  5H92 C;  2KAN A;  2LEK A;  3Q3M C;  1Q10 A;  4RF0 A;  4WH4 A;  3MJ5 A;  2SEB D;  4KZ0 A;  1ZDX A;  2MJ3 A;  1WE6 A;  2MBH A;  4LDT B;  4XZ4 A;  3WA0 A;  1WXA A;  3P4Q B;  4KIK B;  2KN5 A;  3W2D A;  4B6W A;  4MGI E;  1YN5 A;  4NJ7 A;  3ZNG C;  2PMV A;  1I4R A;  3IAM 1;  3PRZ A;  3RMK C;  5E6N A;  2C7H A;  3DBR B;  3HIZ A;  1JAL A;  2IGD A;  3RCZ A;  2FUG 1;  4I6N B;  4RF1 A;  3H6N A;  3RD2 A;  4YTP B;  2NBU A;  3R7R A;  3W9C B;  1YJ1 A;  3ZGZ A;  1SB3 C;  4RGO S;  3IT4 B;  3HVZ A;  1WGG A;  2CR5 A;  2VH2 A;  1FXT B;  1L6U A;  4FJV B;  3Q3J A;  1C4C A;  2RPV A;  2DYB A;  4ICU A;  2N4F A;  3IFW B;  3IXS A;  3Q8A A;  3QCA A;  4IWP A;  3EA6 A;  3DBL I;  1E90 A;  3ZTC A;  2MBB B;  2KLG A;  4TUU A;  3ZDT A;  5H8Y E;  4US8 A;  5IA7 A;  5D7G A;  3DCG A;  3BVZ A;  3K9P B;  4B9K A;  3PHW B;  2G4S A;  4BKS A;  1PQS A;  1QOF A;  1Q1O A;  4BKT A;  1SSN A;  2N7J A;  3Q8F A;  3A33 B;  3UF8 A;  4EKU A;  5J18 A;  3AU4 A;  2RGF A;  4TQ0 A;  2DWQ A;  1YIW A;  3GS2 A;  1VR9 A;  3ABV B;  4HRS A;  1QZE A;  1Z5S B;  4KGS A;  2KAC A;  3DHH C;  3ZNI D;  3Q8B A;  1P7E A;  1V1P A;  3M95 A;  3APD A;  3ZXV A;  1OQR A;  3NS1 A;  1YN4 A;  3ALB A;  2AYO B;  2QCZ A;  4A3O A;  2NBW B;  3DWM A;  1PYW D;  3WAL A;  2KK8 A;  1HA5 A;  2M1M A;  3IG3 A;  2V1Y A;  3PLU A;  1Q5W B;  1EF5 A;  1XLO A;  2BQQ A;  2PLP A;  1OGW A;  1V80 A;  2DZI A;  1YD8 U;  3TEZ A;  3RZW C;  3M3J A;  1T6B X;  1WGK A;  2WXI A;  4QAY A;  4IM2 A;  2W9N A;  3K9O B;  4M02 A;  4A90 A;  5JH5 C;  4XDD A;  2MEK A;  2E6X A;  1KF6 B;  4GSW A;  1D3Z A;  4PS3 A;  3ETR A;  3X0W A;  5FK9 C;  3WAM A;  1V2Y A;  1N63 A;  1DOX A;  4ZOH C;  2O6V B;  4C56 C;  2EMT A;  4R3D A;  1UBI A;  3NS8 A;  4PYZ A;  4G3X B;  1N5W A;  1Y8R C;  3SHQ A;  1WF9 A;  1FPY A;  3LYY A;  4MM3 A;  3ZRC A;  2D07 B;  1PGA A;  2DX5 B;  3SFE B;  1DYQ A;  2ICI A;  2D3A A;  2BYT A;  2CHX A;  2A4Z A;  2LJ5 A;  3VH3 B;  3ZJU A;  4IDI A;  2ASQ A;  3V3X A;  2MBQ A;  1RYJ A;  1EO6 A;  4DDG D;  5HI1 A;  4ICV A;  2X38 A;  4NAW B;  2M8S A;  2BW2 A;  1I35 A;  5BMI A;  3VHT C;  4C7Z A;  3DBL B;  5BMH A;  1I7H A;  3APF A;  3CSF A;  3IT6 B;  5BYQ A;  1LM8 B;  3RPF C;  2D3G A;  1Y56 A;  1DOI A;  4NY0 A;  2IND C;  1R7S A;  2K25 A;  3NVW A;  2FCN A;  2Y3A A;  5E6P A;  2C5L C;  3TL5 A;  3GE3 C;  2MCN B;  4BVU C;  2LGY A;  1TZO A;  3PGE A;  2N9X A;  5D3I B;  1KTK A;  3ZRF A;  4JPS A;  4JIO U;  4KGT A;  4AJW A;  2WXQ A;  3PO0 A;  3QAQ A;  3PZ8 A;  5CHW A;  2BPS A;  2DLB A;  4KV2 A;  1C77 A;  3A9K B;  4HVB A;  1YNT E;  1FCL A;  5IN7 A;  3AE3 B;  3RT3 B;  5JZE B;  1K50 A;  1WMH B;  3NY5 A;  4FJY A;  1FFV A;  1ACC A;  2XEW A;  2EKE C;  4WQM A;  3VUX A;  1WGH A;  3HRD D;  3ONS A;  1NI2 A;  3KH0 A;  4KDL B;  3H1U A;  4HDQ A;  1J0G A;  1TKY A;  4XDC A;  1WR1 A;  3SU8 X;  2KLC A;  1L5P A;  2KYW A;  1V86 A;  1KLV A;  3S2A A;  2J53 A;  2HJ1 A;  1RWS A;  3NOB A;  4XX5 A;  2HTM E;  4RM8 A;  2RSU A;  3KWV A;  3TSS A;  3A1Q A;  2BVC A;  4JL9 A;  2W3R A;  2KMM A;  3KYC D;  4RGT A;  1I4Q A;  4DHZ B;  3FAH A;  2AX5 A;  1S3S G;  1EF1 A;  5IKC M;  3CST A;  2GBR A;  4M0W B;  3I63 C;  2IGG A;  3P63 A;  1ET9 A;  4L2Y A;  3M62 B;  1JQ4 A;  2KDM A;  2FID A;  4OVU A;  3QK0 A;  4KSL C;  2Z0D B;  2XBB C;  3H8H A;  2PE6 B;  2JF5 A;  1L0V B;  4J6I A;  4HCN B;  2FUH B;  3N9Y C;  1WM3 A;  2ZJD A;  1IBX B;  1YOV B;  2MP2 B;  3IHP C;  1XD3 B;  2K5P A;  2CU3 A;  2RR9 A;  1YMH E;  3NVV A;  3V05 A;  1J19 A;  3QC8 B;  3IBE A;  2VZK B;  2JU6 X;  2L0T A;  1IYF A;  3QX1 A;  1J8C A;  3BVM A;  1EWC A;  1ZP0 B;  3AE4 B;  2XK5 A;  1D5X C;  1JW9 D;  1J7B A;  3B1L X;  1ZE3 D;  5J2R A;  3LDZ E;  1JML A;  3ECI A;  4OZC A;  1GAQ B;  1JRP A;  4MSQ B;  2WDT B;  2W55 A;  2KJH B;  2KWD A;  5EE3 A;  4ANX A;  3NRZ A;  3MC8 A;  1HZ5 A;  2W82 A;  1OQQ A;  2CJN A;  2LUE A;  4HEA 1;  1PFD A;  2WP9 B;  1P98 A;  3ZLZ A;  4YSX B;  3ZYY X;  3ZUN A;  2JY6 A;  1UBQ A;  4HKZ E;  1ZDV A;  4IWQ A;  2EEL A;  1R4M I;  2M56 B;  3L17 A;  1F77 A;  2AL6 A;  2ZVN A;  1NBF C;  2NS5 A;  2WS3 B;  1OQY A;  1L2N A;  3DBR I;  4TMA B;  2KDF B;  2LVO A;  2WDQ B;  4MH0 E;  4YWG G;  3RNA C;  1QKZ A;  4YXD B;  2KT7 A;  3V6E B;  1JWA D;  2K6D B;  2V4I B;  3DVG Y;  4A9A A;  4USA A;  4DBG A;  4REZ A;  2IBI B;  5C1Z A;  1UGJ A;  2K8H A;  1LGR A;  2WLB A;  5IP4 D;  2NPT A;  1RM6 C;  2Z59 B;  2JYT A;  1E8X A;  3L16 A;  4LK0 M;  3UGB B;  4S17 A;  5D2M B;  4RNA A;  2ZPN A;  2NTT A;  4A3P A;  1PGB A;  3VFK A;  3RNC C;  3CIR B;  3VVW B;  2J42 A;  4A6Q A;  3PT2 B;  2N7E A;  5L83 A;  1AYF A;  2G1E A;  1TZ1 A;  5E6J A;  2NPT B;  3AEA B;  3EFC A;  4WWO A;  2MJE A;  4B95 A;  1E9M A;  1I4X A;  1SBB B;  3RNB C;  3PZ7 A;  4MGY E;  4MEM A;  2XNA C;  3ZTD A;  4W9F A;  4CQN A;  4JGH B;  4G0N B;  3KUZ A;  2JZZ A;  2CHW A;  3LJ3 A;  4KZC A;  1NI3 A;  1MG4 A;  4MGK E;  1NEN B;  4YTN B;  1ZKH A;  2FCS A;  1NVI D;  1TJE A;  1K52 A;  4W9G A; 
#chains in the Genus database with same CATH homology
 3BII D;  3MFG A;  3KWL A;  1QOF A;  4B0M A;  2WXL A;  1SSN A;  2N7J A;  1L4Z B;  1K53 A;  3I57 A;  3Q69 A;  1B9R A;  1TS3 A;  4JX1 C;  3E56 A;  1QOA A;  3Q8F A;  2RDG A;  4A55 A;  2ZW0 A;  2NMQ A;  2BS2 B;  1LO5 D;  4JE3 B;  3BK1 A;  4TQ0 A;  1WSP A;  1TS2 A;  2WXM A;  3BWU D;  2DWQ A;  3URY A;  4AS1 A;  1EWY C;  3GS2 A;  1VR9 A;  2WNM A;  3VRA B;  1XLQ A;  3ABV B;  4ARI A;  4HRS A;  4XE0 A;  1HEZ E;  2WXJ A;  2D5G A;  2PW9 A;  1FRD A;  4KGS A;  3BYY B;  2WXN A;  2BB6 A;  2KAC A;  1D4B A;  1BXT A;  3Q8B A;  1F2R C;  1P7E A;  1NYR A;  1V1P A;  3AMZ A;  1STE A;  4RGM A;  1ZUD 2;  1FNW A;  3TEW A;  4M0W A;  2WXP A;  2MJD A;  1QOG A;  3AE8 B;  1OQR A;  2WXR A;  3AEB B;  3CWI A;  3NS1 A;  1J7A A;  1QLB B;  1CJE A;  3SR6 A;  1GB4 A;  1YN4 A;  3AE7 B;  2N0S B;  4B0E A;  3U7Z A;  1AW7 A;  2JQR B;  4WIP A;  3GB1 A;  3AEC B;  3DWM A;  1PYW D;  1SEB D;  1FRR A;  1UNS A;  2H88 B;  3TEX A;  1FNV A;  1A70 A;  3E9S A;  1HA5 A;  1QQR A;  1L6V A;  1VRA B;  3MHZ A;  3AM9 A;  5AUI A;  4YTM B;  1IGD A;  1KLG D;  1XLO A;  2PLP A;  3U2S C;  5MPO A;  1ENF A;  1E10 A;  3TEZ A;  4HRO A;  4RGN A;  1T6B X;  1WXQ A;  1D5Z C;  3FC4 A;  1WGK A;  3AB5 A;  3NVZ A;  2WXI A;  1GPX A;  2ON8 A;  5I4D A;  2M0A A;  2LJI A;  4YSY B;  3IAS 1;  2W54 A;  3AH7 A;  4WWM A;  3ZJV A;  2K0P A;  3HVD A;  4A90 A;  2JYE A;  3LB8 C;  4XDD A;  2MEK A;  2E6X A;  1KF6 B;  1MHX A;  1BML C;  2LFI A;  1WYG A;  3ETR A;  5FK9 C;  2WDV B;  1MHH E;  2LMC A;  4O1N A;  1FIQ A;  4ARC A;  2Y5C A;  1QIL A;  1N63 A;  3T3N A;  1DOX A;  2XN9 C;  2AQ2 B;  4ZOH C;  4C56 C;  2TSS A;  4R3D A;  3B2G A;  1ET6 A;  3Q8C A;  1L0Y B;  1V1P B;  3T3O A;  4P16 A;  1N5W A;  3LYY A;  2JSV X;  2FBW B;  2Y5P A;  2WXK A;  4ZRQ A;  3SEB A;  2INP E;  3R8B A;  1PGA A;  1FNU A;  2BB5 A;  3SFE B;  1DYQ A;  1QT9 A;  1RFK A;  2K3U A;  1VZ8 A;  1D6E C;  2ICI A;  2WXO A;  1VZ6 A;  5BYR A;  2BYT A;  1VZ7 A;  3AE5 B;  1FXA A;  3ZJU A;  4IDI A;  3V3X A;  3P4P B;  5EE9 A;  1RYJ A;  1XF5 L;  2LHE A;  1I4P A;  2WXG A;  3U52 E;  3W5U B;  1C4P A;  2DYO A;  2GI9 A;  1FMA D;  1ROE A;  2ZW1 A;  5HI1 A;  2OHF A;  1SE4 A;  2GRI A;  2X38 A;  4NAW B;  1EU4 A;  4UDU C;  2BW2 A;  4OW0 A;  1C79 A;  4MT5 A;  2JZP A;  2I38 A;  5BYS A;  5BMI A;  2V0G A;  4C7Z A;  5BMH A;  1I7H A;  3VR9 B;  2INN E;  3AEG B;  5G5G A;  4GLS C;  3KQ4 A;  4WAF A;  4IKG A;  1TS4 A;  1IUE A;  2N9L A;  1KRH A;  3IT6 B;  5BYQ A;  4Q2J A;  3NZ3 A;  3RPF C;  4ZRP A;  1Y56 A;  1DOI A;  2AQ1 B;  2WXF A;  1XXG A;  2AQ3 B;  1R7S A;  1XO3 A;  3NVW A;  2Y3A A;  1QF6 A;  2WDR B;  1D5M C;  4D2K A;  2Z8L A;  1EM7 A;  1UWX A;  2N9K A;  5LNK 1;  2JWU A;  2WXH A;  2PVG C;  1KFY B;  4KKJ A;  1PGX A;  2BBC A;  1NEK B;  1N62 A;  5EE0 A;  1TZO A;  1ZOY B;  2EKI A;  5D3I B;  1YQ4 B;  2IPK D;  1KTK A;  3L4P A;  4MAC A;  4JPS A;  3AEE B;  1K51 A;  2V3P A;  1P7F A;  4KGT A;  4KGR A;  2CJO A;  4ITK A;  2WXQ A;  3W1S A;  4MH8 A;  3AV8 A;  2R61 A;  1C4A A;  2IGH A;  3PO0 A;  1EU3 A;  3PZ8 A;  2IDY A;  2DLB A;  1C76 A;  4IOI E;  1C77 A;  4DXG A;  1SE3 A;  1V1O A;  2W3S A;  3FIL B;  1FCL A;  1YNT E;  4C7Y A;  3RFZ B;  2FE8 A;  3P42 A;  4OZA A;  1VLB A;  3R2I A;  3AE3 B;  2DBY A;  1K50 A;  1CZP A;  1FFV A;  2PIA A;  1T3Q A;  2Q5W D;  1FO4 A;  1ACC A;  1KLU D;  1UWM A;  4WQM A;  2JXT A;  3HRD D;  1V8C A;  5HHD G;  4ZHP A;  3FIL A;  1E0Z A;  1TKY A;  4XDC A;  2L1A A;  4OHJ A;  1L5P A;  3EGR A;  1SF0 A;  3TEY A;  1FM0 D;  5TSS A;  1PUT A;  3NVY A;  2J53 A;  1RWS A;  5FKA C;  2HTM E;  3VQI A;  1TS5 A;  3KWV A;  3TSS A;  1B1Z A;  1XEE A;  1PDX A;  3MP9 A;  1M4V A;  4MM3 B;  2B76 B;  1XCT L;  2W3R A;  2KMM A;  4RGT A;  3AE1 B;  1I4Q A;  3FAH A;  2JX5 A;  2AX5 A;  1DOY A;  2K9X A;  2KQ4 X;  1GOZ A;  3BVG A;  1SJE D;  4XWT A;  2BS3 B;  1SIJ A;  1ZXH A;  3GP7 A;  3AN1 A;  5EE1 A;  1OFF A;  2IGG A;  3DWG C;  2QEJ C;  3P63 A;  1SJH D;  2ACZ B;  3KLS X;  1TY2 A;  1ET9 A;  1KH0 A;  4L2Y A;  1JQ4 A;  1WWT A;  1HXY D;  2KDM A;  1JWS D;  2L32 A;  1FCC C;  4YT0 B;  2QJL A;  4P6V F;  4GDK B;  3H8H A;  5GXG B;  1L0V B;  2WU2 B;  4RCO A;  4NJC A;  5D3D A;  2L52 A;  3B9J A;  3B2F A;  3N9Y C;  1MPE A;  4NAM A;  1IBX B;  1XLP A;  3J9C A;  1JWB D;  4RFB A;  5FR3 A;  2DYM A;  2K5P A;  2G9H D;  2CU3 A;  4AQ7 A;  4FXC A;  3W5V B;  2HDE A;  2LUM A;  1ZPS A;  1YMH E;  5C2T B;  1C9F A;  3NVV A;  3V05 A;  4KKI A;  2OED A;  1J7C A;  2ONQ A;  1F0Z A;  1UUP A;  2VZK B;  4HJG E;  2JU6 X;  4L1B A;  3ZJT A;  4DXF A;  1F2R I;  1IBX A;  4JWU C;  3BVM A;  1BUI C;  4PT5 A;  1AN8 A;  1EWC A;  1ZP0 B;  3AE4 B;  4EE2 A;  1E6E B;  1D5X C;  1JW9 D;  1FD6 A;  1J7B A;  2BT6 A;  2QSD A;  4RH6 A;  4N58 A;  1YQ3 B;  1ZE3 D;  2YEP F;  3BK2 A;  4C80 A;  1JCK B;  1JML A;  4NZL B;  4OZC A;  1GAQ B;  1JRP A;  2QIL A;  1QOB A;  1YJI A;  2W55 A;  4ZHO A;  1AWD A;  1YN3 A;  2KWD A;  2WU5 B;  5AUK A;  1DGJ A;  5EE3 A;  3VRB B;  2MH7 A;  3P4S B;  4OZB A;  3UI3 A;  3NRZ A;  1T5X D;  4H2A A;  1ESF A;  4KX6 B;  1HZ5 A;  3U4E G;  2W82 A;  2VZK D;  1OQQ A;  4OVZ A;  1XLN A;  2CJN A;  3OWE B;  4US9 A;  3R2T A;  1CK1 A;  1I4H A;  4L23 A;  3P1M A;  2LHD A;  1SXT A;  1SE2 A;  3NUH B;  3C8Y A;  2RMM A;  4LLG M;  1L0X B;  2PKO A;  4HEA 1;  1PFD A;  3MC0 B;  2WP9 B;  4TSS A;  4N6E B;  5BMG A;  3BYT B;  4LTU A;  3TUO A;  1FXI A;  1YJJ A;  4WUR A;  3AEF B;  4YSX B;  2QIE B;  1V97 A;  5HG2 A;  3ZYY X;  5H92 C;  5C3J B;  2IJ0 A;  2LEK A;  2QMT A;  1Q10 A;  1CQV A;  1WRI A;  4HKZ E;  1ZDV A;  3MJ5 A;  4RF0 A;  2SEB D;  4WH4 A;  2I2Y A;  2EEL A;  2V3N A;  2M56 B;  3WCQ A;  1ZDX A;  1F77 A;  4A8X C;  1JWM D;  4GDL B;  3AE6 B;  2WS3 B;  4HKQ A;  2MJ3 A;  2J4X A;  2RDH A;  4JWS C;  4TMA B;  3EUB 2;  4TQ1 A;  2WDQ B;  1N61 A;  4YWG G;  4J3O D;  3HUI A;  4ZYS A;  1QKZ A;  1C78 A;  3P4Q B;  4YXD B;  2LGI A;  5JXV A;  5HFY A;  1JWA D;  2V4I B;  3W2D A;  2WQY B;  2KN4 A;  1YN5 A;  1N60 A;  2E3T A;  4A9A A;  1FEH A;  4USA A;  2H89 B;  1NYQ A;  2PMV A;  1MI0 A;  1I4R A;  1MVK A;  3IAM 1;  4REZ A;  1UGJ A;  2L83 A;  2BS4 B;  2WLB A;  1TYG B;  3BZD B;  1RM6 C;  1JAL A;  3AE9 B;  1HQR D;  2IGD A;  2YEP B;  2FUG 1;  2JYT A;  1E7P B;  4LK0 M;  3I9V 1;  4RF1 A;  4XWW A;  2GB1 A;  3ZQ4 A;  2NTS A;  4RNA A;  4YTP B;  2NTT A;  3AED B;  1PGB A;  3W9C B;  3ZGZ A;  3CIR B;  1SB3 C;  2J42 A;  4A6Q A;  1TKG A;  4RGO S;  1TKE A;  1I4G A;  2KAJ A;  3IT4 B;  5G5H A;  2J52 A;  1AYF A;  2G1E A;  1FFU A;  3HVZ A;  5E6J A;  4DQO C;  3AEA B;  4N59 A;  1HZ6 A;  1L6U A;  2MJE A;  2PTL A;  3P4R B;  2PVO D;  1JWU D;  1E9M A;  1I4X A;  1SBB B;  1C4C A;  2RPV A;  2BTE A;  3PZ7 A;  2XNA C;  1JRO A;  4CQN A;  2K22 A;  3IXS A;  3Q8A A;  3O13 A;  1GB1 A;  1VJK A;  3EA6 A;  1VDV A;  2SAK A;  4YSZ B;  1NI3 A;  1TY0 A;  3LXF A;  2M19 A;  1N5X A;  3AE2 B;  1NEN B;  4YTN B;  1XCQ L;  1ZXI A;  5H8Y E;  4US8 A;  5T8I A;  1IGC A;  5D7G A;  3VR8 B;  3SFD B;  1L4D B;  1NVI D;  3BVZ A;  1TJE A;  1K52 A;  3Q8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...