1XO3A

Solution structure of ubiquitin like protein from mus musculus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 2900073H19
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xo3A00
3B2FA 1FRRA 2WDQB 3LB8C 1JWBD 5G5HA 2N0SB 2PIAA 1J7BA 1ZP0B 3P4SB 2MH7A 3AE5B 4YXDB 1QOBA 1SIJA 4ITKA 4JX1C 4YSYB 5H8YE 1XLOA 5EE3A 3AEGB 5C2TB 3VR9B 2BS3B 1NI3A 3HVZA 1PUTA 4USAA 3NRZA 1FMAD 2PVGC 2W54A 3AM9A 3HRDD 1JQ4A 3SFDB 2W3RA 1E9MA 4YTPB 1FO4A 2QJLA 2PVOD 1F0ZA 1XO3A 3L4PA 4YT0B 3P4QB 3P1MA 5MPOA 2G1EA 2AX5A 1VJKA 5H92C 3P4RB 1TKYA 2KMMA 1KF6B 2W3SA 1FM0D 3AE8B 4C7ZA 1YJJA 4C80A 1VLBA 1L6VA 2ACZB 1NENB 1NYQA 2M19A 2W55A 1E7PB 1RYJA 4P6VF 1PDXA 1QT9A 4N6EB 3W5VB 3W9CB 3P63A 3VRAB 2PKOA 1IUEA 3AE7B 4KX6B 3SR6A 2WDRB 2WS3B 3AE6B 3CWIA 1FFVA 1JWAD 2WU2B 1TYGB 2QIEB 2EKIA 2DWQA 1WRIA 1N61A 3HUIA 1QF6A 1KFYB 1T3QA 1ROEA 4C7YA 1J7AA 2E3TA 4HROA 4JWSC 3AEDB 3EUB2 1JROA 1FXAA 1RFKA 2MJ3A 3AN1A 3FC4A 3ZYYX 4N58A 4ZHPA 1B9RA 1UWMA 3VR8B 3AEEB 1CZPA 5C3JB 4ZHOA 1WGKA 3NS1A 1VDVA 1NYRA 2WLBA 3KWLA 1TKEA 1NEKB 1CJEA 1YQ3B 2B76B 3AE1B 1DOYA 3NVYA 1JRPA 1YQ4B 5GXGB 1V8CA 5AUIA 2OHFA 4N59A 3RPFC 2CJOA 1R7SA 1SB3C 4US9A 1OQRA 3AMZA 1FFUA 4YTMB 1A70A 1JALA 1N62A 1QOAA 2CJNA 5EE9A 3SFEB 1DOXA 1E0ZA 2WU5B 1WWTA 3AEBB 1RM6C 3AB5A 3AE2B 4YSXB 2Y5CA 2WP9B 2WDVB 1TKGA 3AEAB 3NVWA 1KRHA 1SF0A 1OQQA 2CU3A 2BS2B 4YSZB 2JQRB 1AWDA 3AE4B 3AE3B 3PO0A 2BS4B 1QOFA 1QOGA 1YJIA 3B9JA 2L52A 3FAHA 2LEKA 1ZXIA 1V97A 1FXIA 3ETRA 1I7HA 3LXFA 4LTUA 4YTNB 4JWUC 1L5PA 4WWMA 1XLNA 3WCQA 1WXQA 3ABVB 1L0VB 4FXCA 1E6EB 1J7CA 1N5XA 2WQYB 3AECB 2FBWB 3VRBB 1OFFA 1XLPA 2BT6A 1FRDA 1NVID 2H89B 4ZOHC 4A9AA 1TJEA 3AH7A 1FIQA 1N5WA 1N63A 5G5GA 3AV8A 4WQMA 1WYGA 4HRSA 2K22A 2MJEA 1QLBB 3B2GA 3CIRB 2KAJA 1E10A 2K9XA 1N60A 3BIID 1AYFA 1L6UA 3DWGC 1RWSA 5AUKA 3NVZA 1GPXA 2Q5WD 1ZUD2 3P4PB 3W5UB 4US8A 5EE1A 1DGJA 3AE9B 1ZOYB 2MJDA 3NVVA 3AEFB 5EE0A 1EWYC 2K5PA 3DWMA 2M56B 1DOIA 2L83A 1GAQB 1XLQA 2HTME 1JW9D 1PFDA 2H88B 2DBYA 2JX5A 4IDIA
chains in the Genus database with same CATH superfamily
2MH7A 4RM9A 4ITKA 4AJYB 5TR5A 1XLOA 3M3JA 4I6LB 3VH3B 3NOBA 4MM3A 1FMAD 4P7IA 1I4XA 2VH1A 3TUOA 2O2VA 3BVMA 4E71A 4MH8A 1XO3A 1V1PB 3DBRI 2KACA 2FIDA 3VUYA 1P7FA 1PYWD 1B1ZA 2XNAC 1KJTA 1GB4A 1L7YA 3VRAB 1OEYJ 4NJ7A 3TL5A 1T0RC 3AE6B 3U7DA 3OAWA 4JPSA 4KV2A 1SJHD 4EZKA 1WIAA 1QF6A 1KFYB 1T3QA 2G3QB 2BW2A 4N58A 1BMLC 2MX2A 3VHTC 2ZCCA 3ZTCA 5CHWA 2QEJC 1UUPA 3EFUA 2YLMA 3RN9C 1D5XC 1PGXA 3N1XC 4WAAA 2GLSA 4W9KA 1R7SA 1HZ5A 1QOAA 1HE8A 3ZUNA 1WFYA 2GB1A 3AB5A 1EU4A 2PJHA 2WDVB 2INNE 1OQQA 1SIFA 1AWDA 2V3SA 2ASQA 2L52A 1N6ZA 2K6QA 1WXQA 2N9EB 3SU8X 3URYA 3I63C 2O6VD 1WE6A 3KYDD 3QAQA 3GP7A 4DHJD 4HJKA 2RDGA 2WXKA 2KAJA 4IG7B 4TSSA 1ZE3D 2D10A 3BK1A 3NVZA 4LJPB 3ZGZA 1DGJA 3WA0A 2CS4A 4MACA 5EE0A 4FA6A 1WR1A 2L32A 2A5UA 4ZYSA 2OOBB 2R2QA 5IAAC 4IDIA 1QILA 1WR6E 1JWBD 4KIKB 1J7BA 3H7PA 2ZVOA 3UGBB 3A9JA 2W9NA 2UWQA 1FXTB 1GC6A 3NY5A 4USAA 5LXHA 2KWCA 2K8BA 4GU2A 4BKSA 3V3XA 1V80A 4II3B 2L7RA 4MGZE 1S3SG 1YNTE 5MPOA 1TKYA 2W3SA 1JMLA 2KFKB 3PZDA 3NUHB 1Y56A 4M0WB 4LNKA 1IP9A 2AL3A 1IUEA 4G11A 3IAS1 4MGYE 2WDRB 4J3OD 2JT4B 2ZPNA 3ONSA 3N30A 3U4EG 5GMVA 3ECIA 2NTSA 2I1KA 3ZXVA 2VH2A 5C3JB 1WGKA 1G6JA 3EA6A 4ANWA 4BFRA 1DOYA 2BWFA 1V8CA 4C00A 2KWVB 3N1YC 4ZDVA 2IJ0A 2ZCBA 4OW0A 1OQRA 1QKZA 5BMIA 1FFUA 1A70A 1TBEA 5T8IA 5G55A 4WJQA 1C1YB 2IBIB 1ZXIA 4HCNB 4BBNC 1FXIA 1WMHA 3Q2AC 3VRBB 2LGYA 1FRDA 4MJSA 3VTWA 4A9AA 4CYEA 1KLGD 1ZDXA 2V0GA 5BMHA 2IO0B 2RGFA 1Y8RC 3UQAA 2ZW1A 3BINA 1WGYA 3M62B 4HPPA 4DDGD 4A3PA 3Q8AA 3ZQ4A 1J0GA 4G0NB 1T0QC 3BVZA 2M0XA 3BZDB 3V05A 1D6EC 1SE3A 4B0MA 3C0RB 2J7QB 4G50A 3K9OB 1P98A 2ACZB 2M19A 3N9YC 2X38A 1YIWA 2L00B 2PE6B 4WJOA 4MEMA 4NY0A 3FILA 2RDBC 4OVUA 2KMAA 4NJ6A 1WX9A 3U52E 4QAYA 2HD5B 3FC4A 2MP2B 3GZNI 4W9LA 4GOCA 3EECA 3DOWA 4ZHOA 3EC8A 3MFGA 3NS1A 1TKEA 3AE1B 2D2QA 1KLUD 2Y5PA 2KDFB 1PGBA 1R4NI 1ZDVA 4XX5A 1M94A 2LGSA 3AE2B 4O1NA 4NQKE 3I9V1 5BYRA 4HLEA 1RRBA 1V1OA 1MPEA 4M0WA 1WJ4A 2D5GA 4BKSD 1AW7A 1E6EB 3AECB 4TUUA 4HJGE 1LQBA 1GJZA 5DPTA 3MC8A 3A4SC 3BIID 3VAWA 3Q3FA 5FKAC 4LCDE 2CKHB 1C79A 1VRAB 1IGCA 4YWGG 1K52A 3V6EB 3PHWB 2QSDA 4EUTA 2KX0A 1Q1OA 5JHBA 2IDYA 4LNOA 4LDTB 3LB8C 1K8RB 5D2MB 3DPDA 3HM6X 3NHEB 4YSYB 2BBCA 5H8YE 3E56A 1E7VA 5C2TB 2HE7A 1WI0A 3M63B 2PVGC 3CSTA 1UBIA 3SFDB 2W3RA 1MI0A 2GBKA 3PVLA 2G1EA 2AX5A 3H1UA 4GDLA 2LXAA 1V6EA 5E6JA 2W55A 4KGSA 2OEDA 1FEHA 2EMTA 3L16A 3ZNZB 3MC9A 1P3QU 4WJPA 5HKHA 2D07B 2KN4A 3R3MA 3O13A 4A55A 3S2AA 3KVFB 2DZMA 4K7SA 4K3CA 2KANA 2NS5A 3ZJVA 3PT2B 2PEAA 1C76A 2J0JA 1FPYA 2ZPYA 2JWZA 4WWOA 5KHQA 2I2YA 3AE4B 5AEKB 4FJYA 1HEZE 4NJCA 1QOGA 2XBBC 3RUIB 4ANXA 2DZKA 3BYYB 4FJZA 4LTUA 2GBJA 3PGEA 1JCKB 2N9KA 5E6PA 2MRPA 1UBQA 5D6JB 3IXSA 2MWSB 1CK1A 4KZ0A 4BOSC 3K9PB 4LNFA 4REZA 2RDHA 5EE1A 4M8NA 1XCTL 2KWUB 1UELA 2K1FA 1GAQB 1XLQA 2DX5B 2W54A 2N1WA 2D11A 4IW0A 3UIOB 3I5JC 4Q2JA 3OJ3A 4RM8A 1UWXA 1E9MA 3CF6E 3PV1A 4YTPB 2QJLA 3PPAA 1TY0A 4IKGA 4S17A 2AQ1B 4W9DA 3SD5A 4FADA 1NI2A 2WGSA 3NJTA 4XGAB 3AE8B 1I4RA 3BYTB 4MM3B 5DPRA 2LASA 3W5VB 1QT9A 1GNUA 3AE7B 2KN5A 2PMVA 2ONQA 4FLHA 1ROEA 2LUEA 2CHXA 1FXAA 4GB9A 3UF8A 1CZPA 2BQQA 1E90A 3ZVVA 4HCPB 4W9IA 3ML8A 3QQ8B 2FUG1 2INPE 3HM3A 2ZEQA 1AN8A 4XDCA 1ACCA 2BB6A 4W9EA 4IOIE 5KHOA 2N9LA 1UGJA 3Q8CA 4HK2A 3L54A 1DOXA 1JWUD 2VZKB 2WP9B 4A3OA 4YSZB 1V1PA 2NVUI 1TS2A 2JVCA 2KDIA 2E6XA 2BS4B 5LXIB 3Q3MC 2AQ2B 3LXFA 1L5PA 4FJVB 4J6IA 4NZLB 4M00A 3AULA 1TJEA 3AH7A 3NS8A 5E6NA 3GZNB 3UQBA 3QJZA 4BKGA 1N60A 2PE9A 2J53A 2TSSA 1TTNA 1P1AA 2MEKA 3NVVA 2BF8B 2BTEA 4C4VB 1VZ8A 3A1QB 1JQ4A 2AEHA 3B2FA 1D3ZA 1F52A 3P4SB 2BGFA 1SIJA 2O6VB 3P42A 1K51A 1NI3A 2BKFA 2M0AA 3N3KB 4DXAB 1IBXA 1MG4A 4YT0B 3P1MA 1YMHE 4C7ZA 2BVCA 1FM0D 3ZO5B 3VUXA 3Q14C 5CX3A 3KUCB 4BZAA 3L10B 2KMCA 4OZAA 5BMGA 1JWSD 2WS3B 2BYTA 4P1BC 2EKIA 3HUIA 1SGHA 2JZZA 1F2RI 2KLCA 2L76A 2G45B 3C19A 4HWIB 4JWSC 2D3AA 4BVUC 4ZHPA 1HZ6A 2L0FA 1IPGA 4IWPA 4RF0A 2G9HD 2GOWA 4BBNF 4EOYA 3HHMA 1V86A 1FCCC 5DCNA 2L1AA 4HPMB 4W9JA 2MSED 2OHFA 2C7HA 3OLMD 3BK2A 5IN7A 4ZRJA 1KLVA 2J42A 1XF5L 3DDCB 3AEBB 2WXGA 1TS3A 4W9FA 1T0YA 1Q0WB 4NAWA 3B9JA 3MJWA 5DPWA 1I7HA 2KOXA 4EE2A 1N5WA 4ZRQA 3ZLZA 2KT7A 1TZ1A 5J2RA 3IVFA 4WIPA 1AYFA 3VXWA 2FUHB 2KYWA 4DQOC 4OZCA 1WSPA 2KZRA 3Q3OC 2J0MA 3VTVA 1FRRA 1MHXA 4PS8A 2NBUA 2JF5A 2C7MB 3HVZA 1SSNA 4TKNA 1BUIC 3AM9A 3PTFC 3QK0A 2RD0A 2PVOD 1FNWA 2J52A 5JHAA 2YVCA 5DPSA 3TJPA 1V2YA 2KVZA 2KX3A 3OG5A 5CTRC 1TYGB 2GBMA 2V3PA 1J7AA 2GRIA 2XK5B 4K7UA 3AEEB 1I42A 5IOIA 4D2KA 4XDDA 1CJEA 2CJOA 2JPHA 4P16A 1SF0A 1XCQL 1YX6B 3PO0A 3PSEB 2WXQA 3VTUA 2KC1A 3DHIC 4A90A 3FAHA 2C7NB 2IGDA 2WXPA 3Q69A 4JQWC 4JWUC 4WWMA 4FXCA 1WM3A 1NDDA 4KVGB 1TS5A 3RT3B 1IYFA 1KTKA 3R2IA 3UIPB 4EZJA 5LNK1 1ZPSA 1L6UA 3DWGC 1RWSA 1C3TA 3ZKJC 1T6BX 1GG3A 4CO7A 4JE3B 2M56B 2L83A 3IT6B 2K39A 2JX5A 2KK8A 3T8MA 3LJ3A 2R2OA 3P2BA 5G5GA 3U30A 3A9KB 2K25A 2LGDA 5EE3A 1WMHB 3J9CA 3ZRCA 3PZ8A 1JRUA 5AZHA 3T9LA 1FO4A 5H92C 1KOTA 3APCA 4ICVA 1L2NA 3QC8B 4XE0A 4OZBA 2DNFA 1ZGUB 2KLGA 3H9DA 2KTRA 1V5OA 3L17A 1EO6A 1TZOA 2DHZA 2DENB 3O65B 2HTHA 3NZ3A 1JROA 1HXYD 3PZ7A 1UWMA 1WXAA 4XWTA 3DBLI 2C60A 2VRRB 2ZZPB 2V9HA 1VDVA 1NYRA 4KGTA 2RMMA 1WXVA 2WWZA 3GE8C 3KUZA 1MJDA 4MGIE 2MCNB 2LFIA 2WXMA 2WU5B 2JXXA 2N4FA 3M95A 4C4VA 4YSXB 4GSWA 5JH5C 3FILB 4LJOB 1RLFA 2SEBD 4GIVA 2GBRA 4KDIC 1D4BA 4EFOA 1V81A 3QIJA 5HG2A 3ABVB 1L0VB 1OEYA 3AU5A 1WRDB 2LHDA 3BY4B 3TEXA 1EF5A 1YD8U 4M02A 1EUVB 4F8CB 3VDZA 1KM7A 2MBOA 2MQJA 2KJHB 1VZ7A 3A9KA 1ZOYB 1DYQA 3W1SC 3A9JB 2REXA 2EKEC 2SAKA 4I6NB 2FNJB 2JSVX 3EFCA 1ZP0B 2KQ4X 1V9JA 4YXDB 5FR3A 3WAOA 2BS3B 1PUTA 3TEYA 4PYUA 3LYYA 1I35A 4BOZB 2Y5BB 4ZYNA 2HJ8A 1KF6B 3PRMB 4WH4A 2AL6A 4G3XB 1NENB 2DYMA 1H8CA 1QQRA 3OJ4B 4MGKE 3HVDA 1IBXB 4DDID 1D5ZC 3UI3A 2WU2B 2V3NA 1L4ZB 1FCLA 3ALBA 3UINB 1N61A 2QHOA 2FCQA 2CU1A 2E3TA 3QCAA 4MSMB 4AWJA 3JVZX 4ANVA 4HPLB 4MT5A 3APDA 1I4QA 1V49A 4LNIA 3HIZA 3ZTDA 1X1MA 3I3TB 3DBLB 1Q10A 2M8SA 4N59A 2MBEA 3V60A 1N62A 3SFEB 3GB1A 3KWVA 3B1LX 2CHZA 2CU3A 4AS1A 2JQRB 2FCSA 4EZLA 2WX0A 3KQ4A 1V97A 3RNEC 1N5XA 2FCMA 2MW5A 4M8MA 4ZOHC 4TQ1A 5FK9C 4TV3A 5CHVC 3RD2A 2N7JA 3QX1A 2FIFA 2K22A 4DXFA 3U7ZA 2JUOA 4F1SA 4KIKA 2Z0EB 2LWPA 2Q5WD 4A20A 2JYTA 1ET9A 4JLCA 4L23A 2AQ3B 1JW9D 1KH0A 3DVGX 4LDTD 3PLUA 4BAXA 1S1QB 4NNJB 1J19A 2I1JA 3VUWA 5LLIA 4JX1C 3JW0X 1UH6A 4IC7B 2KDBA 2KNBA 5BYQA 1BT0A 3Q8FA 3DVNU 4PYZA 3DVGY 3PREA 3ZNHB 2V4IB 1YOVB 3P4RB 2I38A 2M1MA 1YJJA 2N1VA 1E7PB 4N6EB 4LLGM 5IKCM 1YN3A 5G2NA 5E6OA 5IO9A 2L3ZA 2RPVA 1IGDA 4OVZA 1WRIA 4RGOS 2XN9C 4DHZB 2DZJA 4XZ4A 3C8YA 1RFKA 4B6WA 1MG8A 5I4DA 4MDKE 4ARCA 2KKCA 4DWFA 2LVPA 3H7SA 4HKZE 3PLVA 1R4MB 2B76B 1YQ4B 5GXGB 1JWMD 2AYOB 5EDSA 1SJED 3RFZB 3V61A 2CR5A 1GC7A 4RGTA 3AEAB 3T3OA 1EF1A 3X23A 3TIXA 1YN5A 4MJSB 3AE3B 2DAFA 2V1YA 1T0SC 4XWWA 1OTRB 4RGMA 2W82A 4P1CC 1EU3A 3L0WB 3RNBC 3DBHI 3Q3JA 3RMKC 4ACFA 3QWZB 4FBJB 1NVID 3ML9A 1N63A 4WQMA 1WYGA 4WURA 1VZ6A 2KXJA 2KDMA 2M4NA 4E74A 3IG3A 3A1QA 3E9SA 3CMMB 4KKIA 3DWMA 2HTME 3L13A 1T5XD 2N0SB 2WXLA 1WJ6A 3RNGC 2QC8A 3AXCA 4GLSC 1UNSA 2KD0A 2L8JA 1E8YA 3SEBA 2D3CA 4OHJA 1WE7A 2DYBA 3KW5B 3MHSD 3Q8BA 1RYJA 1C9FA 4FN2A 3TEWA 1P7EA 4A8XC 2JU6X 2BB5A 2KFKA 1ZW7A 4JIOU 2DLBA 2QIEB 2DWQA 4PS7A 4LK0M 1I4PA 1A5RA 2O6VA 3JSVB 1QZEA 4RNAA 4HROA 2KDEB 1TGZB 4GDKA 2IYDB 3SDLC 2LZ6A 4HEA1 4MELA 4GXBA 3DHHC 1NEKB 1YQ3B 4K3BA 1K50A 3LDZE 4K81A 3I57A 3RPFC 4OVVA 5C23A 3AMZA 4YTMB 2NPTB 5EE9A 3DBHB 2ZJDA 1WWTA 1WY8A 4KSKC 4H2AA 3Q8EA 2M17A 5AZFA 3DHGC 3ZIMA 1C77A 5L83A 3PRZA 4WQOB 2LEKA 3W2DA 4XC2A 3WAMA 2BWES 2WQYB 3HK0A 3GS2A 1FIQA 2L05A 2WYQA 4AJWA 2MJEA 2HDEA 2LGXA 4WWNA 4YL8A 4IM3A 5AUKA 3P4PB 5AZGA 4AOFA 4L1BA 1M4VA 2JRHA 1DOIA 1XXGA 1PFDA 1H4RA 3RNFC 3ZRFA 2WDQB 5G5HA 3AI5A 1Z2MA 4DHJB 2WXJA 1XD3B 3PS6A 1L0XB 2ZNVB 2KTRB 3RNCC 3BVGA 2QDFA 2GI9A 2LRWA 3VH4B 5JZEB 4C80A 1TS4A 3W9CB 4PS3A 4GGQA 1LXDA 2INDC 1GUAB 1EWCA 2LGIA 2IGGA 2IY1B 3DBSA 1XEEA 1JWAD 4R3DA 3D32A 1NBFC 4HVBA 4C7YA 3U8ZA 2WXFA 3NZUA 2JZ3B 2IZVB 3ZYYX 2DAJA 3AN1A 2LXCA 4L2YA 1SE9A 1MVKA 3VR8B 2PW9A 3APFA 3MP9A 1YJ1A 1HTOA 2JY6A 2Y3AA 3R2TA 3KWLA 2MBBB 4GMVA 1JRPA 1C4AA 1C4CA 2WXOA 1HTQA 3B0AA 2NR2A 3U2SC 1ISNA 2CJNA 5HI1A 4US8A 2Y5CA 2LHEA 1KRHA 2BS2B 4JL9A 1LM8B 4FULA 2WXNA 2Z8LA 2IPKD 2BYVE 2GMIC 5IA7A 2OJWA 2QMTA 1Z5SB 4WJNA 1J7CA 4NPNA 2BT6A 3A33B 4KKJA 3N20C 3AV8A 4FHKA 2WXIA 2ZNVC 1WGRA 2KC2A 3IT4B 1ET6A 2LMCA 2MJDA 2H88B 4RH6A 4N9F4 3PRPB 1SE4A 3AEGB 4PK1A 2KVRA 1C4PA 5BO4B 1XQQA 1F9JA 1WZ0A 3Q3NC 2XK5A 1EM7A 2KMMA 3ZDTA 3TEZA 1OGWA 2K6DB 2J0KA 2FE8A 4P6VF 2PLPA 3EGRA 1UF0A 4URKA 1L4DB 1HQRD 2RPQA 1FFVA 2C5LC 1P0RA 1SE2A 2K8CA 3WAPA 4TQ0A 4IWOA 3DQVA 3AEDB 3EUB2 4BKTA 2MJ3A 2PTLA 3WIMA 3NVYA 3RNAC 1WJNA 2MA9B 1WM2A 2NTTA 1VCBA 2BYEA 2NMQA 4ZRPA 1WXMA 2KFJA 2B3AA 2RR9A 1Q5WB 1LGRA 1QOFA 2ZW0A 4TMAB 2XEWA 4W9CA 4A6QA 4M01A 1AARA 1SBBB 1TT5B 2QCZA 1XLPA 2H89B 3MTNB 4B0EA 1I4HA 1ZKHA 4K1RB 3ZJTA 4DHZE 2GBNA 2C9WB 3ZW3A 1ZUD2 3W5UB 2G4SA 3AE9B 3FKYA 1WGHA 1VD2A 2V4LA 3ENEA 4RFBA 4HXDA 4IWQA 3Q6BA 3JYUA 4MH0E 4GDKB 3NRZA 4KDLB 4WAFA 5J18A 2K0PA 3R7RA 2WDTB 2ZVNA 4GDLB 3L4PA 3B08A 2WXHA 1E8ZA 4W9GA 1VJKA 2BYFA 3W1SA 2IO1B 3KUDB 1FD6A 1L6VA 2MBQA 1NYQA 3KYCD 1K53A 1WX8A 2MLBA 4IUMB 2PKOA 2NPTA 4KX6B 2LI5A 2X8XX 3SR6A 4KZCA 2IGHA 1ESFA 2R61A 2DYOA 2NCNA 3GOEA 3TBLD 1U4AA 1XT9B 4K7WA 1E7UA 4B95A 3ZNGC 3A4RA 4NQLB 1STEA 4UDUC 4E3CA 2QILA 2NBWB 3PHXB 5BYSA 1SB3C 4US9A 1E8XA 1CMXB 1WJUA 3L08A 2IO3B 4HKQA 1RM6C 2KHWB 3NVWA 4HDOA 2UYZB 4DBGA 1F77A 1YJIA 5D7GA 3MC0B 3IBEA 1R4MI 2D3BA 1XLNA 2JRIB 3WCQA 1D5MC 1F2RC 2N9PC 3R7QA 2FBWB 2HJ1A 2KQ7A 4HRSA 4NAWB 1UZXB 1TIFA 1J8CA 3B2GA 3CIRB 2EMSA 3KH0A 2KO3A 1GPXA 2LVOA 3EHVA 2J4XA 1BXTA 2K5PA 4WWPA 3H7PB 2LJ5A 2DBYA 2FCNA 4ICUA 1MFWA 1PGAA 4JGHB 1QOBA 4PT5A 2KTFA 1VR9A 4II2B 3JSVA 3ZNID 1I4GA 2LUMA 2LVQA 2RSUA 4CHKA 3NG0A 2L0TA 2OJRA 3V6CB 4DXGA 3ZDMC 2WX1A 1F0ZA 2KJRA 3VVWB 1YN4A 1MHHE 2D3GA 1E5WA 4ZRKA 1LFDA 1PDXA 3VFKA 3P63A 4RCOA 1LO5D 2BPSA 4HDQA 4DK5A 1P9DU 3X0WA 4RGNA 2UU7A 3GE3C 3WALA 2Z59B 5JXVA 1WGGA 4LNNA 3DCGA 4S0RA 1B9RA 1PQSA 2FAZA 3N1ZC 4GN1A 3MHZA 4RMAA 2WLBA 4AUQC 2WXRA 3BWUD 4ANUA 1TY2A 1RAXA 5C1ZA 5AUIA 2MBHA 2LD9A 1WX7A 1YQBA 1JALA 1E0ZA 1V5TA 1FNVA 1UD7A 4KSLC 1CQVA 2YEPF 1TKGA 3SHQA 3R8BA 2MP2A 3MJ5A 4W9HA 4AP4C 2A4ZA 2JWUA 3ETRA 2ICIA 1FNUA 4MSQB 4IM0A 1OFFA 2KJ6A 2JXTA 2YEPB 3KLSX 1OQYA 3IHPC 1E8WA 2IO2B 1E10A 2K9XA 2PPHA 2KWDA 4KGRA 2LRUA 3IAM1 4XYCA 4F7ZA 2WNMA 3IFWB 4B9KA 2IY0B 2G4DB 3NZSA 1EWYC 4ZRIA 1ENFA 5D94A 4IM2A 3ZJUA 3ZXRA 2K8HA 3AEFB 3CSFA 4NAMA 2PIAA 3AE5B 1WF9A 3VR9B 4C56C 5D3IB 3HRDD 1F1HA 1GB1A 3RYTA 3P4QB 4RF1A 2KQSA 4X57B 1VLBA 1R4NB 3H8HA 5FR6A 2N7EA 2JYEA 3TMPB 2ON8A 1UGMA 3DVNV 3CWIA 3R66C 4CQNA 1L0YB 4EEWA 1SEBD 1ZXHA 3AU4A 2INCC 2N7DA 2LJIA 4EKUA 1SXTA 2AWTA 1WGDA 5L95C 3QA8A 4FHJA 1WH3A 3VQIA 3WANA 2DZIA 3RI7C 5J17A 3OWEB 1C78A 1RFAA 5IP4D 2NBVB 3N32A 2CHWA 3RULA 2WHIA 3RZFA 4I6PA 3RZWC 1WZ3A 2Z0DB 2MHJA 4ASWC 5D3DA 3T3NA 3H6NA 3TSSA 3QARA 3V62A 1WXSA 3W1YA 4ARIA 2EELA 4YTNB 2BKRB 2N9XA 2O2VB 3DBRB 5HHDG 5HFYA 2K3UA 1HA5A 2VZKD 1QLBB 1YX5B 3RCZA 1GOZA 1WYWB 2JZPA 5TSSA 3TCAA 4AQ7A 3QHTA 5CHFA
chains in the Genus database with same CATH topology
1ZP0B 2KQ4X 1SE4A 2MH7A 4YXDB 5FR3A 4ITKA 1XLOA 3AEGB 2BS3B 1PUTA 3TEYA 1FMAD 1C4PA 1I4XA 4Q2JA 3TUOA 3BVMA 1UWXA 1E9MA 3LYYA 4YTPB 2QJLA 4MH8A 1TY0A 4IKGA 2AQ1B 1XO3A 1V1PB 1EM7A 2KACA 2KMMA 1KF6B 1P7FA 1PYWD 1B1ZA 1I4RA 2XNAC 3AE8B 3BYTB 4MM3B 4WH4A 3TEZA 1NENB 2FE8A 4P6VF 2PLPA 2DYMA 3W5VB 1GB4A 1QT9A 3EGRA 3VRAB 1QQRA 1L4DB 3AE7B 1HQRD 3HVDA 1IBXB 3AE6B 1D5ZC 1FFVA 2PMVA 3UI3A 2WU2B 1SE2A 4JPSA 2V3NA 2ONQA 1L4ZB 1FCLA 1SJHD 1N61A 4TQ0A 1QF6A 1KFYB 1T3QA 1ROEA 2E3TA 2BW2A 3AEDB 3EUB2 1FXAA 2MJ3A 2PTLA 4N58A 1BMLC 1CZPA 4MT5A 2QEJC 1UUPA 1D5XC 1I4QA 2FUG1 3NVYA 2INPE 1AN8A 4XDCA 1ACCA 1PGXA 2BB6A 1Q10A 4IOIE 4N59A 1R7SA 2NTTA 1HZ5A 2N9LA 1N62A 1QOAA 1UGJA 3Q8CA 3SFEB 1DOXA 3GB1A 1JWUD 2NMQA 3KWVA 4ZRPA 2VZKB 2GB1A 3AB5A 1EU4A 2WP9B 2WDVB 2INNE 1OQQA 1V1PA 2CU3A 4YSZB 4AS1A 2JQRB 1AWDA 1TS2A 2E6XA 2BS4B 1QOFA 5BYSA 2L52A 2ZW0A 3KQ4A 4TMAB 2AQ2B 1V97A 4A6QA 3LXFA 1L5PA 1WXQA 4NZLB 1SBBB 1N5XA 3URYA 1XLPA 4ZOHC 2H89B 4TQ1A 5FK9C 1TJEA 3AH7A 2N7JA 4B0EA 3GP7A 2K22A 2RDGA 2WXKA 1I4HA 4DXFA 2KAJA 3U7ZA 3ZJTA 1N60A 4TSSA 1ZE3D 2J53A 3BK1A 2TSSA 3NVZA 2Q5WD 1ZUD2 3ZGZA 3W5UB 1DGJA 2MEKA 3AE9B 2JYTA 1ET9A 3NVVA 4MACA 2BTEA 5EE0A 2L32A 4L23A 4RFBA 1VZ8A 4ZYSA 2AQ3B 1JW9D 1KH0A 1JQ4A 4IDIA 3B2FA 1QILA 1JWBD 3P4SB 1J7BA 4JX1C 1SIJA 4GDKB 5BYQA 3P42A 1K51A 1NI3A 3Q8FA 4USAA 3NRZA 4WAFA 2K0PA 3V3XA 2M0AA 4GDLB 1IBXA 2V4IB 3L4PA 1YNTE 4YT0B 3P1MA 5MPOA 2WXHA 3W1SA 1VJKA 3P4RB 1TKYA 1YMHE 1JMLA 2I38A 1FM0D 2W3SA 4C7ZA 1YJJA 1FD6A 1L6VA 3NUHB 1Y56A 1NYQA 1E7PB 1K53A 4N6EB 4LLGM 1YN3A 2PKOA 1IUEA 3IAS1 4OZAA 4KX6B 5BMGA 3SR6A 2WDRB 1JWSD 2IGHA 2WS3B 1ESFA 4J3OD 2BYTA 2RPVA 2EKIA 2R61A 1IGDA 4OVZA 1WRIA 3HUIA 2DYOA 4RGOS 3U4EG 1F2RI 2XN9C 4JWSC 3C8YA 1RFKA 4ZHPA 1HZ6A 2NTSA 4RF0A 2G9HD 5I4DA 5C3JB 4ARCA 1STEA 4UDUC 1WGKA 3EA6A 1FCCC 4HKZE 2L1AA 1DOYA 2B76B 2QILA 1YQ4B 5GXGB 1V8CA 1JWMD 2OHFA 2IJ0A 1SJED 1SB3C 4OW0A 1OQRA 1QKZA 3BK2A 4US9A 1FFUA 5BMIA 1A70A 3RFZB 2J42A 1XF5L 5T8IA 3AEBB 4HKQA 1RM6C 2WXGA 4RGTA 1TS3A 3AEAB 3NVWA 3T3OA 1YN5A 3AE3B 4XWWA 1F77A 1YJIA 3B9JA 5D7GA 3MC0B 1ZXIA 4RGMA 1FXIA 2W82A 1I7HA 1EU3A 1XLNA 3WCQA 1F2RC 1D5MC 3VRBB 2FBWB 4EE2A 1FRDA 1NVID 4A9AA 1N5WA 1N63A 4WQMA 1WYGA 4ZRQA 1KLGD 4HRSA 4NAWB 4WURA 1VZ6A 3B2GA 3CIRB 1ZDXA 4WIPA 2KDMA 2V0GA 5BMHA 1AYFA 4DQOC 1GPXA 2ZW1A 2J4XA 3E9SA 1BXTA 2K5PA 4KKIA 4OZCA 3DWMA 1WSPA 2HTME 1T5XD 2DBYA 1FRRA 3Q8AA 3ZQ4A 2N0SB 1MHXA 1PGAA 2WXLA 1QOBA 4PT5A 1VR9A 3HVZA 1I4GA 3BVZA 1SSNA 2LUMA 4GLSC 1BUIC 1UNSA 3AM9A 3BZDB 4DXGA 3V05A 2PVOD 1F0ZA 1FNWA 2J52A 1D6EC 1SE3A 3SEBA 4B0MA 4OHJA 1YN4A 1MHHE 3Q8BA 2ACZB 2M19A 1RYJA 3N9YC 1PDXA 2X38A 1C9FA 3P63A 4RCOA 3TEWA 1P7EA 4A8XC 1LO5D 2JU6X 2BB5A 2DLBA 4RGNA 1TYGB 2QIEB 2DWQA 4LK0M 3FILA 1I4PA 5JXVA 2V3PA 1J7AA 4RNAA 4HROA 3U52E 3FC4A 1B9RA 2GRIA 3AEEB 4ZHOA 3MFGA 3MHZA 3NS1A 4HEA1 2WLBA 4D2KA 1TKEA 2WXRA 3BWUD 1NEKB 1CJEA 1TY2A 1YQ3B 3AE1B 4XDDA 1K50A 1KLUD 2Y5PA 3I57A 5AUIA 1PGBA 3RPFC 2CJOA 3AMZA 1ZDVA 4YTMB 1JALA 5EE9A 1E0ZA 1FNVA 1WWTA 3AE2B 1CQVA 4H2AA 2YEPF 3Q8EA 4O1NA 1TKGA 4P16A 1SF0A 1XCQL 3I9V1 5BYRA 3R8BA 1C77A 3PO0A 2WXQA 1V1OA 3MJ5A 4A90A 1MPEA 4M0WA 3FAHA 2LEKA 3W2DA 2JWUA 2IGDA 3ETRA 2WXPA 2D5GA 2ICIA 3Q69A 1FNUA 4JWUC 4WWMA 1AW7A 4FXCA 1E6EB 3AECB 2WQYB 4HJGE 1OFFA 3GS2A 2JXTA 2YEPB 3KLSX 1FIQA 1TS5A 1KTKA 3R2IA 2MJEA 2HDEA 5LNK1 1E10A 2K9XA 1ZPSA 3BIID 4KGRA 1L6UA 2KWDA 5FKAC 3DWGC 1RWSA 3IAM1 1C79A 5AUKA 2WNMA 1VRAB 3P4PB 1IGCA 4YWGG 1K52A 1T6BX 4L1BA 1M4VA 1EWYC 4JE3B 2QSDA 1ENFA 2M56B 1DOIA 2L83A 3IT6B 1XXGA 1PFDA 3ZJUA 3AEFB 2JX5A 2IDYA 4NAMA 2WDQB 3LB8C 5G5HA 5G5GA 2PIAA 3AE5B 4YSYB 2BBCA 5H8YE 3E56A 5EE3A 3J9CA 5C2TB 3VR9B 3PZ8A 4C56C 2PVGC 2WXJA 5D3IB 3HRDD 3SFDB 1L0XB 2W3RA 1MI0A 1FO4A 1GB1A 3BVGA 3P4QB 2GI9A 2G1EA 2AX5A 4RF1A 5H92C 4C80A 1VLBA 3H8HA 5E6JA 2W55A 4XE0A 1TS4A 4OZBA 3W9CB 4KGSA 2OEDA 2JYEA 1FEHA 2ON8A 1EWCA 2LGIA 2IGGA 3CWIA 1XEEA 1JWAD 4CQNA 1L0YB 4R3DA 1SEBD 1ZXHA 1TZOA 4C7YA 2WXFA 2LJIA 2KN4A 1SXTA 3NZ3A 1JROA 3ZYYX 3AN1A 3O13A 1HXYD 4L2YA 3PZ7A 1UWMA 1MVKA 4XWTA 3VR8B 2PW9A 3MP9A 4A55A 2Y3AA 1VDVA 1NYRA 3R2TA 3VQIA 4KGTA 3KWLA 2RMMA 3OWEB 1C78A 1JRPA 1C4AA 1C4CA 2WXOA 3ZJVA 3U2SC 1C76A 2LFIA 2WXMA 2CJNA 2WU5B 5HI1A 4YSXB 4US8A 2Y5CA 2LHEA 1KRHA 3FILB 5D3DA 2BS2B 3T3NA 2I2YA 3AE4B 2SEBD 3TSSA 1HEZE 4NJCA 1QOGA 1D4BA 2WXNA 4ARIA 2Z8LA 2EELA 2IPKD 3BYYB 4LTUA 4YTNB 5HG2A 2QMTA 1JCKB 3ABVB 1L0VB 1J7CA 2LHDA 3TEXA 2BT6A 2N9KA 4KKJA 5HHDG 5HFYA 3AV8A 2K3UA 1HA5A 2WXIA 2VZKD 1QLBB 3IXSA 1CK1A 3IT4B 1ET6A 1GOZA 2JZPA 2LMCA 1VZ7A 4REZA 2RDHA 5EE1A 1XCTL 5TSSA 1ZOYB 2MJDA 4AQ7A 1DYQA 1GAQB 1XLQA 2SAKA 2H88B 2JSVX 2W54A 4RH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2F A;  1FRR A;  2WDQ B;  3LB8 C;  1JWB D;  5G5H A;  2N0S B;  2PIA A;  1J7B A;  1ZP0 B;  3P4S B;  2MH7 A;  3AE5 B;  4YXD B;  1QOB A;  1SIJ A;  4ITK A;  4JX1 C;  4YSY B;  5H8Y E;  1XLO A;  5EE3 A;  3AEG B;  5C2T B;  3VR9 B;  2BS3 B;  1NI3 A;  3HVZ A;  1PUT A;  4USA A;  3NRZ A;  1FMA D;  2PVG C;  2W54 A;  3AM9 A;  3HRD D;  1JQ4 A;  3SFD B;  2W3R A;  1E9M A;  4YTP B;  1FO4 A;  2QJL A;  2PVO D;  1F0Z A;  1XO3 A;  3L4P A;  4YT0 B;  3P4Q B;  3P1M A;  5MPO A;  2G1E A;  2AX5 A;  1VJK A;  5H92 C;  3P4R B;  1TKY A;  2KMM A;  1KF6 B;  2W3S A;  1FM0 D;  3AE8 B;  4C7Z A;  1YJJ A;  4C80 A;  1VLB A;  1L6V A;  2ACZ B;  1NEN B;  1NYQ A;  2M19 A;  2W55 A;  1E7P B;  1RYJ A;  4P6V F;  1PDX A;  1QT9 A;  4N6E B;  3W5V B;  3W9C B;  3P63 A;  3VRA B;  2PKO A;  1IUE A;  3AE7 B;  4KX6 B;  3SR6 A;  2WDR B;  2WS3 B;  3AE6 B;  3CWI A;  1FFV A;  1JWA D;  2WU2 B;  1TYG B;  2QIE B;  2EKI A;  2DWQ A;  1WRI A;  1N61 A;  3HUI A;  1QF6 A;  1KFY B;  1T3Q A;  1ROE A;  4C7Y A;  1J7A A;  2E3T A;  4HRO A;  4JWS C;  3AED B;  3EUB 2;  1JRO A;  1FXA A;  1RFK A;  2MJ3 A;  3AN1 A;  3FC4 A;  3ZYY X;  4N58 A;  4ZHP A;  1B9R A;  1UWM A;  3VR8 B;  3AEE B;  1CZP A;  5C3J B;  4ZHO A;  1WGK A;  3NS1 A;  1VDV A;  1NYR A;  2WLB A;  3KWL A;  1TKE A;  1NEK B;  1CJE A;  1YQ3 B;  2B76 B;  3AE1 B;  1DOY A;  3NVY A;  1JRP A;  1YQ4 B;  5GXG B;  1V8C A;  5AUI A;  2OHF A;  4N59 A;  3RPF C;  2CJO A;  1R7S A;  1SB3 C;  4US9 A;  1OQR A;  3AMZ A;  1FFU A;  4YTM B;  1A70 A;  1JAL A;  1N62 A;  1QOA A;  2CJN A;  5EE9 A;  3SFE B;  1DOX A;  1E0Z A;  2WU5 B;  1WWT A;  3AEB B;  1RM6 C;  3AB5 A;  3AE2 B;  4YSX B;  2Y5C A;  2WP9 B;  2WDV B;  1TKG A;  3AEA B;  3NVW A;  1KRH A;  1SF0 A;  1OQQ A;  2CU3 A;  2BS2 B;  4YSZ B;  2JQR B;  1AWD A;  3AE4 B;  3AE3 B;  3PO0 A;  2BS4 B;  1QOF A;  1QOG A;  1YJI A;  3B9J A;  2L52 A;  3FAH A;  2LEK A;  1ZXI A;  1V97 A;  1FXI A;  3ETR A;  1I7H A;  3LXF A;  4LTU A;  4YTN B;  4JWU C;  1L5P A;  4WWM A;  1XLN A;  3WCQ A;  1WXQ A;  3ABV B;  1L0V B;  4FXC A;  1E6E B;  1J7C A;  1N5X A;  2WQY B;  3AEC B;  2FBW B;  3VRB B;  1OFF A;  1XLP A;  2BT6 A;  1FRD A;  1NVI D;  2H89 B;  4ZOH C;  4A9A A;  1TJE A;  3AH7 A;  1FIQ A;  1N5W A;  1N63 A;  5G5G A;  3AV8 A;  4WQM A;  1WYG A;  4HRS A;  2K22 A;  2MJE A;  1QLB B;  3B2G A;  3CIR B;  2KAJ A;  1E10 A;  2K9X A;  1N60 A;  3BII D;  1AYF A;  1L6U A;  3DWG C;  1RWS A;  5AUK A;  3NVZ A;  1GPX A;  2Q5W D;  1ZUD 2;  3P4P B;  3W5U B;  4US8 A;  5EE1 A;  1DGJ A;  3AE9 B;  1ZOY B;  2MJD A;  3NVV A;  3AEF B;  5EE0 A;  1EWY C;  2K5P A;  3DWM A;  2M56 B;  1DOI A;  2L83 A;  1GAQ B;  1XLQ A;  2HTM E;  1JW9 D;  1PFD A;  2H88 B;  2DBY A;  2JX5 A;  4IDI A; 
#chains in the Genus database with same CATH topology
 2MH7 A;  4RM9 A;  4ITK A;  4AJY B;  5TR5 A;  1XLO A;  3M3J A;  4I6L B;  3VH3 B;  3NOB A;  4MM3 A;  1FMA D;  4P7I A;  1I4X A;  2VH1 A;  3TUO A;  2O2V A;  3BVM A;  4E71 A;  4MH8 A;  1XO3 A;  1V1P B;  3DBR I;  2KAC A;  2FID A;  3VUY A;  1P7F A;  1PYW D;  1B1Z A;  2XNA C;  1KJT A;  1GB4 A;  1L7Y A;  3VRA B;  1OEY J;  4NJ7 A;  3TL5 A;  1T0R C;  3AE6 B;  3U7D A;  3OAW A;  4JPS A;  4KV2 A;  1SJH D;  4EZK A;  1WIA A;  1QF6 A;  1KFY B;  1T3Q A;  2G3Q B;  2BW2 A;  4N58 A;  1BML C;  2MX2 A;  3VHT C;  2ZCC A;  3ZTC A;  5CHW A;  2QEJ C;  1UUP A;  3EFU A;  2YLM A;  3RN9 C;  1D5X C;  1PGX A;  3N1X C;  4WAA A;  2GLS A;  4W9K A;  1R7S A;  1HZ5 A;  1QOA A;  1HE8 A;  3ZUN A;  1WFY A;  2GB1 A;  3AB5 A;  1EU4 A;  2PJH A;  2WDV B;  2INN E;  1OQQ A;  1SIF A;  1AWD A;  2V3S A;  2ASQ A;  2L52 A;  1N6Z A;  2K6Q A;  1WXQ A;  2N9E B;  3SU8 X;  3URY A;  3I63 C;  2O6V D;  1WE6 A;  3KYD D;  3QAQ A;  3GP7 A;  4DHJ D;  4HJK A;  2RDG A;  2WXK A;  2KAJ A;  4IG7 B;  4TSS A;  1ZE3 D;  2D10 A;  3BK1 A;  3NVZ A;  4LJP B;  3ZGZ A;  1DGJ A;  3WA0 A;  2CS4 A;  4MAC A;  5EE0 A;  4FA6 A;  1WR1 A;  2L32 A;  2A5U A;  4ZYS A;  2OOB B;  2R2Q A;  5IAA C;  4IDI A;  1QIL A;  1WR6 E;  1JWB D;  4KIK B;  1J7B A;  3H7P A;  2ZVO A;  3UGB B;  3A9J A;  2W9N A;  2UWQ A;  1FXT B;  1GC6 A;  3NY5 A;  4USA A;  5LXH A;  2KWC A;  2K8B A;  4GU2 A;  4BKS A;  3V3X A;  1V80 A;  4II3 B;  2L7R A;  4MGZ E;  1S3S G;  1YNT E;  5MPO A;  1TKY A;  2W3S A;  1JML A;  2KFK B;  3PZD A;  3NUH B;  1Y56 A;  4M0W B;  4LNK A;  1IP9 A;  2AL3 A;  1IUE A;  4G11 A;  3IAS 1;  4MGY E;  2WDR B;  4J3O D;  2JT4 B;  2ZPN A;  3ONS A;  3N30 A;  3U4E G;  5GMV A;  3ECI A;  2NTS A;  2I1K A;  3ZXV A;  2VH2 A;  5C3J B;  1WGK A;  1G6J A;  3EA6 A;  4ANW A;  4BFR A;  1DOY A;  2BWF A;  1V8C A;  4C00 A;  2KWV B;  3N1Y C;  4ZDV A;  2IJ0 A;  2ZCB A;  4OW0 A;  1OQR A;  1QKZ A;  5BMI A;  1FFU A;  1A70 A;  1TBE A;  5T8I A;  5G55 A;  4WJQ A;  1C1Y B;  2IBI B;  1ZXI A;  4HCN B;  4BBN C;  1FXI A;  1WMH A;  3Q2A C;  3VRB B;  2LGY A;  1FRD A;  4MJS A;  3VTW A;  4A9A A;  4CYE A;  1KLG D;  1ZDX A;  2V0G A;  5BMH A;  2IO0 B;  2RGF A;  1Y8R C;  3UQA A;  2ZW1 A;  3BIN A;  1WGY A;  3M62 B;  4HPP A;  4DDG D;  4A3P A;  3Q8A A;  3ZQ4 A;  1J0G A;  4G0N B;  1T0Q C;  3BVZ A;  2M0X A;  3BZD B;  3V05 A;  1D6E C;  1SE3 A;  4B0M A;  3C0R B;  2J7Q B;  4G50 A;  3K9O B;  1P98 A;  2ACZ B;  2M19 A;  3N9Y C;  2X38 A;  1YIW A;  2L00 B;  2PE6 B;  4WJO A;  4MEM A;  4NY0 A;  3FIL A;  2RDB C;  4OVU A;  2KMA A;  4NJ6 A;  1WX9 A;  3U52 E;  4QAY A;  2HD5 B;  3FC4 A;  2MP2 B;  3GZN I;  4W9L A;  4GOC A;  3EEC A;  3DOW A;  4ZHO A;  3EC8 A;  3MFG A;  3NS1 A;  1TKE A;  3AE1 B;  2D2Q A;  1KLU D;  2Y5P A;  2KDF B;  1PGB A;  1R4N I;  1ZDV A;  4XX5 A;  1M94 A;  2LGS A;  3AE2 B;  4O1N A;  4NQK E;  3I9V 1;  5BYR A;  4HLE A;  1RRB A;  1V1O A;  1MPE A;  4M0W A;  1WJ4 A;  2D5G A;  4BKS D;  1AW7 A;  1E6E B;  3AEC B;  4TUU A;  4HJG E;  1LQB A;  1GJZ A;  5DPT A;  3MC8 A;  3A4S C;  3BII D;  3VAW A;  3Q3F A;  5FKA C;  4LCD E;  2CKH B;  1C79 A;  1VRA B;  1IGC A;  4YWG G;  1K52 A;  3V6E B;  3PHW B;  2QSD A;  4EUT A;  2KX0 A;  1Q1O A;  5JHB A;  2IDY A;  4LNO A;  4LDT B;  3LB8 C;  1K8R B;  5D2M B;  3DPD A;  3HM6 X;  3NHE B;  4YSY B;  2BBC A;  5H8Y E;  3E56 A;  1E7V A;  5C2T B;  2HE7 A;  1WI0 A;  3M63 B;  2PVG C;  3CST A;  1UBI A;  3SFD B;  2W3R A;  1MI0 A;  2GBK A;  3PVL A;  2G1E A;  2AX5 A;  3H1U A;  4GDL A;  2LXA A;  1V6E A;  5E6J A;  2W55 A;  4KGS A;  2OED A;  1FEH A;  2EMT A;  3L16 A;  3ZNZ B;  3MC9 A;  1P3Q U;  4WJP A;  5HKH A;  2D07 B;  2KN4 A;  3R3M A;  3O13 A;  4A55 A;  3S2A A;  3KVF B;  2DZM A;  4K7S A;  4K3C A;  2KAN A;  2NS5 A;  3ZJV A;  3PT2 B;  2PEA A;  1C76 A;  2J0J A;  1FPY A;  2ZPY A;  2JWZ A;  4WWO A;  5KHQ A;  2I2Y A;  3AE4 B;  5AEK B;  4FJY A;  1HEZ E;  4NJC A;  1QOG A;  2XBB C;  3RUI B;  4ANX A;  2DZK A;  3BYY B;  4FJZ A;  4LTU A;  2GBJ A;  3PGE A;  1JCK B;  2N9K A;  5E6P A;  2MRP A;  1UBQ A;  5D6J B;  3IXS A;  2MWS B;  1CK1 A;  4KZ0 A;  4BOS C;  3K9P B;  4LNF A;  4REZ A;  2RDH A;  5EE1 A;  4M8N A;  1XCT L;  2KWU B;  1UEL A;  2K1F A;  1GAQ B;  1XLQ A;  2DX5 B;  2W54 A;  2N1W A;  2D11 A;  4IW0 A;  3UIO B;  3I5J C;  4Q2J A;  3OJ3 A;  4RM8 A;  1UWX A;  1E9M A;  3CF6 E;  3PV1 A;  4YTP B;  2QJL A;  3PPA A;  1TY0 A;  4IKG A;  4S17 A;  2AQ1 B;  4W9D A;  3SD5 A;  4FAD A;  1NI2 A;  2WGS A;  3NJT A;  4XGA B;  3AE8 B;  1I4R A;  3BYT B;  4MM3 B;  5DPR A;  2LAS A;  3W5V B;  1QT9 A;  1GNU A;  3AE7 B;  2KN5 A;  2PMV A;  2ONQ A;  4FLH A;  1ROE A;  2LUE A;  2CHX A;  1FXA A;  4GB9 A;  3UF8 A;  1CZP A;  2BQQ A;  1E90 A;  3ZVV A;  4HCP B;  4W9I A;  3ML8 A;  3QQ8 B;  2FUG 1;  2INP E;  3HM3 A;  2ZEQ A;  1AN8 A;  4XDC A;  1ACC A;  2BB6 A;  4W9E A;  4IOI E;  5KHO A;  2N9L A;  1UGJ A;  3Q8C A;  4HK2 A;  3L54 A;  1DOX A;  1JWU D;  2VZK B;  2WP9 B;  4A3O A;  4YSZ B;  1V1P A;  2NVU I;  1TS2 A;  2JVC A;  2KDI A;  2E6X A;  2BS4 B;  5LXI B;  3Q3M C;  2AQ2 B;  3LXF A;  1L5P A;  4FJV B;  4J6I A;  4NZL B;  4M00 A;  3AUL A;  1TJE A;  3AH7 A;  3NS8 A;  5E6N A;  3GZN B;  3UQB A;  3QJZ A;  4BKG A;  1N60 A;  2PE9 A;  2J53 A;  2TSS A;  1TTN A;  1P1A A;  2MEK A;  3NVV A;  2BF8 B;  2BTE A;  4C4V B;  1VZ8 A;  3A1Q B;  1JQ4 A;  2AEH A;  3B2F A;  1D3Z A;  1F52 A;  3P4S B;  2BGF A;  1SIJ A;  2O6V B;  3P42 A;  1K51 A;  1NI3 A;  2BKF A;  2M0A A;  3N3K B;  4DXA B;  1IBX A;  1MG4 A;  4YT0 B;  3P1M A;  1YMH E;  4C7Z A;  2BVC A;  1FM0 D;  3ZO5 B;  3VUX A;  3Q14 C;  5CX3 A;  3KUC B;  4BZA A;  3L10 B;  2KMC A;  4OZA A;  5BMG A;  1JWS D;  2WS3 B;  2BYT A;  4P1B C;  2EKI A;  3HUI A;  1SGH A;  2JZZ A;  1F2R I;  2KLC A;  2L76 A;  2G45 B;  3C19 A;  4HWI B;  4JWS C;  2D3A A;  4BVU C;  4ZHP A;  1HZ6 A;  2L0F A;  1IPG A;  4IWP A;  4RF0 A;  2G9H D;  2GOW A;  4BBN F;  4EOY A;  3HHM A;  1V86 A;  1FCC C;  5DCN A;  2L1A A;  4HPM B;  4W9J A;  2MSE D;  2OHF A;  2C7H A;  3OLM D;  3BK2 A;  5IN7 A;  4ZRJ A;  1KLV A;  2J42 A;  1XF5 L;  3DDC B;  3AEB B;  2WXG A;  1TS3 A;  4W9F A;  1T0Y A;  1Q0W B;  4NAW A;  3B9J A;  3MJW A;  5DPW A;  1I7H A;  2KOX A;  4EE2 A;  1N5W A;  4ZRQ A;  3ZLZ A;  2KT7 A;  1TZ1 A;  5J2R A;  3IVF A;  4WIP A;  1AYF A;  3VXW A;  2FUH B;  2KYW A;  4DQO C;  4OZC A;  1WSP A;  2KZR A;  3Q3O C;  2J0M A;  3VTV A;  1FRR A;  1MHX A;  4PS8 A;  2NBU A;  2JF5 A;  2C7M B;  3HVZ A;  1SSN A;  4TKN A;  1BUI C;  3AM9 A;  3PTF C;  3QK0 A;  2RD0 A;  2PVO D;  1FNW A;  2J52 A;  5JHA A;  2YVC A;  5DPS A;  3TJP A;  1V2Y A;  2KVZ A;  2KX3 A;  3OG5 A;  5CTR C;  1TYG B;  2GBM A;  2V3P A;  1J7A A;  2GRI A;  2XK5 B;  4K7U A;  3AEE B;  1I42 A;  5IOI A;  4D2K A;  4XDD A;  1CJE A;  2CJO A;  2JPH A;  4P16 A;  1SF0 A;  1XCQ L;  1YX6 B;  3PO0 A;  3PSE B;  2WXQ A;  3VTU A;  2KC1 A;  3DHI C;  4A90 A;  3FAH A;  2C7N B;  2IGD A;  2WXP A;  3Q69 A;  4JQW C;  4JWU C;  4WWM A;  4FXC A;  1WM3 A;  1NDD A;  4KVG B;  1TS5 A;  3RT3 B;  1IYF A;  1KTK A;  3R2I A;  3UIP B;  4EZJ A;  5LNK 1;  1ZPS A;  1L6U A;  3DWG C;  1RWS A;  1C3T A;  3ZKJ C;  1T6B X;  1GG3 A;  4CO7 A;  4JE3 B;  2M56 B;  2L83 A;  3IT6 B;  2K39 A;  2JX5 A;  2KK8 A;  3T8M A;  3LJ3 A;  2R2O A;  3P2B A;  5G5G A;  3U30 A;  3A9K B;  2K25 A;  2LGD A;  5EE3 A;  1WMH B;  3J9C A;  3ZRC A;  3PZ8 A;  1JRU A;  5AZH A;  3T9L A;  1FO4 A;  5H92 C;  1KOT A;  3APC A;  4ICV A;  1L2N A;  3QC8 B;  4XE0 A;  4OZB A;  2DNF A;  1ZGU B;  2KLG A;  3H9D A;  2KTR A;  1V5O A;  3L17 A;  1EO6 A;  1TZO A;  2DHZ A;  2DEN B;  3O65 B;  2HTH A;  3NZ3 A;  1JRO A;  1HXY D;  3PZ7 A;  1UWM A;  1WXA A;  4XWT A;  3DBL I;  2C60 A;  2VRR B;  2ZZP B;  2V9H A;  1VDV A;  1NYR A;  4KGT A;  2RMM A;  1WXV A;  2WWZ A;  3GE8 C;  3KUZ A;  1MJD A;  4MGI E;  2MCN B;  2LFI A;  2WXM A;  2WU5 B;  2JXX A;  2N4F A;  3M95 A;  4C4V A;  4YSX B;  4GSW A;  5JH5 C;  3FIL B;  4LJO B;  1RLF A;  2SEB D;  4GIV A;  2GBR A;  4KDI C;  1D4B A;  4EFO A;  1V81 A;  3QIJ A;  5HG2 A;  3ABV B;  1L0V B;  1OEY A;  3AU5 A;  1WRD B;  2LHD A;  3BY4 B;  3TEX A;  1EF5 A;  1YD8 U;  4M02 A;  1EUV B;  4F8C B;  3VDZ A;  1KM7 A;  2MBO A;  2MQJ A;  2KJH B;  1VZ7 A;  3A9K A;  1ZOY B;  1DYQ A;  3W1S C;  3A9J B;  2REX A;  2EKE C;  2SAK A;  4I6N B;  2FNJ B;  2JSV X;  3EFC A;  1ZP0 B;  2KQ4 X;  1V9J A;  4YXD B;  5FR3 A;  3WAO A;  2BS3 B;  1PUT A;  3TEY A;  4PYU A;  3LYY A;  1I35 A;  4BOZ B;  2Y5B B;  4ZYN A;  2HJ8 A;  1KF6 B;  3PRM B;  4WH4 A;  2AL6 A;  4G3X B;  1NEN B;  2DYM A;  1H8C A;  1QQR A;  3OJ4 B;  4MGK E;  3HVD A;  1IBX B;  4DDI D;  1D5Z C;  3UI3 A;  2WU2 B;  2V3N A;  1L4Z B;  1FCL A;  3ALB A;  3UIN B;  1N61 A;  2QHO A;  2FCQ A;  2CU1 A;  2E3T A;  3QCA A;  4MSM B;  4AWJ A;  3JVZ X;  4ANV A;  4HPL B;  4MT5 A;  3APD A;  1I4Q A;  1V49 A;  4LNI A;  3HIZ A;  3ZTD A;  1X1M A;  3I3T B;  3DBL B;  1Q10 A;  2M8S A;  4N59 A;  2MBE A;  3V60 A;  1N62 A;  3SFE B;  3GB1 A;  3KWV A;  3B1L X;  2CHZ A;  2CU3 A;  4AS1 A;  2JQR B;  2FCS A;  4EZL A;  2WX0 A;  3KQ4 A;  1V97 A;  3RNE C;  1N5X A;  2FCM A;  2MW5 A;  4M8M A;  4ZOH C;  4TQ1 A;  5FK9 C;  4TV3 A;  5CHV C;  3RD2 A;  2N7J A;  3QX1 A;  2FIF A;  2K22 A;  4DXF A;  3U7Z A;  2JUO A;  4F1S A;  4KIK A;  2Z0E B;  2LWP A;  2Q5W D;  4A20 A;  2JYT A;  1ET9 A;  4JLC A;  4L23 A;  2AQ3 B;  1JW9 D;  1KH0 A;  3DVG X;  4LDT D;  3PLU A;  4BAX A;  1S1Q B;  4NNJ B;  1J19 A;  2I1J A;  3VUW A;  5LLI A;  4JX1 C;  3JW0 X;  1UH6 A;  4IC7 B;  2KDB A;  2KNB A;  5BYQ A;  1BT0 A;  3Q8F A;  3DVN U;  4PYZ A;  3DVG Y;  3PRE A;  3ZNH B;  2V4I B;  1YOV B;  3P4R B;  2I38 A;  2M1M A;  1YJJ A;  2N1V A;  1E7P B;  4N6E B;  4LLG M;  5IKC M;  1YN3 A;  5G2N A;  5E6O A;  5IO9 A;  2L3Z A;  2RPV A;  1IGD A;  4OVZ A;  1WRI A;  4RGO S;  2XN9 C;  4DHZ B;  2DZJ A;  4XZ4 A;  3C8Y A;  1RFK A;  4B6W A;  1MG8 A;  5I4D A;  4MDK E;  4ARC A;  2KKC A;  4DWF A;  2LVP A;  3H7S A;  4HKZ E;  3PLV A;  1R4M B;  2B76 B;  1YQ4 B;  5GXG B;  1JWM D;  2AYO B;  5EDS A;  1SJE D;  3RFZ B;  3V61 A;  2CR5 A;  1GC7 A;  4RGT A;  3AEA B;  3T3O A;  1EF1 A;  3X23 A;  3TIX A;  1YN5 A;  4MJS B;  3AE3 B;  2DAF A;  2V1Y A;  1T0S C;  4XWW A;  1OTR B;  4RGM A;  2W82 A;  4P1C C;  1EU3 A;  3L0W B;  3RNB C;  3DBH I;  3Q3J A;  3RMK C;  4ACF A;  3QWZ B;  4FBJ B;  1NVI D;  3ML9 A;  1N63 A;  4WQM A;  1WYG A;  4WUR A;  1VZ6 A;  2KXJ A;  2KDM A;  2M4N A;  4E74 A;  3IG3 A;  3A1Q A;  3E9S A;  3CMM B;  4KKI A;  3DWM A;  2HTM E;  3L13 A;  1T5X D;  2N0S B;  2WXL A;  1WJ6 A;  3RNG C;  2QC8 A;  3AXC A;  4GLS C;  1UNS A;  2KD0 A;  2L8J A;  1E8Y A;  3SEB A;  2D3C A;  4OHJ A;  1WE7 A;  2DYB A;  3KW5 B;  3MHS D;  3Q8B A;  1RYJ A;  1C9F A;  4FN2 A;  3TEW A;  1P7E A;  4A8X C;  2JU6 X;  2BB5 A;  2KFK A;  1ZW7 A;  4JIO U;  2DLB A;  2QIE B;  2DWQ A;  4PS7 A;  4LK0 M;  1I4P A;  1A5R A;  2O6V A;  3JSV B;  1QZE A;  4RNA A;  4HRO A;  2KDE B;  1TGZ B;  4GDK A;  2IYD B;  3SDL C;  2LZ6 A;  4HEA 1;  4MEL A;  4GXB A;  3DHH C;  1NEK B;  1YQ3 B;  4K3B A;  1K50 A;  3LDZ E;  4K81 A;  3I57 A;  3RPF C;  4OVV A;  5C23 A;  3AMZ A;  4YTM B;  2NPT B;  5EE9 A;  3DBH B;  2ZJD A;  1WWT A;  1WY8 A;  4KSK C;  4H2A A;  3Q8E A;  2M17 A;  5AZF A;  3DHG C;  3ZIM A;  1C77 A;  5L83 A;  3PRZ A;  4WQO B;  2LEK A;  3W2D A;  4XC2 A;  3WAM A;  2BWE S;  2WQY B;  3HK0 A;  3GS2 A;  1FIQ A;  2L05 A;  2WYQ A;  4AJW A;  2MJE A;  2HDE A;  2LGX A;  4WWN A;  4YL8 A;  4IM3 A;  5AUK A;  3P4P B;  5AZG A;  4AOF A;  4L1B A;  1M4V A;  2JRH A;  1DOI A;  1XXG A;  1PFD A;  1H4R A;  3RNF C;  3ZRF A;  2WDQ B;  5G5H A;  3AI5 A;  1Z2M A;  4DHJ B;  2WXJ A;  1XD3 B;  3PS6 A;  1L0X B;  2ZNV B;  2KTR B;  3RNC C;  3BVG A;  2QDF A;  2GI9 A;  2LRW A;  3VH4 B;  5JZE B;  4C80 A;  1TS4 A;  3W9C B;  4PS3 A;  4GGQ A;  1LXD A;  2IND C;  1GUA B;  1EWC A;  2LGI A;  2IGG A;  2IY1 B;  3DBS A;  1XEE A;  1JWA D;  4R3D A;  3D32 A;  1NBF C;  4HVB A;  4C7Y A;  3U8Z A;  2WXF A;  3NZU A;  2JZ3 B;  2IZV B;  3ZYY X;  2DAJ A;  3AN1 A;  2LXC A;  4L2Y A;  1SE9 A;  1MVK A;  3VR8 B;  2PW9 A;  3APF A;  3MP9 A;  1YJ1 A;  1HTO A;  2JY6 A;  2Y3A A;  3R2T A;  3KWL A;  2MBB B;  4GMV A;  1JRP A;  1C4A A;  1C4C A;  2WXO A;  1HTQ A;  3B0A A;  2NR2 A;  3U2S C;  1ISN A;  2CJN A;  5HI1 A;  4US8 A;  2Y5C A;  2LHE A;  1KRH A;  2BS2 B;  4JL9 A;  1LM8 B;  4FUL A;  2WXN A;  2Z8L A;  2IPK D;  2BYV E;  2GMI C;  5IA7 A;  2OJW A;  2QMT A;  1Z5S B;  4WJN A;  1J7C A;  4NPN A;  2BT6 A;  3A33 B;  4KKJ A;  3N20 C;  3AV8 A;  4FHK A;  2WXI A;  2ZNV C;  1WGR A;  2KC2 A;  3IT4 B;  1ET6 A;  2LMC A;  2MJD A;  2H88 B;  4RH6 A;  4N9F 4;  3PRP B;  1SE4 A;  3AEG B;  4PK1 A;  2KVR A;  1C4P A;  5BO4 B;  1XQQ A;  1F9J A;  1WZ0 A;  3Q3N C;  2XK5 A;  1EM7 A;  2KMM A;  3ZDT A;  3TEZ A;  1OGW A;  2K6D B;  2J0K A;  2FE8 A;  4P6V F;  2PLP A;  3EGR A;  1UF0 A;  4URK A;  1L4D B;  1HQR D;  2RPQ A;  1FFV A;  2C5L C;  1P0R A;  1SE2 A;  2K8C A;  3WAP A;  4TQ0 A;  4IWO A;  3DQV A;  3AED B;  3EUB 2;  4BKT A;  2MJ3 A;  2PTL A;  3WIM A;  3NVY A;  3RNA C;  1WJN A;  2MA9 B;  1WM2 A;  2NTT A;  1VCB A;  2BYE A;  2NMQ A;  4ZRP A;  1WXM A;  2KFJ A;  2B3A A;  2RR9 A;  1Q5W B;  1LGR A;  1QOF A;  2ZW0 A;  4TMA B;  2XEW A;  4W9C A;  4A6Q A;  4M01 A;  1AAR A;  1SBB B;  1TT5 B;  2QCZ A;  1XLP A;  2H89 B;  3MTN B;  4B0E A;  1I4H A;  1ZKH A;  4K1R B;  3ZJT A;  4DHZ E;  2GBN A;  2C9W B;  3ZW3 A;  1ZUD 2;  3W5U B;  2G4S A;  3AE9 B;  3FKY A;  1WGH A;  1VD2 A;  2V4L A;  3ENE A;  4RFB A;  4HXD A;  4IWQ A;  3Q6B A;  3JYU A;  4MH0 E;  4GDK B;  3NRZ A;  4KDL B;  4WAF A;  5J18 A;  2K0P A;  3R7R A;  2WDT B;  2ZVN A;  4GDL B;  3L4P A;  3B08 A;  2WXH A;  1E8Z A;  4W9G A;  1VJK A;  2BYF A;  3W1S A;  2IO1 B;  3KUD B;  1FD6 A;  1L6V A;  2MBQ A;  1NYQ A;  3KYC D;  1K53 A;  1WX8 A;  2MLB A;  4IUM B;  2PKO A;  2NPT A;  4KX6 B;  2LI5 A;  2X8X X;  3SR6 A;  4KZC A;  2IGH A;  1ESF A;  2R61 A;  2DYO A;  2NCN A;  3GOE A;  3TBL D;  1U4A A;  1XT9 B;  4K7W A;  1E7U A;  4B95 A;  3ZNG C;  3A4R A;  4NQL B;  1STE A;  4UDU C;  4E3C A;  2QIL A;  2NBW B;  3PHX B;  5BYS A;  1SB3 C;  4US9 A;  1E8X A;  1CMX B;  1WJU A;  3L08 A;  2IO3 B;  4HKQ A;  1RM6 C;  2KHW B;  3NVW A;  4HDO A;  2UYZ B;  4DBG A;  1F77 A;  1YJI A;  5D7G A;  3MC0 B;  3IBE A;  1R4M I;  2D3B A;  1XLN A;  2JRI B;  3WCQ A;  1D5M C;  1F2R C;  2N9P C;  3R7Q A;  2FBW B;  2HJ1 A;  2KQ7 A;  4HRS A;  4NAW B;  1UZX B;  1TIF A;  1J8C A;  3B2G A;  3CIR B;  2EMS A;  3KH0 A;  2KO3 A;  1GPX A;  2LVO A;  3EHV A;  2J4X A;  1BXT A;  2K5P A;  4WWP A;  3H7P B;  2LJ5 A;  2DBY A;  2FCN A;  4ICU A;  1MFW A;  1PGA A;  4JGH B;  1QOB A;  4PT5 A;  2KTF A;  1VR9 A;  4II2 B;  3JSV A;  3ZNI D;  1I4G A;  2LUM A;  2LVQ A;  2RSU A;  4CHK A;  3NG0 A;  2L0T A;  2OJR A;  3V6C B;  4DXG A;  3ZDM C;  2WX1 A;  1F0Z A;  2KJR A;  3VVW B;  1YN4 A;  1MHH E;  2D3G A;  1E5W A;  4ZRK A;  1LFD A;  1PDX A;  3VFK A;  3P63 A;  4RCO A;  1LO5 D;  2BPS A;  4HDQ A;  4DK5 A;  1P9D U;  3X0W A;  4RGN A;  2UU7 A;  3GE3 C;  3WAL A;  2Z59 B;  5JXV A;  1WGG A;  4LNN A;  3DCG A;  4S0R A;  1B9R A;  1PQS A;  2FAZ A;  3N1Z C;  4GN1 A;  3MHZ A;  4RMA A;  2WLB A;  4AUQ C;  2WXR A;  3BWU D;  4ANU A;  1TY2 A;  1RAX A;  5C1Z A;  5AUI A;  2MBH A;  2LD9 A;  1WX7 A;  1YQB A;  1JAL A;  1E0Z A;  1V5T A;  1FNV A;  1UD7 A;  4KSL C;  1CQV A;  2YEP F;  1TKG A;  3SHQ A;  3R8B A;  2MP2 A;  3MJ5 A;  4W9H A;  4AP4 C;  2A4Z A;  2JWU A;  3ETR A;  2ICI A;  1FNU A;  4MSQ B;  4IM0 A;  1OFF A;  2KJ6 A;  2JXT A;  2YEP B;  3KLS X;  1OQY A;  3IHP C;  1E8W A;  2IO2 B;  1E10 A;  2K9X A;  2PPH A;  2KWD A;  4KGR A;  2LRU A;  3IAM 1;  4XYC A;  4F7Z A;  2WNM A;  3IFW B;  4B9K A;  2IY0 B;  2G4D B;  3NZS A;  1EWY C;  4ZRI A;  1ENF A;  5D94 A;  4IM2 A;  3ZJU A;  3ZXR A;  2K8H A;  3AEF B;  3CSF A;  4NAM A;  2PIA A;  3AE5 B;  1WF9 A;  3VR9 B;  4C56 C;  5D3I B;  3HRD D;  1F1H A;  1GB1 A;  3RYT A;  3P4Q B;  4RF1 A;  2KQS A;  4X57 B;  1VLB A;  1R4N B;  3H8H A;  5FR6 A;  2N7E A;  2JYE A;  3TMP B;  2ON8 A;  1UGM A;  3DVN V;  3CWI A;  3R66 C;  4CQN A;  1L0Y B;  4EEW A;  1SEB D;  1ZXH A;  3AU4 A;  2INC C;  2N7D A;  2LJI A;  4EKU A;  1SXT A;  2AWT A;  1WGD A;  5L95 C;  3QA8 A;  4FHJ A;  1WH3 A;  3VQI A;  3WAN A;  2DZI A;  3RI7 C;  5J17 A;  3OWE B;  1C78 A;  1RFA A;  5IP4 D;  2NBV B;  3N32 A;  2CHW A;  3RUL A;  2WHI A;  3RZF A;  4I6P A;  3RZW C;  1WZ3 A;  2Z0D B;  2MHJ A;  4ASW C;  5D3D A;  3T3N A;  3H6N A;  3TSS A;  3QAR A;  3V62 A;  1WXS A;  3W1Y A;  4ARI A;  2EEL A;  4YTN B;  2BKR B;  2N9X A;  2O2V B;  3DBR B;  5HHD G;  5HFY A;  2K3U A;  1HA5 A;  2VZK D;  1QLB B;  1YX5 B;  3RCZ A;  1GOZ A;  1WYW B;  2JZP A;  5TSS A;  3TCA A;  4AQ7 A;  3QHT A;  5CHF A; 
#chains in the Genus database with same CATH homology
 1ZP0 B;  2KQ4 X;  1SE4 A;  2MH7 A;  4YXD B;  5FR3 A;  4ITK A;  1XLO A;  3AEG B;  2BS3 B;  1PUT A;  3TEY A;  1FMA D;  1C4P A;  1I4X A;  4Q2J A;  3TUO A;  3BVM A;  1UWX A;  1E9M A;  3LYY A;  4YTP B;  2QJL A;  4MH8 A;  1TY0 A;  4IKG A;  2AQ1 B;  1XO3 A;  1V1P B;  1EM7 A;  2KAC A;  2KMM A;  1KF6 B;  1P7F A;  1PYW D;  1B1Z A;  1I4R A;  2XNA C;  3AE8 B;  3BYT B;  4MM3 B;  4WH4 A;  3TEZ A;  1NEN B;  2FE8 A;  4P6V F;  2PLP A;  2DYM A;  3W5V B;  1GB4 A;  1QT9 A;  3EGR A;  3VRA B;  1QQR A;  1L4D B;  3AE7 B;  1HQR D;  3HVD A;  1IBX B;  3AE6 B;  1D5Z C;  1FFV A;  2PMV A;  3UI3 A;  2WU2 B;  1SE2 A;  4JPS A;  2V3N A;  2ONQ A;  1L4Z B;  1FCL A;  1SJH D;  1N61 A;  4TQ0 A;  1QF6 A;  1KFY B;  1T3Q A;  1ROE A;  2E3T A;  2BW2 A;  3AED B;  3EUB 2;  1FXA A;  2MJ3 A;  2PTL A;  4N58 A;  1BML C;  1CZP A;  4MT5 A;  2QEJ C;  1UUP A;  1D5X C;  1I4Q A;  2FUG 1;  3NVY A;  2INP E;  1AN8 A;  4XDC A;  1ACC A;  1PGX A;  2BB6 A;  1Q10 A;  4IOI E;  4N59 A;  1R7S A;  2NTT A;  1HZ5 A;  2N9L A;  1N62 A;  1QOA A;  1UGJ A;  3Q8C A;  3SFE B;  1DOX A;  3GB1 A;  1JWU D;  2NMQ A;  3KWV A;  4ZRP A;  2VZK B;  2GB1 A;  3AB5 A;  1EU4 A;  2WP9 B;  2WDV B;  2INN E;  1OQQ A;  1V1P A;  2CU3 A;  4YSZ B;  4AS1 A;  2JQR B;  1AWD A;  1TS2 A;  2E6X A;  2BS4 B;  1QOF A;  5BYS A;  2L52 A;  2ZW0 A;  3KQ4 A;  4TMA B;  2AQ2 B;  1V97 A;  4A6Q A;  3LXF A;  1L5P A;  1WXQ A;  4NZL B;  1SBB B;  1N5X A;  3URY A;  1XLP A;  4ZOH C;  2H89 B;  4TQ1 A;  5FK9 C;  1TJE A;  3AH7 A;  2N7J A;  4B0E A;  3GP7 A;  2K22 A;  2RDG A;  2WXK A;  1I4H A;  4DXF A;  2KAJ A;  3U7Z A;  3ZJT A;  1N60 A;  4TSS A;  1ZE3 D;  2J53 A;  3BK1 A;  2TSS A;  3NVZ A;  2Q5W D;  1ZUD 2;  3ZGZ A;  3W5U B;  1DGJ A;  2MEK A;  3AE9 B;  2JYT A;  1ET9 A;  3NVV A;  4MAC A;  2BTE A;  5EE0 A;  2L32 A;  4L23 A;  4RFB A;  1VZ8 A;  4ZYS A;  2AQ3 B;  1JW9 D;  1KH0 A;  1JQ4 A;  4IDI A;  3B2F A;  1QIL A;  1JWB D;  3P4S B;  1J7B A;  4JX1 C;  1SIJ A;  4GDK B;  5BYQ A;  3P42 A;  1K51 A;  1NI3 A;  3Q8F A;  4USA A;  3NRZ A;  4WAF A;  2K0P A;  3V3X A;  2M0A A;  4GDL B;  1IBX A;  2V4I B;  3L4P A;  1YNT E;  4YT0 B;  3P1M A;  5MPO A;  2WXH A;  3W1S A;  1VJK A;  3P4R B;  1TKY A;  1YMH E;  1JML A;  2I38 A;  1FM0 D;  2W3S A;  4C7Z A;  1YJJ A;  1FD6 A;  1L6V A;  3NUH B;  1Y56 A;  1NYQ A;  1E7P B;  1K53 A;  4N6E B;  4LLG M;  1YN3 A;  2PKO A;  1IUE A;  3IAS 1;  4OZA A;  4KX6 B;  5BMG A;  3SR6 A;  2WDR B;  1JWS D;  2IGH A;  2WS3 B;  1ESF A;  4J3O D;  2BYT A;  2RPV A;  2EKI A;  2R61 A;  1IGD A;  4OVZ A;  1WRI A;  3HUI A;  2DYO A;  4RGO S;  3U4E G;  1F2R I;  2XN9 C;  4JWS C;  3C8Y A;  1RFK A;  4ZHP A;  1HZ6 A;  2NTS A;  4RF0 A;  2G9H D;  5I4D A;  5C3J B;  4ARC A;  1STE A;  4UDU C;  1WGK A;  3EA6 A;  1FCC C;  4HKZ E;  2L1A A;  1DOY A;  2B76 B;  2QIL A;  1YQ4 B;  5GXG B;  1V8C A;  1JWM D;  2OHF A;  2IJ0 A;  1SJE D;  1SB3 C;  4OW0 A;  1OQR A;  1QKZ A;  3BK2 A;  4US9 A;  1FFU A;  5BMI A;  1A70 A;  3RFZ B;  2J42 A;  1XF5 L;  5T8I A;  3AEB B;  4HKQ A;  1RM6 C;  2WXG A;  4RGT A;  1TS3 A;  3AEA B;  3NVW A;  3T3O A;  1YN5 A;  3AE3 B;  4XWW A;  1F77 A;  1YJI A;  3B9J A;  5D7G A;  3MC0 B;  1ZXI A;  4RGM A;  1FXI A;  2W82 A;  1I7H A;  1EU3 A;  1XLN A;  3WCQ A;  1F2R C;  1D5M C;  3VRB B;  2FBW B;  4EE2 A;  1FRD A;  1NVI D;  4A9A A;  1N5W A;  1N63 A;  4WQM A;  1WYG A;  4ZRQ A;  1KLG D;  4HRS A;  4NAW B;  4WUR A;  1VZ6 A;  3B2G A;  3CIR B;  1ZDX A;  4WIP A;  2KDM A;  2V0G A;  5BMH A;  1AYF A;  4DQO C;  1GPX A;  2ZW1 A;  2J4X A;  3E9S A;  1BXT A;  2K5P A;  4KKI A;  4OZC A;  3DWM A;  1WSP A;  2HTM E;  1T5X D;  2DBY A;  1FRR A;  3Q8A A;  3ZQ4 A;  2N0S B;  1MHX A;  1PGA A;  2WXL A;  1QOB A;  4PT5 A;  1VR9 A;  3HVZ A;  1I4G A;  3BVZ A;  1SSN A;  2LUM A;  4GLS C;  1BUI C;  1UNS A;  3AM9 A;  3BZD B;  4DXG A;  3V05 A;  2PVO D;  1F0Z A;  1FNW A;  2J52 A;  1D6E C;  1SE3 A;  3SEB A;  4B0M A;  4OHJ A;  1YN4 A;  1MHH E;  3Q8B A;  2ACZ B;  2M19 A;  1RYJ A;  3N9Y C;  1PDX A;  2X38 A;  1C9F A;  3P63 A;  4RCO A;  3TEW A;  1P7E A;  4A8X C;  1LO5 D;  2JU6 X;  2BB5 A;  2DLB A;  4RGN A;  1TYG B;  2QIE B;  2DWQ A;  4LK0 M;  3FIL A;  1I4P A;  5JXV A;  2V3P A;  1J7A A;  4RNA A;  4HRO A;  3U52 E;  3FC4 A;  1B9R A;  2GRI A;  3AEE B;  4ZHO A;  3MFG A;  3MHZ A;  3NS1 A;  4HEA 1;  2WLB A;  4D2K A;  1TKE A;  2WXR A;  3BWU D;  1NEK B;  1CJE A;  1TY2 A;  1YQ3 B;  3AE1 B;  4XDD A;  1K50 A;  1KLU D;  2Y5P A;  3I57 A;  5AUI A;  1PGB A;  3RPF C;  2CJO A;  3AMZ A;  1ZDV A;  4YTM B;  1JAL A;  5EE9 A;  1E0Z A;  1FNV A;  1WWT A;  3AE2 B;  1CQV A;  4H2A A;  2YEP F;  3Q8E A;  4O1N A;  1TKG A;  4P16 A;  1SF0 A;  1XCQ L;  3I9V 1;  5BYR A;  3R8B A;  1C77 A;  3PO0 A;  2WXQ A;  1V1O A;  3MJ5 A;  4A90 A;  1MPE A;  4M0W A;  3FAH A;  2LEK A;  3W2D A;  2JWU A;  2IGD A;  3ETR A;  2WXP A;  2D5G A;  2ICI A;  3Q69 A;  1FNU A;  4JWU C;  4WWM A;  1AW7 A;  4FXC A;  1E6E B;  3AEC B;  2WQY B;  4HJG E;  1OFF A;  3GS2 A;  2JXT A;  2YEP B;  3KLS X;  1FIQ A;  1TS5 A;  1KTK A;  3R2I A;  2MJE A;  2HDE A;  5LNK 1;  1E10 A;  2K9X A;  1ZPS A;  3BII D;  4KGR A;  1L6U A;  2KWD A;  5FKA C;  3DWG C;  1RWS A;  3IAM 1;  1C79 A;  5AUK A;  2WNM A;  1VRA B;  3P4P B;  1IGC A;  4YWG G;  1K52 A;  1T6B X;  4L1B A;  1M4V A;  1EWY C;  4JE3 B;  2QSD A;  1ENF A;  2M56 B;  1DOI A;  2L83 A;  3IT6 B;  1XXG A;  1PFD A;  3ZJU A;  3AEF B;  2JX5 A;  2IDY A;  4NAM A;  2WDQ B;  3LB8 C;  5G5H A;  5G5G A;  2PIA A;  3AE5 B;  4YSY B;  2BBC A;  5H8Y E;  3E56 A;  5EE3 A;  3J9C A;  5C2T B;  3VR9 B;  3PZ8 A;  4C56 C;  2PVG C;  2WXJ A;  5D3I B;  3HRD D;  3SFD B;  1L0X B;  2W3R A;  1MI0 A;  1FO4 A;  1GB1 A;  3BVG A;  3P4Q B;  2GI9 A;  2G1E A;  2AX5 A;  4RF1 A;  5H92 C;  4C80 A;  1VLB A;  3H8H A;  5E6J A;  2W55 A;  4XE0 A;  1TS4 A;  4OZB A;  3W9C B;  4KGS A;  2OED A;  2JYE A;  1FEH A;  2ON8 A;  1EWC A;  2LGI A;  2IGG A;  3CWI A;  1XEE A;  1JWA D;  4CQN A;  1L0Y B;  4R3D A;  1SEB D;  1ZXH A;  1TZO A;  4C7Y A;  2WXF A;  2LJI A;  2KN4 A;  1SXT A;  3NZ3 A;  1JRO A;  3ZYY X;  3AN1 A;  3O13 A;  1HXY D;  4L2Y A;  3PZ7 A;  1UWM A;  1MVK A;  4XWT A;  3VR8 B;  2PW9 A;  3MP9 A;  4A55 A;  2Y3A A;  1VDV A;  1NYR A;  3R2T A;  3VQI A;  4KGT A;  3KWL A;  2RMM A;  3OWE B;  1C78 A;  1JRP A;  1C4A A;  1C4C A;  2WXO A;  3ZJV A;  3U2S C;  1C76 A;  2LFI A;  2WXM A;  2CJN A;  2WU5 B;  5HI1 A;  4YSX B;  4US8 A;  2Y5C A;  2LHE A;  1KRH A;  3FIL B;  5D3D A;  2BS2 B;  3T3N A;  2I2Y A;  3AE4 B;  2SEB D;  3TSS A;  1HEZ E;  4NJC A;  1QOG A;  1D4B A;  2WXN A;  4ARI A;  2Z8L A;  2EEL A;  2IPK D;  3BYY B;  4LTU A;  4YTN B;  5HG2 A;  2QMT A;  1JCK B;  3ABV B;  1L0V B;  1J7C A;  2LHD A;  3TEX A;  2BT6 A;  2N9K A;  4KKJ A;  5HHD G;  5HFY A;  3AV8 A;  2K3U A;  1HA5 A;  2WXI A;  2VZK D;  1QLB B;  3IXS A;  1CK1 A;  3IT4 B;  1ET6 A;  1GOZ A;  2JZP A;  2LMC A;  1VZ7 A;  4REZ A;  2RDH A;  5EE1 A;  1XCT L;  5TSS A;  1ZOY B;  2MJD A;  4AQ7 A;  1DYQ A;  1GAQ B;  1XLQ A;  2SAK A;  2H88 B;  2JSV X;  2W54 A;  4RH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...