1XOUA

Crystal structure of the cesa-espa complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
72
Chain Sequence
DVIDLFNKLGVFQAAILMFAYMYQAQSDLNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspA
publication title Structural characterization of a type III secretion system filament protein in complex with its chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
total genus 23
structure length 72
sequence length 160
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03433 EspA EspA-like secreted protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1140 Mainly Alpha Orthogonal Bundle Helix Hairpins EspA/CesA-like 1xouA00
1XOUA
chains in the Genus database with same CATH superfamily
2UUCB 2NLJC 1GH6A 4ZI7B 4JI0B 1HR0B 3TXSA 4BAYA 3JARB 3ZHRA 2VWJA 3CJHB 3B4SA 2EIKB 4JI2O 2Q68A 2A7WA 3AG4B 4JV5B 2DWEC 3UM7A 4Q20A 2KSDA 3ZHTA 4PDMA 1VEWA 1RM1B 5DEDA 3WU2Z 4CS3A 2K9PA 1IBMB 4U3FH 1S3JA 2AHZA 3OGCC 2DE0X 5IT9N 5IDJA 4MVMA 4F6RA 1EN5A 2Q8VA 2D2CB 4PDLA 1THZA 4DUZB 2QR4A 3CCSV 4DV1O 3SYCA 3CP1A 5J2UB 4O2BA 4MW3A 1Y4MA 2OIEA 3ETQA 1US6A 1NH2D 3SPHA 3ZRWB 3RYCB 2OIGA 1IBKB 1I08A 3AEIA 4PDVA 4DV0B 3A0HZ 4I50B 1YTFB 3ZX6A 1V9PA 1Z5WA 1GN2A 2B1IA 3BABA 4DV2O 4DUYO 2XAJA 1XMQB 3ZEDA 1R6NA 3H01A 3OM3B 2ZQMA 1FYJA 2JDIG 3FAVB 3K5OA 1W0KG 1B6QA 3ZRSA 4MVZA 2QA4V 5CB4A 5LOVA 3O9OA 4LH6A 2PYJA 1NJIW 2ZIOA 2OCCB 2YDEA 4JI4O 5IYDO 4XBFA 2PYLA 1VQOV 1S5LZ 3CS5A 5IE9A 1I5XA 4ZIBA 1J5EO 3H1IH 2PZSA 1MSWD 4CS2A 2BTOA 3C90A 2F93B 1RSOB 4TV9A 5LP6A 1AB3A 1S5JA 4YJ3A 2QWQB 2GSMB 3JAKB 4RQFA 5IJ9A 4QPJA 4WFAV 1PPJH 2CTRA 5F2VO 4FLUA 1KU9A 5FPRA 2IU3A 4ZKIA 2QWRB 1EZJA 1JX9A 3ABKB 2QM7A 4TQFA 4JYAB 1L8DA 4KL1A 1URFA 3HKBB 4ZBMA 1V55C 1OCOB 3ZS8C 4GX1A 1V54C 1ZSPA 4DV5O 4J41A 5FNVA 1YZBA 1KUQA 4GYCB 4JI7O 4IT5A 3WFVA 4QE9A 4Z1MG 4BIUA 3UT5A 4UV8A 2OCHA 3BEHA 1FXHA 4PI0A 2WLHA 1YITV 2WLIB 2OTLV 2X0LA 2DN9A 2CK3G 4DXWA 1XNQO 2CUGA 1SA0A 2FMLA 4JI8B 3RW0A 1M5IA 4FPPA 3LDEA 4UV9A 1J95A 1XHXA 3ASOB 3JALB 3UKMA 1N34B 3JYCA 2QSAA 1H2GA 4ZHQA 4NXMO 4DRXA 2JVDA 4WFFA 4LR3A 3JAMN 2YIBA 2O57A 2XOKG 4LFBO 1R3JC 2E5LO 5IYBO 1UJWB 2ZNIA 2VQFB 4O2AA 3VQXA 2GDSA 1YJNV 4O4HA 1YIJV 2IJIA 3WB1A 1R3LC 3SYAA 3EFFK 1AR1B 1YJ9V 1IBLO 1OV9A 4JI6O 5EZYB 5EIBD 3N2KB 5C8YB 1P7BA 2DQ0A 2DOSA 1X4TA 2RMKB 3H1JH 2LP7A 1WP8A 5EC2C 3JD3A 2F23A 3GB7C 4UCSA 4O4JA 4D7SA 2VQEB 1VMGA 3ASNB 1B3QA 1FD9A 1O9HA 3H1LH 5HFLA 2BCCH 3TJTA 4B3MO 1XEQA 3DXRB 3TETA 2Y0PA 1OJHA 1ZTEA 3N27A 1H2KA 3SJAC 1ZL8B 3K03A 1VQMV 2HEPA 3F5WC 3ETGA 3X2QC 5FLXN 3LSQA 3D3QA 2WLKA 1VQKV 2BSKB 4O2BB 3SJCC 3OAAG 1RFYA 1VF5B 2XTAA 2YXYA 2UXDO 4IIJA 1FXKB 4LCUC 2W6IG 3ZN1A 2UU9B 2P4KA 1N36O 4CZZA 1KP2A 4E4EA 3T1CA 1EBOA 4LFAB 1AI7A 1KECA 1YDXA 2HJFC 3FB5C 3ABMB 4CH5A 4OPHA 1GMGA 3K9SA 4DR2O 1D5NA 1TA8A 1JVMA 1IVSA 3K08A 2E3CA 2GUZA 1R3IC 4LP8A 3CCUV 1BGYH 1QQCA 3Q4HA 1NZ6A 3OMNB 4X66B 2JGUA 1SZTA 1Y74A 3STLC 4EFEA 2ZR2A 2Q69A 2NR5A 3CXCU 3N2GA 3KKYA 4JI5B 2HR3A 1GN6A 2Y48A 2L35A 3AK2A 2XUMA 3AG7A 4FLZA 4D7TA 1N33O 3G80A 3ETDA 3AG1B 1VQ6V 4JI3B 1SRYA 1HNWB 4DW0A 1YSCA 5B1BB 2CH7A 3L70H 3FB7C 1VQLV 1NH2B 4TOIA 5EYPA 1OCZC 4JI1O 1SQFA 4MT8A 5K1XA 2KG7B 3K04A 3DSQA 5H9CA 1JFFA 4LF6O 4B3SO 3ETEA 4LF7B 3CRAA 4PD4F 1XQ8A 2OWOA 3PN1A 4XDJA 4JAAA 2UXXA 3FB6C 1N0NA 2B1GA 2ITCC 1M56B 4DR5O 5L3FA 5GONA 3SYOA 2R9AA 2Y69B 4NVPA 1YHQV 2UUAO 1Q90D 2P06A 1KBHA 1QVGU 5LMNB 5IYCO 1YI2V 1M57B 4GX5A 4UB8Z 1F23A 2DW4A 3JAWA 5IJ0B 3G4SV 1XL4A 5IWAO 2ZCEA 4LF8B 3CRQA 4I0XB 5KHIA 3CCLV 4MTFA 1SC5B 4PDRA 4YJ2B 5B1OA 2X6AA 2ARHA 3K5MA 1VP7A 4DR6B 1NS1A 2WLLB 1DK1A 4GKKB 5LMUB 3SYPA 1XDCA 2HLDG 2JJ1G 2Q73A 2Y4TA 5LYJB 3R65A 4X20A 1FJGO 1I7FA 2Y4UA 1MA1A 4JF3A 5A2QN 5L3GA 1JR9A 1OHHG 2DYRC 1VARA 2QWNB 2K1EA 1KMIZ 2CE4A 3HR0A 1DF5A 4XDLA 1R73A 2EX3A 3VQYA 2ATKC 4IGGA 3CMAV 3T4ZA 4UCRA 3B8NA 1NI8A 1VQ5V 4JTAB 1HNXO 2XNDG 2ZNJA 5ITZB 3WB2A 2OT5A 4JAVA 4RUEA 5LHHA 2ZXWB 3U10A 2F1MA 3RYIA 3AG3C 1YCIA 1K5SA 3CRMA 4ZOLA 4DR4O 3ZCCA 1BS3A 4FM1A 1H8EG 3LSUA 3JD2A 2UXCB 2Q7HA 3QG5A 3SPCA 1O9GA 4XDKA 4B3TB 1PL4A 5LL6Y 3NR7A 3F7YC 3HKEA 2AZ0A 1YXBA 1Q5OA 1KKDA 3LUTB 4I9WA 1NU1H 2VRZA 1U96A 2WAMA 3RYHB 1JCHA 2ZM6O 1Q6UA 3SJBC 2JEXA 3U0ZA 4DV7O 3JSNA 3OUSA 1QU7A 5CA0A 4TT3G 3CCQV 3F7VC 3OMAB 4W4KA 4LF4O 1N32B 4U3JA 3OW2U 3IC9A 3T1HB 1H38A 1CPYA 2EZOA 3ABTA 1Z2GA 5FPOA 4DK0A 2GBOA 2YC0A 3APQA 5JVDA 2IU0A 1Y74B 3JASA 2ETNA 2RDCA 1N4CA 4FIPC 3GWOA 4OX9O 2PGGA 2EILB 1JJ2U 3FB8C 3WB0A 2DYSB 2F66C 4X1YB 4LF5B 2CTPA 2X6BA 2RCVA 1K9MW 3BCCH 1NQTA 4K8ZA 1IDSA 4C7UA 5B1AB 4FFBA 5B3SB 4YHHB 2A79B 2HVKC 4X1IA 5CA1A 3E86A 2EIMB 4AQYO 1AI5A 2AHYA 1VQPV 2EIKC 3A0BZ 4KUMA 3QVNA 4TUYB 1I94O 2B9ZA 3ZRXA 4B3RB 2KQXA 5LXTA 4NB5A 2DJVA 3G6EV 3TCUA 2Q9LA 4LC1A 2QM4A 4JI2B 2FB5A 2W0FC 1VF7A 2V1DA 3JATA 4DYLA 5KAIZ 3CSXA 4X1KB 2EINC 4X65O 3OEEG 2ZE7A 2BOCC 3OTOO 1EZVH 3J80N 5EBLC 2X7RB 1IXMA 1S76D 3L72H 1SETA 4I55A 2QJ1A 3BA8A 4H0LB 3R66A 1SF9A 1Y67A 2UUCO 4G2KA 4DV1B 5KAFZ 3RVZA 2QKCA 4A5UB 3E22B 4YY3O 1IZ3A 4JZGA 1Y6XA 4X88A 3TXQA 4UVBA 3SJQC 4J9YB 4JV5O 1BQ0A 3JCZA 1I5YA 3B09A 4LNUB 4O4LA 2CTQA 4FVMA 4DV2B 2OCCC 4DUYB 4WBNA 3LDCA 4W4LA 1QLEC 5A9GA 1VF6A 4LWSB 1H2LA 1NTZH 5H5NA 1FPOA 3MD0A 4JI4B 3ZHUA 3RWRD 4PA3A 3CX5F 3G6BA 4FLTA 1X59A 1SQGA 5BXZA 4CH3A 1QR8A 3M99B 5CA3A 1J5EB 4J80A 2JIZG 3HKDA 1TUBB 4PA6A 1Q3EA 1MZFA 4DV3O 3E89A 1XI1A 2YSUB 3AG2C 4DO2A 4R8CA 2VWKA 4GLXA 4K0KO 1PNKA 1OCCC 2ADQB 2HP8A 1MABG 3JD4A 4TV8A 3ZBHA 2Z0AA 1WLEA 2P7TC 4HBNA 4RO2A 2YEVA 2GTSA 1IXBA 4FJCC 1FXVA 1K5QA 5KX5B 1GM9A 1G6UA 2JGDA 3E35A 2ODMA 2YIBD 4MVQA 5GTHZ 1P84F 3B77A 3BVOA 4GUNA 4I4TA 1TGOA 4ABMA 4YIOA 5JH7A 4LFCO 3RYFB 4JI7B 3MDSA 2QTSA 1GN4A 1HDJA 1LR1A 2DWDC 1XNQB 4QE7A 1K73W 2UXBB 1WPBA 1AJQA 1PV0A 5EC1C 3RN4A 5IY5C 5LGNA 4OPAA 4NXMB 2RN9A 1WAZA 4EB6A 1TVKB 1XNRO 1LUWA 1QCEA 3L71H 4G27B 2AZ2A 5JQGA 3FD9A 4LFBB 1EM1A 4JGSA 4HNAB 4O4IA 2B5UA 4CBCA 4GKJO 1YVWA 2MK3A 1XMOO 2ZD9A 3CC2V 1V54B 2ILMA 5BMVB 5E79Z 1NVPD 1E1RG 1QR9A 3SDLA 4TSFG 4DV4O 2QKSA 1IBLB 4LF9B 4KHPO 4BW5A 4JI6B 1NR1A 2CGNA 1RP3B 4J42A 2F95B 2Q6AA 1SZXA 1WA8B 2IJJA 2ZT9B 2ZIMA 3JCUZ 4EEQA 1PD3A 2YIDA 2F4VO 3K06A 3ASNC 1M1KW 3LNNA 2BTQB 4QGPA 3QO5A 3LSSA 5E1AC 4UCOA 1JA8A 2QDOA 5C93A 4NXNO 5HFMA 3AK1A 1VQNV 2UXNA 1VIBA 4J7KA 4IHJA 4EFBA 4B3MB 1F51A 1VF6C 4NTYA 3HKCA 3OGIB 4HZ3A 1YJWV 1EN6A 5KMGA 1Q86W 1CP9A 4H37A 1BT8A 4H44B 1M90W 1BL8A 3L75H 4KFMA 3OUFA 2HHHO 3OE7G 1FXKC 4DR1O 4D6TH 4F6RB 4N21A 2A3QA 1MSDA 3K5LA 3J81N 2JK5C 4UCVA 3ABMC 2R9IA 2OTJV 1DGSA 5BR8O 1U97A 4P9OA 2VQEO 1OCRC 1N36B 3IC7A 3W7TA 2R72A 1BE3H 5KUMA 2P4VA 4QJFB 2ADPA 4DR2B 4JZ2A 4JASA 4WF9V 2WWWA 1FAFA 1NR7A 4U7NA 2AGAA 3E8FA 4FK5C 5CB4B 5LOVB 2AXTZ 1QBZA 5K1PA 3UO2A 3KCXA 3H9VA 5B1BC 1VQ9V 1P4RA 2C2AA 2UUBO 4NKGB 2KKWA 3X2QB 5EBMC 1N33B 1AI6A 2LO1A 4P30A 2ITDC 1VQ4V 3EVKA 4TV9B 1YF2A 2IBZH 2IH1C 5LP6B 2ZE8A 3EXAA 4YJ3B 5LA6A 4RAIA 2JEUA 5IJ9B 3DC6A 2Q4PA 2W6JG 5GW7A 3OT7A 4J11A 3D36A 3T4DA 1QVFU 4JI1B 1DF4A 4LF6B 1K34A 4B3SB 4MS2A 1M57C 5DN6G 3APOA 4DV6O 4QPKA 1Y76A 3IGAC 1SQQH 2JJ2G 5J2TA 1G4YB 4DR5B 1JQ0A 2P67A 2M7WA 3SPGA 2UUAB 2E76B 5FNVB 1FFXA 2GV9A 3UT5B 2QTOA 4JI3O 3CMEV 3BY6A 3SPIA 4HYOA 1GTOA 3BPZA 2WLMA 5IWAB 1Z5VA 1SA0B 5FL7G 3M8AA 1K33A 3UCSC 2AW9A 4ZI7A 4MTOA 4Q6GA 3JARA 2RJZA 3CJHA 4ZHQB 1MOFA 3CE2A 4DRXB 1QLNA 3LDDA 1LUVA 2A06H 1HNZO 2XAFA 1OCZB 4CS4A 1FJGB 5KHJA 1R6TA 2IM9A 2R9RB 4O2AB 3A2FA 2YIAA 4O4HB 2OYQA 3IFXA 2F43G 4GT1A 1D5AA 1K3EA 2RQ6A 4ICGA 2LQTA 3FYEB 3ZMTA 4P2ZA 1NTMH 1K97A 2WA3A 5DM6V 3JD1A 5J2UA 1XILA 1HNXB 3FYIB 4B7KA 1SS3A 3ZRWA 3K9AA 3KG2A 3RYCA 4UB6Z 4WFGA 2PI5A 1ZX3A 4UCTA 4I50A 4O4JB 4FLXA 1BZKA 4DR4B 3D8CA 3FAVA 1T5EA 2PY5A 3T1YO 3W7WA 4X64O 2GTAA 4K35A 4JAUA 3L74H 1QNMA 1AVMA 3VBBA 1NVPB 1H2MA 4TWKA 4FLVA 5CN0A 3I5DA 2DYRB 3ABLC 1K92A 4ASUG 4BR6A 2PI4A 3BRCA 3CYOA 1RSOA 5LHIA 4DV7B 3CRRA 1RPOA 3JAKA 4I9QA 4IIJB 4PI2A 2GHYA 3J7AU 4PV1B 1IURA 4J10A 1E1QG 2KB1A 1Q7YW 3K59A 1PL0A 2DYSC 3D36C 2YI8A 3OR6C 4LBEC 3W7XA 3HKBA 2Q0AA 2GUZB 1Q43A 4TQDA 1ZLZA 2LGQA 4OX9B 1Q8IA 3I56V 3Q4HB 1ZUQA 2DQ3A 2EIMC 3N2GB 2QEXV 2XHBA 1K4DC 1AR5A 1COWG 2WLIA 4PJ0Z 2EIJC 1PP9H 4I7ZB 4CC6A 3P3PA 4AHCA 2P22C 3W7UA 4AQYB 2Z5UA 3K5NA 4Z2WA 5AG2A 3ZMSA 2CH7B 3JALA 5BZBA 3VQWA 2A9HA 2LJ2A 4P9PA 1L0LH 3AG4C 5EYPB 3RVYA 5B1NA 1AROP 2N04A 4RQEA 1RM1C 4X62O 1JFFB 2X6CA 1KYOF 3CEIA 4EKWA 3K58A 1F4NA 2HKOA 5LHGA 4X65B 4X8AA 3L73H 5GONB 1WPXA 4BIZA 3E8GA 3OTOB 4DR3O 4H33A 2YS8A 3VOUA 5EZYA 3CXHF 1FFTB 3N2KA 5C8YA 2EJRA 2H8PC 4J7JA 3JAWB 4R50A 1DLBA 3WG7B 2WA4A 4YIPA 2YICA 4DR7O 2HG5C 1GK9A 4J9ZB 1KKCA 4BWAA 3CHXA 5IYZA 4YY3B 1XREA 1NKDA 3ML0A 3ZHSA 2YI9A 2WLNA 2Z3YA 4JI0O 1HR0O 1R3KC 3RBZA 1LNQA 1JPXA 3DXRA 5JJJB 4X20B 4MTXA 4CH4A 3E8BA 1ZL8A 1IBMO 3G67A 4FLYA 1FKAO 4WFEA 2CDYA 3STZC 2EINB 1AP5A 1XL6A 3K0GA 4JYCA 1AI4A 1NT2B 4GX2A 2BSKA 3JD0A 1EN4A 2W0XA 3GWKC 4LH7A 5KLVH 4DUZO 1GAXA 4I5SA 4DV3B 1FXKA 3CCVV 1MZEA 1BHBA 1D2DA 3ABKC 4UCUA 3JSLA 4K0KB 1G1XB 1XBLA 4UFZA 2QWPB 1WB7A 1IBKO 4NTWA 5LBQA 2Q67A 4DV0O 5H6QA 3RYIB 1OCOC 3T2MA 4ZOLB 3CCMV 1HWYA 4G28B 4X9QA 4Z1VA 1XMQO 4X89A 1P7GA 2NN4A 3UQ8A 2EZPA 1QLEB 3HKEB 4OXSA 2D3OW 1GRJA 3MAQA 4LFCB 5D5PA 4FZ0A 5J9PC 4DV5B 3E8HA 1SQVH 4K3AA 4MW8A 2H94A 3ZHQA 1W2BU 4WCEV 3ASOC 5CA0B 2ZDIA 1VQ7V 4JTCB 2M6YA 2FKXA 2V4DA 3AG2B 4U3JB 1OCCB 4JYAO 2KG7A 3GVMA 5JVDB 2BE3A 1XNRB 4JPRA 5EK0A 2DMXA 3JASB 1UPGA 1AP6A 3QO7A 4GKJB 2P5OA 1L0NH 1XMOB 3E2EA 1PM9A 1H2NA 2E5LB 1V55B 4DV4B 2UXBO 4KHPB 4B08A 5IJ0A 4WFBV 4FFBB 5JCOC 3KCYA 5L3CA 3MHSC 3C3SA 4MTGA 4X1IB 3S3XA 1M9NA 4NR1A 5CA1B 1MNGA 4I0XA 2LFSA 4JI8O 2F4VB 1WJZA 4YXWG 4PA7A 3ZN0A 4AI8A 3IAYA 4YJ2A 2Q5ZA 2E74B 4IL6Z 2JS5A 5CBGA 4RWUA 5KHKA 4PELA 5LXTB 1N34O 2WLLA 5KA6A 4NXNB 3ZMVA 5CBFA 5IY5B 2YUAA 5LYJA 2XAGA 5GTIZ 4DW1A 3P30A 1CXZB 1HP8A 3JATB 4MSWC 1RPRA 2VQFO 4FLWA 1W59A 3B2EE 4GX0A 3BA9A 1BHAA 4LF9O 3OR7C 4PA4A 3FX7A 5D5QA 5KHHA 2HHHB 3THOA 1Q6HA 5B66Z 3DC5A 4GCZA 2Y0IA 3OTFA 4DK1A 5JJEB 4DR1B 1BMFG 4WFHA 1MMMA 1H2SB 1SKVA 4I55B 5IYZB 1R1BA 3B8MA 3SPJA 2MW2B 3ZRVA 1UFIA 1EFRG 5BR8B 2HFEC 4L8JA 4GZRB 2LW1A 5ITZA 2H3OA 2PF4E 4MVSA 2UXDB 3AK3A 3NXSA 2LFRA 1YEWA 3SGIA 3BHPA 1KB9F 1QHTA 2YXLA 3RGBA 3OD4A 4O4LB 3QNEA 4BW9A 4WBNB 1L1FA 3A8TA 1BQZA 3QO8A 4FFKA 5LGTA 1G8MA 1HW7A 1ENVA 3P3NA 2Q7GA 5L3BA 1NBMG 1JJOA 5LP6C 3CB2A 1AJPA 2ZR3A 2R70A 3AG1C 3CCRV 3FFQA 3RYHA 3W7SA 2UUBB 3H1HH 1GO3F 5CBHA 3HKDB 1B06A 3RFRA 4FMTA 2ZDIC 3HPLC 4E2LA 2UU9O 1FS0G 1AJNA 4FZ1A 2FYUH 4JYYA 4H13B 1WN7A 3CWBH 3QF7A 4LFAO 1OCRB 4TV8B 1ORQC 5B5EZ 2YEVB 2CAZC 1ZAUA 2JGDB 1B04A 4R7CA 1SQXH 2L6LA 2QWOB 2ZKOA 1M56C 1F7YA 1WB8A 4F6EA 2P90A 4I4TB 4X66O 4X1YA 2JS3A 4DV6B 2Y69C 2LW7A 2Q7EA 1BSMA 1I0HA 5LGUA 1F4MA 4JI5O 3OEHG 2V7QG 2ZE5A 1S72V 5JH7B 2IJKA 3HB3B 1IX9A 1SERA 1DTOA 5L3DA 1WP7A 4IYHA 4U7OA 1Q82W 4UXNA 1S5HC 4B7EA 3I55V 4BIOA 2P6JA 4TUYA 3CC4V 1HNWO 2Q0OC 3VQVA 5TISZ 2VS0A 3C3TA 4JYBA 1A32A 5H2FZ 1YTFD 4MVOA 3SR2C 3K3WA 4EB6B 1AILA 1PKXA 4NYKA 1HNZB 1N0JA 1P49A 5JQGB 4LF7O 3LNMB 3S3WA 1BCCH 4X1KA 4O4IB 4KXRA 2XT9A 1N8RW 1M93A 1KQSU 4OGQB 5LMNO 2PTMA 4IYIA 3CC7V 2LGWA 3TK1A 1PNMA 3QTCA 4LF8O 3ZJZA 5BY1A 4FM2A 3E22A 3K57A 2ZXWC 4NTXA 5DECA 2N74A 4DR6O 3P32A 4GKKO 5LMUO 2RNBA 4QIWF 4LNUA 2QE7G 1W0JG 3SYQA 2BOBC 2A0LA 4IHJB 5KHGA 2WLJA 4FM0A 3HKCB 3MHHC 3T1YB 4X64B 5KMGB 3OFNG 4F4LA 4LWSA 2CGOA 3FKSG 1NTKH 2JRIA 2EJ7A 1K7DA 3L9DA 3G71V 2N05A 4UVCA 1E79G 3O65A 5EIBC 4HAMA 2XASA 1WNSA 3CRCA 3DGEA 1K4CC 1H8HG 5KA5A 1TUBA 3PJSK 1Y66A 5JJNB 1XOUA 3U11A 4AILC 4CC5A 3IJ4A 2WPDG 1R6KA 2ZM6B 3UO3A 1JOYA 5KUKA 2WSSG 1SQPH 1GKFA 2HVJC 2HJDA 3CD6V 4JTDB 2QKAA 1GM8A 1PNLA 5KX5A 4LF4B 3RT3C 4QNHB 2EILC 4UVAA 1TAEA 4CH6A 2UXCO 4MVUA 1MG1A 5EBWC 3ZHVA 1GN3A 3E83A 4B3TO 3BFRA 1ROPA 2EBOA 2EULA 2PUSA 3KZIZ 2E75B 2XAQA 3AG3B 1Q81W 3TGUH 5B1AC 3RYFA 5B3SC 3CCJV 3B40A 2QGNA 2ZINA 5L3EA 3A0RA 3CCEV 3DTUB 2IW5A 4R6ZA 4K8XA 3ABLB 1K8AW 1XUQA 3CPWU 1GM7A 2CTWA 4KP4A 1JMKC 2FTKA 2IH3C 2IJHA 3F5TA 1KP3A 3K0DA 4UUJC 5LA6B 1N32O 5JWPA 2ZE6A 1KC8W 3T1HO 1TVKA 1I94B 4N23A 3ZMUA 4PHZA 4MVRA 3OMIB 4X62B 4PA9A 4HNAA 1AR4A 2XAHA 4LF5O 5BMVA 3WG7C 3K79A 3ZMZA 1CEZA 1Y76B 3ABUA 5J2TB 2G38A 3ICXA 1ZWIC 2FL4A 1FFXB 1SQBH 3H1KH 4DR3B 1M4UA 4J7ZA 4YHHO 1XHZA 5H6RA 4RUFA 1Q6IA 1WA8A 1SESA 2EIJB 2QM8A 1TUEB 3EHBB 2NNUA 4DR7B 2BTQA 5CMUA 3D3IA 2YXHA 4L87A 4B3RO 5JCOA 1VQ8V 3ZIAG 1OZ0A 3M7MX 1S77D 1KD1W 3BAAA 1S0VA
chains in the Genus database with same CATH topology
1XOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOU A; 
#chains in the Genus database with same CATH topology
 2UUC B;  2NLJ C;  1GH6 A;  4ZI7 B;  4JI0 B;  1HR0 B;  3TXS A;  4BAY A;  3JAR B;  3ZHR A;  2VWJ A;  3CJH B;  3B4S A;  2EIK B;  4JI2 O;  2Q68 A;  2A7W A;  3AG4 B;  4JV5 B;  2DWE C;  3UM7 A;  4Q20 A;  2KSD A;  3ZHT A;  4PDM A;  1VEW A;  1RM1 B;  5DED A;  3WU2 Z;  4CS3 A;  2K9P A;  1IBM B;  4U3F H;  1S3J A;  2AHZ A;  3OGC C;  2DE0 X;  5IT9 N;  5IDJ A;  4MVM A;  4F6R A;  1EN5 A;  2Q8V A;  2D2C B;  4PDL A;  1THZ A;  4DUZ B;  2QR4 A;  3CCS V;  4DV1 O;  3SYC A;  3CP1 A;  5J2U B;  4O2B A;  4MW3 A;  1Y4M A;  2OIE A;  3ETQ A;  1US6 A;  1NH2 D;  3SPH A;  3ZRW B;  3RYC B;  2OIG A;  1IBK B;  1I08 A;  3AEI A;  4PDV A;  4DV0 B;  3A0H Z;  4I50 B;  1YTF B;  3ZX6 A;  1V9P A;  1Z5W A;  1GN2 A;  2B1I A;  3BAB A;  4DV2 O;  4DUY O;  2XAJ A;  1XMQ B;  3ZED A;  1R6N A;  3H01 A;  3OM3 B;  2ZQM A;  1FYJ A;  2JDI G;  3FAV B;  3K5O A;  1W0K G;  1B6Q A;  3ZRS A;  4MVZ A;  2QA4 V;  5CB4 A;  5LOV A;  3O9O A;  4LH6 A;  2PYJ A;  1NJI W;  2ZIO A;  2OCC B;  2YDE A;  4JI4 O;  5IYD O;  4XBF A;  2PYL A;  1VQO V;  1S5L Z;  3CS5 A;  5IE9 A;  1I5X A;  4ZIB A;  1J5E O;  3H1I H;  2PZS A;  1MSW D;  4CS2 A;  2BTO A;  3C90 A;  2F93 B;  1RSO B;  4TV9 A;  5LP6 A;  1AB3 A;  1S5J A;  4YJ3 A;  2QWQ B;  2GSM B;  3JAK B;  4RQF A;  5IJ9 A;  4QPJ A;  4WFA V;  1PPJ H;  2CTR A;  5F2V O;  4FLU A;  1KU9 A;  5FPR A;  2IU3 A;  4ZKI A;  2QWR B;  1EZJ A;  1JX9 A;  3ABK B;  2QM7 A;  4TQF A;  4JYA B;  1L8D A;  4KL1 A;  1URF A;  3HKB B;  4ZBM A;  1V55 C;  1OCO B;  3ZS8 C;  4GX1 A;  1V54 C;  1ZSP A;  4DV5 O;  4J41 A;  5FNV A;  1YZB A;  1KUQ A;  4GYC B;  4JI7 O;  4IT5 A;  3WFV A;  4QE9 A;  4Z1M G;  4BIU A;  3UT5 A;  4UV8 A;  2OCH A;  3BEH A;  1FXH A;  4PI0 A;  2WLH A;  1YIT V;  2WLI B;  2OTL V;  2X0L A;  2DN9 A;  2CK3 G;  4DXW A;  1XNQ O;  2CUG A;  1SA0 A;  2FML A;  4JI8 B;  3RW0 A;  1M5I A;  4FPP A;  3LDE A;  4UV9 A;  1J95 A;  1XHX A;  3ASO B;  3JAL B;  3UKM A;  1N34 B;  3JYC A;  2QSA A;  1H2G A;  4ZHQ A;  4NXM O;  4DRX A;  2JVD A;  4WFF A;  4LR3 A;  3JAM N;  2YIB A;  2O57 A;  2XOK G;  4LFB O;  1R3J C;  2E5L O;  5IYB O;  1UJW B;  2ZNI A;  2VQF B;  4O2A A;  3VQX A;  2GDS A;  1YJN V;  4O4H A;  1YIJ V;  2IJI A;  3WB1 A;  1R3L C;  3SYA A;  3EFF K;  1AR1 B;  1YJ9 V;  1IBL O;  1OV9 A;  4JI6 O;  5EZY B;  5EIB D;  3N2K B;  5C8Y B;  1P7B A;  2DQ0 A;  2DOS A;  1X4T A;  2RMK B;  3H1J H;  2LP7 A;  1WP8 A;  5EC2 C;  3JD3 A;  2F23 A;  3GB7 C;  4UCS A;  4O4J A;  4D7S A;  2VQE B;  1VMG A;  3ASN B;  1B3Q A;  1FD9 A;  1O9H A;  3H1L H;  5HFL A;  2BCC H;  3TJT A;  4B3M O;  1XEQ A;  3DXR B;  3TET A;  2Y0P A;  1OJH A;  1ZTE A;  3N27 A;  1H2K A;  3SJA C;  1ZL8 B;  3K03 A;  1VQM V;  2HEP A;  3F5W C;  3ETG A;  3X2Q C;  5FLX N;  3LSQ A;  3D3Q A;  2WLK A;  1VQK V;  2BSK B;  4O2B B;  3SJC C;  3OAA G;  1RFY A;  1VF5 B;  2XTA A;  2YXY A;  2UXD O;  4IIJ A;  1FXK B;  4LCU C;  2W6I G;  3ZN1 A;  2UU9 B;  2P4K A;  1N36 O;  4CZZ A;  1KP2 A;  4E4E A;  3T1C A;  1EBO A;  4LFA B;  1AI7 A;  1KEC A;  1YDX A;  2HJF C;  3FB5 C;  3ABM B;  4CH5 A;  4OPH A;  1GMG A;  3K9S A;  4DR2 O;  1D5N A;  1TA8 A;  1JVM A;  1IVS A;  3K08 A;  2E3C A;  2GUZ A;  1R3I C;  4LP8 A;  3CCU V;  1BGY H;  1QQC A;  3Q4H A;  1NZ6 A;  3OMN B;  4X66 B;  2JGU A;  1SZT A;  1Y74 A;  3STL C;  4EFE A;  2ZR2 A;  2Q69 A;  2NR5 A;  3CXC U;  3N2G A;  3KKY A;  4JI5 B;  2HR3 A;  1GN6 A;  2Y48 A;  2L35 A;  3AK2 A;  2XUM A;  3AG7 A;  4FLZ A;  4D7T A;  1N33 O;  3G80 A;  3ETD A;  3AG1 B;  1VQ6 V;  4JI3 B;  1SRY A;  1HNW B;  4DW0 A;  1YSC A;  5B1B B;  2CH7 A;  3L70 H;  3FB7 C;  1VQL V;  1NH2 B;  4TOI A;  5EYP A;  1OCZ C;  4JI1 O;  1SQF A;  4MT8 A;  5K1X A;  2KG7 B;  3K04 A;  3DSQ A;  5H9C A;  1JFF A;  4LF6 O;  4B3S O;  3ETE A;  4LF7 B;  3CRA A;  4PD4 F;  1XQ8 A;  2OWO A;  3PN1 A;  4XDJ A;  4JAA A;  2UXX A;  3FB6 C;  1N0N A;  2B1G A;  2ITC C;  1M56 B;  4DR5 O;  5L3F A;  5GON A;  3SYO A;  2R9A A;  2Y69 B;  4NVP A;  1YHQ V;  2UUA O;  1Q90 D;  2P06 A;  1KBH A;  1QVG U;  5LMN B;  5IYC O;  1YI2 V;  1M57 B;  4GX5 A;  4UB8 Z;  1F23 A;  2DW4 A;  3JAW A;  5IJ0 B;  3G4S V;  1XL4 A;  5IWA O;  2ZCE A;  4LF8 B;  3CRQ A;  4I0X B;  5KHI A;  3CCL V;  4MTF A;  1SC5 B;  4PDR A;  4YJ2 B;  5B1O A;  2X6A A;  2ARH A;  3K5M A;  1VP7 A;  4DR6 B;  1NS1 A;  2WLL B;  1DK1 A;  4GKK B;  5LMU B;  3SYP A;  1XDC A;  2HLD G;  2JJ1 G;  2Q73 A;  2Y4T A;  5LYJ B;  3R65 A;  4X20 A;  1FJG O;  1I7F A;  2Y4U A;  1MA1 A;  4JF3 A;  5A2Q N;  5L3G A;  1JR9 A;  1OHH G;  2DYR C;  1VAR A;  2QWN B;  2K1E A;  1KMI Z;  2CE4 A;  3HR0 A;  1DF5 A;  4XDL A;  1R73 A;  2EX3 A;  3VQY A;  2ATK C;  4IGG A;  3CMA V;  3T4Z A;  4UCR A;  3B8N A;  1NI8 A;  1VQ5 V;  4JTA B;  1HNX O;  2XND G;  2ZNJ A;  5ITZ B;  3WB2 A;  2OT5 A;  4JAV A;  4RUE A;  5LHH A;  2ZXW B;  3U10 A;  2F1M A;  3RYI A;  3AG3 C;  1YCI A;  1K5S A;  3CRM A;  4ZOL A;  4DR4 O;  3ZCC A;  1BS3 A;  4FM1 A;  1H8E G;  3LSU A;  3JD2 A;  2UXC B;  2Q7H A;  3QG5 A;  3SPC A;  1O9G A;  4XDK A;  4B3T B;  1PL4 A;  5LL6 Y;  3NR7 A;  3F7Y C;  3HKE A;  2AZ0 A;  1YXB A;  1Q5O A;  1KKD A;  3LUT B;  4I9W A;  1NU1 H;  2VRZ A;  1U96 A;  2WAM A;  3RYH B;  1JCH A;  2ZM6 O;  1Q6U A;  3SJB C;  2JEX A;  3U0Z A;  4DV7 O;  3JSN A;  3OUS A;  1QU7 A;  5CA0 A;  4TT3 G;  3CCQ V;  3F7V C;  3OMA B;  4W4K A;  4LF4 O;  1N32 B;  4U3J A;  3OW2 U;  3IC9 A;  3T1H B;  1H38 A;  1CPY A;  2EZO A;  3ABT A;  1Z2G A;  5FPO A;  4DK0 A;  2GBO A;  2YC0 A;  3APQ A;  5JVD A;  2IU0 A;  1Y74 B;  3JAS A;  2ETN A;  2RDC A;  1N4C A;  4FIP C;  3GWO A;  4OX9 O;  2PGG A;  2EIL B;  1JJ2 U;  3FB8 C;  3WB0 A;  2DYS B;  2F66 C;  4X1Y B;  4LF5 B;  2CTP A;  2X6B A;  2RCV A;  1K9M W;  3BCC H;  1NQT A;  4K8Z A;  1IDS A;  4C7U A;  5B1A B;  4FFB A;  5B3S B;  4YHH B;  2A79 B;  2HVK C;  4X1I A;  5CA1 A;  3E86 A;  2EIM B;  4AQY O;  1AI5 A;  2AHY A;  1VQP V;  2EIK C;  3A0B Z;  4KUM A;  3QVN A;  4TUY B;  1I94 O;  2B9Z A;  3ZRX A;  4B3R B;  2KQX A;  5LXT A;  4NB5 A;  2DJV A;  3G6E V;  3TCU A;  2Q9L A;  4LC1 A;  2QM4 A;  4JI2 B;  2FB5 A;  2W0F C;  1VF7 A;  2V1D A;  3JAT A;  4DYL A;  5KAI Z;  3CSX A;  4X1K B;  2EIN C;  4X65 O;  3OEE G;  2ZE7 A;  2BOC C;  3OTO O;  1EZV H;  3J80 N;  5EBL C;  2X7R B;  1IXM A;  1S76 D;  3L72 H;  1SET A;  4I55 A;  2QJ1 A;  3BA8 A;  4H0L B;  3R66 A;  1SF9 A;  1Y67 A;  2UUC O;  4G2K A;  4DV1 B;  5KAF Z;  3RVZ A;  2QKC A;  4A5U B;  3E22 B;  4YY3 O;  1IZ3 A;  4JZG A;  1Y6X A;  4X88 A;  3TXQ A;  4UVB A;  3SJQ C;  4J9Y B;  4JV5 O;  1BQ0 A;  3JCZ A;  1I5Y A;  3B09 A;  4LNU B;  4O4L A;  2CTQ A;  4FVM A;  4DV2 B;  2OCC C;  4DUY B;  4WBN A;  3LDC A;  4W4L A;  1QLE C;  5A9G A;  1VF6 A;  4LWS B;  1H2L A;  1NTZ H;  5H5N A;  1FPO A;  3MD0 A;  4JI4 B;  3ZHU A;  3RWR D;  4PA3 A;  3CX5 F;  3G6B A;  4FLT A;  1X59 A;  1SQG A;  5BXZ A;  4CH3 A;  1QR8 A;  3M99 B;  5CA3 A;  1J5E B;  4J80 A;  2JIZ G;  3HKD A;  1TUB B;  4PA6 A;  1Q3E A;  1MZF A;  4DV3 O;  3E89 A;  1XI1 A;  2YSU B;  3AG2 C;  4DO2 A;  4R8C A;  2VWK A;  4GLX A;  4K0K O;  1PNK A;  1OCC C;  2ADQ B;  2HP8 A;  1MAB G;  3JD4 A;  4TV8 A;  3ZBH A;  2Z0A A;  1WLE A;  2P7T C;  4HBN A;  4RO2 A;  2YEV A;  2GTS A;  1IXB A;  4FJC C;  1FXV A;  1K5Q A;  5KX5 B;  1GM9 A;  1G6U A;  2JGD A;  3E35 A;  2ODM A;  2YIB D;  4MVQ A;  5GTH Z;  1P84 F;  3B77 A;  3BVO A;  4GUN A;  4I4T A;  1TGO A;  4ABM A;  4YIO A;  5JH7 A;  4LFC O;  3RYF B;  4JI7 B;  3MDS A;  2QTS A;  1GN4 A;  1HDJ A;  1LR1 A;  2DWD C;  1XNQ B;  4QE7 A;  1K73 W;  2UXB B;  1WPB A;  1AJQ A;  1PV0 A;  5EC1 C;  3RN4 A;  5IY5 C;  5LGN A;  4OPA A;  4NXM B;  2RN9 A;  1WAZ A;  4EB6 A;  1TVK B;  1XNR O;  1LUW A;  1QCE A;  3L71 H;  4G27 B;  2AZ2 A;  5JQG A;  3FD9 A;  4LFB B;  1EM1 A;  4JGS A;  4HNA B;  4O4I A;  2B5U A;  4CBC A;  4GKJ O;  1YVW A;  2MK3 A;  1XMO O;  2ZD9 A;  3CC2 V;  1V54 B;  2ILM A;  5BMV B;  5E79 Z;  1NVP D;  1E1R G;  1QR9 A;  3SDL A;  4TSF G;  4DV4 O;  2QKS A;  1IBL B;  4LF9 B;  4KHP O;  4BW5 A;  4JI6 B;  1NR1 A;  2CGN A;  1RP3 B;  4J42 A;  2F95 B;  2Q6A A;  1SZX A;  1WA8 B;  2IJJ A;  2ZT9 B;  2ZIM A;  3JCU Z;  4EEQ A;  1PD3 A;  2YID A;  2F4V O;  3K06 A;  3ASN C;  1M1K W;  3LNN A;  2BTQ B;  4QGP A;  3QO5 A;  3LSS A;  5E1A C;  4UCO A;  1JA8 A;  2QDO A;  5C93 A;  4NXN O;  5HFM A;  3AK1 A;  1VQN V;  2UXN A;  1VIB A;  4J7K A;  4IHJ A;  4EFB A;  4B3M B;  1F51 A;  1VF6 C;  4NTY A;  3HKC A;  3OGI B;  4HZ3 A;  1YJW V;  1EN6 A;  5KMG A;  1Q86 W;  1CP9 A;  4H37 A;  1BT8 A;  4H44 B;  1M90 W;  1BL8 A;  3L75 H;  4KFM A;  3OUF A;  2HHH O;  3OE7 G;  1FXK C;  4DR1 O;  4D6T H;  4F6R B;  4N21 A;  2A3Q A;  1MSD A;  3K5L A;  3J81 N;  2JK5 C;  4UCV A;  3ABM C;  2R9I A;  2OTJ V;  1DGS A;  5BR8 O;  1U97 A;  4P9O A;  2VQE O;  1OCR C;  1N36 B;  3IC7 A;  3W7T A;  2R72 A;  1BE3 H;  5KUM A;  2P4V A;  4QJF B;  2ADP A;  4DR2 B;  4JZ2 A;  4JAS A;  4WF9 V;  2WWW A;  1FAF A;  1NR7 A;  4U7N A;  2AGA A;  3E8F A;  4FK5 C;  5CB4 B;  5LOV B;  2AXT Z;  1QBZ A;  5K1P A;  3UO2 A;  3KCX A;  3H9V A;  5B1B C;  1VQ9 V;  1P4R A;  2C2A A;  2UUB O;  4NKG B;  2KKW A;  3X2Q B;  5EBM C;  1N33 B;  1AI6 A;  2LO1 A;  4P30 A;  2ITD C;  1VQ4 V;  3EVK A;  4TV9 B;  1YF2 A;  2IBZ H;  2IH1 C;  5LP6 B;  2ZE8 A;  3EXA A;  4YJ3 B;  5LA6 A;  4RAI A;  2JEU A;  5IJ9 B;  3DC6 A;  2Q4P A;  2W6J G;  5GW7 A;  3OT7 A;  4J11 A;  3D36 A;  3T4D A;  1QVF U;  4JI1 B;  1DF4 A;  4LF6 B;  1K34 A;  4B3S B;  4MS2 A;  1M57 C;  5DN6 G;  3APO A;  4DV6 O;  4QPK A;  1Y76 A;  3IGA C;  1SQQ H;  2JJ2 G;  5J2T A;  1G4Y B;  4DR5 B;  1JQ0 A;  2P67 A;  2M7W A;  3SPG A;  2UUA B;  2E76 B;  5FNV B;  1FFX A;  2GV9 A;  3UT5 B;  2QTO A;  4JI3 O;  3CME V;  3BY6 A;  3SPI A;  4HYO A;  1GTO A;  3BPZ A;  2WLM A;  5IWA B;  1Z5V A;  1SA0 B;  5FL7 G;  3M8A A;  1K33 A;  3UCS C;  2AW9 A;  4ZI7 A;  4MTO A;  4Q6G A;  3JAR A;  2RJZ A;  3CJH A;  4ZHQ B;  1MOF A;  3CE2 A;  4DRX B;  1QLN A;  3LDD A;  1LUV A;  2A06 H;  1HNZ O;  2XAF A;  1OCZ B;  4CS4 A;  1FJG B;  5KHJ A;  1R6T A;  2IM9 A;  2R9R B;  4O2A B;  3A2F A;  2YIA A;  4O4H B;  2OYQ A;  3IFX A;  2F43 G;  4GT1 A;  1D5A A;  1K3E A;  2RQ6 A;  4ICG A;  2LQT A;  3FYE B;  3ZMT A;  4P2Z A;  1NTM H;  1K97 A;  2WA3 A;  5DM6 V;  3JD1 A;  5J2U A;  1XIL A;  1HNX B;  3FYI B;  4B7K A;  1SS3 A;  3ZRW A;  3K9A A;  3KG2 A;  3RYC A;  4UB6 Z;  4WFG A;  2PI5 A;  1ZX3 A;  4UCT A;  4I50 A;  4O4J B;  4FLX A;  1BZK A;  4DR4 B;  3D8C A;  3FAV A;  1T5E A;  2PY5 A;  3T1Y O;  3W7W A;  4X64 O;  2GTA A;  4K35 A;  4JAU A;  3L74 H;  1QNM A;  1AVM A;  3VBB A;  1NVP B;  1H2M A;  4TWK A;  4FLV A;  5CN0 A;  3I5D A;  2DYR B;  3ABL C;  1K92 A;  4ASU G;  4BR6 A;  2PI4 A;  3BRC A;  3CYO A;  1RSO A;  5LHI A;  4DV7 B;  3CRR A;  1RPO A;  3JAK A;  4I9Q A;  4IIJ B;  4PI2 A;  2GHY A;  3J7A U;  4PV1 B;  1IUR A;  4J10 A;  1E1Q G;  2KB1 A;  1Q7Y W;  3K59 A;  1PL0 A;  2DYS C;  3D36 C;  2YI8 A;  3OR6 C;  4LBE C;  3W7X A;  3HKB A;  2Q0A A;  2GUZ B;  1Q43 A;  4TQD A;  1ZLZ A;  2LGQ A;  4OX9 B;  1Q8I A;  3I56 V;  3Q4H B;  1ZUQ A;  2DQ3 A;  2EIM C;  3N2G B;  2QEX V;  2XHB A;  1K4D C;  1AR5 A;  1COW G;  2WLI A;  4PJ0 Z;  2EIJ C;  1PP9 H;  4I7Z B;  4CC6 A;  3P3P A;  4AHC A;  2P22 C;  3W7U A;  4AQY B;  2Z5U A;  3K5N A;  4Z2W A;  5AG2 A;  3ZMS A;  2CH7 B;  3JAL A;  5BZB A;  3VQW A;  2A9H A;  2LJ2 A;  4P9P A;  1L0L H;  3AG4 C;  5EYP B;  3RVY A;  5B1N A;  1ARO P;  2N04 A;  4RQE A;  1RM1 C;  4X62 O;  1JFF B;  2X6C A;  1KYO F;  3CEI A;  4EKW A;  3K58 A;  1F4N A;  2HKO A;  5LHG A;  4X65 B;  4X8A A;  3L73 H;  5GON B;  1WPX A;  4BIZ A;  3E8G A;  3OTO B;  4DR3 O;  4H33 A;  2YS8 A;  3VOU A;  5EZY A;  3CXH F;  1FFT B;  3N2K A;  5C8Y A;  2EJR A;  2H8P C;  4J7J A;  3JAW B;  4R50 A;  1DLB A;  3WG7 B;  2WA4 A;  4YIP A;  2YIC A;  4DR7 O;  2HG5 C;  1GK9 A;  4J9Z B;  1KKC A;  4BWA A;  3CHX A;  5IYZ A;  4YY3 B;  1XRE A;  1NKD A;  3ML0 A;  3ZHS A;  2YI9 A;  2WLN A;  2Z3Y A;  4JI0 O;  1HR0 O;  1R3K C;  3RBZ A;  1LNQ A;  1JPX A;  3DXR A;  5JJJ B;  4X20 B;  4MTX A;  4CH4 A;  3E8B A;  1ZL8 A;  1IBM O;  3G67 A;  4FLY A;  1FKA O;  4WFE A;  2CDY A;  3STZ C;  2EIN B;  1AP5 A;  1XL6 A;  3K0G A;  4JYC A;  1AI4 A;  1NT2 B;  4GX2 A;  2BSK A;  3JD0 A;  1EN4 A;  2W0X A;  3GWK C;  4LH7 A;  5KLV H;  4DUZ O;  1GAX A;  4I5S A;  4DV3 B;  1FXK A;  3CCV V;  1MZE A;  1BHB A;  1D2D A;  3ABK C;  4UCU A;  3JSL A;  4K0K B;  1G1X B;  1XBL A;  4UFZ A;  2QWP B;  1WB7 A;  1IBK O;  4NTW A;  5LBQ A;  2Q67 A;  4DV0 O;  5H6Q A;  3RYI B;  1OCO C;  3T2M A;  4ZOL B;  3CCM V;  1HWY A;  4G28 B;  4X9Q A;  4Z1V A;  1XMQ O;  4X89 A;  1P7G A;  2NN4 A;  3UQ8 A;  2EZP A;  1QLE B;  3HKE B;  4OXS A;  2D3O W;  1GRJ A;  3MAQ A;  4LFC B;  5D5P A;  4FZ0 A;  5J9P C;  4DV5 B;  3E8H A;  1SQV H;  4K3A A;  4MW8 A;  2H94 A;  3ZHQ A;  1W2B U;  4WCE V;  3ASO C;  5CA0 B;  2ZDI A;  1VQ7 V;  4JTC B;  2M6Y A;  2FKX A;  2V4D A;  3AG2 B;  4U3J B;  1OCC B;  4JYA O;  2KG7 A;  3GVM A;  5JVD B;  2BE3 A;  1XNR B;  4JPR A;  5EK0 A;  2DMX A;  3JAS B;  1UPG A;  1AP6 A;  3QO7 A;  4GKJ B;  2P5O A;  1L0N H;  1XMO B;  3E2E A;  1PM9 A;  1H2N A;  2E5L B;  1V55 B;  4DV4 B;  2UXB O;  4KHP B;  4B08 A;  5IJ0 A;  4WFB V;  4FFB B;  5JCO C;  3KCY A;  5L3C A;  3MHS C;  3C3S A;  4MTG A;  4X1I B;  3S3X A;  1M9N A;  4NR1 A;  5CA1 B;  1MNG A;  4I0X A;  2LFS A;  4JI8 O;  2F4V B;  1WJZ A;  4YXW G;  4PA7 A;  3ZN0 A;  4AI8 A;  3IAY A;  4YJ2 A;  2Q5Z A;  2E74 B;  4IL6 Z;  2JS5 A;  5CBG A;  4RWU A;  5KHK A;  4PEL A;  5LXT B;  1N34 O;  2WLL A;  5KA6 A;  4NXN B;  3ZMV A;  5CBF A;  5IY5 B;  2YUA A;  5LYJ A;  2XAG A;  5GTI Z;  4DW1 A;  3P30 A;  1CXZ B;  1HP8 A;  3JAT B;  4MSW C;  1RPR A;  2VQF O;  4FLW A;  1W59 A;  3B2E E;  4GX0 A;  3BA9 A;  1BHA A;  4LF9 O;  3OR7 C;  4PA4 A;  3FX7 A;  5D5Q A;  5KHH A;  2HHH B;  3THO A;  1Q6H A;  5B66 Z;  3DC5 A;  4GCZ A;  2Y0I A;  3OTF A;  4DK1 A;  5JJE B;  4DR1 B;  1BMF G;  4WFH A;  1MMM A;  1H2S B;  1SKV A;  4I55 B;  5IYZ B;  1R1B A;  3B8M A;  3SPJ A;  2MW2 B;  3ZRV A;  1UFI A;  1EFR G;  5BR8 B;  2HFE C;  4L8J A;  4GZR B;  2LW1 A;  5ITZ A;  2H3O A;  2PF4 E;  4MVS A;  2UXD B;  3AK3 A;  3NXS A;  2LFR A;  1YEW A;  3SGI A;  3BHP A;  1KB9 F;  1QHT A;  2YXL A;  3RGB A;  3OD4 A;  4O4L B;  3QNE A;  4BW9 A;  4WBN B;  1L1F A;  3A8T A;  1BQZ A;  3QO8 A;  4FFK A;  5LGT A;  1G8M A;  1HW7 A;  1ENV A;  3P3N A;  2Q7G A;  5L3B A;  1NBM G;  1JJO A;  5LP6 C;  3CB2 A;  1AJP A;  2ZR3 A;  2R70 A;  3AG1 C;  3CCR V;  3FFQ A;  3RYH A;  3W7S A;  2UUB B;  3H1H H;  1GO3 F;  5CBH A;  3HKD B;  1B06 A;  3RFR A;  4FMT A;  2ZDI C;  3HPL C;  4E2L A;  2UU9 O;  1FS0 G;  1AJN A;  4FZ1 A;  2FYU H;  4JYY A;  4H13 B;  1WN7 A;  3CWB H;  3QF7 A;  4LFA O;  1OCR B;  4TV8 B;  1ORQ C;  5B5E Z;  2YEV B;  2CAZ C;  1ZAU A;  2JGD B;  1B04 A;  4R7C A;  1SQX H;  2L6L A;  2QWO B;  2ZKO A;  1M56 C;  1F7Y A;  1WB8 A;  4F6E A;  2P90 A;  4I4T B;  4X66 O;  4X1Y A;  2JS3 A;  4DV6 B;  2Y69 C;  2LW7 A;  2Q7E A;  1BSM A;  1I0H A;  5LGU A;  1F4M A;  4JI5 O;  3OEH G;  2V7Q G;  2ZE5 A;  1S72 V;  5JH7 B;  2IJK A;  3HB3 B;  1IX9 A;  1SER A;  1DTO A;  5L3D A;  1WP7 A;  4IYH A;  4U7O A;  1Q82 W;  4UXN A;  1S5H C;  4B7E A;  3I55 V;  4BIO A;  2P6J A;  4TUY A;  3CC4 V;  1HNW O;  2Q0O C;  3VQV A;  5TIS Z;  2VS0 A;  3C3T A;  4JYB A;  1A32 A;  5H2F Z;  1YTF D;  4MVO A;  3SR2 C;  3K3W A;  4EB6 B;  1AIL A;  1PKX A;  4NYK A;  1HNZ B;  1N0J A;  1P49 A;  5JQG B;  4LF7 O;  3LNM B;  3S3W A;  1BCC H;  4X1K A;  4O4I B;  4KXR A;  2XT9 A;  1N8R W;  1M93 A;  1KQS U;  4OGQ B;  5LMN O;  2PTM A;  4IYI A;  3CC7 V;  2LGW A;  3TK1 A;  1PNM A;  3QTC A;  4LF8 O;  3ZJZ A;  5BY1 A;  4FM2 A;  3E22 A;  3K57 A;  2ZXW C;  4NTX A;  5DEC A;  2N74 A;  4DR6 O;  3P32 A;  4GKK O;  5LMU O;  2RNB A;  4QIW F;  4LNU A;  2QE7 G;  1W0J G;  3SYQ A;  2BOB C;  2A0L A;  4IHJ B;  5KHG A;  2WLJ A;  4FM0 A;  3HKC B;  3MHH C;  3T1Y B;  4X64 B;  5KMG B;  3OFN G;  4F4L A;  4LWS A;  2CGO A;  3FKS G;  1NTK H;  2JRI A;  2EJ7 A;  1K7D A;  3L9D A;  3G71 V;  2N05 A;  4UVC A;  1E79 G;  3O65 A;  5EIB C;  4HAM A;  2XAS A;  1WNS A;  3CRC A;  3DGE A;  1K4C C;  1H8H G;  5KA5 A;  1TUB A;  3PJS K;  1Y66 A;  5JJN B;  1XOU A;  3U11 A;  4AIL C;  4CC5 A;  3IJ4 A;  2WPD G;  1R6K A;  2ZM6 B;  3UO3 A;  1JOY A;  5KUK A;  2WSS G;  1SQP H;  1GKF A;  2HVJ C;  2HJD A;  3CD6 V;  4JTD B;  2QKA A;  1GM8 A;  1PNL A;  5KX5 A;  4LF4 B;  3RT3 C;  4QNH B;  2EIL C;  4UVA A;  1TAE A;  4CH6 A;  2UXC O;  4MVU A;  1MG1 A;  5EBW C;  3ZHV A;  1GN3 A;  3E83 A;  4B3T O;  3BFR A;  1ROP A;  2EBO A;  2EUL A;  2PUS A;  3KZI Z;  2E75 B;  2XAQ A;  3AG3 B;  1Q81 W;  3TGU H;  5B1A C;  3RYF A;  5B3S C;  3CCJ V;  3B40 A;  2QGN A;  2ZIN A;  5L3E A;  3A0R A;  3CCE V;  3DTU B;  2IW5 A;  4R6Z A;  4K8X A;  3ABL B;  1K8A W;  1XUQ A;  3CPW U;  1GM7 A;  2CTW A;  4KP4 A;  1JMK C;  2FTK A;  2IH3 C;  2IJH A;  3F5T A;  1KP3 A;  3K0D A;  4UUJ C;  5LA6 B;  1N32 O;  5JWP A;  2ZE6 A;  1KC8 W;  3T1H O;  1TVK A;  1I94 B;  4N23 A;  3ZMU A;  4PHZ A;  4MVR A;  3OMI B;  4X62 B;  4PA9 A;  4HNA A;  1AR4 A;  2XAH A;  4LF5 O;  5BMV A;  3WG7 C;  3K79 A;  3ZMZ A;  1CEZ A;  1Y76 B;  3ABU A;  5J2T B;  2G38 A;  3ICX A;  1ZWI C;  2FL4 A;  1FFX B;  1SQB H;  3H1K H;  4DR3 B;  1M4U A;  4J7Z A;  4YHH O;  1XHZ A;  5H6R A;  4RUF A;  1Q6I A;  1WA8 A;  1SES A;  2EIJ B;  2QM8 A;  1TUE B;  3EHB B;  2NNU A;  4DR7 B;  2BTQ A;  5CMU A;  3D3I A;  2YXH A;  4L87 A;  4B3R O;  5JCO A;  1VQ8 V;  3ZIA G;  1OZ0 A;  3M7M X;  1S77 D;  1KD1 W;  3BAA A;  1S0V A; 
#chains in the Genus database with same CATH homology
 1XOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...