1XOUA

Crystal structure of the cesa-espa complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
72
Chain Sequence
b'DVIDLFNKLGVFQAAILMFAYMYQAQSDLNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspA
publication title Structural characterization of a type III secretion system filament protein in complex with its chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
total genus 23
structure length 72
sequence length 160
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03433 EspA EspA-like secreted protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1140 Mainly Alpha Orthogonal Bundle Helix Hairpins EspA/CesA-like 1xouA00
1XOUA
chains in the Genus database with same CATH superfamily
3RFRA 1SS3A 3KCXA 1QVFU 1XHZA 2GSMB 4DV1O 1P7BA 4LCUC 1Q3EA 2XAGA 2JDIG 4DW0A 2QEXV 2UXDO 4LF9B 1GM7A 1YJWV 1I7FA 1FS0G 1M93A 2EULA 5EBLC 5LMUO 5B3SC 2AGAA 2EIMC 2X6BA 4FK5C 1BQZA 3TXQA 1NVPD 4I0XB 4QIWF 1N8RW 3K5OA 1KYOF 4J42A 1XNQO 3P3PA 4C7UA 1X59A 1H8EG 2X0LA 2BOBC 4ABMA 1F4NA 2XAFA 4YY3O 3ABUA 4LNUB 3AG1C 2KQXA 1BCCH 3RVZA 1EM1A 2UUAO 2WLIB 4LF4O 4H37A 2QE7G 5CB4A 3APOA 4KUMA 4CS2A 3ZX6A 1JVMA 1XL6A 4E2LA 1EZVH 1HDJA 4JASA 1GK9A 2P4KA 3VQVA 4RAIA 2Q6AA 2QTOA 3JARB 2YIBA 3KG2A 4DUYO 2ZE8A 1G8MA 2ZNIA 3K5MA 3ASOB 4LP8A 4IIJB 2JVDA 5LMNO 4R8CA 2V1DA 2M7WA 4YJ2B 1P49A 4YHHB 3CYOA 3CRCA 3D36A 2W6IG 1SA0A 2MW2B 3CB2A 5L3EA 1QLEC 3DXRB 4FVMA 4FFBB 3K58A 4JI8B 4P9PA 5LOVA 1YI2V 3H1JH 5BZBA 5IJ9B 5BXZA 1Y76A 3IAYA 2FL4A 3G67A 3RYIB 2QKAA 4J9YB 2P22C 3BABA 1KP2A 5CBHA 1IZ3A 4U7OA 1BHAA 2Q4PA 3LUTB 3E83A 1VQKV 2F23A 3OGIB 3SYOA 2YSUB 1GTOA 1ZTEA 3IC9A 3RT3C 3STLC 2ZIOA 3F7VC 3UO2A 5IWAB 5D5PA 2E3CA 2N04A 4ZI7B 2WWWA 1BGYH 4DV3B 1IURA 2VWJA 2QWOB 4IYIA 1AROP 4CC6A 3GWOA 3MHSC 5CA1A 2VQFO 1DTOA 3JAMN 4DK0A 3D3QA 1M9NA 4NXMB 1AP6A 3J81N 4NVPA 1YJNV 4N21A 3UT5B 3CS5A 4I55A 4MTXA 4JV5B 4O4HB 3KZIZ 4IGGA 2JIZG 4D6TH 2YEVA 2ZM6B 1MA1A 4GZRB 2JJ2G 4QPJA 1AP5A 4GKJB 4PA7A 5DM6V 4UVBA 3LNMB 3QTCA 3E8HA 1ZSPA 1M57B 2EIMB 1H2KA 3CRMA 2HVJC 2LFSA 4TQDA 1XEQA 4GX1A 3T1YO 1KBHA 1YJ9V 4TWKA 1YTFB 3K79A 1S3JA 1XMQO 1MNGA 4JAAA 5JJJB 2XAJA 3CC7V 1XOUA 2IU0A 4WFAV 1H2MA 3LSQA 3L71H 3J7AU 1FJGB 3OW2U 3WG7C 1TAEA 3RVYA 1JCHA 1EFRG 3AK1A 4X89A 2ADQB 3LDEA 5CB4B 5J2UA 2ARHA 5L3BA 5EC2C 4DR4B 2IJIA 4LF8O 2Y0IA 1XDCA 3CHXA 1S76D 2EIKC 4MTFA 2PI5A 4RQEA 3PJSK 3E8GA 3CRRA 3B2EE 1WB8A 3BFRA 1NTKH 3Q4HB 4DV7B 1H38A 3EFFK 4U3JA 3L9DA 3MD0A 1R3LC 4X65B 3GWKC 5IYCO 1GKFA 1KB9F 1PL0A 5EZYA 1N32B 4A5UB 1Z5WA 3CMAV 1S5LZ 3ZS8C 4O4LA 2AZ2A 2LFRA 3SYAA 3JAWA 1OHHG 1SA0B 3OGCC 3E2EA 4PV1B 3ASNC 1M56C 3SJQC 5FL7G 3OR6C 5LOVB 1DF5A 1XMOB 4JI5O 4DUZO 1NVPB 1Y76B 1H8HG 4F6EA 4DV2O 2F66C 2EIJB 3A0BZ 3CC4V 4JI0B 4FM0A 2WLJA 3ETQA 5IDJA 1YXBA 4UXNA 2ADPA 1VQ4V 4UFZA 5K1XA 1AB3A 2ZR3A 4BWAA 4UB6Z 1OCZC 4ZHQA 4X66O 4K8ZA 3JASA 3HKDB 1G1XB 2LW7A 3FAVA 3BEHA 4IHJA 1UFIA 1COWG 2PYLA 2Y69B 4XBFA 5B1AB 2OTLV 4NXNO 4LF7B 4MT8A 1YCIA 5CA1B 4I50A 2ZR2A 3H1KH 3JD0A 4P30A 2UXCB 4X9QA 2E5LB 4X20A 4I55B 3HB3B 3RBZA 2BOCC 4NTYA 4JF3A 5F2VO 2YEVB 4KHPO 3CEIA 1V55C 2XAHA 1VARA 2LJ2A 1F4MA 2WSSG 3A0HZ 5KMGA 1NZ6A 2D3OW 2DMXA 5H5NA 4GUNA 3E22B 1YIJV 1UJWB 5LP6B 4FLVA 1WA8A 2P5OA 1Q86W 3FKSG 3G80A 1N33B 1DGSA 2CTWA 1XBLA 1K73W 4B3SB 4FZ1A 1VQ8V 1B04A 3M7MX 3G71V 2Q7GA 5L3FA 2XUMA 1IBLB 2E76B 3C3SA 4LFCB 4EEQA 2QKSA 4DV6O 2DJVA 3CP1A 4JI1B 1VQOV 4PA9A 1DK1A 3W7TA 1AJQA 2WLHA 3AK3A 4LFBO 2WLNA 2EIKB 4UCRA 5EC1C 1KUQA 3X2QB 3GB7C 4RUEA 3W7XA 4MVOA 1R3KC 4J11A 1NH2D 2LGQA 2JGDB 5HFMA 2UXDB 1GRJA 3A2FA 4Q20A 2XOKG 4U3JB 3CCEV 5IYDO 4CH5A 3N2KB 3ML0A 2UU9O 4AI8A 3SJAC 1Y66A 5EZYB 4OGQB 5CBGA 1MZFA 3OD4A 1M90W 4LFAB 4O4LB 3ASNB 2PI4A 4YY3B 3JAWB 1K34A 1Y74A 5IT9N 3FB6C 2HHHB 4QPKA 3OTOB 4K0KO 5KA5A 4LF4B 1SQPH 2UXBO 1K7DA 3LSSA 3IGAC 1QBZA 2R9AA 5KLVH 3ABLB 5KHIA 2A7WA 4KFMA 2GTAA 4DR2O 1RP3B 4YXWG 2JEUA 1WPBA 3FYEB 2QJ1A 3DC5A 1GN3A 4H13B 5LGUA 4PI2A 3ZHRA 1L0LH 1ENVA 4PDLA 5JCOA 1TUBA 4ZHQB 1E1RG 1BMFG 3JASB 3W7WA 4UV8A 2Q69A 3FAVB 4IHJB 3E89A 5JCOC 5D5QA 2E74B 1N34B 5EBWC 3CXHF 2BCCH 4I50B 1CPYA 1V9PA 2PZSA 2QM8A 1V55B 4JYYA 3L70H 4X20B 5KUMA 4IIJA 5FPRA 5BR8O 5B5EZ 1SQFA 3ZCCA 4YJ2A 1QLNA 3ASOC 4DYLA 4R7CA 3E8BA 1CXZB 5GW7A 1ORQC 2CUGA 3OEEG 4CBCA 5KMGB 1VF5B 3OMNB 4MTGA 4BW9A 3DXRA 3H1IH 2YIAA 4KXRA 3T4ZA 2L35A 3CCLV 1R1BA 2DOSA 3APQA 4DO2A 1WA8B 1RSOA 3FB5C 2XHBA 1KC8W 2DYSB 1W59A 3G4SV 3L74H 3JATA 3K9AA 2PYJA 3WFVA 4MS2A 1JPXA 2ZE6A 1MSWD 5BMVA 1Z2GA 3THOA 4X1KA 3UKMA 3ZMSA 4WF9V 1KD1W 3SPHA 2ZIMA 2CTPA 2EBOA 3AG4B 1WNSA 1Q6HA 4DV4O 1EBOA 3ZRWB 2GTSA 4JI2O 2L6LA 3FYIB 3U0ZA 2IH3C 4UCTA 2V7QG 3DSQA 2H8PC 5EIBD 4X64B 1KECA 1Y4MA 1AI4A 2VWKA 3VQWA 3FB7C 4J80A 3RYFA 2JS3A 3SJCC 4JI6B 5JJNB 4X1IA 3JD1A 1K33A 3T1YB 4EB6A 1HNWO 1LR1A 3SYCA 1HW7A 2IJHA 5IYZA 3ZN1A 1M1KW 1XMQB 3K0GA 4UCVA 1VIBA 5KHJA 2Q68A 5H2FZ 2F43G 3GVMA 4AHCA 2BE3A 1Y74B 3W7SA 2O57A 1KQSU 2P06A 5FLXN 4WFFA 1TA8A 1M57C 3S3XA 1BZKA 4DR1O 1M5IA 4LF8B 4JI7O 4WFGA 2CGNA 2FMLA 4QE7A 2Q0OC 2C2AA 2PTMA 2ITCC 2LW1A 4B3MO 1S77D 3MDSA 1VQPV 1TUBB 4NTWA 1W0JG 1NH2B 4JYAO 1PM9A 1BE3H 5EIBC 1Q81W 3RGBA 1B3QA 5HFLA 1PNKA 1GMGA 2B5UA 4DR5O 3Q4HA 1K92A 4PI0A 4BR6A 4JI5B 4DUZB 3ABTA 1HNXB 4PA6A 3ZIAG 1I0HA 4UUJC 3HKCA 4WFEA 2EJRA 1FPOA 3VQYA 3WB0A 4JI3O 4O2AA 4G2KA 4JTAB 1FYJA 4DV0O 1IXBA 3D36C 1RSOB 2ZNJA 3AEIA 1I5XA 3JATB 2DE0X 1NTMH 2AW9A 5B66Z 5BMVB 2EZOA 4X1KB 2F4VO 2EIJC 2QWQB 3K5LA 1AI7A 3DC6A 4CS4A 3S3WA 2IJJA 2N74A 4B7KA 4LF5O 4Z1MG 1S5JA 2LP7A 4O4JA 3ZMVA 3MHHC 1J5EO 1YZBA 3HKDA 2Q67A 1FXHA 2XAQA 1VF7A 3JYCA 3KKYA 4GKKO 4F4LA 3RYFB 1TGOA 5ITZB 3R65A 3W7UA 2Y69C 1AJPA 1XNRB 2YICA 1B06A 4X1IB 5B1AC 1T5EA 4EB6B 5IYZB 4ZBMA 4DV5B 1SKVA 1PP9H 2JK5C 3RW0A 1US6A 1JOYA 4UVCA 5LL6Y 4DV6B 4RO2A 5DECA 5GONA 2F1MA 2NLJC 2QR4A 1VQLV 3E22A 2P7TC 1XI1A 5LP6A 1ZWIC 2AHZA 2Z3YA 4DR6B 4LFBB 1HR0O 1NTZH 3OAAG 4HYOA 1B6QA 2UUBO 3CMEV 3JSLA 5LP6C 5KHGA 1VQ7V 1VQ9V 2VS0A 4W4LA 1QCEA 2ODMA 1I94O 1Q90D 1H2NA 2IW5A 2YXYA 3SPCA 4JI4O 4R6ZA 3WB1A 1KMIZ 4IL6Z 3TETA 4UCSA 4B3TB 2UU9B 5C93A 3ETGA 4AQYB 2H94A 2FYUH 2B1GA 4CZZA 5FPOA 2ETNA 1N36B 2RJZA 3SYPA 2ZCEA 2QTSA 2WA3A 3X2QC 4LF9O 4B3RB 2JGDA 3ABMB 5EK0A 4DR7B 3H1HH 5K1PA 1SQVH 1RPOA 1R6NA 1FXKA 3RYHA 2QKCA 4W4KA 1BL8A 3N2KA 3LDCA 1K5SA 1R3IC 2OCCB 3O65A 3ETEA 1PD3A 1PL4A 3ZN0A 1Y6XA 3HKCB 3CCRV 1GH6A 1JX9A 3BPZA 4O2AB 3FX7A 3L72H 4GT1A 2YXHA 1NQTA 2YC0A 1VEWA 4B7EA 1U96A 4WFBV 4PDRA 2Y4TA 1VQMV 3SR2C 2Y0PA 2RQ6A 3OEHG 4YJ3A 1Q6UA 4NTXA 3LNNA 4J10A 1NR7A 1Q8IA 2AHYA 3ABLC 2EILB 4JPRA 3ZMZA 5E79Z 3CX5F 3IJ4A 5A9GA 1PKXA 2QA4V 2ZKOA 1P7GA 3ZRXA 1YVWA 2W0FC 4O4JB 2UUCO 1XUQA 3H1LH 5LHHA 4YHHO 5GTIZ 4PA4A 2M6YA 1AJNA 4PHZA 4JI8O 4J7JA 4HBNA 1H2GA 1VQ5V 1S5HC 2KKWA 2RN9A 1BT8A 3HKEA 4JAUA 4IYHA 2ZQMA 1SERA 4NB5A 3BRCA 2JRIA 3CRQA 4LR3A 3P3NA 5JWPA 5GONB 4TV9A 2VQEO 3A8TA 4K35A 4DV4B 4X62B 5C8YB 1FAFA 1XHXA 2CTQA 4UV9A 3CCVV 1G6UA 2IJKA 1X4TA 3AG2B 2EJ7A 3IC7A 2HEPA 4GCZA 2DYSC 1K9MW 2F93B 5KX5B 3I55V 4Q6GA 1WN7A 1IBKB 4MW8A 2JEXA 2RCVA 1HNZB 1SF9A 1W0KG 5KHHA 1ZX3A 2ILMA 4MVRA 3ZRWA 5CA0B 3OM3B 2ZM6O 2OYQA 1V54C 4JYCA 2AXTZ 3ZRVA 3AG4C 1I08A 1ZL8A 4FZ0A 1RFYA 4DV1B 1Q43A 1O9HA 2OT5A 4PDMA 3M99B 1ZLZA 3AG7A 2JGUA 1HWYA 5L3GA 4JTCB 1VF6A 1FXKB 5LMUB 3RYHB 2ATKC 4DR1B 3K3WA 2X6CA 3SGIA 2HG5C 3WB2A 1IVSA 1PPJH 5H6QA 1NT2B 1XNQB 1VF6C 3T1CA 1SC5B 2CAZC 1OCOB 1OCRC 3L75H 1NU1H 2XNDG 3UM7A 1YF2A 3UQ8A 1XILA 2P4VA 1SQXH 3P32A 4I4TA 2UUAB 1DF4A 2CH7A 4DR4O 1GAXA 1H2SB 4KP4A 3JCZA 1K5QA 2ZINA 4YJ3B 1MG1A 3LDDA 4ZKIA 2HKOA 1SRYA 1R6TA 2QM4A 3B40A 4HZ3A 4I5SA 3CRAA 3VOUA 4X65O 1K4CC 4DUYB 4H33A 3JD3A 2X6AA 5LMNB 4LF6O 2GUZB 3JD4A 4QJFB 3J80N 4JI3B 2HR3A 5B1BB 4LH7A 2DW4A 1XMOO 4MVUA 3DGEA 2HVKC 1Q7YW 1YEWA 1EZJA 2ZT9B 2EINC 1JFFA 3D8CA 4H0LB 2WLLB 5JVDA 3U11A 5KHKA 4BIZA 3HKEB 2KG7A 3JCUZ 2ZXWB 3L73H 4UCOA 3BAAA 4X8AA 3MAQA 1KU9A 2FTKA 4JI0O 2QDOA 5J2TB 1TVKA 2F4VB 1GN2A 2YIDA 4TV9B 3QO8A 3OFNG 1E1QG 4PELA 3OMIB 3ZHSA 2NR5A 1DLBA 4FJCC 3LSUA 3CXCU 2ZDIA 2YS8A 2AZ0A 1N0NA 3T1HO 1QR9A 3BVOA 2FKXA 3SDLA 4Z1VA 2PUSA 2UXNA 4EKWA 2HP8A 2OWOA 5LHIA 2VQFB 3K57A 1JMKC 3OMAB 1ZAUA 4FPPA 1FD9A 1V54B 2E5LO 2R9RB 3T4DA 3SJBC 1PNLA 2CTRA 5B1OA 3ZRSA 3K06A 2DWDC 4GX5A 4LH6A 1ZL8B 3HR0A 1IXMA 1Y67A 4K8XA 3K9SA 3TXSA 5IY5B 2G38A 1MMMA 1FKAO 2DQ0A 5ITZA 3QVNA 4LC1A 1Q82W 3NR7A 4DR3O 3JALA 2P6JA 3BCCH 1N33O 2Y4UA 4JAVA 1R73A 1OCRB 2R72A 1CEZA 2UUBB 1J95A 2F95B 3CCJV 2YXLA 2UXXA 4LFCO 3T2MA 5KAFZ 3BA8A 3CCSV 1GN4A 4J7KA 3ZMTA 2KSDA 4JI1O 3ZHUA 4EFBA 4GLXA 2QSAA 3E8FA 2YIBD 1WLEA 4I4TB 5IYBO 3C3TA 3CJHA 5B1NA 3K08A 2D2CB 4WBNA 2CH7B 5CN0A 2BSKB 1OJHA 5FNVA 3G6BA 5LGNA 5DEDA 2W6JG 4FMTA 4DW1A 3AG3C 4FLYA 1EN4A 3FB8C 2DYRB 2Y48A 1U97A 3WU2Z 1F23A 1H2LA 1ZUQA 1I5YA 2Q5ZA 3QF7A 1WP7A 4CH6A 2ZE5A 2QWRB 3C90A 1BSMA 1AVMA 1A32A 4FLWA 1QR8A 2WLKA 2YI8A 4Z2WA 1D2DA 1R3JC 1Q6IA 4LFAO 1QU7A 2QGNA 5EYPA 2IM9A 2K1EA 4ZOLA 4ZIBA 1GN6A 2DN9A 5TISZ 2HHHO 5J9PC 2EINB 2BTOA 3OTOO 1NJIW 3NXSA 3ABMC 2YDEA 4DV2B 1JFFB 1OCCB 5JVDB 2IU3A 3OE7G 3TK1A 2KG7B 5KAIZ 1JR9A 5CMUA 4OPHA 3E35A 1IBMO 1TVKB 4QE9A 2OCCC 4TUYA 1Z5VA 2XTAA 3RYCA 4JZ2A 4O4IA 4OXSA 1L1FA 1YSCA 4MW3A 2QWPB 4LWSB 4FM2A 3H9VA 3B8MA 4DK1A 2ZE7A 3BY6A 4X66B 2UUCB 4BAYA 1EN6A 4JYBA 3CSXA 1YDXA 1EN5A 1N34O 1RM1B 2DQ3A 3F5WC 4NXNB 4O2BB 1PNMA 3JAKA 2EILC 3OUSA 5LYJA 3TJTA 2JS5A 3IFXA 2A9HA 3PN1A 4KHPB 3EXAA 3AK2A 3JD2A 1IDSA 4FLZA 2ZD9A 4OX9O 3CCUV 2X7RB 1YHQV 4F6RA 2PF4E 2VQEB 3JALB 3ETDA 2FB5A 1YITV 2DWEC 1K97A 2Z0AA 3OT7A 5H6RA 2Q7EA 1VMGA 4FLTA 2P67A 4UCUA 2Q8VA 1BS3A 2RNBA 2HLDG 1HP8A 1P84F 3CWBH 3RN4A 1QQCA 1ROPA 3CJHB 3I56V 5JQGA 2PY5A 1BQ0A 4WBNB 3AG3B 5C8YA 5CA3A 1P4RA 4WCEV 4X88A 4XDLA 4TSFG 5FNVB 4X64O 4G28B 1SQGA 2A3QA 3CD6V 5LGTA 1AR4A 5B3SB 2ITDC 3QNEA 1AI6A 5KX5A 4JI6O 3AG2C 2HFEC 1CP9A 2MK3A 3K5NA 4G27B 3ZEDA 5LA6A 3TCUA 1OZ0A 1QVGU 1NKDA 1L8DA 2XT9A 2HJFC 5CA0A 1KKCA 4TT3G 3AG1B 2JJ1G 1RPRA 3M8AA 3N2GA 1K3EA 5EYPB 5KA6A 2A79B 4ZOLB 1AILA 3K04A 1NR1A 3STZC 2CDYA 3I5DA 2WAMA 4K3AA 2WLMA 4K0KB 3HKBA 2UXBB 1TUEB 2WPDG 4MTOA 3OUFA 5IJ0A 1FXKC 2W0XA 3ZMUA 1S0VA 2CGOA 1IX9A 4DR2B 1OV9A 4BW5A 2Q7HA 4TUYB 3RYCB 3P30A 4O4IB 1R6KA 2GBOA 2OIGA 2RDCA 2QM7A 3K59A 1OCOC 2Q9LA 3H01A 3CC2V 1VQNV 4J7ZA 1M4UA 3BHPA 4L87A 4LF6B 1QLEB 4PA3A 5LXTA 1S72V 3SYQA 4FM1A 4PJ0Z 3VQXA 3SPJA 2KB1A 1MSDA 1WPXA 2BTQA 5CBFA 3B09A 2GV9A 5BY1A 4FIPC 3JAKB 1HNXO 4IT5A 1F51A 5LYJB 3ABKC 2Q0AA 5BR8B 2Q73A 3D3IA 1SETA 2GUZA 3F7YC 3CE2A 1UPGA 4X1YA 4NR1A 1NBMG 1L0NH 1N4CA 3QO7A 5AG2A 4FLXA 4F6RB 4HNAA 3FD9A 3HPLC 5EBMC 1N0JA 3R66A 1KP3A 5B1BC 4PDVA 5E1AC 2WLLA 3ICXA 1LUVA 1FFTB 1LNQA 3T1HB 1XQ8A 4DRXA 2B9ZA 2LGWA 4J9ZB 5J2TA 4CH3A 4I9QA 3U10A 4B08A 2ZXWC 2RMKB 4GYCB 4RWUA 5JQGB 5IWAO 3JSNA 4CS3A 1GM9A 4JI2B 3F5TA 4PD4F 4JTDB 4DV3O 2N05A 2OTJV 1WAZA 2IBZH 2YI9A 4E4EA 4TV8A 3G6EV 4NXMO 4CC5A 2A06H 4JZGA 3DTUB 1XNRO 1JJOA 1WP8A 3B77A 4DR3B 2EZPA 1FFXA 5LA6B 3EHBB 4JV5O 1JJ2U 4QNHB 4D7SA 4JGSA 1HNWB 1QHTA 1THZA 1MZEA 4DV5O 2Z5UA 4GX0A 5GTHZ 2R9IA 3N2GB 2B1IA 1PV0A 4GKJO 4XDJA 4CH4A 3WG7B 3ZBHA 4MSWC 3K03A 2PGGA 1GM8A 1D5AA 4YIPA 5A2QN 4P9OA 1G4YB 1F7YA 2NNUA 5LHGA 3OTFA 1AR5A 2K9PA 2OIEA 5IY5C 4DR6O 2NN4A 3HKBB 4R50A 5J2UB 5DN6G 5LBQA 4QGPA 2WA4A 5IJ0B 4JI7B 4NYKA 3BA9A 2GHYA 2V4DA 2R70A 3ZHTA 4TQFA 1SZXA 1FJGO 4B3MB 5IE9A 1K4DC 2A0LA 5JH7A 4B3TO 3KCYA 3UO3A 2BSKA 2P90A 4AQYO 4TOIA 2QWNB 1AR1B 1N36O 1M56B 5LXTB 4RQFA 4JYAB 4B3RO 3A0RA 4DR7O 4FFKA 4AILC 4ASUG 1D5NA 3EVKA 3SPGA 3ABKB 3K0DA 4DV7O 4DR5B 2BTQB 2DYRC 4I0XA 3VBBA 3ZJZA 1FXVA 1N32O 2VRZA 4UVAA 4LBEC 1SQQH 1MOFA 4U3FH 1IBMB 4LNUA 4X1YB 4I7ZB 1OCZB 1JQ0A 4DV0B 1SZTA 2WLIA 4HNAB 3RWRD 2GDSA 5L3CA 4BIOA 3CCMV 3E86A 4FLUA 3CCQV 3CPWU 4EFEA 1JA8A 3QO5A 2LQTA 4DRXB 1OCCC 1SQBH 1SESA 2H3OA 2IH1C 3JARA 4N23A 1LUWA 2HJDA 3B4SA 4GX2A 3ZHQA 4NKGB 4ICGA 4WFHA 1VQ6V 3TGUH 2YUAA 3QG5A 4U7NA 4XDKA 5L3DA 4LWSA 1WB7A 4MVQA 4YIOA 1VP7A 3FFQA 4LF5B 1URFA 3ZHVA 1WJZA 4RUFA 1J5EB 4I9WA 2EX3A 4MVSA 2ZDIC 2CK3G 4OX9B 2CE4A 4LF7O 4TV8B 4BIUA 4HAMA 4GKKB 4O2BA 4FFBA 1BHBA 2OCHA 4MVMA 1O9GA 1XREA 1KKDA 3N27A 2UXCO 5IJ9A 2E75B 1FFXB 1RM1C 3RYIA 4L8JA 1YTFD 3OR7C 4D7TA 1AI5A 4DXWA 4H44B 1XL4A 4P2ZA 1W2BU 2LO1A 1NS1A 4MVZA 1MABG 1QNMA 4X62O 4OPAA 1HR0B 4UB8Z 1E79G 4ZI7A 3UCSC 4KL1A 4B3SO 5H9CA 1GO3F 1IBLO 3SPIA 4J41A 1I94B 1Q5OA 1IBKO 1HNZO 3B8NA 2XASA 5KUKA 4JI4B 1NI8A 3UT5A 4O4HA 5JJEB 5JH7B 3O9OA 1K8AW
chains in the Genus database with same CATH topology
1XOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOU A; 
#chains in the Genus database with same CATH topology
 3RFR A;  1SS3 A;  3KCX A;  1QVF U;  1XHZ A;  2GSM B;  4DV1 O;  1P7B A;  4LCU C;  1Q3E A;  2XAG A;  2JDI G;  4DW0 A;  2QEX V;  2UXD O;  4LF9 B;  1GM7 A;  1YJW V;  1I7F A;  1FS0 G;  1M93 A;  2EUL A;  5EBL C;  5LMU O;  5B3S C;  2AGA A;  2EIM C;  2X6B A;  4FK5 C;  1BQZ A;  3TXQ A;  1NVP D;  4I0X B;  4QIW F;  1N8R W;  3K5O A;  1KYO F;  4J42 A;  1XNQ O;  3P3P A;  4C7U A;  1X59 A;  1H8E G;  2X0L A;  2BOB C;  4ABM A;  1F4N A;  2XAF A;  4YY3 O;  3ABU A;  4LNU B;  3AG1 C;  2KQX A;  1BCC H;  3RVZ A;  1EM1 A;  2UUA O;  2WLI B;  4LF4 O;  4H37 A;  2QE7 G;  5CB4 A;  3APO A;  4KUM A;  4CS2 A;  3ZX6 A;  1JVM A;  1XL6 A;  4E2L A;  1EZV H;  1HDJ A;  4JAS A;  1GK9 A;  2P4K A;  3VQV A;  4RAI A;  2Q6A A;  2QTO A;  3JAR B;  2YIB A;  3KG2 A;  4DUY O;  2ZE8 A;  1G8M A;  2ZNI A;  3K5M A;  3ASO B;  4LP8 A;  4IIJ B;  2JVD A;  5LMN O;  4R8C A;  2V1D A;  2M7W A;  4YJ2 B;  1P49 A;  4YHH B;  3CYO A;  3CRC A;  3D36 A;  2W6I G;  1SA0 A;  2MW2 B;  3CB2 A;  5L3E A;  1QLE C;  3DXR B;  4FVM A;  4FFB B;  3K58 A;  4JI8 B;  4P9P A;  5LOV A;  1YI2 V;  3H1J H;  5BZB A;  5IJ9 B;  5BXZ A;  1Y76 A;  3IAY A;  2FL4 A;  3G67 A;  3RYI B;  2QKA A;  4J9Y B;  2P22 C;  3BAB A;  1KP2 A;  5CBH A;  1IZ3 A;  4U7O A;  1BHA A;  2Q4P A;  3LUT B;  3E83 A;  1VQK V;  2F23 A;  3OGI B;  3SYO A;  2YSU B;  1GTO A;  1ZTE A;  3IC9 A;  3RT3 C;  3STL C;  2ZIO A;  3F7V C;  3UO2 A;  5IWA B;  5D5P A;  2E3C A;  2N04 A;  4ZI7 B;  2WWW A;  1BGY H;  4DV3 B;  1IUR A;  2VWJ A;  2QWO B;  4IYI A;  1ARO P;  4CC6 A;  3GWO A;  3MHS C;  5CA1 A;  2VQF O;  1DTO A;  3JAM N;  4DK0 A;  3D3Q A;  1M9N A;  4NXM B;  1AP6 A;  3J81 N;  4NVP A;  1YJN V;  4N21 A;  3UT5 B;  3CS5 A;  4I55 A;  4MTX A;  4JV5 B;  4O4H B;  3KZI Z;  4IGG A;  2JIZ G;  4D6T H;  2YEV A;  2ZM6 B;  1MA1 A;  4GZR B;  2JJ2 G;  4QPJ A;  1AP5 A;  4GKJ B;  4PA7 A;  5DM6 V;  4UVB A;  3LNM B;  3QTC A;  3E8H A;  1ZSP A;  1M57 B;  2EIM B;  1H2K A;  3CRM A;  2HVJ C;  2LFS A;  4TQD A;  1XEQ A;  4GX1 A;  3T1Y O;  1KBH A;  1YJ9 V;  4TWK A;  1YTF B;  3K79 A;  1S3J A;  1XMQ O;  1MNG A;  4JAA A;  5JJJ B;  2XAJ A;  3CC7 V;  1XOU A;  2IU0 A;  4WFA V;  1H2M A;  3LSQ A;  3L71 H;  3J7A U;  1FJG B;  3OW2 U;  3WG7 C;  1TAE A;  3RVY A;  1JCH A;  1EFR G;  3AK1 A;  4X89 A;  2ADQ B;  3LDE A;  5CB4 B;  5J2U A;  2ARH A;  5L3B A;  5EC2 C;  4DR4 B;  2IJI A;  4LF8 O;  2Y0I A;  1XDC A;  3CHX A;  1S76 D;  2EIK C;  4MTF A;  2PI5 A;  4RQE A;  3PJS K;  3E8G A;  3CRR A;  3B2E E;  1WB8 A;  3BFR A;  1NTK H;  3Q4H B;  4DV7 B;  1H38 A;  3EFF K;  4U3J A;  3L9D A;  3MD0 A;  1R3L C;  4X65 B;  3GWK C;  5IYC O;  1GKF A;  1KB9 F;  1PL0 A;  5EZY A;  1N32 B;  4A5U B;  1Z5W A;  3CMA V;  1S5L Z;  3ZS8 C;  4O4L A;  2AZ2 A;  2LFR A;  3SYA A;  3JAW A;  1OHH G;  1SA0 B;  3OGC C;  3E2E A;  4PV1 B;  3ASN C;  1M56 C;  3SJQ C;  5FL7 G;  3OR6 C;  5LOV B;  1DF5 A;  1XMO B;  4JI5 O;  4DUZ O;  1NVP B;  1Y76 B;  1H8H G;  4F6E A;  4DV2 O;  2F66 C;  2EIJ B;  3A0B Z;  3CC4 V;  4JI0 B;  4FM0 A;  2WLJ A;  3ETQ A;  5IDJ A;  1YXB A;  4UXN A;  2ADP A;  1VQ4 V;  4UFZ A;  5K1X A;  1AB3 A;  2ZR3 A;  4BWA A;  4UB6 Z;  1OCZ C;  4ZHQ A;  4X66 O;  4K8Z A;  3JAS A;  3HKD B;  1G1X B;  2LW7 A;  3FAV A;  3BEH A;  4IHJ A;  1UFI A;  1COW G;  2PYL A;  2Y69 B;  4XBF A;  5B1A B;  2OTL V;  4NXN O;  4LF7 B;  4MT8 A;  1YCI A;  5CA1 B;  4I50 A;  2ZR2 A;  3H1K H;  3JD0 A;  4P30 A;  2UXC B;  4X9Q A;  2E5L B;  4X20 A;  4I55 B;  3HB3 B;  3RBZ A;  2BOC C;  4NTY A;  4JF3 A;  5F2V O;  2YEV B;  4KHP O;  3CEI A;  1V55 C;  2XAH A;  1VAR A;  2LJ2 A;  1F4M A;  2WSS G;  3A0H Z;  5KMG A;  1NZ6 A;  2D3O W;  2DMX A;  5H5N A;  4GUN A;  3E22 B;  1YIJ V;  1UJW B;  5LP6 B;  4FLV A;  1WA8 A;  2P5O A;  1Q86 W;  3FKS G;  3G80 A;  1N33 B;  1DGS A;  2CTW A;  1XBL A;  1K73 W;  4B3S B;  4FZ1 A;  1VQ8 V;  1B04 A;  3M7M X;  3G71 V;  2Q7G A;  5L3F A;  2XUM A;  1IBL B;  2E76 B;  3C3S A;  4LFC B;  4EEQ A;  2QKS A;  4DV6 O;  2DJV A;  3CP1 A;  4JI1 B;  1VQO V;  4PA9 A;  1DK1 A;  3W7T A;  1AJQ A;  2WLH A;  3AK3 A;  4LFB O;  2WLN A;  2EIK B;  4UCR A;  5EC1 C;  1KUQ A;  3X2Q B;  3GB7 C;  4RUE A;  3W7X A;  4MVO A;  1R3K C;  4J11 A;  1NH2 D;  2LGQ A;  2JGD B;  5HFM A;  2UXD B;  1GRJ A;  3A2F A;  4Q20 A;  2XOK G;  4U3J B;  3CCE V;  5IYD O;  4CH5 A;  3N2K B;  3ML0 A;  2UU9 O;  4AI8 A;  3SJA C;  1Y66 A;  5EZY B;  4OGQ B;  5CBG A;  1MZF A;  3OD4 A;  1M90 W;  4LFA B;  4O4L B;  3ASN B;  2PI4 A;  4YY3 B;  3JAW B;  1K34 A;  1Y74 A;  5IT9 N;  3FB6 C;  2HHH B;  4QPK A;  3OTO B;  4K0K O;  5KA5 A;  4LF4 B;  1SQP H;  2UXB O;  1K7D A;  3LSS A;  3IGA C;  1QBZ A;  2R9A A;  5KLV H;  3ABL B;  5KHI A;  2A7W A;  4KFM A;  2GTA A;  4DR2 O;  1RP3 B;  4YXW G;  2JEU A;  1WPB A;  3FYE B;  2QJ1 A;  3DC5 A;  1GN3 A;  4H13 B;  5LGU A;  4PI2 A;  3ZHR A;  1L0L H;  1ENV A;  4PDL A;  5JCO A;  1TUB A;  4ZHQ B;  1E1R G;  1BMF G;  3JAS B;  3W7W A;  4UV8 A;  2Q69 A;  3FAV B;  4IHJ B;  3E89 A;  5JCO C;  5D5Q A;  2E74 B;  1N34 B;  5EBW C;  3CXH F;  2BCC H;  4I50 B;  1CPY A;  1V9P A;  2PZS A;  2QM8 A;  1V55 B;  4JYY A;  3L70 H;  4X20 B;  5KUM A;  4IIJ A;  5FPR A;  5BR8 O;  5B5E Z;  1SQF A;  3ZCC A;  4YJ2 A;  1QLN A;  3ASO C;  4DYL A;  4R7C A;  3E8B A;  1CXZ B;  5GW7 A;  1ORQ C;  2CUG A;  3OEE G;  4CBC A;  5KMG B;  1VF5 B;  3OMN B;  4MTG A;  4BW9 A;  3DXR A;  3H1I H;  2YIA A;  4KXR A;  3T4Z A;  2L35 A;  3CCL V;  1R1B A;  2DOS A;  3APQ A;  4DO2 A;  1WA8 B;  1RSO A;  3FB5 C;  2XHB A;  1KC8 W;  2DYS B;  1W59 A;  3G4S V;  3L74 H;  3JAT A;  3K9A A;  2PYJ A;  3WFV A;  4MS2 A;  1JPX A;  2ZE6 A;  1MSW D;  5BMV A;  1Z2G A;  3THO A;  4X1K A;  3UKM A;  3ZMS A;  4WF9 V;  1KD1 W;  3SPH A;  2ZIM A;  2CTP A;  2EBO A;  3AG4 B;  1WNS A;  1Q6H A;  4DV4 O;  1EBO A;  3ZRW B;  2GTS A;  4JI2 O;  2L6L A;  3FYI B;  3U0Z A;  2IH3 C;  4UCT A;  2V7Q G;  3DSQ A;  2H8P C;  5EIB D;  4X64 B;  1KEC A;  1Y4M A;  1AI4 A;  2VWK A;  3VQW A;  3FB7 C;  4J80 A;  3RYF A;  2JS3 A;  3SJC C;  4JI6 B;  5JJN B;  4X1I A;  3JD1 A;  1K33 A;  3T1Y B;  4EB6 A;  1HNW O;  1LR1 A;  3SYC A;  1HW7 A;  2IJH A;  5IYZ A;  3ZN1 A;  1M1K W;  1XMQ B;  3K0G A;  4UCV A;  1VIB A;  5KHJ A;  2Q68 A;  5H2F Z;  2F43 G;  3GVM A;  4AHC A;  2BE3 A;  1Y74 B;  3W7S A;  2O57 A;  1KQS U;  2P06 A;  5FLX N;  4WFF A;  1TA8 A;  1M57 C;  3S3X A;  1BZK A;  4DR1 O;  1M5I A;  4LF8 B;  4JI7 O;  4WFG A;  2CGN A;  2FML A;  4QE7 A;  2Q0O C;  2C2A A;  2PTM A;  2ITC C;  2LW1 A;  4B3M O;  1S77 D;  3MDS A;  1VQP V;  1TUB B;  4NTW A;  1W0J G;  1NH2 B;  4JYA O;  1PM9 A;  1BE3 H;  5EIB C;  1Q81 W;  3RGB A;  1B3Q A;  5HFL A;  1PNK A;  1GMG A;  2B5U A;  4DR5 O;  3Q4H A;  1K92 A;  4PI0 A;  4BR6 A;  4JI5 B;  4DUZ B;  3ABT A;  1HNX B;  4PA6 A;  3ZIA G;  1I0H A;  4UUJ C;  3HKC A;  4WFE A;  2EJR A;  1FPO A;  3VQY A;  3WB0 A;  4JI3 O;  4O2A A;  4G2K A;  4JTA B;  1FYJ A;  4DV0 O;  1IXB A;  3D36 C;  1RSO B;  2ZNJ A;  3AEI A;  1I5X A;  3JAT B;  2DE0 X;  1NTM H;  2AW9 A;  5B66 Z;  5BMV B;  2EZO A;  4X1K B;  2F4V O;  2EIJ C;  2QWQ B;  3K5L A;  1AI7 A;  3DC6 A;  4CS4 A;  3S3W A;  2IJJ A;  2N74 A;  4B7K A;  4LF5 O;  4Z1M G;  1S5J A;  2LP7 A;  4O4J A;  3ZMV A;  3MHH C;  1J5E O;  1YZB A;  3HKD A;  2Q67 A;  1FXH A;  2XAQ A;  1VF7 A;  3JYC A;  3KKY A;  4GKK O;  4F4L A;  3RYF B;  1TGO A;  5ITZ B;  3R65 A;  3W7U A;  2Y69 C;  1AJP A;  1XNR B;  2YIC A;  1B06 A;  4X1I B;  5B1A C;  1T5E A;  4EB6 B;  5IYZ B;  4ZBM A;  4DV5 B;  1SKV A;  1PP9 H;  2JK5 C;  3RW0 A;  1US6 A;  1JOY A;  4UVC A;  5LL6 Y;  4DV6 B;  4RO2 A;  5DEC A;  5GON A;  2F1M A;  2NLJ C;  2QR4 A;  1VQL V;  3E22 A;  2P7T C;  1XI1 A;  5LP6 A;  1ZWI C;  2AHZ A;  2Z3Y A;  4DR6 B;  4LFB B;  1HR0 O;  1NTZ H;  3OAA G;  4HYO A;  1B6Q A;  2UUB O;  3CME V;  3JSL A;  5LP6 C;  5KHG A;  1VQ7 V;  1VQ9 V;  2VS0 A;  4W4L A;  1QCE A;  2ODM A;  1I94 O;  1Q90 D;  1H2N A;  2IW5 A;  2YXY A;  3SPC A;  4JI4 O;  4R6Z A;  3WB1 A;  1KMI Z;  4IL6 Z;  3TET A;  4UCS A;  4B3T B;  2UU9 B;  5C93 A;  3ETG A;  4AQY B;  2H94 A;  2FYU H;  2B1G A;  4CZZ A;  5FPO A;  2ETN A;  1N36 B;  2RJZ A;  3SYP A;  2ZCE A;  2QTS A;  2WA3 A;  3X2Q C;  4LF9 O;  4B3R B;  2JGD A;  3ABM B;  5EK0 A;  4DR7 B;  3H1H H;  5K1P A;  1SQV H;  1RPO A;  1R6N A;  1FXK A;  3RYH A;  2QKC A;  4W4K A;  1BL8 A;  3N2K A;  3LDC A;  1K5S A;  1R3I C;  2OCC B;  3O65 A;  3ETE A;  1PD3 A;  1PL4 A;  3ZN0 A;  1Y6X A;  3HKC B;  3CCR V;  1GH6 A;  1JX9 A;  3BPZ A;  4O2A B;  3FX7 A;  3L72 H;  4GT1 A;  2YXH A;  1NQT A;  2YC0 A;  1VEW A;  4B7E A;  1U96 A;  4WFB V;  4PDR A;  2Y4T A;  1VQM V;  3SR2 C;  2Y0P A;  2RQ6 A;  3OEH G;  4YJ3 A;  1Q6U A;  4NTX A;  3LNN A;  4J10 A;  1NR7 A;  1Q8I A;  2AHY A;  3ABL C;  2EIL B;  4JPR A;  3ZMZ A;  5E79 Z;  3CX5 F;  3IJ4 A;  5A9G A;  1PKX A;  2QA4 V;  2ZKO A;  1P7G A;  3ZRX A;  1YVW A;  2W0F C;  4O4J B;  2UUC O;  1XUQ A;  3H1L H;  5LHH A;  4YHH O;  5GTI Z;  4PA4 A;  2M6Y A;  1AJN A;  4PHZ A;  4JI8 O;  4J7J A;  4HBN A;  1H2G A;  1VQ5 V;  1S5H C;  2KKW A;  2RN9 A;  1BT8 A;  3HKE A;  4JAU A;  4IYH A;  2ZQM A;  1SER A;  4NB5 A;  3BRC A;  2JRI A;  3CRQ A;  4LR3 A;  3P3N A;  5JWP A;  5GON B;  4TV9 A;  2VQE O;  3A8T A;  4K35 A;  4DV4 B;  4X62 B;  5C8Y B;  1FAF A;  1XHX A;  2CTQ A;  4UV9 A;  3CCV V;  1G6U A;  2IJK A;  1X4T A;  3AG2 B;  2EJ7 A;  3IC7 A;  2HEP A;  4GCZ A;  2DYS C;  1K9M W;  2F93 B;  5KX5 B;  3I55 V;  4Q6G A;  1WN7 A;  1IBK B;  4MW8 A;  2JEX A;  2RCV A;  1HNZ B;  1SF9 A;  1W0K G;  5KHH A;  1ZX3 A;  2ILM A;  4MVR A;  3ZRW A;  5CA0 B;  3OM3 B;  2ZM6 O;  2OYQ A;  1V54 C;  4JYC A;  2AXT Z;  3ZRV A;  3AG4 C;  1I08 A;  1ZL8 A;  4FZ0 A;  1RFY A;  4DV1 B;  1Q43 A;  1O9H A;  2OT5 A;  4PDM A;  3M99 B;  1ZLZ A;  3AG7 A;  2JGU A;  1HWY A;  5L3G A;  4JTC B;  1VF6 A;  1FXK B;  5LMU B;  3RYH B;  2ATK C;  4DR1 B;  3K3W A;  2X6C A;  3SGI A;  2HG5 C;  3WB2 A;  1IVS A;  1PPJ H;  5H6Q A;  1NT2 B;  1XNQ B;  1VF6 C;  3T1C A;  1SC5 B;  2CAZ C;  1OCO B;  1OCR C;  3L75 H;  1NU1 H;  2XND G;  3UM7 A;  1YF2 A;  3UQ8 A;  1XIL A;  2P4V A;  1SQX H;  3P32 A;  4I4T A;  2UUA B;  1DF4 A;  2CH7 A;  4DR4 O;  1GAX A;  1H2S B;  4KP4 A;  3JCZ A;  1K5Q A;  2ZIN A;  4YJ3 B;  1MG1 A;  3LDD A;  4ZKI A;  2HKO A;  1SRY A;  1R6T A;  2QM4 A;  3B40 A;  4HZ3 A;  4I5S A;  3CRA A;  3VOU A;  4X65 O;  1K4C C;  4DUY B;  4H33 A;  3JD3 A;  2X6A A;  5LMN B;  4LF6 O;  2GUZ B;  3JD4 A;  4QJF B;  3J80 N;  4JI3 B;  2HR3 A;  5B1B B;  4LH7 A;  2DW4 A;  1XMO O;  4MVU A;  3DGE A;  2HVK C;  1Q7Y W;  1YEW A;  1EZJ A;  2ZT9 B;  2EIN C;  1JFF A;  3D8C A;  4H0L B;  2WLL B;  5JVD A;  3U11 A;  5KHK A;  4BIZ A;  3HKE B;  2KG7 A;  3JCU Z;  2ZXW B;  3L73 H;  4UCO A;  3BAA A;  4X8A A;  3MAQ A;  1KU9 A;  2FTK A;  4JI0 O;  2QDO A;  5J2T B;  1TVK A;  2F4V B;  1GN2 A;  2YID A;  4TV9 B;  3QO8 A;  3OFN G;  1E1Q G;  4PEL A;  3OMI B;  3ZHS A;  2NR5 A;  1DLB A;  4FJC C;  3LSU A;  3CXC U;  2ZDI A;  2YS8 A;  2AZ0 A;  1N0N A;  3T1H O;  1QR9 A;  3BVO A;  2FKX A;  3SDL A;  4Z1V A;  2PUS A;  2UXN A;  4EKW A;  2HP8 A;  2OWO A;  5LHI A;  2VQF B;  3K57 A;  1JMK C;  3OMA B;  1ZAU A;  4FPP A;  1FD9 A;  1V54 B;  2E5L O;  2R9R B;  3T4D A;  3SJB C;  1PNL A;  2CTR A;  5B1O A;  3ZRS A;  3K06 A;  2DWD C;  4GX5 A;  4LH6 A;  1ZL8 B;  3HR0 A;  1IXM A;  1Y67 A;  4K8X A;  3K9S A;  3TXS A;  5IY5 B;  2G38 A;  1MMM A;  1FKA O;  2DQ0 A;  5ITZ A;  3QVN A;  4LC1 A;  1Q82 W;  3NR7 A;  4DR3 O;  3JAL A;  2P6J A;  3BCC H;  1N33 O;  2Y4U A;  4JAV A;  1R73 A;  1OCR B;  2R72 A;  1CEZ A;  2UUB B;  1J95 A;  2F95 B;  3CCJ V;  2YXL A;  2UXX A;  4LFC O;  3T2M A;  5KAF Z;  3BA8 A;  3CCS V;  1GN4 A;  4J7K A;  3ZMT A;  2KSD A;  4JI1 O;  3ZHU A;  4EFB A;  4GLX A;  2QSA A;  3E8F A;  2YIB D;  1WLE A;  4I4T B;  5IYB O;  3C3T A;  3CJH A;  5B1N A;  3K08 A;  2D2C B;  4WBN A;  2CH7 B;  5CN0 A;  2BSK B;  1OJH A;  5FNV A;  3G6B A;  5LGN A;  5DED A;  2W6J G;  4FMT A;  4DW1 A;  3AG3 C;  4FLY A;  1EN4 A;  3FB8 C;  2DYR B;  2Y48 A;  1U97 A;  3WU2 Z;  1F23 A;  1H2L A;  1ZUQ A;  1I5Y A;  2Q5Z A;  3QF7 A;  1WP7 A;  4CH6 A;  2ZE5 A;  2QWR B;  3C90 A;  1BSM A;  1AVM A;  1A32 A;  4FLW A;  1QR8 A;  2WLK A;  2YI8 A;  4Z2W A;  1D2D A;  1R3J C;  1Q6I A;  4LFA O;  1QU7 A;  2QGN A;  5EYP A;  2IM9 A;  2K1E A;  4ZOL A;  4ZIB A;  1GN6 A;  2DN9 A;  5TIS Z;  2HHH O;  5J9P C;  2EIN B;  2BTO A;  3OTO O;  1NJI W;  3NXS A;  3ABM C;  2YDE A;  4DV2 B;  1JFF B;  1OCC B;  5JVD B;  2IU3 A;  3OE7 G;  3TK1 A;  2KG7 B;  5KAI Z;  1JR9 A;  5CMU A;  4OPH A;  3E35 A;  1IBM O;  1TVK B;  4QE9 A;  2OCC C;  4TUY A;  1Z5V A;  2XTA A;  3RYC A;  4JZ2 A;  4O4I A;  4OXS A;  1L1F A;  1YSC A;  4MW3 A;  2QWP B;  4LWS B;  4FM2 A;  3H9V A;  3B8M A;  4DK1 A;  2ZE7 A;  3BY6 A;  4X66 B;  2UUC B;  4BAY A;  1EN6 A;  4JYB A;  3CSX A;  1YDX A;  1EN5 A;  1N34 O;  1RM1 B;  2DQ3 A;  3F5W C;  4NXN B;  4O2B B;  1PNM A;  3JAK A;  2EIL C;  3OUS A;  5LYJ A;  3TJT A;  2JS5 A;  3IFX A;  2A9H A;  3PN1 A;  4KHP B;  3EXA A;  3AK2 A;  3JD2 A;  1IDS A;  4FLZ A;  2ZD9 A;  4OX9 O;  3CCU V;  2X7R B;  1YHQ V;  4F6R A;  2PF4 E;  2VQE B;  3JAL B;  3ETD A;  2FB5 A;  1YIT V;  2DWE C;  1K97 A;  2Z0A A;  3OT7 A;  5H6R A;  2Q7E A;  1VMG A;  4FLT A;  2P67 A;  4UCU A;  2Q8V A;  1BS3 A;  2RNB A;  2HLD G;  1HP8 A;  1P84 F;  3CWB H;  3RN4 A;  1QQC A;  1ROP A;  3CJH B;  3I56 V;  5JQG A;  2PY5 A;  1BQ0 A;  4WBN B;  3AG3 B;  5C8Y A;  5CA3 A;  1P4R A;  4WCE V;  4X88 A;  4XDL A;  4TSF G;  5FNV B;  4X64 O;  4G28 B;  1SQG A;  2A3Q A;  3CD6 V;  5LGT A;  1AR4 A;  5B3S B;  2ITD C;  3QNE A;  1AI6 A;  5KX5 A;  4JI6 O;  3AG2 C;  2HFE C;  1CP9 A;  2MK3 A;  3K5N A;  4G27 B;  3ZED A;  5LA6 A;  3TCU A;  1OZ0 A;  1QVG U;  1NKD A;  1L8D A;  2XT9 A;  2HJF C;  5CA0 A;  1KKC A;  4TT3 G;  3AG1 B;  2JJ1 G;  1RPR A;  3M8A A;  3N2G A;  1K3E A;  5EYP B;  5KA6 A;  2A79 B;  4ZOL B;  1AIL A;  3K04 A;  1NR1 A;  3STZ C;  2CDY A;  3I5D A;  2WAM A;  4K3A A;  2WLM A;  4K0K B;  3HKB A;  2UXB B;  1TUE B;  2WPD G;  4MTO A;  3OUF A;  5IJ0 A;  1FXK C;  2W0X A;  3ZMU A;  1S0V A;  2CGO A;  1IX9 A;  4DR2 B;  1OV9 A;  4BW5 A;  2Q7H A;  4TUY B;  3RYC B;  3P30 A;  4O4I B;  1R6K A;  2GBO A;  2OIG A;  2RDC A;  2QM7 A;  3K59 A;  1OCO C;  2Q9L A;  3H01 A;  3CC2 V;  1VQN V;  4J7Z A;  1M4U A;  3BHP A;  4L87 A;  4LF6 B;  1QLE B;  4PA3 A;  5LXT A;  1S72 V;  3SYQ A;  4FM1 A;  4PJ0 Z;  3VQX A;  3SPJ A;  2KB1 A;  1MSD A;  1WPX A;  2BTQ A;  5CBF A;  3B09 A;  2GV9 A;  5BY1 A;  4FIP C;  3JAK B;  1HNX O;  4IT5 A;  1F51 A;  5LYJ B;  3ABK C;  2Q0A A;  5BR8 B;  2Q73 A;  3D3I A;  1SET A;  2GUZ A;  3F7Y C;  3CE2 A;  1UPG A;  4X1Y A;  4NR1 A;  1NBM G;  1L0N H;  1N4C A;  3QO7 A;  5AG2 A;  4FLX A;  4F6R B;  4HNA A;  3FD9 A;  3HPL C;  5EBM C;  1N0J A;  3R66 A;  1KP3 A;  5B1B C;  4PDV A;  5E1A C;  2WLL A;  3ICX A;  1LUV A;  1FFT B;  1LNQ A;  3T1H B;  1XQ8 A;  4DRX A;  2B9Z A;  2LGW A;  4J9Z B;  5J2T A;  4CH3 A;  4I9Q A;  3U10 A;  4B08 A;  2ZXW C;  2RMK B;  4GYC B;  4RWU A;  5JQG B;  5IWA O;  3JSN A;  4CS3 A;  1GM9 A;  4JI2 B;  3F5T A;  4PD4 F;  4JTD B;  4DV3 O;  2N05 A;  2OTJ V;  1WAZ A;  2IBZ H;  2YI9 A;  4E4E A;  4TV8 A;  3G6E V;  4NXM O;  4CC5 A;  2A06 H;  4JZG A;  3DTU B;  1XNR O;  1JJO A;  1WP8 A;  3B77 A;  4DR3 B;  2EZP A;  1FFX A;  5LA6 B;  3EHB B;  4JV5 O;  1JJ2 U;  4QNH B;  4D7S A;  4JGS A;  1HNW B;  1QHT A;  1THZ A;  1MZE A;  4DV5 O;  2Z5U A;  4GX0 A;  5GTH Z;  2R9I A;  3N2G B;  2B1I A;  1PV0 A;  4GKJ O;  4XDJ A;  4CH4 A;  3WG7 B;  3ZBH A;  4MSW C;  3K03 A;  2PGG A;  1GM8 A;  1D5A A;  4YIP A;  5A2Q N;  4P9O A;  1G4Y B;  1F7Y A;  2NNU A;  5LHG A;  3OTF A;  1AR5 A;  2K9P A;  2OIE A;  5IY5 C;  4DR6 O;  2NN4 A;  3HKB B;  4R50 A;  5J2U B;  5DN6 G;  5LBQ A;  4QGP A;  2WA4 A;  5IJ0 B;  4JI7 B;  4NYK A;  3BA9 A;  2GHY A;  2V4D A;  2R70 A;  3ZHT A;  4TQF A;  1SZX A;  1FJG O;  4B3M B;  5IE9 A;  1K4D C;  2A0L A;  5JH7 A;  4B3T O;  3KCY A;  3UO3 A;  2BSK A;  2P90 A;  4AQY O;  4TOI A;  2QWN B;  1AR1 B;  1N36 O;  1M56 B;  5LXT B;  4RQF A;  4JYA B;  4B3R O;  3A0R A;  4DR7 O;  4FFK A;  4AIL C;  4ASU G;  1D5N A;  3EVK A;  3SPG A;  3ABK B;  3K0D A;  4DV7 O;  4DR5 B;  2BTQ B;  2DYR C;  4I0X A;  3VBB A;  3ZJZ A;  1FXV A;  1N32 O;  2VRZ A;  4UVA A;  4LBE C;  1SQQ H;  1MOF A;  4U3F H;  1IBM B;  4LNU A;  4X1Y B;  4I7Z B;  1OCZ B;  1JQ0 A;  4DV0 B;  1SZT A;  2WLI A;  4HNA B;  3RWR D;  2GDS A;  5L3C A;  4BIO A;  3CCM V;  3E86 A;  4FLU A;  3CCQ V;  3CPW U;  4EFE A;  1JA8 A;  3QO5 A;  2LQT A;  4DRX B;  1OCC C;  1SQB H;  1SES A;  2H3O A;  2IH1 C;  3JAR A;  4N23 A;  1LUW A;  2HJD A;  3B4S A;  4GX2 A;  3ZHQ A;  4NKG B;  4ICG A;  4WFH A;  1VQ6 V;  3TGU H;  2YUA A;  3QG5 A;  4U7N A;  4XDK A;  5L3D A;  4LWS A;  1WB7 A;  4MVQ A;  4YIO A;  1VP7 A;  3FFQ A;  4LF5 B;  1URF A;  3ZHV A;  1WJZ A;  4RUF A;  1J5E B;  4I9W A;  2EX3 A;  4MVS A;  2ZDI C;  2CK3 G;  4OX9 B;  2CE4 A;  4LF7 O;  4TV8 B;  4BIU A;  4HAM A;  4GKK B;  4O2B A;  4FFB A;  1BHB A;  2OCH A;  4MVM A;  1O9G A;  1XRE A;  1KKD A;  3N27 A;  2UXC O;  5IJ9 A;  2E75 B;  1FFX B;  1RM1 C;  3RYI A;  4L8J A;  1YTF D;  3OR7 C;  4D7T A;  1AI5 A;  4DXW A;  4H44 B;  1XL4 A;  4P2Z A;  1W2B U;  2LO1 A;  1NS1 A;  4MVZ A;  1MAB G;  1QNM A;  4X62 O;  4OPA A;  1HR0 B;  4UB8 Z;  1E79 G;  4ZI7 A;  3UCS C;  4KL1 A;  4B3S O;  5H9C A;  1GO3 F;  1IBL O;  3SPI A;  4J41 A;  1I94 B;  1Q5O A;  1IBK O;  1HNZ O;  3B8N A;  2XAS A;  5KUK A;  4JI4 B;  1NI8 A;  3UT5 A;  4O4H A;  5JJE B;  5JH7 B;  3O9O A;  1K8A W; 
#chains in the Genus database with same CATH homology
 1XOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...