1XOUA

Crystal structure of the cesa-espa complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
72
Chain Sequence
b'DVIDLFNKLGVFQAAILMFAYMYQAQSDLNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspA
publication title Structural characterization of a type III secretion system filament protein in complex with its chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
total genus 23
structure length 72
sequence length 160
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03433 EspA EspA-like secreted protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1140 Mainly Alpha Orthogonal Bundle Helix Hairpins EspA/CesA-like 1xouA00
1XOUA
chains in the Genus database with same CATH superfamily
4UUJC 3HB3B 1YF2A 4PDRA 3CB2A 2XT9A 4RO2A 1XNRO 5BZBA 4W4KA 1VQ9V 1DF5A 4DUZB 2EILC 1K5SA 1Y76A 3A0BZ 2HP8A 2ZIOA 4X1YB 4LF5O 5IYZB 4IIJB 1IBLO 5EYPA 2WLIB 1AROP 3A8TA 4GKJB 5IYDO 3K9SA 4CH4A 4K3AA 4UCRA 4IHJA 1AJNA 5CA0B 2ZR3A 5JQGA 2P22C 1FYJA 2GSMB 3JAKB 1F4NA 1PM9A 4I50A 3OUFA 1DF4A 4DV0O 2H94A 4HZ3A 1GN2A 3JAWB 1NKDA 3KKYA 1OCZB 1N4CA 4DR5B 1K92A 5KHHA 3GWKC 5L3CA 3AEIA 5D5PA 4LCUC 5C8YA 2YIBA 1VQ8V 3RFRA 2Q67A 4CS4A 5CA1A 2CTWA 5LMNB 1US6A 1Z5WA 3C90A 4FFKA 4FM1A 4YHHO 5H2FZ 3JSLA 1XUQA 2ZNIA 1YVWA 4UCVA 3BY6A 3P3NA 2NR5A 4LFBO 1THZA 2YEVA 4E4EA 2ODMA 3WFVA 2DQ0A 5IWAB 1G1XB 1AJPA 5GW7A 3E8GA 4HBNA 4GLXA 2PTMA 2XOKG 4DK1A 3CRCA 3CXHF 2YC0A 1K5QA 3SJAC 4JAUA 2Y69B 1HWYA 1O9HA 3RWRD 3LDEA 4FZ0A 4JTCB 3ABUA 2ZCEA 3D3IA 5BMVB 3J81N 3ABKC 2D2CB 1KD1W 1HNWB 1Q6UA 4ZIBA 1Q81W 1IURA 4P2ZA 4QPJA 1VQ6V 1KKDA 4PI0A 4X20B 4O4HA 3SYOA 1FFXA 2LJ2A 2RMKB 4Q6GA 4QNHB 2QWPB 3FYIB 1UFIA 3T1HO 2KKWA 3RW0A 1G4YB 4LF6O 2YI9A 3UCSC 2XAHA 1AP5A 2ZE7A 3ETEA 1IXMA 1B3QA 4X65B 1KB9F 1Q43A 1SZTA 4UCOA 4PDVA 4DYLA 3T1YO 2O57A 3CCQV 2Q0OC 5LHGA 2XASA 3FYEB 3WB0A 3TETA 2Y48A 3N27A 3NR7A 3E35A 1KMIZ 1I5XA 1ROPA 1NH2D 3SJCC 5JH7B 2UXDB 3CJHB 2RQ6A 4RAIA 1GN6A 1AI7A 2R9AA 1XNRB 1K4CC 3M99B 1KP2A 3F7VC 3K57A 1PV0A 5J2TA 5KLVH 4K8XA 3HKDB 2RNBA 5A2QN 1Y67A 2P6JA 4LF5B 5KHIA 1IBLB 2EIKB 3NXSA 2AHZA 3WU2Z 3JCUZ 4OX9O 5L3GA 4X1KB 4QIWF 2FB5A 2F66C 5B66Z 1M1KW 1F23A 1FD9A 4RWUA 3ASOC 3ABMB 2OCCB 3CYOA 4P9PA 2JVDA 4DV0B 2UXNA 2AHYA 4LC1A 3E86A 1S0VA 1XNQB 3K79A 4YJ3A 5GONA 4DRXB 2OWOA 2B1GA 5B1BC 1ZWIC 4MSWC 2DQ3A 2LW1A 4X1IB 1TAEA 4MTGA 4J80A 4X9QA 1V54C 2GHYA 2VWJA 1YSCA 2EIMB 4YHHB 2W6JG 3SYQA 4BW9A 4I4TB 2YDEA 1ZLZA 4GCZA 2QA4V 2YI8A 3OR7C 1Q7YW 2Q68A 4LFBB 5B3SB 4G2KA 4U3JA 3E83A 1E1QG 2ZXWC 3KCYA 3CCEV 2MK3A 1L0NH 3E8HA 3EFFK 5A9GA 3K0GA 2WA4A 3CWBH 5EZYB 3K5NA 4PV1B 5LP6A 2IJJA 1FJGO 4X8AA 4TT3G 5KMGA 2R9RB 4I5SA 2B5UA 1NZ6A 2PI4A 3OMAB 4WFHA 3VQYA 2QWNB 3B40A 1R73A 2BTQA 3H01A 1AP6A 2F95B 4GKKO 1S5LZ 4FIPC 3EVKA 1K4DC 2ZIMA 3RYFB 2F23A 2Q5ZA 3B09A 1OCCB 5EBWC 4JI7B 4JI8O 4B08A 5LHHA 3T1HB 4J11A 4LF6B 4GT1A 2L6LA 1PL0A 4Z2WA 1GAXA 1PNKA 3F5TA 1N0JA 1TA8A 4GX1A 4J42A 4DR4O 1ORQC 5BXZA 1R3JC 2GDSA 3TJTA 1M56C 2QE7G 2CK3G 1BL8A 2Y0PA 1MOFA 4TSFG 1NVPB 4L8JA 1X59A 4IGGA 4EB6A 3CC2V 1D5AA 5EK0A 4O2AB 3KG2A 1SQXH 3RT3C 2W6IG 3O9OA 4CS2A 4NB5A 3AG2C 3VQWA 1K33A 4DR3O 3OR6C 4MW3A 3E8FA 2XAFA 3RN4A 4DV2O 4OX9B 3RBZA 3DC6A 4KP4A 1MG1A 1EN4A 2X6BA 1QNMA 1RPRA 1YDXA 3QTCA 4KFMA 4NKGB 2W0XA 4OPAA 3JALA 3AG3B 2V7QG 2X6CA 4CH5A 1Q86W 4PA6A 1KECA 4PDLA 3I55V 1SERA 1AI4A 2PZSA 2QKCA 4ZHQA 2UUBB 2DN9A 4LF7O 1JR9A 3ZHUA 2NN4A 5IJ9A 2HHHO 4UCSA 3AK2A 4YXWG 1LUWA 2A79B 4CC6A 1UJWB 1PD3A 2WLMA 1VMGA 1H8HG 3THOA 2EIKC 1OCRB 2AGAA 1FS0G 3K5OA 3MHSC 2QGNA 4OXSA 2GBOA 3FAVB 2P06A 1VIBA 4GX0A 4MTFA 4U7OA 3C3SA 3ZHSA 2AW9A 5LXTA 1FJGB 3A0HZ 4F4LA 4ZKIA 1FXKA 1Y76B 4PA9A 3L74H 2WWWA 2KSDA 2EIJB 4DXWA 3K59A 4FLVA 3N2GB 2QDOA 5ITZB 5EYPB 4MT8A 1I08A 4TV9B 1BHAA 2XHBA 4GKKB 1NJIW 3QNEA 5EC1C 5JQGB 1AILA 2DJVA 1JMKC 1QR9A 3OW2U 3JD4A 1HP8A 4JI8B 2JS5A 4I50B 2BTOA 2UXXA 2YXYA 5B3SC 2VQEO 1R6TA 4FLWA 1R6KA 1Q6IA 3OTOB 4FJCC 4I0XA 4JYAO 4NR1A 4DR4B 1H2NA 5C8YB 2HKOA 1XI1A 3SJBC 1B06A 3IJ4A 5LMNO 4QE9A 3W7XA 4DUYO 3CC7V 5B1AB 1RSOA 3FB5C 1AJQA 1QQCA 3FB6C 1NR7A 1VQLV 2Q6AA 2DYSB 3BFRA 2D3OW 2YIDA 2WA3A 2YEVB 1NR1A 5CB4B 1XMQO 1NI8A 3WB1A 3U0ZA 4PD4F 1GN4A 2YICA 2PYJA 1BQZA 4DR3B 4FLZA 1B6QA 3SPHA 3IFXA 3CCMV 4DV2B 1QCEA 1R3IC 4BWAA 4JI5B 1T5EA 2ZM6O 2OCHA 1BSMA 2ZINA 3ABLC 2Y0IA 1SKVA 4QPKA 1S77D 1VF7A 5LA6A 3WG7B 5JJNB 1LR1A 5TISZ 3JD1A 1RM1B 3D3QA 1GRJA 4D6TH 1BQ0A 3T1CA 3ZHTA 4FLYA 1PKXA 3K0DA 4O4LA 3JSNA 1PPJH 4WFAV 3APQA 2QM4A 3SJQC 3T4ZA 2YIAA 1GO3F 3OUSA 4J9YB 1YEWA 3CC4V 3ML0A 1FFXB 2P7TC 1EZVH 4LF7B 1J5EB 3JD2A 2V4DA 3S3XA 3ZHQA 4WBNB 3OE7G 4DO2A 3K9AA 1OZ0A 2X7RB 4O4JA 4FPPA 2JGUA 5KHGA 1TUBA 3JASB 3PJSK 3AG1B 2IJHA 2UXDO 1I94O 3ZBHA 1MMMA 4MW8A 1W59A 2P4KA 2AZ2A 3BA8A 4OGQB 3CMAV 1H2MA 3MHHC 4I55A 1PNMA 3H1JH 5LOVA 2FKXA 3OGIB 1Q6HA 1NTZH 2HR3A 2JEXA 3HKCA 3JAMN 1YITV 3D8CA 1SQQH 2PI5A 1NTKH 1XL4A 4JI3B 4MTXA 4UCUA 4JI1O 2ADPA 1G6UA 5FNVA 2QWRB 3X2QC 1LNQA 3BABA 2IW5A 4XDJA 3G6EV 4LF4O 4MVRA 1FXHA 2VQEB 5DM6V 1XNQO 2WLHA 1P84F 4CH6A 4JYAB 1SA0A 3CXCU 4DV1O 4YJ3B 5GONB 5IYCO 3LSUA 2XAGA 1NU1H 2P90A 4NXNB 1M9NA 3SYPA 1TVKB 4DUYB 1MA1A 3N2KB 4B3RO 3JARB 4IYIA 2Z0AA 5B1NA 2QEXV 1FPOA 4RUEA 3AK1A 1NQTA 1XMQB 1P4RA 1ZL8A 1JQ0A 4RQEA 4TV8A 1HR0B 5J2UB 3BPZA 4OPHA 4JI2O 1WJZA 1VQPV 2ZM6B 1Y4MA 4O2BA 1RFYA 5LP6B 4UV8A 4DR6O 2BSKA 1SQBH 3LNMB 1A32A 4EKWA 3GWOA 2ZQMA 3JATA 2KG7A 4JI4O 5JCOC 5JVDA 3BRCA 2EINB 1NH2B 3GB7C 4CZZA 3STZC 3ZX6A 3L72H 5B1AC 1R3KC 1WP8A 1YCIA 1MNGA 4JI7O 1LUVA 4QE7A 4D7TA 3ZMTA 1YI2V 2A7WA 2ITDC 3JCZA 3FB7C 1MZEA 2GUZA 1S5HC 4LH6A 2JJ1G 2UU9B 1XHXA 3CD6V 1K9MW 4DR2O 1DTOA 1XDCA 1M57C 4JZ2A 3ZMUA 5KAIZ 2WLNA 2Q7GA 4BAYA 1I94B 5E79Z 1H2GA 5CBGA 5KA6A 4LNUA 3CPWU 4WFFA 3E22A 3B4SA 4NTYA 4EB6B 3OT7A 2VQFB 3SYAA 3J7AU 4JTAB 1PNLA 1QLNA 2Q7EA 1D2DA 5IT9N 2DW4A 1QHTA 1JX9A 4ZI7A 2UXBO 2ZNJA 3RYCB 4JI1B 4G27B 3L73H 1BGYH 2QKSA 4IIJA 2RDCA 2ZR2A 4LF4B 1EBOA 2JRIA 2WLIA 2HVJC 2X0LA 5IY5C 4UFZA 3JALB 3SPCA 2A9HA 3ZRVA 4DK0A 1XBLA 3UT5A 3TGUH 3JAKA 4IYHA 3E8BA 1Z5VA 3AG1C 4DV1B 1DK1A 5KA5A 2K1EA 4J7ZA 4B3SO 4BW5A 2IM9A 2AXTZ 2A3QA 2JJ2G 3EXAA 3U11A 2JS3A 4F6RB 2UUBO 5H5NA 5IJ0A 2LW7A 2MW2B 4FVMA 2M6YA 3CHXA 4B3TO 4HNAB 1BT8A 1I7FA 2ZE5A 3UO3A 4JV5B 1V55B 4B3RB 1G8MA 5CN0A 4H33A 5IJ9B 5BY1A 2HG5C 5LYJA 1KUQA 3FD9A 2ITCC 3H1HH 4JYBA 3AG4B 2EX3A 3SYCA 3GVMA 2P5OA 2GTSA 4LWSA 5FPOA 1H2KA 3RYHA 2PUSA 4JI2B 1HDJA 3ICXA 3FKSG 3K08A 3T4DA 1M4UA 1F7YA 4IT5A 1OCZC 4DR6B 4CC5A 5KAFZ 4JPRA 2JEUA 1FXKB 1HW7A 3IC7A 2EJRA 4DV4O 4JI4B 3JD0A 3TXQA 4JTDB 2W0FC 3OAAG 1XREA 4UCTA 4DV7B 1SF9A 4JYYA 3B77A 2A06H 5BMVA 4UV9A 1N34O 1URFA 3QO5A 3SDLA 1W2BU 1N33O 1IBKB 1XQ8A 2Z5UA 2PYLA 1OJHA 3OTOO 3IAYA 1BHBA 2AZ0A 1KC8W 4L87A 1OV9A 1JFFB 2NLJC 3ETQA 4DR2B 4JZGA 2F43G 2Y69C 4GYCB 4FFBA 1Z2GA 4DV3B 4JAVA 4FK5C 2IBZH 3RYIB 2QM7A 4FMTA 1QVGU 3H1IH 1RSOB 5L3BA 4YJ2A 2Q7HA 2NNUA 3ZHRA 3SPJA 1N32O 2EINC 3F7YC 3CJHA 5CBHA 2UUCB 1WB7A 2EZPA 1Q8IA 2UXBB 2DYRB 3K04A 2V1DA 4JI5O 4UVCA 1QBZA 4H13B 3AG7A 1IX9A 3I5DA 3ASNB 3CRRA 4K8ZA 1AR4A 5H6QA 2QTOA 2VRZA 4X1KA 5LA6B 1PL4A 3OEEG 1SS3A 1QR8A 1XILA 4PHZA 2YXLA 1EM1A 2LO1A 4WFBV 1I5YA 1MZFA 1COWG 2QWOB 2OYQA 4B3SB 3OGCC 2H3OA 4EFEA 1NVPD 5EBMC 4FLUA 2EILB 3STLC 3B2EE 2VS0A 1J5EO 3CRAA 3K5MA 3H1KH 4DRXA 4GZRB 4B3TB 3UO2A 1FXVA 2ZE6A 4X1IA 1ZX3A 2KQXA 3W7UA 1VF6C 1D5NA 4JAAA 3A0RA 4NVPA 3G80A 2DE0X 3BCCH 2FMLA 4X64O 4I4TA 1S76D 3LSSA 5DN6G 4DR1O 3ABMC 2OCCC 4C7UA 5KX5A 1JPXA 4O4IA 1FKAO 3ZHVA 1WPXA 5JWPA 1DLBA 4NTXA 3ZCCA 3SR2C 1V9PA 4DV4B 2CTQA 5IYBO 4JI3O 3CCUV 4DW0A 1K8AW 1M90W 1BS3A 2P4VA 1EZJA 2EIMC 1JVMA 2A0LA 4IHJB 1KKCA 2CTPA 2WPDG 1N34B 1ZUQA 1N36O 5AG2A 1N33B 4RQFA 4J7KA 2E75B 1SQVH 3ZS8C 5HFLA 1F51A 1L8DA 1HNXO 1WPBA 4A5UB 4UB8Z 2GV9A 2QJ1A 4CBCA 3RYFA 2N05A 1FFTB 3QF7A 2WLJA 2RN9A 1WA8A 5CA1B 4NXNO 1M5IA 2JGDA 3CSXA 1NT2B 3JD3A 3VOUA 1K73W 4N23A 1YIJV 3ETGA 1YTFB 3TCUA 3KCXA 1Q5OA 4P9OA 1SETA 1N0NA 4YY3O 3L9DA 3ZEDA 3E89A 1NTMH 2WAMA 1N32B 1Q90D 1DGSA 3OMNB 3FX7A 3F5WC 1HR0O 2ZD9A 4TQDA 3ZRWA 2F93B 1I0HA 4O2AA 1OCCC 1L1FA 2LGQA 3PN1A 2G38A 5GTHZ 3IC9A 1EN5A 3BHPA 4O2BB 3ZMSA 2BSKB 2Y4TA 4MVOA 2C2AA 3Q4HA 2CH7A 1JA8A 4X66O 1Q82W 3ETDA 1BZKA 2EJ7A 2BCCH 5JVDB 2ZDIA 3DXRA 3DGEA 4DV6O 2HLDG 4O4HB 5JJJB 2XAJA 4J9ZB 5J9PC 3A2FA 3H9VA 4JI6O 4LF8B 4KHPB 2F4VB 1GM8A 3CP1A 3D36A 4MVSA 3FFQA 2UU9O 2GUZB 2IJKA 1B04A 1KBHA 1L0LH 5LGUA 3FB8C 2DYRC 2DWEC 1ENVA 4X62O 3QG5A 2HJFC 3LSQA 4X64B 2CUGA 3ASOB 4DR1B 2OIEA 2ZDIC 1S3JA 1P49A 5LHIA 1OCOB 4LNUB 3K58A 2JIZG 4ZOLA 1IBMO 3AG3C 2VQFO 5J2TB 3OEHG 1U97A 3FAVA 5B1BB 5KHJA 3VBBA 1IXBA 2WLLA 4LH7A 3D36C 3CEIA 1V54B 1TGOA 3OFNG 1BMFG 4ZI7B 2LQTA 1X4TA 4XDKA 1MABG 3HR0A 1YXBA 4YIPA 4PJ0Z 4U7NA 3L71H 1QVFU 4JYCA 4WFGA 3N2GA 1W0JG 5ITZA 4CH3A 1H2SB 1N36B 4LP8A 2UXCB 4TV9A 4AQYO 2R70A 2LFRA 4I9WA 2ZXWB 1OCRC 2JK5C 3H1LH 4D7SA 4Q20A 3HPLC 1HNXB 1SQPH 2IH3C 4LBEC 1AVMA 1VP7A 3UT5B 1Y74A 5LL6Y 3BEHA 1YHQV 5CMUA 2BOCC 4ABMA 3WB2A 4R6ZA 3P30A 5IJ0B 2XTAA 2CDYA 4CS3A 3UQ8A 3CS5A 4JV5O 5H6RA 3CMEV 1XHZA 1W0KG 4ASUG 2EIJC 5JCOA 3OMIB 4KUMA 5LYJB 4YY3B 4X89A 1XMOO 4K0KB 1KU9A 2LFSA 2ZT9B 4U3JB 3W7TA 1VQNV 1KYOF 3M7MX 4LWSB 4G28B 2ATKC 3HKEA 3MDSA 2Q4PA 1BE3H 3CRQA 4PA7A 3RYHB 4BIZA 4EEQA 1RPOA 1EFRG 2WLKA 4J41A 3ZIAG 1VQOV 5CB4A 5FPRA 3DC5A 1IZ3A 4I7ZB 5KMGB 4AHCA 2EBOA 1AI5A 4Z1VA 3MD0A 1VQ4V 1TUEB 2RCVA 1E1RG 1IDSA 3DSQA 1M56B 4X66B 2Q8VA 3EHBB 2BTQB 4DV7O 1GM9A 1JJOA 1H2LA 4R50A 3ZJZA 2Z3YA 2ZKOA 4DV6B 3HKBA 1CXZB 4MVZA 4JI6B 1IBKO 4J7JA 4F6EA 3CCLV 4FLXA 2DYSC 2CTRA 5IE9A 2ADQB 2M7WA 3MAQA 3AG2B 3OM3B 2X6AA 4TUYA 1RP3B 4ICGA 3W7SA 2BE3A 1O9GA 4FLTA 1MSDA 2XUMA 2YUAA 4X62B 2R72A 4WBNA 3G6BA 2KB1A 2R9IA 1FAFA 2PGGA 5B1OA 2ARHA 5LMUO 4TQFA 4DV3O 4FFBB 2DWDC 5KUMA 3TK1A 4RUFA 3WG7C 1IVSA 1XOUA 5CA3A 5L3DA 1RM1C 3JASA 1IBMB 2BOBC 4YJ2B 5EC2C 4DV5B 3C3TA 2DMXA 1GKFA 2UUCO 2F1MA 1WP7A 4B7EA 3BA9A 2WSSG 3BVOA 4JASA 1VQKV 4UVAA 3OTFA 2JDIG 4X1YA 1QLEB 4I9QA 2Y4UA 5L3FA 1ZSPA 5IYZA 5EBLC 4FM2A 1VQ7V 4UVBA 4AQYB 3ZMVA 5CA0A 4QGPA 2IU3A 1YJNV 3E2EA 1M93A 3P32A 2XAQA 3SGIA 5LGTA 1CEZA 4UB6Z 4MVMA 4ZBMA 2OT5A 5DECA 3JAWA 1OCOC 1K7DA 4ZHQB 4UXNA 4PI2A 3UKMA 1SZXA 2N74A 4EFBA 3RGBA 4LF9O 4NXMO 3OD4A 4R8CA 5JJEB 1WAZA 3G4SV 1GH6A 5LBQA 1ZTEA 1XMOB 2H8PC 1TVKA 1VF5B 5IDJA 1CP9A 4K35A 3N2KA 1R6NA 3JARA 4R7CA 2RJZA 3L75H 3L70H 4LFCO 4GX2A 4P30A 3K06A 5KX5B 5LXTB 4O4IB 2DOSA 3I56V 3K3WA 2GTAA 1R1BA 5J2UA 1KQSU 4Z1MG 4XDLA 3LUTB 3VQXA 4B3MO 1E79G 1JCHA 2HJDA 3KZIZ 2E76B 2ETNA 1KP3A 4X20A 4LR3A 1SC5B 5FLXN 1GK9A 4I0XB 2CE4A 2OIGA 2Q9LA 5H9CA 4TWKA 3SPGA 1MSWD 4PDMA 2N04A 3SPIA 2HVKC 1N8RW 3ABLB 5KHKA 1WA8B 5LP6C 5L3EA 3CRMA 2JGDB 5LMUB 2ZE8A 4J10A 4E2LA 2FYUH 3T1YB 3QVNA 2E5LO 3R66A 5JH7A 1WN7A 3RVZA 5BR8O 1WNSA 4B7KA 4AI8A 4LFAO 4N21A 2HFEC 1AI6A 2FTKA 3ZRWB 3HKDA 3DTUB 2FL4A 2VWKA 3IGAC 1YZBA 4XBFA 2HEPA 4AILC 1VF6A 4JI0O 1K97A 5EIBD 2OTJV 1HNZO 4BIOA 3RYCA 2CAZC 2Q69A 1AR1B 2LP7A 3Q4HB 5GTIZ 2CH7B 4O4LB 4U3FH 5HFMA 2YXHA 4WF9V 3DXRB 4MS2A 4DR7O 4WCEV 4WFEA 4LF8O 4KHPO 3P3PA 4PA3A 2IJIA 2PF4E 3RVYA 3J80N 4NYKA 2UUAO 2F4VO 3S3WA 3ZN1A 4LF9B 4NXMB 3ZMZA 1WLEA 3B8MA 1SQFA 2YSUB 2QWQB 2QSAA 2L35A 4FZ1A 4O4JB 4F6RA 4W4LA 4KXRA 1TUBB 4JF3A 1P7GA 4HNAA 1QLEC 3X2QB 3CCSV 4H0LB 2OTLV 1NBMG 2K9PA 1BCCH 4LFCB 4FM0A 1P7BA 1K34A 4ZOLB 4YIOA 1GM7A 2CGOA 3G67A 4I55B 4KL1A 1NS1A 3O65A 3K5LA 2QKAA 5LOVB 1H8EG 3CE2A 5EZYA 5DEDA 3HKCB 1QU7A 2P67A 2WLLB 4NTWA 4DUZO 4B3MB 4IL6Z 1Y6XA 5FNVB 1V55C 1VARA 1VQ5V 2UXCO 3B8NA 4MVUA 4GKJO 3AG4C 5F2VO 5C93A 5FL7G 2XNDG 3R65A 3CX5F 3VQVA 1F4MA 3G71V 4MTOA 1SA0B 1U96A 1GN3A 1OHHG 1Y74B 1S72V 2QTSA 1XL6A 1UPGA 4QJFB 1SESA 4HYOA 1AR5A 1R3LC 4DR5O 4X88A 4GUNA 3QO7A 3JYCA 2PY5A 3ABKB 5LGNA 4HAMA 1PP9H 1FXKC 3CCVV 1JFFA 2B1IA 1ZAUA 1J95A 2Q0AA 2E5LB 4K0KO 2B9ZA 3CCRV 2QR4A 3ZN0A 2Q73A 5K1PA 5BR8B 1ZL8B 1YJWV 4LFAB 1AB3A 3RYIA 4TV8B 2E74B 5B5EZ 1VQMV 2CGNA 3HKEB 3TXSA 3LNNA 1EN6A 4BR6A 3M8AA 5IWAO 3LDDA 1JOYA 4JI0B 5EIBC 1SRYA 3ZRXA 3AK3A 1GTOA 4MVQA 1CPYA 1Q3EA 2IH1C 3BAAA 1HNZB 2YS8A 4H44B 1M57B 3JATB 2KG7B 2YIBD 5E1AC 2QM8A 5CBFA 2EULA 3LDCA 5KUKA 4PELA 1K3EA 1S5JA 1SQGA 2EZOA 3W7WA 3HKBB 4DR7B 1HNWO 1YTFD 5D5QA 3U10A 4H37A 2IU0A 4PA4A 1WB8A 3ABTA 1H38A 2UUAB 1JJ2U 5K1XA 4TOIA 1YJ9V 3K03A 4BIUA 2ILMA 4TUYB 3APOA 4JGSA 2E3CA 2LGWA 3ZRSA 3QO8A 4DW1A 2HHHB 1VEWA 4X65O 1Y66A 3T2MA 3ASNC 1GMGA 3CCJV 5IY5B 3UM7A 1XEQA 4GX5A 3E22B 4DV5O
chains in the Genus database with same CATH topology
1XOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOU A; 
#chains in the Genus database with same CATH topology
 4UUJ C;  3HB3 B;  1YF2 A;  4PDR A;  3CB2 A;  2XT9 A;  4RO2 A;  1XNR O;  5BZB A;  4W4K A;  1VQ9 V;  1DF5 A;  4DUZ B;  2EIL C;  1K5S A;  1Y76 A;  3A0B Z;  2HP8 A;  2ZIO A;  4X1Y B;  4LF5 O;  5IYZ B;  4IIJ B;  1IBL O;  5EYP A;  2WLI B;  1ARO P;  3A8T A;  4GKJ B;  5IYD O;  3K9S A;  4CH4 A;  4K3A A;  4UCR A;  4IHJ A;  1AJN A;  5CA0 B;  2ZR3 A;  5JQG A;  2P22 C;  1FYJ A;  2GSM B;  3JAK B;  1F4N A;  1PM9 A;  4I50 A;  3OUF A;  1DF4 A;  4DV0 O;  2H94 A;  4HZ3 A;  1GN2 A;  3JAW B;  1NKD A;  3KKY A;  1OCZ B;  1N4C A;  4DR5 B;  1K92 A;  5KHH A;  3GWK C;  5L3C A;  3AEI A;  5D5P A;  4LCU C;  5C8Y A;  2YIB A;  1VQ8 V;  3RFR A;  2Q67 A;  4CS4 A;  5CA1 A;  2CTW A;  5LMN B;  1US6 A;  1Z5W A;  3C90 A;  4FFK A;  4FM1 A;  4YHH O;  5H2F Z;  3JSL A;  1XUQ A;  2ZNI A;  1YVW A;  4UCV A;  3BY6 A;  3P3N A;  2NR5 A;  4LFB O;  1THZ A;  2YEV A;  4E4E A;  2ODM A;  3WFV A;  2DQ0 A;  5IWA B;  1G1X B;  1AJP A;  5GW7 A;  3E8G A;  4HBN A;  4GLX A;  2PTM A;  2XOK G;  4DK1 A;  3CRC A;  3CXH F;  2YC0 A;  1K5Q A;  3SJA C;  4JAU A;  2Y69 B;  1HWY A;  1O9H A;  3RWR D;  3LDE A;  4FZ0 A;  4JTC B;  3ABU A;  2ZCE A;  3D3I A;  5BMV B;  3J81 N;  3ABK C;  2D2C B;  1KD1 W;  1HNW B;  1Q6U A;  4ZIB A;  1Q81 W;  1IUR A;  4P2Z A;  4QPJ A;  1VQ6 V;  1KKD A;  4PI0 A;  4X20 B;  4O4H A;  3SYO A;  1FFX A;  2LJ2 A;  2RMK B;  4Q6G A;  4QNH B;  2QWP B;  3FYI B;  1UFI A;  3T1H O;  2KKW A;  3RW0 A;  1G4Y B;  4LF6 O;  2YI9 A;  3UCS C;  2XAH A;  1AP5 A;  2ZE7 A;  3ETE A;  1IXM A;  1B3Q A;  4X65 B;  1KB9 F;  1Q43 A;  1SZT A;  4UCO A;  4PDV A;  4DYL A;  3T1Y O;  2O57 A;  3CCQ V;  2Q0O C;  5LHG A;  2XAS A;  3FYE B;  3WB0 A;  3TET A;  2Y48 A;  3N27 A;  3NR7 A;  3E35 A;  1KMI Z;  1I5X A;  1ROP A;  1NH2 D;  3SJC C;  5JH7 B;  2UXD B;  3CJH B;  2RQ6 A;  4RAI A;  1GN6 A;  1AI7 A;  2R9A A;  1XNR B;  1K4C C;  3M99 B;  1KP2 A;  3F7V C;  3K57 A;  1PV0 A;  5J2T A;  5KLV H;  4K8X A;  3HKD B;  2RNB A;  5A2Q N;  1Y67 A;  2P6J A;  4LF5 B;  5KHI A;  1IBL B;  2EIK B;  3NXS A;  2AHZ A;  3WU2 Z;  3JCU Z;  4OX9 O;  5L3G A;  4X1K B;  4QIW F;  2FB5 A;  2F66 C;  5B66 Z;  1M1K W;  1F23 A;  1FD9 A;  4RWU A;  3ASO C;  3ABM B;  2OCC B;  3CYO A;  4P9P A;  2JVD A;  4DV0 B;  2UXN A;  2AHY A;  4LC1 A;  3E86 A;  1S0V A;  1XNQ B;  3K79 A;  4YJ3 A;  5GON A;  4DRX B;  2OWO A;  2B1G A;  5B1B C;  1ZWI C;  4MSW C;  2DQ3 A;  2LW1 A;  4X1I B;  1TAE A;  4MTG A;  4J80 A;  4X9Q A;  1V54 C;  2GHY A;  2VWJ A;  1YSC A;  2EIM B;  4YHH B;  2W6J G;  3SYQ A;  4BW9 A;  4I4T B;  2YDE A;  1ZLZ A;  4GCZ A;  2QA4 V;  2YI8 A;  3OR7 C;  1Q7Y W;  2Q68 A;  4LFB B;  5B3S B;  4G2K A;  4U3J A;  3E83 A;  1E1Q G;  2ZXW C;  3KCY A;  3CCE V;  2MK3 A;  1L0N H;  3E8H A;  3EFF K;  5A9G A;  3K0G A;  2WA4 A;  3CWB H;  5EZY B;  3K5N A;  4PV1 B;  5LP6 A;  2IJJ A;  1FJG O;  4X8A A;  4TT3 G;  5KMG A;  2R9R B;  4I5S A;  2B5U A;  1NZ6 A;  2PI4 A;  3OMA B;  4WFH A;  3VQY A;  2QWN B;  3B40 A;  1R73 A;  2BTQ A;  3H01 A;  1AP6 A;  2F95 B;  4GKK O;  1S5L Z;  4FIP C;  3EVK A;  1K4D C;  2ZIM A;  3RYF B;  2F23 A;  2Q5Z A;  3B09 A;  1OCC B;  5EBW C;  4JI7 B;  4JI8 O;  4B08 A;  5LHH A;  3T1H B;  4J11 A;  4LF6 B;  4GT1 A;  2L6L A;  1PL0 A;  4Z2W A;  1GAX A;  1PNK A;  3F5T A;  1N0J A;  1TA8 A;  4GX1 A;  4J42 A;  4DR4 O;  1ORQ C;  5BXZ A;  1R3J C;  2GDS A;  3TJT A;  1M56 C;  2QE7 G;  2CK3 G;  1BL8 A;  2Y0P A;  1MOF A;  4TSF G;  1NVP B;  4L8J A;  1X59 A;  4IGG A;  4EB6 A;  3CC2 V;  1D5A A;  5EK0 A;  4O2A B;  3KG2 A;  1SQX H;  3RT3 C;  2W6I G;  3O9O A;  4CS2 A;  4NB5 A;  3AG2 C;  3VQW A;  1K33 A;  4DR3 O;  3OR6 C;  4MW3 A;  3E8F A;  2XAF A;  3RN4 A;  4DV2 O;  4OX9 B;  3RBZ A;  3DC6 A;  4KP4 A;  1MG1 A;  1EN4 A;  2X6B A;  1QNM A;  1RPR A;  1YDX A;  3QTC A;  4KFM A;  4NKG B;  2W0X A;  4OPA A;  3JAL A;  3AG3 B;  2V7Q G;  2X6C A;  4CH5 A;  1Q86 W;  4PA6 A;  1KEC A;  4PDL A;  3I55 V;  1SER A;  1AI4 A;  2PZS A;  2QKC A;  4ZHQ A;  2UUB B;  2DN9 A;  4LF7 O;  1JR9 A;  3ZHU A;  2NN4 A;  5IJ9 A;  2HHH O;  4UCS A;  3AK2 A;  4YXW G;  1LUW A;  2A79 B;  4CC6 A;  1UJW B;  1PD3 A;  2WLM A;  1VMG A;  1H8H G;  3THO A;  2EIK C;  1OCR B;  2AGA A;  1FS0 G;  3K5O A;  3MHS C;  2QGN A;  4OXS A;  2GBO A;  3FAV B;  2P06 A;  1VIB A;  4GX0 A;  4MTF A;  4U7O A;  3C3S A;  3ZHS A;  2AW9 A;  5LXT A;  1FJG B;  3A0H Z;  4F4L A;  4ZKI A;  1FXK A;  1Y76 B;  4PA9 A;  3L74 H;  2WWW A;  2KSD A;  2EIJ B;  4DXW A;  3K59 A;  4FLV A;  3N2G B;  2QDO A;  5ITZ B;  5EYP B;  4MT8 A;  1I08 A;  4TV9 B;  1BHA A;  2XHB A;  4GKK B;  1NJI W;  3QNE A;  5EC1 C;  5JQG B;  1AIL A;  2DJV A;  1JMK C;  1QR9 A;  3OW2 U;  3JD4 A;  1HP8 A;  4JI8 B;  2JS5 A;  4I50 B;  2BTO A;  2UXX A;  2YXY A;  5B3S C;  2VQE O;  1R6T A;  4FLW A;  1R6K A;  1Q6I A;  3OTO B;  4FJC C;  4I0X A;  4JYA O;  4NR1 A;  4DR4 B;  1H2N A;  5C8Y B;  2HKO A;  1XI1 A;  3SJB C;  1B06 A;  3IJ4 A;  5LMN O;  4QE9 A;  3W7X A;  4DUY O;  3CC7 V;  5B1A B;  1RSO A;  3FB5 C;  1AJQ A;  1QQC A;  3FB6 C;  1NR7 A;  1VQL V;  2Q6A A;  2DYS B;  3BFR A;  2D3O W;  2YID A;  2WA3 A;  2YEV B;  1NR1 A;  5CB4 B;  1XMQ O;  1NI8 A;  3WB1 A;  3U0Z A;  4PD4 F;  1GN4 A;  2YIC A;  2PYJ A;  1BQZ A;  4DR3 B;  4FLZ A;  1B6Q A;  3SPH A;  3IFX A;  3CCM V;  4DV2 B;  1QCE A;  1R3I C;  4BWA A;  4JI5 B;  1T5E A;  2ZM6 O;  2OCH A;  1BSM A;  2ZIN A;  3ABL C;  2Y0I A;  1SKV A;  4QPK A;  1S77 D;  1VF7 A;  5LA6 A;  3WG7 B;  5JJN B;  1LR1 A;  5TIS Z;  3JD1 A;  1RM1 B;  3D3Q A;  1GRJ A;  4D6T H;  1BQ0 A;  3T1C A;  3ZHT A;  4FLY A;  1PKX A;  3K0D A;  4O4L A;  3JSN A;  1PPJ H;  4WFA V;  3APQ A;  2QM4 A;  3SJQ C;  3T4Z A;  2YIA A;  1GO3 F;  3OUS A;  4J9Y B;  1YEW A;  3CC4 V;  3ML0 A;  1FFX B;  2P7T C;  1EZV H;  4LF7 B;  1J5E B;  3JD2 A;  2V4D A;  3S3X A;  3ZHQ A;  4WBN B;  3OE7 G;  4DO2 A;  3K9A A;  1OZ0 A;  2X7R B;  4O4J A;  4FPP A;  2JGU A;  5KHG A;  1TUB A;  3JAS B;  3PJS K;  3AG1 B;  2IJH A;  2UXD O;  1I94 O;  3ZBH A;  1MMM A;  4MW8 A;  1W59 A;  2P4K A;  2AZ2 A;  3BA8 A;  4OGQ B;  3CMA V;  1H2M A;  3MHH C;  4I55 A;  1PNM A;  3H1J H;  5LOV A;  2FKX A;  3OGI B;  1Q6H A;  1NTZ H;  2HR3 A;  2JEX A;  3HKC A;  3JAM N;  1YIT V;  3D8C A;  1SQQ H;  2PI5 A;  1NTK H;  1XL4 A;  4JI3 B;  4MTX A;  4UCU A;  4JI1 O;  2ADP A;  1G6U A;  5FNV A;  2QWR B;  3X2Q C;  1LNQ A;  3BAB A;  2IW5 A;  4XDJ A;  3G6E V;  4LF4 O;  4MVR A;  1FXH A;  2VQE B;  5DM6 V;  1XNQ O;  2WLH A;  1P84 F;  4CH6 A;  4JYA B;  1SA0 A;  3CXC U;  4DV1 O;  4YJ3 B;  5GON B;  5IYC O;  3LSU A;  2XAG A;  1NU1 H;  2P90 A;  4NXN B;  1M9N A;  3SYP A;  1TVK B;  4DUY B;  1MA1 A;  3N2K B;  4B3R O;  3JAR B;  4IYI A;  2Z0A A;  5B1N A;  2QEX V;  1FPO A;  4RUE A;  3AK1 A;  1NQT A;  1XMQ B;  1P4R A;  1ZL8 A;  1JQ0 A;  4RQE A;  4TV8 A;  1HR0 B;  5J2U B;  3BPZ A;  4OPH A;  4JI2 O;  1WJZ A;  1VQP V;  2ZM6 B;  1Y4M A;  4O2B A;  1RFY A;  5LP6 B;  4UV8 A;  4DR6 O;  2BSK A;  1SQB H;  3LNM B;  1A32 A;  4EKW A;  3GWO A;  2ZQM A;  3JAT A;  2KG7 A;  4JI4 O;  5JCO C;  5JVD A;  3BRC A;  2EIN B;  1NH2 B;  3GB7 C;  4CZZ A;  3STZ C;  3ZX6 A;  3L72 H;  5B1A C;  1R3K C;  1WP8 A;  1YCI A;  1MNG A;  4JI7 O;  1LUV A;  4QE7 A;  4D7T A;  3ZMT A;  1YI2 V;  2A7W A;  2ITD C;  3JCZ A;  3FB7 C;  1MZE A;  2GUZ A;  1S5H C;  4LH6 A;  2JJ1 G;  2UU9 B;  1XHX A;  3CD6 V;  1K9M W;  4DR2 O;  1DTO A;  1XDC A;  1M57 C;  4JZ2 A;  3ZMU A;  5KAI Z;  2WLN A;  2Q7G A;  4BAY A;  1I94 B;  5E79 Z;  1H2G A;  5CBG A;  5KA6 A;  4LNU A;  3CPW U;  4WFF A;  3E22 A;  3B4S A;  4NTY A;  4EB6 B;  3OT7 A;  2VQF B;  3SYA A;  3J7A U;  4JTA B;  1PNL A;  1QLN A;  2Q7E A;  1D2D A;  5IT9 N;  2DW4 A;  1QHT A;  1JX9 A;  4ZI7 A;  2UXB O;  2ZNJ A;  3RYC B;  4JI1 B;  4G27 B;  3L73 H;  1BGY H;  2QKS A;  4IIJ A;  2RDC A;  2ZR2 A;  4LF4 B;  1EBO A;  2JRI A;  2WLI A;  2HVJ C;  2X0L A;  5IY5 C;  4UFZ A;  3JAL B;  3SPC A;  2A9H A;  3ZRV A;  4DK0 A;  1XBL A;  3UT5 A;  3TGU H;  3JAK A;  4IYH A;  3E8B A;  1Z5V A;  3AG1 C;  4DV1 B;  1DK1 A;  5KA5 A;  2K1E A;  4J7Z A;  4B3S O;  4BW5 A;  2IM9 A;  2AXT Z;  2A3Q A;  2JJ2 G;  3EXA A;  3U11 A;  2JS3 A;  4F6R B;  2UUB O;  5H5N A;  5IJ0 A;  2LW7 A;  2MW2 B;  4FVM A;  2M6Y A;  3CHX A;  4B3T O;  4HNA B;  1BT8 A;  1I7F A;  2ZE5 A;  3UO3 A;  4JV5 B;  1V55 B;  4B3R B;  1G8M A;  5CN0 A;  4H33 A;  5IJ9 B;  5BY1 A;  2HG5 C;  5LYJ A;  1KUQ A;  3FD9 A;  2ITC C;  3H1H H;  4JYB A;  3AG4 B;  2EX3 A;  3SYC A;  3GVM A;  2P5O A;  2GTS A;  4LWS A;  5FPO A;  1H2K A;  3RYH A;  2PUS A;  4JI2 B;  1HDJ A;  3ICX A;  3FKS G;  3K08 A;  3T4D A;  1M4U A;  1F7Y A;  4IT5 A;  1OCZ C;  4DR6 B;  4CC5 A;  5KAF Z;  4JPR A;  2JEU A;  1FXK B;  1HW7 A;  3IC7 A;  2EJR A;  4DV4 O;  4JI4 B;  3JD0 A;  3TXQ A;  4JTD B;  2W0F C;  3OAA G;  1XRE A;  4UCT A;  4DV7 B;  1SF9 A;  4JYY A;  3B77 A;  2A06 H;  5BMV A;  4UV9 A;  1N34 O;  1URF A;  3QO5 A;  3SDL A;  1W2B U;  1N33 O;  1IBK B;  1XQ8 A;  2Z5U A;  2PYL A;  1OJH A;  3OTO O;  3IAY A;  1BHB A;  2AZ0 A;  1KC8 W;  4L87 A;  1OV9 A;  1JFF B;  2NLJ C;  3ETQ A;  4DR2 B;  4JZG A;  2F43 G;  2Y69 C;  4GYC B;  4FFB A;  1Z2G A;  4DV3 B;  4JAV A;  4FK5 C;  2IBZ H;  3RYI B;  2QM7 A;  4FMT A;  1QVG U;  3H1I H;  1RSO B;  5L3B A;  4YJ2 A;  2Q7H A;  2NNU A;  3ZHR A;  3SPJ A;  1N32 O;  2EIN C;  3F7Y C;  3CJH A;  5CBH A;  2UUC B;  1WB7 A;  2EZP A;  1Q8I A;  2UXB B;  2DYR B;  3K04 A;  2V1D A;  4JI5 O;  4UVC A;  1QBZ A;  4H13 B;  3AG7 A;  1IX9 A;  3I5D A;  3ASN B;  3CRR A;  4K8Z A;  1AR4 A;  5H6Q A;  2QTO A;  2VRZ A;  4X1K A;  5LA6 B;  1PL4 A;  3OEE G;  1SS3 A;  1QR8 A;  1XIL A;  4PHZ A;  2YXL A;  1EM1 A;  2LO1 A;  4WFB V;  1I5Y A;  1MZF A;  1COW G;  2QWO B;  2OYQ A;  4B3S B;  3OGC C;  2H3O A;  4EFE A;  1NVP D;  5EBM C;  4FLU A;  2EIL B;  3STL C;  3B2E E;  2VS0 A;  1J5E O;  3CRA A;  3K5M A;  3H1K H;  4DRX A;  4GZR B;  4B3T B;  3UO2 A;  1FXV A;  2ZE6 A;  4X1I A;  1ZX3 A;  2KQX A;  3W7U A;  1VF6 C;  1D5N A;  4JAA A;  3A0R A;  4NVP A;  3G80 A;  2DE0 X;  3BCC H;  2FML A;  4X64 O;  4I4T A;  1S76 D;  3LSS A;  5DN6 G;  4DR1 O;  3ABM C;  2OCC C;  4C7U A;  5KX5 A;  1JPX A;  4O4I A;  1FKA O;  3ZHV A;  1WPX A;  5JWP A;  1DLB A;  4NTX A;  3ZCC A;  3SR2 C;  1V9P A;  4DV4 B;  2CTQ A;  5IYB O;  4JI3 O;  3CCU V;  4DW0 A;  1K8A W;  1M90 W;  1BS3 A;  2P4V A;  1EZJ A;  2EIM C;  1JVM A;  2A0L A;  4IHJ B;  1KKC A;  2CTP A;  2WPD G;  1N34 B;  1ZUQ A;  1N36 O;  5AG2 A;  1N33 B;  4RQF A;  4J7K A;  2E75 B;  1SQV H;  3ZS8 C;  5HFL A;  1F51 A;  1L8D A;  1HNX O;  1WPB A;  4A5U B;  4UB8 Z;  2GV9 A;  2QJ1 A;  4CBC A;  3RYF A;  2N05 A;  1FFT B;  3QF7 A;  2WLJ A;  2RN9 A;  1WA8 A;  5CA1 B;  4NXN O;  1M5I A;  2JGD A;  3CSX A;  1NT2 B;  3JD3 A;  3VOU A;  1K73 W;  4N23 A;  1YIJ V;  3ETG A;  1YTF B;  3TCU A;  3KCX A;  1Q5O A;  4P9O A;  1SET A;  1N0N A;  4YY3 O;  3L9D A;  3ZED A;  3E89 A;  1NTM H;  2WAM A;  1N32 B;  1Q90 D;  1DGS A;  3OMN B;  3FX7 A;  3F5W C;  1HR0 O;  2ZD9 A;  4TQD A;  3ZRW A;  2F93 B;  1I0H A;  4O2A A;  1OCC C;  1L1F A;  2LGQ A;  3PN1 A;  2G38 A;  5GTH Z;  3IC9 A;  1EN5 A;  3BHP A;  4O2B B;  3ZMS A;  2BSK B;  2Y4T A;  4MVO A;  2C2A A;  3Q4H A;  2CH7 A;  1JA8 A;  4X66 O;  1Q82 W;  3ETD A;  1BZK A;  2EJ7 A;  2BCC H;  5JVD B;  2ZDI A;  3DXR A;  3DGE A;  4DV6 O;  2HLD G;  4O4H B;  5JJJ B;  2XAJ A;  4J9Z B;  5J9P C;  3A2F A;  3H9V A;  4JI6 O;  4LF8 B;  4KHP B;  2F4V B;  1GM8 A;  3CP1 A;  3D36 A;  4MVS A;  3FFQ A;  2UU9 O;  2GUZ B;  2IJK A;  1B04 A;  1KBH A;  1L0L H;  5LGU A;  3FB8 C;  2DYR C;  2DWE C;  1ENV A;  4X62 O;  3QG5 A;  2HJF C;  3LSQ A;  4X64 B;  2CUG A;  3ASO B;  4DR1 B;  2OIE A;  2ZDI C;  1S3J A;  1P49 A;  5LHI A;  1OCO B;  4LNU B;  3K58 A;  2JIZ G;  4ZOL A;  1IBM O;  3AG3 C;  2VQF O;  5J2T B;  3OEH G;  1U97 A;  3FAV A;  5B1B B;  5KHJ A;  3VBB A;  1IXB A;  2WLL A;  4LH7 A;  3D36 C;  3CEI A;  1V54 B;  1TGO A;  3OFN G;  1BMF G;  4ZI7 B;  2LQT A;  1X4T A;  4XDK A;  1MAB G;  3HR0 A;  1YXB A;  4YIP A;  4PJ0 Z;  4U7N A;  3L71 H;  1QVF U;  4JYC A;  4WFG A;  3N2G A;  1W0J G;  5ITZ A;  4CH3 A;  1H2S B;  1N36 B;  4LP8 A;  2UXC B;  4TV9 A;  4AQY O;  2R70 A;  2LFR A;  4I9W A;  2ZXW B;  1OCR C;  2JK5 C;  3H1L H;  4D7S A;  4Q20 A;  3HPL C;  1HNX B;  1SQP H;  2IH3 C;  4LBE C;  1AVM A;  1VP7 A;  3UT5 B;  1Y74 A;  5LL6 Y;  3BEH A;  1YHQ V;  5CMU A;  2BOC C;  4ABM A;  3WB2 A;  4R6Z A;  3P30 A;  5IJ0 B;  2XTA A;  2CDY A;  4CS3 A;  3UQ8 A;  3CS5 A;  4JV5 O;  5H6R A;  3CME V;  1XHZ A;  1W0K G;  4ASU G;  2EIJ C;  5JCO A;  3OMI B;  4KUM A;  5LYJ B;  4YY3 B;  4X89 A;  1XMO O;  4K0K B;  1KU9 A;  2LFS A;  2ZT9 B;  4U3J B;  3W7T A;  1VQN V;  1KYO F;  3M7M X;  4LWS B;  4G28 B;  2ATK C;  3HKE A;  3MDS A;  2Q4P A;  1BE3 H;  3CRQ A;  4PA7 A;  3RYH B;  4BIZ A;  4EEQ A;  1RPO A;  1EFR G;  2WLK A;  4J41 A;  3ZIA G;  1VQO V;  5CB4 A;  5FPR A;  3DC5 A;  1IZ3 A;  4I7Z B;  5KMG B;  4AHC A;  2EBO A;  1AI5 A;  4Z1V A;  3MD0 A;  1VQ4 V;  1TUE B;  2RCV A;  1E1R G;  1IDS A;  3DSQ A;  1M56 B;  4X66 B;  2Q8V A;  3EHB B;  2BTQ B;  4DV7 O;  1GM9 A;  1JJO A;  1H2L A;  4R50 A;  3ZJZ A;  2Z3Y A;  2ZKO A;  4DV6 B;  3HKB A;  1CXZ B;  4MVZ A;  4JI6 B;  1IBK O;  4J7J A;  4F6E A;  3CCL V;  4FLX A;  2DYS C;  2CTR A;  5IE9 A;  2ADQ B;  2M7W A;  3MAQ A;  3AG2 B;  3OM3 B;  2X6A A;  4TUY A;  1RP3 B;  4ICG A;  3W7S A;  2BE3 A;  1O9G A;  4FLT A;  1MSD A;  2XUM A;  2YUA A;  4X62 B;  2R72 A;  4WBN A;  3G6B A;  2KB1 A;  2R9I A;  1FAF A;  2PGG A;  5B1O A;  2ARH A;  5LMU O;  4TQF A;  4DV3 O;  4FFB B;  2DWD C;  5KUM A;  3TK1 A;  4RUF A;  3WG7 C;  1IVS A;  1XOU A;  5CA3 A;  5L3D A;  1RM1 C;  3JAS A;  1IBM B;  2BOB C;  4YJ2 B;  5EC2 C;  4DV5 B;  3C3T A;  2DMX A;  1GKF A;  2UUC O;  2F1M A;  1WP7 A;  4B7E A;  3BA9 A;  2WSS G;  3BVO A;  4JAS A;  1VQK V;  4UVA A;  3OTF A;  2JDI G;  4X1Y A;  1QLE B;  4I9Q A;  2Y4U A;  5L3F A;  1ZSP A;  5IYZ A;  5EBL C;  4FM2 A;  1VQ7 V;  4UVB A;  4AQY B;  3ZMV A;  5CA0 A;  4QGP A;  2IU3 A;  1YJN V;  3E2E A;  1M93 A;  3P32 A;  2XAQ A;  3SGI A;  5LGT A;  1CEZ A;  4UB6 Z;  4MVM A;  4ZBM A;  2OT5 A;  5DEC A;  3JAW A;  1OCO C;  1K7D A;  4ZHQ B;  4UXN A;  4PI2 A;  3UKM A;  1SZX A;  2N74 A;  4EFB A;  3RGB A;  4LF9 O;  4NXM O;  3OD4 A;  4R8C A;  5JJE B;  1WAZ A;  3G4S V;  1GH6 A;  5LBQ A;  1ZTE A;  1XMO B;  2H8P C;  1TVK A;  1VF5 B;  5IDJ A;  1CP9 A;  4K35 A;  3N2K A;  1R6N A;  3JAR A;  4R7C A;  2RJZ A;  3L75 H;  3L70 H;  4LFC O;  4GX2 A;  4P30 A;  3K06 A;  5KX5 B;  5LXT B;  4O4I B;  2DOS A;  3I56 V;  3K3W A;  2GTA A;  1R1B A;  5J2U A;  1KQS U;  4Z1M G;  4XDL A;  3LUT B;  3VQX A;  4B3M O;  1E79 G;  1JCH A;  2HJD A;  3KZI Z;  2E76 B;  2ETN A;  1KP3 A;  4X20 A;  4LR3 A;  1SC5 B;  5FLX N;  1GK9 A;  4I0X B;  2CE4 A;  2OIG A;  2Q9L A;  5H9C A;  4TWK A;  3SPG A;  1MSW D;  4PDM A;  2N04 A;  3SPI A;  2HVK C;  1N8R W;  3ABL B;  5KHK A;  1WA8 B;  5LP6 C;  5L3E A;  3CRM A;  2JGD B;  5LMU B;  2ZE8 A;  4J10 A;  4E2L A;  2FYU H;  3T1Y B;  3QVN A;  2E5L O;  3R66 A;  5JH7 A;  1WN7 A;  3RVZ A;  5BR8 O;  1WNS A;  4B7K A;  4AI8 A;  4LFA O;  4N21 A;  2HFE C;  1AI6 A;  2FTK A;  3ZRW B;  3HKD A;  3DTU B;  2FL4 A;  2VWK A;  3IGA C;  1YZB A;  4XBF A;  2HEP A;  4AIL C;  1VF6 A;  4JI0 O;  1K97 A;  5EIB D;  2OTJ V;  1HNZ O;  4BIO A;  3RYC A;  2CAZ C;  2Q69 A;  1AR1 B;  2LP7 A;  3Q4H B;  5GTI Z;  2CH7 B;  4O4L B;  4U3F H;  5HFM A;  2YXH A;  4WF9 V;  3DXR B;  4MS2 A;  4DR7 O;  4WCE V;  4WFE A;  4LF8 O;  4KHP O;  3P3P A;  4PA3 A;  2IJI A;  2PF4 E;  3RVY A;  3J80 N;  4NYK A;  2UUA O;  2F4V O;  3S3W A;  3ZN1 A;  4LF9 B;  4NXM B;  3ZMZ A;  1WLE A;  3B8M A;  1SQF A;  2YSU B;  2QWQ B;  2QSA A;  2L35 A;  4FZ1 A;  4O4J B;  4F6R A;  4W4L A;  4KXR A;  1TUB B;  4JF3 A;  1P7G A;  4HNA A;  1QLE C;  3X2Q B;  3CCS V;  4H0L B;  2OTL V;  1NBM G;  2K9P A;  1BCC H;  4LFC B;  4FM0 A;  1P7B A;  1K34 A;  4ZOL B;  4YIO A;  1GM7 A;  2CGO A;  3G67 A;  4I55 B;  4KL1 A;  1NS1 A;  3O65 A;  3K5L A;  2QKA A;  5LOV B;  1H8E G;  3CE2 A;  5EZY A;  5DED A;  3HKC B;  1QU7 A;  2P67 A;  2WLL B;  4NTW A;  4DUZ O;  4B3M B;  4IL6 Z;  1Y6X A;  5FNV B;  1V55 C;  1VAR A;  1VQ5 V;  2UXC O;  3B8N A;  4MVU A;  4GKJ O;  3AG4 C;  5F2V O;  5C93 A;  5FL7 G;  2XND G;  3R65 A;  3CX5 F;  3VQV A;  1F4M A;  3G71 V;  4MTO A;  1SA0 B;  1U96 A;  1GN3 A;  1OHH G;  1Y74 B;  1S72 V;  2QTS A;  1XL6 A;  1UPG A;  4QJF B;  1SES A;  4HYO A;  1AR5 A;  1R3L C;  4DR5 O;  4X88 A;  4GUN A;  3QO7 A;  3JYC A;  2PY5 A;  3ABK B;  5LGN A;  4HAM A;  1PP9 H;  1FXK C;  3CCV V;  1JFF A;  2B1I A;  1ZAU A;  1J95 A;  2Q0A A;  2E5L B;  4K0K O;  2B9Z A;  3CCR V;  2QR4 A;  3ZN0 A;  2Q73 A;  5K1P A;  5BR8 B;  1ZL8 B;  1YJW V;  4LFA B;  1AB3 A;  3RYI A;  4TV8 B;  2E74 B;  5B5E Z;  1VQM V;  2CGN A;  3HKE B;  3TXS A;  3LNN A;  1EN6 A;  4BR6 A;  3M8A A;  5IWA O;  3LDD A;  1JOY A;  4JI0 B;  5EIB C;  1SRY A;  3ZRX A;  3AK3 A;  1GTO A;  4MVQ A;  1CPY A;  1Q3E A;  2IH1 C;  3BAA A;  1HNZ B;  2YS8 A;  4H44 B;  1M57 B;  3JAT B;  2KG7 B;  2YIB D;  5E1A C;  2QM8 A;  5CBF A;  2EUL A;  3LDC A;  5KUK A;  4PEL A;  1K3E A;  1S5J A;  1SQG A;  2EZO A;  3W7W A;  3HKB B;  4DR7 B;  1HNW O;  1YTF D;  5D5Q A;  3U10 A;  4H37 A;  2IU0 A;  4PA4 A;  1WB8 A;  3ABT A;  1H38 A;  2UUA B;  1JJ2 U;  5K1X A;  4TOI A;  1YJ9 V;  3K03 A;  4BIU A;  2ILM A;  4TUY B;  3APO A;  4JGS A;  2E3C A;  2LGW A;  3ZRS A;  3QO8 A;  4DW1 A;  2HHH B;  1VEW A;  4X65 O;  1Y66 A;  3T2M A;  3ASN C;  1GMG A;  3CCJ V;  5IY5 B;  3UM7 A;  1XEQ A;  4GX5 A;  3E22 B;  4DV5 O; 
#chains in the Genus database with same CATH homology
 1XOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...