1XOUA

Crystal structure of the cesa-espa complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
72
Chain Sequence
DVIDLFNKLGVFQAAILMFAYMYQAQSDLNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a type III secretion system filament protein in complex with its chaperone.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein/chaperone
molecule keywords EspA
total genus 23
structure length 72
sequence length 160
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03433 EspA EspA-like secreted protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1140 Mainly Alpha Orthogonal Bundle Helix Hairpins EspA/CesA-like 1xouA00
1XOUA
chains in the Genus database with same CATH superfamily
1A32A 1I7FA 5F2VO 1IXMA 3ZN1A 4O4IA 4R7CA 4JYAB 1L8DA 2WLIB 4BWAA 3W7TA 2M7WA 3ASNB 3CC4V 2JS5A 5LMUB 1B06A 4GX5A 1K9MW 1GTOA 1AP5A 3JD4A 2NLJC 2XAFA 3ZMSA 4PJ0Z 1XEQA 4XDKA 4B7KA 1PKXA 4LF4O 5LYJB 1VF5B 1NVPD 1Q3EA 3QF7A 4MVMA 2LO1A 5B1NA 3CRRA 3E2EA 2DMXA 4GLXA 1N0JA 2XT9A 3WFVA 1Y76B 3T1YO 1WAZA 3OMIB 1OCOC 3MHHC 3LSQA 1VQMV 1KC8W 4WBNA 1PL4A 1SA0A 3Q4HA 4JTAB 1ROPA 5LP6B 2F66C 4X64O 1SF9A 3J80N 4U3FH 1PPJH 1MA1A 3RWRD 2UXDO 5IT9N 4GUNA 1OCRB 2HKOA 1H2GA 1IBLO 4I50A 4FZ1A 3TXSA 2LP7A 4FVMA 3LUTB 3E35A 1T5EA 2B9ZA 3IC7A 2WSSG 2EINB 5HFLA 5JWPA 2ZT9B 4X62B 2BOBC 4N21A 3DXRA 3TCUA 4F4LA 4DUYB 5EIBC 4P2ZA 3ABMB 5KA6A 1HNZB 2Q73A 1JVMA 1XMOO 3FAVB 4DV4B 4FM0A 5GONA 1GN3A 1EZVH 1DF4A 3UT5B 1BL8A 1NKDA 5JQGB 4UFZA 3BFRA 3STZC 3FB7C 3N2KA 2GBOA 1N36B 4LF9O 5BR8O 4JI0O 4FZ0A 3D36A 4I4TB 3WB0A 3TK1A 2QTSA 4K0KO 3ZHVA 3ETGA 4DUZB 3AG2B 5E1AC 3ZHRA 2IU0A 4JV5O 1HNWO 4MVZA 5ITZA 2ZM6B 2RNBA 3QTCA 4BW9A 4ZI7A 5EC1C 4FIPC 1KYOF 3G6EV 3ICXA 3FYIB 1V54B 4CH6A 2E74B 4JASA 2JDIG 2PI4A 2P67A 4DR7O 2DW4A 2UUAO 2EINC 2YEVB 2HFEC 2ZXWB 3QO8A 5JJEB 1HW7A 3UM7A 2A3QA 2EILC 3ZMTA 1CXZB 1COWG 4GKJO 3AEIA 3OM3B 3CD6V 3ZHQA 4X20A 3U0ZA 1M57C 5KMGB 3T1YB 5IYZB 4J7JA 2AHZA 5EIBD 3I5DA 1VIBA 1H2NA 2CGNA 5LHGA 1NI8A 1OZ0A 2QJ1A 3OUSA 2P06A 2X0LA 2Y48A 4NB5A 3H1IH 2Z5UA 1JR9A 3CRQA 3ZMZA 4DR2O 3A0BZ 1ZX3A 4WFFA 2G38A 3T1CA 5IJ9A 2OIEA 3ZS8C 5IJ0A 1LUWA 4D6TH 1XILA 2P7TC 3ASNC 4CS3A 3ETQA 3LSSA 2NR5A 2IU3A 4P30A 3P3PA 1HWYA 2Q7HA 1IBMB 3O65A 2QM4A 3CCEV 4CS2A 4L87A 1XNQB 3R66A 1V9PA 2EIKC 4X89A 3SJBC 4MTFA 4QE7A 3LNMB 1FXVA 3CMAV 4H37A 1FXHA 3H1JH 2HHHO 2DYSC 1O9GA 2V7QG 5B3SC 4PV1B 2P4KA 4L8JA 4X9QA 2RN9A 5LMNB 4JI7O 3IC9A 4YJ2B 4Z1MG 2EULA 5KX5B 5EYPB 1BQ0A 3K9AA 4LF5O 3L74H 1OCCC 5IDJA 1M57B 4Z2WA 4J10A 3BY6A 4DV3B 4X62O 4LF9B 4X1KA 1YJ9V 2QM7A 1PNLA 5B1AB 4IL6Z 1KKDA 3P30A 1XHXA 4ZIBA 3C90A 3ZJZA 1X59A 2XAJA 3T1HO 3JATA 4HZ3A 3HR0A 4C7UA 1JFFA 2EIMC 5C93A 3F5TA 3ZMUA 1WP7A 4DV0O 2BOCC 4NTXA 3L9DA 3OD4A 2JK5C 1P4RA 4FLWA 1VQ4V 1QVGU 1PP9H 4LFCB 5IY5C 4TWKA 4DV0B 2A7WA 3RGBA 3JCUZ 3ASOB 3ZX6A 1WB8A 2PGGA 2UXNA 5LOVA 5DECA 3UCSC 1TAEA 1TVKB 4IYHA 3OR6C 2CK3G 2BTOA 4LWSB 4TUYA 5KMGA 4XBFA 3CS5A 4JI5B 2ZXWC 3OEEG 4NVPA 4PA7A 3B8NA 4E4EA 3BHPA 4WFAV 4KHPB 2PI5A 1BZKA 4DR7B 4YJ3A 2ZIOA 3BA8A 2AXTZ 4LFBB 1EZJA 1H8EG 4JAAA 4JI7B 5DEDA 5IJ0B 1TUEB 2CTWA 4B3RB 1WA8B 4D7SA 4AHCA 4OGQB 4YJ2A 4NXMO 1V54C 4PI0A 2Q9LA 3CWBH 3UQ8A 1E79G 2KQXA 1QLNA 2X6BA 2YI9A 3SYQA 3JD2A 3E8GA 4O4LA 1UJWB 4LFBO 3JAMN 3CCMV 2JGDB 1THZA 4HBNA 4DV2B 4DV1O 2FMLA 1B04A 4ZHQA 3SR2C 3CXHF 3K5NA 2GV9A 2YIDA 2B1GA 1S3JA 3RYHA 2YUAA 4JF3A 4JYAO 1G1XB 1YSCA 3TXQA 1M56B 3BVOA 5LA6B 5LXTA 1H2LA 1IBKB 1S5LZ 2YIAA 4MTXA 1AJQA 2E3CA 3G4SV 2HVJC 1QCEA 2KG7A 1XMQO 3SJAC 1FS0G 2E75B 3BRCA 2HLDG 3ZEDA 1WB7A 5FLXN 2QWPB 5L3CA 4W4KA 4LFAO 1KQSU 4CH5A 4JI2O 1Y74A 1SS3A 5LP6A 1YI2V 3S3WA 5L3GA 4N23A 1VF6C 4FLZA 1SQQH 4GKKB 2CTQA 4F6EA 2DE0X 5L3FA 4TT3G 3CCQV 2QEXV 4B3SB 2N05A 3ZBHA 3DSQA 3JD3A 5L3BA 4Q20A 4DK1A 2H94A 2BSKA 3AK2A 4PDMA 4I50B 2EX3A 2L35A 5LMNO 2FYUH 5CA0A 3AG3C 1RM1C 4FJCC 4JAUA 4TQFA 3OAAG 3DC5A 2EJRA 1YZBA 3CCJV 1WJZA 2QTOA 3DXRB 1FJGB 4A5UB 4DO2A 2IJIA 1YF2A 1AI6A 4LNUB 1KKCA 1OCZB 3ZCCA 1Z5WA 3A2FA 3RYFA 4IIJA 2AZ0A 1VQLV 3IAYA 4UB6Z 3OTOO 1TVKA 2F1MA 1EM1A 2QKCA 3B2EE 5EBMC 5B66Z 1H2MA 4OPHA 1TA8A 5FNVB 2BTQA 3HKBB 1ORQC 1DLBA 1B3QA 4I55B 1S76D 5EBWC 3ZRSA 3HKDB 4RWUA 1U96A 1SQVH 3FB5C 4LBEC 4YJ3B 2AZ2A 5D5PA 1LR1A 2F4VB 1S0VA 1I94B 3KCXA 1AILA 3EFFK 4NXMB 3K08A 4B3MB 1R3LC 2IH1C 3AG7A 3E22B 3VQWA 4UVBA 4FK5C 1DGSA 4O2AA 1H2KA 4JAVA 3G71V 3O9OA 1N0NA 5KHHA 1GN4A 3WU2Z 4CBCA 4LH7A 1N32O 1FXKB 2WLLB 2JGDA 2NNUA 1GH6A 1BCCH 2R72A 3W7WA 2EIMB 2E5LO 5JJNB 2HG5C 3H1HH 4X1IB 4JI1O 4DV4O 4JYBA 1FXKC 1XHZA 2IBZH 1QHTA 2ZR3A 2XOKG 1M93A 4G2KA 4WF9V 5LA6A 1IX9A 1OCZC 4PDVA 1BHBA 1KD1W 1XMQB 4PDLA 1SQPH 3L73H 2JS3A 1WPXA 1J95A 1F7YA 3S3XA 4GT1A 4K0KB 2ZD9A 5JJJB 1AI4A 2ZIMA 3G80A 1F4MA 2BCCH 4DXWA 4PA6A 1L0LH 2JEUA 2EZOA 1AROP 1K73W 4JPRA 4JTCB 4PA3A 1KB9F 3H1LH 5BMVA 3RBZA 5AG2A 5B1BC 4UV9A 1GM8A 2AW9A 1GO3F 2ETNA 1W2BU 4R6ZA 4J9YB 4QPJA 4MSWC 1RSOB 1RM1B 1LUVA 1EFRG 2IW5A 3HPLC 5J2UB 3K58A 3JAWB 1F4NA 3OFNG 1R73A 4JZGA 1ZWIC 3ZHUA 4EEQA 4WCEV 4BAYA 4YHHB 1M5IA 5FPRA 2P4VA 5LMUO 1V55B 3BA9A 3CB2A 2EIJC 1JX9A 1IBMO 3K57A 2WLHA 1RPRA 1VQKV 2E76B 4WFGA 4GKKO 2XASA 4DR1O 4UV8A 1VP7A 1P49A 4LCUC 2YSUB 1NS1A 1XMOB 4DV7B 1JMKC 2B5UA 1BT8A 1VQ8V 3JAKB 4O4IB 2P5OA 3H01A 2CH7A 4JI8B 4J9ZB 2YI8A 3T4DA 2R70A 3UT5A 1QNMA 3A0HZ 3FKSG 4JI0B 1MSWD 4KUMA 2Q7EA 4EFEA 5H5NA 4DR6O 2OCCC 1ENVA 3QO7A 4TV8A 3D8CA 5C8YA 3ZRXA 5JVDB 2CDYA 4MVRA 4X64B 3B4SA 5LGNA 1S77D 3OGCC 1JJOA 1OCOB 1VQ6V 4BIUA 4MS2A 2GSMB 3STLC 1S5JA 5CMUA 1ZTEA 3EXAA 1AI7A 1NVPB 5EYPA 3QO5A 3NR7A 1H38A 2D2CB 4QNHB 4DR2B 4BIZA 3JYCA 3K59A 1R6KA 3T1HB 1S5HC 3ABLC 3ABUA 2ZNIA 2YEVA 5JCOC 2WAMA 2Y0PA 3SYAA 4PDRA 2QKAA 4AQYO 1SRYA 1IVSA 1D5AA 3OUFA 1AB3A 4X20B 3L70H 3F7YC 3JD0A 5LOVB 3X2QC 3N2GA 1J5EO 5IYZA 4IHJB 2FTKA 2Q67A 2UUBO 1L0NH 3K3WA 2DYSB 1K4DC 4RUEA 3WB2A 2XAHA 3D3IA 4ZOLB 1OV9A 3LSUA 4IGGA 3ZMVA 4B3TB 4FLUA 1GN6A 3U11A 1Y67A 4O2BB 1YJNV 3G67A 2W6JG 3CCSV 2UUBB 5H6RA 3HKEB 2JJ2G 4U7NA 5EBLC 2UUCO 2CH7B 4KFMA 3I56V 1OHHG 1XREA 1VF6A 5GONB 3LDDA 3SYPA 3ZRVA 1XNRB 3JASB 1UPGA 3E8HA 4DV5O 2VQFO 1N34B 2H8PC 4TV9A 3TETA 3GVMA 1XBLA 2ZDIA 1XUQA 4DYLA 1NR7A 2HEPA 2F93B 3IGAC 3N27A 3HKCB 3VQXA 5FL7G 2V4DA 1KBHA 4MVSA 1WA8A 5KAIZ 1Q43A 1ZLZA 2WLIA 2QKSA 2DQ0A 4ZI7B 5GW7A 2ATKC 2OT5A 1NU1H 4DV3O 2GTSA 3AG4C 3SJQC 5GTHZ 1NR1A 1JOYA 4KL1A 4CH4A 2ITCC 2DJVA 1Q90D 2P90A 3K5OA 1TGOA 3C3SA 1X4TA 3ABKC 2A9HA 2HR3A 3AG4B 3PN1A 4F6RB 4TV8B 4DR3B 1AI5A 3QNEA 1Y76A 1W0JG 1P7BA 2W6IG 4QGPA 5H6QA 1VQOV 4LF8B 3J7AU 5LL6Y 2LJ2A 3H9VA 1I5XA 5KHKA 4DR3O 2CE4A 1IDSA 2ZE8A 4H33A 3CSXA 2YIBA 2ZINA 4UCTA 3LDCA 3R65A 1MNGA 5IJ9B 2UXCB 3MHSC 3CCLV 1YEWA 4JI6B 3OEHG 1QQCA 4JI3B 4CZZA 2KKWA 3F5WC 4PA4A 3CPWU 2BE3A 5KLVH 3FB6C 3QVNA 4E2LA 4ZKIA 4J7ZA 4I9WA 4UCUA 3CP1A 3WG7B 1HP8A 4JI3O 1PNKA 2Z0AA 3OMAB 3P3NA 3CRAA 3ML0A 5A9GA 1HNXB 3HKCA 1Q6IA 1M1KW 1YJWV 3A0RA 1W59A 2EZPA 3B09A 2F43G 3GB7C 1IBKO 1NTKH 4GYCB 1ZL8A 3SYOA 5EC2C 3X2QB 4UVAA 1JJ2U 3HKEA 1YITV 3IFXA 1O9HA 2DWEC 4OX9O 1MZFA 1XNRO 1BMFG 3K0DA 5CBHA 2P6JA 3BABA 4U3JA 2BTQB 5BR8B 1MSDA 4DV2O 2IJJA 5BZBA 2N74A 5EZYB 2LFSA 2R9AA 2AGAA 1NT2B 3K5MA 1FD9A 4J42A 4LF6O 4QIWF 5KHGA 2F95B 3UO3A 1YXBA 2WLMA 4WFEA 5KA5A 1V55C 2YS8A 4RQFA 1Q81W 5CA1B 3PJSK 3TJTA 3MD0A 2FKXA 1G4YB 1H8HG 1Y6XA 2D3OW 4O2AB 4XDLA 2HP8A 1Q6UA 2QDOA 2CUGA 3VQYA 4EB6A 3DC6A 1IURA 2WPDG 4RUFA 5B5EZ 4DV6B 2K9PA 4X8AA 1XQ8A 3WG7C 3RYIB 1K5SA 4JYCA 4FPPA 1MZEA 1CP9A 4X88A 1FFXA 2PY5A 4JI2B 1K34A 3T2MA 1HNZO 3JALA 4MW8A 1BHAA 2HVKC 2JGUA 5BY1A 4CS4A 5JH7B 2ZE5A 2PYLA 3OMNB 1XI1A 5CN0A 3KG2A 4LWSA 1CPYA 3AK1A 2HHHB 1I08A 4PA9A 1JQ0A 2Q7GA 3H1KH 1XL6A 3UO2A 1GN2A 1PL0A 1VEWA 3JARA 3E83A 4GKJB 1KUQA 4DR5O 4X66O 4O4HB 3ABLB 5KUMA 2Q6AA 3FAVA 1BE3H 2ILMA 3CJHA 4DRXA 4U3JB 2LW1A 2RDCA 1SQBH 1K3EA 2R9IA 1SQFA 5JQGA 4UXNA 3ZRWB 3GWKC 2Q0AA 2ZCEA 1OCRC 1Z5VA 4DW0A 3E89A 4KXRA 4H13B 1M4UA 2LFRA 2XNDG 3WB1A 2YXLA 1FYJA 1F23A 4X1YB 3AG2C 2Y69B 3JSLA 1NH2B 2ARHA 5KHIA 1R3KC 4FLXA 4B3MO 2UXBO 2K1EA 2W0FC 1F51A 3THOA 2Y69C 1YTFD 1R3IC 2X6AA 4MW3A 4B3SO 2RCVA 2OTJV 2MW2B 1K92A 3FFQA 1CEZA 1N4CA 5A2QN 4FMTA 4D7TA 2ZKOA 1NZ6A 5H9CA 5LYJA 3E8BA 2UUAB 5L3DA 2WA4A 2KB1A 3CCUV 4MTOA 2XAGA 2DQ3A 5C8YB 4UCRA 1YIJV 1H2SB 1N36O 4I7ZB 4R8CA 1U97A 2JEXA 3M7MX 1KMIZ 5CB4A 4UVCA 1N8RW 3OW2U 1TUBA 2RJZA 4BR6A 2JIZG 4OX9B 3DGEA 4DR6B 3N2GB 4WFHA 4BIOA 2A06H 1GKFA 2Z3YA 2JRIA 4LFCO 1VQ7V 1PNMA 4LF7B 4XDJA 1G8MA 3EVKA 1WP8A 1PD3A 1R1BA 1URFA 3CJHB 2V1DA 2OIGA 3RT3C 4O2BA 3K04A 3JALB 4QPKA 1LNQA 3U10A 1P7GA 5IYCO 3RYCB 1VQPV 2CAZC 5JH7A 4TUYB 3CC7V 2IH3C 3OE7G 3BPZA 2EILB 1M90W 2A79B 1SERA 4LP8A 4KP4A 2LW7A 3CCVV 3RFRA 3N2KB 2XHBA 4FLTA 1R6NA 4YHHO 1UFIA 1GAXA 1ZUQA 1GRJA 1SZXA 2UUCB 2QWNB 3B8MA 4FM1A 2P22C 3CRCA 4FFBA 3T4ZA 1SZTA 2HJFC 4MT8A 1Y66A 3D36C 5ITZB 4FLYA 3JD1A 1EN5A 1JPXA 2X7RB 3JAKA 4DK0A 5LHIA 4YXWG 1QR9A 1YDXA 3ABKB 1YCIA 2QWOB 3CMEV 2F23A 2YDEA 4LF4B 4X1YA 3K0GA 4RAIA 4UCVA 4WFBV 4UUJC 1EN4A 1TUBB 3BAAA 4YY3B 1K33A 2UXBB 2Y4UA 4JTDB 4P9PA 4F6RA 3ZIAG 2QR4A 2VS0A 1K4CC 4GX2A 2WLNA 1JFFB 4DR4O 4QJFB 2QGNA 1B6QA 2KSDA 1VARA 2OCHA 1FKAO 1XOUA 3SGIA 2DN9A 2QWRB 4JI5O 1FXKA 4TOIA 2ZNJA 4YY3O 2DWDC 4K35A 1PV0A 4JV5B 3SPJA 4Q6GA 1KU9A 1PM9A 3CX5F 2RQ6A 3FB8C 4YIOA 2ZDIC 2ZQMA 3KKYA 4J7KA 4LF5B 3ASOC 5FPOA 4I9QA 2X6CA 1FPOA 4YIPA 4IT5A 2XTAA 1K7DA 2PUSA 1K5QA 4X66B 1IBLB 2HJDA 4NXNO 2Y0IA 1J5EB 5K1PA 1SQGA 3C3TA 3EHBB 5KAFZ 3K03A 2YIBD 1GM7A 4K8XA 5IWAO 3NXSA 2DOSA 1FAFA 1FJGO 2MK3A 1WPBA 5J2UA 4DUZO 3JSNA 3W7SA 3AG1B 4Z1VA 4RO2A 4MVOA 3KZIZ 1Z2GA 2LGQA 3IJ4A 4H44B 2W0XA 2ZE6A 1AR5A 2CTRA 4ABMA 1R3JC 2Q0OC 4I0XB 5J2TA 1MABG 1ZL8B 1RSOA 3RYCA 3MDSA 2Q5ZA 2YXYA 3W7UA 1VQ9V 4PI2A 2L6LA 1BSMA 4I4TA 2YICA 4TV9B 1E1RG 3K06A 3OT7A 4HNAB 4CC5A 1M56C 1QU7A 4DUYO 1I94O 4ZBMA 2C2AA 4NR1A 5JVDA 4MVUA 4X65B 1AJNA 2B1IA 2ZM6O 4LF8O 2JVDA 2PTMA 3BEHA 5DN6G 3OGIB 1RP3B 2O57A 2WWWA 4U7OA 4LF6B 4GCZA 2GUZB 3APOA 4X65O 1I5YA 1RPOA 1HDJA 1RFYA 1Q8IA 4EB6B 2IM9A 1Y74B 5BXZA 4LFAB 4K3AA 1JA8A 2YC0A 4X1IA 3DTUB 1DK1A 3GWOA 2UU9O 2GDSA 2F4VO 1QLEC 1SQXH 2FL4A 4H0LB 3CXCU 4B7EA 1WLEA 1SETA 1HR0O 5TISZ 5H2FZ 4WBNB 3A8TA 3I55V 1SA0B 4CC6A 1HNWB 3L72H 3ETDA 1MOFA 5EK0A 5CA0B 4NYKA 2EBOA 1Q86W 4JI4O 3SJCC 2NN4A 1XL4A 4ZOLA 4LH6A 3CHXA 2A0LA 1MG1A 4LNUA 3APQA 1FFXB 3K5LA 3LNNA 4JI8O 4I5SA 1JCHA 3CCRV 1NTMH 3E86A 4QE9A 1L1FA 3CRMA 2UXCO 2EJ7A 3CYOA 1NTZH 2ZE7A 4IHJA 2ADPA 2CTPA 4HAMA 3CC2V 3K9SA 3J81N 2XUMA 1SC5B 4CH3A 4G28B 4HNAA 3JASA 4DR5B 5CBFA 2FB5A 3AK3A 4G27B 5B1AC 4FFKA 4AI8A 2ITDC 4FM2A 3ZHSA 5CA3A 3HKDA 1Q7YW 3BCCH 4B08A 2PF4E 3SYCA 4DR1B 3E8FA 1ZSPA 4PD4F 5LBQA 4LC1A 2GTAA 4R50A 2VQEB 3E22A 4NKGB 4O4LB 4JI6O 4GX0A 1D2DA 4NXNB 4I0XA 3RW0A 5J2TB 1NJIW 4DR4B 1AR4A 3ZRWA 5KUKA 1N33B 4X1KB 3VOUA 1QBZA 1NQTA 4GX1A 3RN4A 3UKMA 1FFTB 5IY5B 2OTLV 2ADQB 1OJHA 2Y4TA 1GMGA 1WN7A 2Q4PA 5LGTA 4O4JB 3ABMC 3L71H 4EFBA 3FD9A 2EIJB 3G6BA 1Y4MA 1Q82W 2OYQA 5CA1A 3K79A 4DW1A 4J80A 2KG7B 4ICGA 5CB4B 1AJPA 3SPIA 2ZR2A 3FX7A 2IJKA 2GUZA 4OXSA 3RVYA 1BQZA 1XNQO 5E79Z 4DV6O 1QVFU 1Q6HA 5B1BB 4RQEA 1SKVA 2OCCB 4FLVA 5L3EA 4K8ZA 2UXXA 4TQDA 2BSKB 3MAQA 2JJ1G 4BW5A 4MVQA 1XDCA 2PZSA 3SPGA 2IJHA 3SPCA 2LQTA 3TGUH 2VWKA 3AG3B 3M99B 3CEIA 1GK9A 5FNVA 1WNSA 4EKWA 2QM8A 4B3TO 3JAWA 2R9RB 1YVWA 1QLEB 3F7VC 2VRZA 4B3RO 3P32A 2EIKB 3SDLA 4ASUG 2DYRC 2LGWA 2UU9B 2QA4V 4IIJB 4J11A 1VF7A 2QWQB 3FYEB 4O4HA 4FFBB 5GTIZ 2Q69A 4DRXB 1I0HA 4JYYA 4DV7O 5KX5A 2VWJA 2Q68A 4PELA 4DV5B 1BGYH 4JGSA 1YTFB 1AR1B 1DTOA 2RMKB 2PYJA 2WLKA 3ZN0A 4ZHQB 2WA3A 4JI4B 4NTYA 4GZRB 4JZ2A 4O4JA 4OPAA 1IXBA 3RYHB 5EZYA 2M6YA 1OCCB 4MTGA 5LP6C 3OTOB 1KP2A 4LR3A 1R6TA 5LXTB 3JATB 1D5NA 3M8AA 1S72V 2VQEO 4AQYB 5IE9A 1VQNV 3VBBA 3Q4HB 1HR0B 2QE7G 1M9NA 2YXHA 5K1XA 1E1QG 2WLLA 2VQFB 1N34O 1K8AW 1N33O 3LDEA 1SESA 5LHHA 3D3QA 1NH2D 4LF7O 3W7XA 1EBOA 3VQVA 5IYDO 3ETEA 1BS3A 4HYOA 4DV1B 4UB8Z 1G6UA 2N04A 4KHPO 2UXDB 4UCSA 4J41A 2QSAA 3AG1C 3HB3B 3ZHTA 1US6A 5BMVB 4W4LA 1YHQV 3L75H 4UCOA 2DYRB 3OR7C 1N32B 5B1OA 1HNXO 3QG5A 3OTFA 1ZAUA 4P9OA 4PHZA 4JI1B 1AVMA 1EN6A 3ABTA 1NBMG 3SPHA 3KCYA 4IYIA 1MMMA 3RYIA 4NTWA 3B40A 2H3OA 5CBGA 5B3SB 1Q5OA 2WLJA 1KP3A 5HFMA 1KECA 5KHJA 4TSFG 1AP6A 2AHYA 3CE2A 4AILC 5LGUA 3RYFB 5IWAB 5IYBO 5DM6V 5JCOA 1GM9A 1K97A 1P84F 1VMGA 1QR8A 2CGOA 3HKBA 5J9PC 2Q8VA 4I55A 1DF5A 2E5LB 2XAQA 1W0KG 1VQ5V 1IZ3A 3B77A 5D5QA 3RVZA 3JARB 3JCZA 2OWOA 2GHYA 2ODMA
chains in the Genus database with same CATH topology
1XOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOU A; 
#chains in the Genus database with same CATH topology
 1A32 A;  1I7F A;  5F2V O;  1IXM A;  3ZN1 A;  4O4I A;  4R7C A;  4JYA B;  1L8D A;  2WLI B;  4BWA A;  3W7T A;  2M7W A;  3ASN B;  3CC4 V;  2JS5 A;  5LMU B;  1B06 A;  4GX5 A;  1K9M W;  1GTO A;  1AP5 A;  3JD4 A;  2NLJ C;  2XAF A;  3ZMS A;  4PJ0 Z;  1XEQ A;  4XDK A;  4B7K A;  1PKX A;  4LF4 O;  5LYJ B;  1VF5 B;  1NVP D;  1Q3E A;  3QF7 A;  4MVM A;  2LO1 A;  5B1N A;  3CRR A;  3E2E A;  2DMX A;  4GLX A;  1N0J A;  2XT9 A;  3WFV A;  1Y76 B;  3T1Y O;  1WAZ A;  3OMI B;  1OCO C;  3MHH C;  3LSQ A;  1VQM V;  1KC8 W;  4WBN A;  1PL4 A;  1SA0 A;  3Q4H A;  4JTA B;  1ROP A;  5LP6 B;  2F66 C;  4X64 O;  1SF9 A;  3J80 N;  4U3F H;  1PPJ H;  1MA1 A;  3RWR D;  2UXD O;  5IT9 N;  4GUN A;  1OCR B;  2HKO A;  1H2G A;  1IBL O;  4I50 A;  4FZ1 A;  3TXS A;  2LP7 A;  4FVM A;  3LUT B;  3E35 A;  1T5E A;  2B9Z A;  3IC7 A;  2WSS G;  2EIN B;  5HFL A;  5JWP A;  2ZT9 B;  4X62 B;  2BOB C;  4N21 A;  3DXR A;  3TCU A;  4F4L A;  4DUY B;  5EIB C;  4P2Z A;  3ABM B;  5KA6 A;  1HNZ B;  2Q73 A;  1JVM A;  1XMO O;  3FAV B;  4DV4 B;  4FM0 A;  5GON A;  1GN3 A;  1EZV H;  1DF4 A;  3UT5 B;  1BL8 A;  1NKD A;  5JQG B;  4UFZ A;  3BFR A;  3STZ C;  3FB7 C;  3N2K A;  2GBO A;  1N36 B;  4LF9 O;  5BR8 O;  4JI0 O;  4FZ0 A;  3D36 A;  4I4T B;  3WB0 A;  3TK1 A;  2QTS A;  4K0K O;  3ZHV A;  3ETG A;  4DUZ B;  3AG2 B;  5E1A C;  3ZHR A;  2IU0 A;  4JV5 O;  1HNW O;  4MVZ A;  5ITZ A;  2ZM6 B;  2RNB A;  3QTC A;  4BW9 A;  4ZI7 A;  5EC1 C;  4FIP C;  1KYO F;  3G6E V;  3ICX A;  3FYI B;  1V54 B;  4CH6 A;  2E74 B;  4JAS A;  2JDI G;  2PI4 A;  2P67 A;  4DR7 O;  2DW4 A;  2UUA O;  2EIN C;  2YEV B;  2HFE C;  2ZXW B;  3QO8 A;  5JJE B;  1HW7 A;  3UM7 A;  2A3Q A;  2EIL C;  3ZMT A;  1CXZ B;  1COW G;  4GKJ O;  3AEI A;  3OM3 B;  3CD6 V;  3ZHQ A;  4X20 A;  3U0Z A;  1M57 C;  5KMG B;  3T1Y B;  5IYZ B;  4J7J A;  2AHZ A;  5EIB D;  3I5D A;  1VIB A;  1H2N A;  2CGN A;  5LHG A;  1NI8 A;  1OZ0 A;  2QJ1 A;  3OUS A;  2P06 A;  2X0L A;  2Y48 A;  4NB5 A;  3H1I H;  2Z5U A;  1JR9 A;  3CRQ A;  3ZMZ A;  4DR2 O;  3A0B Z;  1ZX3 A;  4WFF A;  2G38 A;  3T1C A;  5IJ9 A;  2OIE A;  3ZS8 C;  5IJ0 A;  1LUW A;  4D6T H;  1XIL A;  2P7T C;  3ASN C;  4CS3 A;  3ETQ A;  3LSS A;  2NR5 A;  2IU3 A;  4P30 A;  3P3P A;  1HWY A;  2Q7H A;  1IBM B;  3O65 A;  2QM4 A;  3CCE V;  4CS2 A;  4L87 A;  1XNQ B;  3R66 A;  1V9P A;  2EIK C;  4X89 A;  3SJB C;  4MTF A;  4QE7 A;  3LNM B;  1FXV A;  3CMA V;  4H37 A;  1FXH A;  3H1J H;  2HHH O;  2DYS C;  1O9G A;  2V7Q G;  5B3S C;  4PV1 B;  2P4K A;  4L8J A;  4X9Q A;  2RN9 A;  5LMN B;  4JI7 O;  3IC9 A;  4YJ2 B;  4Z1M G;  2EUL A;  5KX5 B;  5EYP B;  1BQ0 A;  3K9A A;  4LF5 O;  3L74 H;  1OCC C;  5IDJ A;  1M57 B;  4Z2W A;  4J10 A;  3BY6 A;  4DV3 B;  4X62 O;  4LF9 B;  4X1K A;  1YJ9 V;  2QM7 A;  1PNL A;  5B1A B;  4IL6 Z;  1KKD A;  3P30 A;  1XHX A;  4ZIB A;  3C90 A;  3ZJZ A;  1X59 A;  2XAJ A;  3T1H O;  3JAT A;  4HZ3 A;  3HR0 A;  4C7U A;  1JFF A;  2EIM C;  5C93 A;  3F5T A;  3ZMU A;  1WP7 A;  4DV0 O;  2BOC C;  4NTX A;  3L9D A;  3OD4 A;  2JK5 C;  1P4R A;  4FLW A;  1VQ4 V;  1QVG U;  1PP9 H;  4LFC B;  5IY5 C;  4TWK A;  4DV0 B;  2A7W A;  3RGB A;  3JCU Z;  3ASO B;  3ZX6 A;  1WB8 A;  2PGG A;  2UXN A;  5LOV A;  5DEC A;  3UCS C;  1TAE A;  1TVK B;  4IYH A;  3OR6 C;  2CK3 G;  2BTO A;  4LWS B;  4TUY A;  5KMG A;  4XBF A;  3CS5 A;  4JI5 B;  2ZXW C;  3OEE G;  4NVP A;  4PA7 A;  3B8N A;  4E4E A;  3BHP A;  4WFA V;  4KHP B;  2PI5 A;  1BZK A;  4DR7 B;  4YJ3 A;  2ZIO A;  3BA8 A;  2AXT Z;  4LFB B;  1EZJ A;  1H8E G;  4JAA A;  4JI7 B;  5DED A;  5IJ0 B;  1TUE B;  2CTW A;  4B3R B;  1WA8 B;  4D7S A;  4AHC A;  4OGQ B;  4YJ2 A;  4NXM O;  1V54 C;  4PI0 A;  2Q9L A;  3CWB H;  3UQ8 A;  1E79 G;  2KQX A;  1QLN A;  2X6B A;  2YI9 A;  3SYQ A;  3JD2 A;  3E8G A;  4O4L A;  1UJW B;  4LFB O;  3JAM N;  3CCM V;  2JGD B;  1THZ A;  4HBN A;  4DV2 B;  4DV1 O;  2FML A;  1B04 A;  4ZHQ A;  3SR2 C;  3CXH F;  3K5N A;  2GV9 A;  2YID A;  2B1G A;  1S3J A;  3RYH A;  2YUA A;  4JF3 A;  4JYA O;  1G1X B;  1YSC A;  3TXQ A;  1M56 B;  3BVO A;  5LA6 B;  5LXT A;  1H2L A;  1IBK B;  1S5L Z;  2YIA A;  4MTX A;  1AJQ A;  2E3C A;  3G4S V;  2HVJ C;  1QCE A;  2KG7 A;  1XMQ O;  3SJA C;  1FS0 G;  2E75 B;  3BRC A;  2HLD G;  3ZED A;  1WB7 A;  5FLX N;  2QWP B;  5L3C A;  4W4K A;  4LFA O;  1KQS U;  4CH5 A;  4JI2 O;  1Y74 A;  1SS3 A;  5LP6 A;  1YI2 V;  3S3W A;  5L3G A;  4N23 A;  1VF6 C;  4FLZ A;  1SQQ H;  4GKK B;  2CTQ A;  4F6E A;  2DE0 X;  5L3F A;  4TT3 G;  3CCQ V;  2QEX V;  4B3S B;  2N05 A;  3ZBH A;  3DSQ A;  3JD3 A;  5L3B A;  4Q20 A;  4DK1 A;  2H94 A;  2BSK A;  3AK2 A;  4PDM A;  4I50 B;  2EX3 A;  2L35 A;  5LMN O;  2FYU H;  5CA0 A;  3AG3 C;  1RM1 C;  4FJC C;  4JAU A;  4TQF A;  3OAA G;  3DC5 A;  2EJR A;  1YZB A;  3CCJ V;  1WJZ A;  2QTO A;  3DXR B;  1FJG B;  4A5U B;  4DO2 A;  2IJI A;  1YF2 A;  1AI6 A;  4LNU B;  1KKC A;  1OCZ B;  3ZCC A;  1Z5W A;  3A2F A;  3RYF A;  4IIJ A;  2AZ0 A;  1VQL V;  3IAY A;  4UB6 Z;  3OTO O;  1TVK A;  2F1M A;  1EM1 A;  2QKC A;  3B2E E;  5EBM C;  5B66 Z;  1H2M A;  4OPH A;  1TA8 A;  5FNV B;  2BTQ A;  3HKB B;  1ORQ C;  1DLB A;  1B3Q A;  4I55 B;  1S76 D;  5EBW C;  3ZRS A;  3HKD B;  4RWU A;  1U96 A;  1SQV H;  3FB5 C;  4LBE C;  4YJ3 B;  2AZ2 A;  5D5P A;  1LR1 A;  2F4V B;  1S0V A;  1I94 B;  3KCX A;  1AIL A;  3EFF K;  4NXM B;  3K08 A;  4B3M B;  1R3L C;  2IH1 C;  3AG7 A;  3E22 B;  3VQW A;  4UVB A;  4FK5 C;  1DGS A;  4O2A A;  1H2K A;  4JAV A;  3G71 V;  3O9O A;  1N0N A;  5KHH A;  1GN4 A;  3WU2 Z;  4CBC A;  4LH7 A;  1N32 O;  1FXK B;  2WLL B;  2JGD A;  2NNU A;  1GH6 A;  1BCC H;  2R72 A;  3W7W A;  2EIM B;  2E5L O;  5JJN B;  2HG5 C;  3H1H H;  4X1I B;  4JI1 O;  4DV4 O;  4JYB A;  1FXK C;  1XHZ A;  2IBZ H;  1QHT A;  2ZR3 A;  2XOK G;  1M93 A;  4G2K A;  4WF9 V;  5LA6 A;  1IX9 A;  1OCZ C;  4PDV A;  1BHB A;  1KD1 W;  1XMQ B;  4PDL A;  1SQP H;  3L73 H;  2JS3 A;  1WPX A;  1J95 A;  1F7Y A;  3S3X A;  4GT1 A;  4K0K B;  2ZD9 A;  5JJJ B;  1AI4 A;  2ZIM A;  3G80 A;  1F4M A;  2BCC H;  4DXW A;  4PA6 A;  1L0L H;  2JEU A;  2EZO A;  1ARO P;  1K73 W;  4JPR A;  4JTC B;  4PA3 A;  1KB9 F;  3H1L H;  5BMV A;  3RBZ A;  5AG2 A;  5B1B C;  4UV9 A;  1GM8 A;  2AW9 A;  1GO3 F;  2ETN A;  1W2B U;  4R6Z A;  4J9Y B;  4QPJ A;  4MSW C;  1RSO B;  1RM1 B;  1LUV A;  1EFR G;  2IW5 A;  3HPL C;  5J2U B;  3K58 A;  3JAW B;  1F4N A;  3OFN G;  1R73 A;  4JZG A;  1ZWI C;  3ZHU A;  4EEQ A;  4WCE V;  4BAY A;  4YHH B;  1M5I A;  5FPR A;  2P4V A;  5LMU O;  1V55 B;  3BA9 A;  3CB2 A;  2EIJ C;  1JX9 A;  1IBM O;  3K57 A;  2WLH A;  1RPR A;  1VQK V;  2E76 B;  4WFG A;  4GKK O;  2XAS A;  4DR1 O;  4UV8 A;  1VP7 A;  1P49 A;  4LCU C;  2YSU B;  1NS1 A;  1XMO B;  4DV7 B;  1JMK C;  2B5U A;  1BT8 A;  1VQ8 V;  3JAK B;  4O4I B;  2P5O A;  3H01 A;  2CH7 A;  4JI8 B;  4J9Z B;  2YI8 A;  3T4D A;  2R70 A;  3UT5 A;  1QNM A;  3A0H Z;  3FKS G;  4JI0 B;  1MSW D;  4KUM A;  2Q7E A;  4EFE A;  5H5N A;  4DR6 O;  2OCC C;  1ENV A;  3QO7 A;  4TV8 A;  3D8C A;  5C8Y A;  3ZRX A;  5JVD B;  2CDY A;  4MVR A;  4X64 B;  3B4S A;  5LGN A;  1S77 D;  3OGC C;  1JJO A;  1OCO B;  1VQ6 V;  4BIU A;  4MS2 A;  2GSM B;  3STL C;  1S5J A;  5CMU A;  1ZTE A;  3EXA A;  1AI7 A;  1NVP B;  5EYP A;  3QO5 A;  3NR7 A;  1H38 A;  2D2C B;  4QNH B;  4DR2 B;  4BIZ A;  3JYC A;  3K59 A;  1R6K A;  3T1H B;  1S5H C;  3ABL C;  3ABU A;  2ZNI A;  2YEV A;  5JCO C;  2WAM A;  2Y0P A;  3SYA A;  4PDR A;  2QKA A;  4AQY O;  1SRY A;  1IVS A;  1D5A A;  3OUF A;  1AB3 A;  4X20 B;  3L70 H;  3F7Y C;  3JD0 A;  5LOV B;  3X2Q C;  3N2G A;  1J5E O;  5IYZ A;  4IHJ B;  2FTK A;  2Q67 A;  2UUB O;  1L0N H;  3K3W A;  2DYS B;  1K4D C;  4RUE A;  3WB2 A;  2XAH A;  3D3I A;  4ZOL B;  1OV9 A;  3LSU A;  4IGG A;  3ZMV A;  4B3T B;  4FLU A;  1GN6 A;  3U11 A;  1Y67 A;  4O2B B;  1YJN V;  3G67 A;  2W6J G;  3CCS V;  2UUB B;  5H6R A;  3HKE B;  2JJ2 G;  4U7N A;  5EBL C;  2UUC O;  2CH7 B;  4KFM A;  3I56 V;  1OHH G;  1XRE A;  1VF6 A;  5GON B;  3LDD A;  3SYP A;  3ZRV A;  1XNR B;  3JAS B;  1UPG A;  3E8H A;  4DV5 O;  2VQF O;  1N34 B;  2H8P C;  4TV9 A;  3TET A;  3GVM A;  1XBL A;  2ZDI A;  1XUQ A;  4DYL A;  1NR7 A;  2HEP A;  2F93 B;  3IGA C;  3N27 A;  3HKC B;  3VQX A;  5FL7 G;  2V4D A;  1KBH A;  4MVS A;  1WA8 A;  5KAI Z;  1Q43 A;  1ZLZ A;  2WLI A;  2QKS A;  2DQ0 A;  4ZI7 B;  5GW7 A;  2ATK C;  2OT5 A;  1NU1 H;  4DV3 O;  2GTS A;  3AG4 C;  3SJQ C;  5GTH Z;  1NR1 A;  1JOY A;  4KL1 A;  4CH4 A;  2ITC C;  2DJV A;  1Q90 D;  2P90 A;  3K5O A;  1TGO A;  3C3S A;  1X4T A;  3ABK C;  2A9H A;  2HR3 A;  3AG4 B;  3PN1 A;  4F6R B;  4TV8 B;  4DR3 B;  1AI5 A;  3QNE A;  1Y76 A;  1W0J G;  1P7B A;  2W6I G;  4QGP A;  5H6Q A;  1VQO V;  4LF8 B;  3J7A U;  5LL6 Y;  2LJ2 A;  3H9V A;  1I5X A;  5KHK A;  4DR3 O;  2CE4 A;  1IDS A;  2ZE8 A;  4H33 A;  3CSX A;  2YIB A;  2ZIN A;  4UCT A;  3LDC A;  3R65 A;  1MNG A;  5IJ9 B;  2UXC B;  3MHS C;  3CCL V;  1YEW A;  4JI6 B;  3OEH G;  1QQC A;  4JI3 B;  4CZZ A;  2KKW A;  3F5W C;  4PA4 A;  3CPW U;  2BE3 A;  5KLV H;  3FB6 C;  3QVN A;  4E2L A;  4ZKI A;  4J7Z A;  4I9W A;  4UCU A;  3CP1 A;  3WG7 B;  1HP8 A;  4JI3 O;  1PNK A;  2Z0A A;  3OMA B;  3P3N A;  3CRA A;  3ML0 A;  5A9G A;  1HNX B;  3HKC A;  1Q6I A;  1M1K W;  1YJW V;  3A0R A;  1W59 A;  2EZP A;  3B09 A;  2F43 G;  3GB7 C;  1IBK O;  1NTK H;  4GYC B;  1ZL8 A;  3SYO A;  5EC2 C;  3X2Q B;  4UVA A;  1JJ2 U;  3HKE A;  1YIT V;  3IFX A;  1O9H A;  2DWE C;  4OX9 O;  1MZF A;  1XNR O;  1BMF G;  3K0D A;  5CBH A;  2P6J A;  3BAB A;  4U3J A;  2BTQ B;  5BR8 B;  1MSD A;  4DV2 O;  2IJJ A;  5BZB A;  2N74 A;  5EZY B;  2LFS A;  2R9A A;  2AGA A;  1NT2 B;  3K5M A;  1FD9 A;  4J42 A;  4LF6 O;  4QIW F;  5KHG A;  2F95 B;  3UO3 A;  1YXB A;  2WLM A;  4WFE A;  5KA5 A;  1V55 C;  2YS8 A;  4RQF A;  1Q81 W;  5CA1 B;  3PJS K;  3TJT A;  3MD0 A;  2FKX A;  1G4Y B;  1H8H G;  1Y6X A;  2D3O W;  4O2A B;  4XDL A;  2HP8 A;  1Q6U A;  2QDO A;  2CUG A;  3VQY A;  4EB6 A;  3DC6 A;  1IUR A;  2WPD G;  4RUF A;  5B5E Z;  4DV6 B;  2K9P A;  4X8A A;  1XQ8 A;  3WG7 C;  3RYI B;  1K5S A;  4JYC A;  4FPP A;  1MZE A;  1CP9 A;  4X88 A;  1FFX A;  2PY5 A;  4JI2 B;  1K34 A;  3T2M A;  1HNZ O;  3JAL A;  4MW8 A;  1BHA A;  2HVK C;  2JGU A;  5BY1 A;  4CS4 A;  5JH7 B;  2ZE5 A;  2PYL A;  3OMN B;  1XI1 A;  5CN0 A;  3KG2 A;  4LWS A;  1CPY A;  3AK1 A;  2HHH B;  1I08 A;  4PA9 A;  1JQ0 A;  2Q7G A;  3H1K H;  1XL6 A;  3UO2 A;  1GN2 A;  1PL0 A;  1VEW A;  3JAR A;  3E83 A;  4GKJ B;  1KUQ A;  4DR5 O;  4X66 O;  4O4H B;  3ABL B;  5KUM A;  2Q6A A;  3FAV A;  1BE3 H;  2ILM A;  3CJH A;  4DRX A;  4U3J B;  2LW1 A;  2RDC A;  1SQB H;  1K3E A;  2R9I A;  1SQF A;  5JQG A;  4UXN A;  3ZRW B;  3GWK C;  2Q0A A;  2ZCE A;  1OCR C;  1Z5V A;  4DW0 A;  3E89 A;  4KXR A;  4H13 B;  1M4U A;  2LFR A;  2XND G;  3WB1 A;  2YXL A;  1FYJ A;  1F23 A;  4X1Y B;  3AG2 C;  2Y69 B;  3JSL A;  1NH2 B;  2ARH A;  5KHI A;  1R3K C;  4FLX A;  4B3M O;  2UXB O;  2K1E A;  2W0F C;  1F51 A;  3THO A;  2Y69 C;  1YTF D;  1R3I C;  2X6A A;  4MW3 A;  4B3S O;  2RCV A;  2OTJ V;  2MW2 B;  1K92 A;  3FFQ A;  1CEZ A;  1N4C A;  5A2Q N;  4FMT A;  4D7T A;  2ZKO A;  1NZ6 A;  5H9C A;  5LYJ A;  3E8B A;  2UUA B;  5L3D A;  2WA4 A;  2KB1 A;  3CCU V;  4MTO A;  2XAG A;  2DQ3 A;  5C8Y B;  4UCR A;  1YIJ V;  1H2S B;  1N36 O;  4I7Z B;  4R8C A;  1U97 A;  2JEX A;  3M7M X;  1KMI Z;  5CB4 A;  4UVC A;  1N8R W;  3OW2 U;  1TUB A;  2RJZ A;  4BR6 A;  2JIZ G;  4OX9 B;  3DGE A;  4DR6 B;  3N2G B;  4WFH A;  4BIO A;  2A06 H;  1GKF A;  2Z3Y A;  2JRI A;  4LFC O;  1VQ7 V;  1PNM A;  4LF7 B;  4XDJ A;  1G8M A;  3EVK A;  1WP8 A;  1PD3 A;  1R1B A;  1URF A;  3CJH B;  2V1D A;  2OIG A;  3RT3 C;  4O2B A;  3K04 A;  3JAL B;  4QPK A;  1LNQ A;  3U10 A;  1P7G A;  5IYC O;  3RYC B;  1VQP V;  2CAZ C;  5JH7 A;  4TUY B;  3CC7 V;  2IH3 C;  3OE7 G;  3BPZ A;  2EIL B;  1M90 W;  2A79 B;  1SER A;  4LP8 A;  4KP4 A;  2LW7 A;  3CCV V;  3RFR A;  3N2K B;  2XHB A;  4FLT A;  1R6N A;  4YHH O;  1UFI A;  1GAX A;  1ZUQ A;  1GRJ A;  1SZX A;  2UUC B;  2QWN B;  3B8M A;  4FM1 A;  2P22 C;  3CRC A;  4FFB A;  3T4Z A;  1SZT A;  2HJF C;  4MT8 A;  1Y66 A;  3D36 C;  5ITZ B;  4FLY A;  3JD1 A;  1EN5 A;  1JPX A;  2X7R B;  3JAK A;  4DK0 A;  5LHI A;  4YXW G;  1QR9 A;  1YDX A;  3ABK B;  1YCI A;  2QWO B;  3CME V;  2F23 A;  2YDE A;  4LF4 B;  4X1Y A;  3K0G A;  4RAI A;  4UCV A;  4WFB V;  4UUJ C;  1EN4 A;  1TUB B;  3BAA A;  4YY3 B;  1K33 A;  2UXB B;  2Y4U A;  4JTD B;  4P9P A;  4F6R A;  3ZIA G;  2QR4 A;  2VS0 A;  1K4C C;  4GX2 A;  2WLN A;  1JFF B;  4DR4 O;  4QJF B;  2QGN A;  1B6Q A;  2KSD A;  1VAR A;  2OCH A;  1FKA O;  1XOU A;  3SGI A;  2DN9 A;  2QWR B;  4JI5 O;  1FXK A;  4TOI A;  2ZNJ A;  4YY3 O;  2DWD C;  4K35 A;  1PV0 A;  4JV5 B;  3SPJ A;  4Q6G A;  1KU9 A;  1PM9 A;  3CX5 F;  2RQ6 A;  3FB8 C;  4YIO A;  2ZDI C;  2ZQM A;  3KKY A;  4J7K A;  4LF5 B;  3ASO C;  5FPO A;  4I9Q A;  2X6C A;  1FPO A;  4YIP A;  4IT5 A;  2XTA A;  1K7D A;  2PUS A;  1K5Q A;  4X66 B;  1IBL B;  2HJD A;  4NXN O;  2Y0I A;  1J5E B;  5K1P A;  1SQG A;  3C3T A;  3EHB B;  5KAF Z;  3K03 A;  2YIB D;  1GM7 A;  4K8X A;  5IWA O;  3NXS A;  2DOS A;  1FAF A;  1FJG O;  2MK3 A;  1WPB A;  5J2U A;  4DUZ O;  3JSN A;  3W7S A;  3AG1 B;  4Z1V A;  4RO2 A;  4MVO A;  3KZI Z;  1Z2G A;  2LGQ A;  3IJ4 A;  4H44 B;  2W0X A;  2ZE6 A;  1AR5 A;  2CTR A;  4ABM A;  1R3J C;  2Q0O C;  4I0X B;  5J2T A;  1MAB G;  1ZL8 B;  1RSO A;  3RYC A;  3MDS A;  2Q5Z A;  2YXY A;  3W7U A;  1VQ9 V;  4PI2 A;  2L6L A;  1BSM A;  4I4T A;  2YIC A;  4TV9 B;  1E1R G;  3K06 A;  3OT7 A;  4HNA B;  4CC5 A;  1M56 C;  1QU7 A;  4DUY O;  1I94 O;  4ZBM A;  2C2A A;  4NR1 A;  5JVD A;  4MVU A;  4X65 B;  1AJN A;  2B1I A;  2ZM6 O;  4LF8 O;  2JVD A;  2PTM A;  3BEH A;  5DN6 G;  3OGI B;  1RP3 B;  2O57 A;  2WWW A;  4U7O A;  4LF6 B;  4GCZ A;  2GUZ B;  3APO A;  4X65 O;  1I5Y A;  1RPO A;  1HDJ A;  1RFY A;  1Q8I A;  4EB6 B;  2IM9 A;  1Y74 B;  5BXZ A;  4LFA B;  4K3A A;  1JA8 A;  2YC0 A;  4X1I A;  3DTU B;  1DK1 A;  3GWO A;  2UU9 O;  2GDS A;  2F4V O;  1QLE C;  1SQX H;  2FL4 A;  4H0L B;  3CXC U;  4B7E A;  1WLE A;  1SET A;  1HR0 O;  5TIS Z;  5H2F Z;  4WBN B;  3A8T A;  3I55 V;  1SA0 B;  4CC6 A;  1HNW B;  3L72 H;  3ETD A;  1MOF A;  5EK0 A;  5CA0 B;  4NYK A;  2EBO A;  1Q86 W;  4JI4 O;  3SJC C;  2NN4 A;  1XL4 A;  4ZOL A;  4LH6 A;  3CHX A;  2A0L A;  1MG1 A;  4LNU A;  3APQ A;  1FFX B;  3K5L A;  3LNN A;  4JI8 O;  4I5S A;  1JCH A;  3CCR V;  1NTM H;  3E86 A;  4QE9 A;  1L1F A;  3CRM A;  2UXC O;  2EJ7 A;  3CYO A;  1NTZ H;  2ZE7 A;  4IHJ A;  2ADP A;  2CTP A;  4HAM A;  3CC2 V;  3K9S A;  3J81 N;  2XUM A;  1SC5 B;  4CH3 A;  4G28 B;  4HNA A;  3JAS A;  4DR5 B;  5CBF A;  2FB5 A;  3AK3 A;  4G27 B;  5B1A C;  4FFK A;  4AI8 A;  2ITD C;  4FM2 A;  3ZHS A;  5CA3 A;  3HKD A;  1Q7Y W;  3BCC H;  4B08 A;  2PF4 E;  3SYC A;  4DR1 B;  3E8F A;  1ZSP A;  4PD4 F;  5LBQ A;  4LC1 A;  2GTA A;  4R50 A;  2VQE B;  3E22 A;  4NKG B;  4O4L B;  4JI6 O;  4GX0 A;  1D2D A;  4NXN B;  4I0X A;  3RW0 A;  5J2T B;  1NJI W;  4DR4 B;  1AR4 A;  3ZRW A;  5KUK A;  1N33 B;  4X1K B;  3VOU A;  1QBZ A;  1NQT A;  4GX1 A;  3RN4 A;  3UKM A;  1FFT B;  5IY5 B;  2OTL V;  2ADQ B;  1OJH A;  2Y4T A;  1GMG A;  1WN7 A;  2Q4P A;  5LGT A;  4O4J B;  3ABM C;  3L71 H;  4EFB A;  3FD9 A;  2EIJ B;  3G6B A;  1Y4M A;  1Q82 W;  2OYQ A;  5CA1 A;  3K79 A;  4DW1 A;  4J80 A;  2KG7 B;  4ICG A;  5CB4 B;  1AJP A;  3SPI A;  2ZR2 A;  3FX7 A;  2IJK A;  2GUZ A;  4OXS A;  3RVY A;  1BQZ A;  1XNQ O;  5E79 Z;  4DV6 O;  1QVF U;  1Q6H A;  5B1B B;  4RQE A;  1SKV A;  2OCC B;  4FLV A;  5L3E A;  4K8Z A;  2UXX A;  4TQD A;  2BSK B;  3MAQ A;  2JJ1 G;  4BW5 A;  4MVQ A;  1XDC A;  2PZS A;  3SPG A;  2IJH A;  3SPC A;  2LQT A;  3TGU H;  2VWK A;  3AG3 B;  3M99 B;  3CEI A;  1GK9 A;  5FNV A;  1WNS A;  4EKW A;  2QM8 A;  4B3T O;  3JAW A;  2R9R B;  1YVW A;  1QLE B;  3F7V C;  2VRZ A;  4B3R O;  3P32 A;  2EIK B;  3SDL A;  4ASU G;  2DYR C;  2LGW A;  2UU9 B;  2QA4 V;  4IIJ B;  4J11 A;  1VF7 A;  2QWQ B;  3FYE B;  4O4H A;  4FFB B;  5GTI Z;  2Q69 A;  4DRX B;  1I0H A;  4JYY A;  4DV7 O;  5KX5 A;  2VWJ A;  2Q68 A;  4PEL A;  4DV5 B;  1BGY H;  4JGS A;  1YTF B;  1AR1 B;  1DTO A;  2RMK B;  2PYJ A;  2WLK A;  3ZN0 A;  4ZHQ B;  2WA3 A;  4JI4 B;  4NTY A;  4GZR B;  4JZ2 A;  4O4J A;  4OPA A;  1IXB A;  3RYH B;  5EZY A;  2M6Y A;  1OCC B;  4MTG A;  5LP6 C;  3OTO B;  1KP2 A;  4LR3 A;  1R6T A;  5LXT B;  3JAT B;  1D5N A;  3M8A A;  1S72 V;  2VQE O;  4AQY B;  5IE9 A;  1VQN V;  3VBB A;  3Q4H B;  1HR0 B;  2QE7 G;  1M9N A;  2YXH A;  5K1X A;  1E1Q G;  2WLL A;  2VQF B;  1N34 O;  1K8A W;  1N33 O;  3LDE A;  1SES A;  5LHH A;  3D3Q A;  1NH2 D;  4LF7 O;  3W7X A;  1EBO A;  3VQV A;  5IYD O;  3ETE A;  1BS3 A;  4HYO A;  4DV1 B;  4UB8 Z;  1G6U A;  2N04 A;  4KHP O;  2UXD B;  4UCS A;  4J41 A;  2QSA A;  3AG1 C;  3HB3 B;  3ZHT A;  1US6 A;  5BMV B;  4W4L A;  1YHQ V;  3L75 H;  4UCO A;  2DYR B;  3OR7 C;  1N32 B;  5B1O A;  1HNX O;  3QG5 A;  3OTF A;  1ZAU A;  4P9O A;  4PHZ A;  4JI1 B;  1AVM A;  1EN6 A;  3ABT A;  1NBM G;  3SPH A;  3KCY A;  4IYI A;  1MMM A;  3RYI A;  4NTW A;  3B40 A;  2H3O A;  5CBG A;  5B3S B;  1Q5O A;  2WLJ A;  1KP3 A;  5HFM A;  1KEC A;  5KHJ A;  4TSF G;  1AP6 A;  2AHY A;  3CE2 A;  4AIL C;  5LGU A;  3RYF B;  5IWA B;  5IYB O;  5DM6 V;  5JCO A;  1GM9 A;  1K97 A;  1P84 F;  1VMG A;  1QR8 A;  2CGO A;  3HKB A;  5J9P C;  2Q8V A;  4I55 A;  1DF5 A;  2E5L B;  2XAQ A;  1W0K G;  1VQ5 V;  1IZ3 A;  3B77 A;  5D5Q A;  3RVZ A;  3JAR B;  3JCZ A;  2OWO A;  2GHY A;  2ODM A; 
#chains in the Genus database with same CATH homology
 1XOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...