1XP3A

Crystal structure of endonuclease iv (ba4508) from bacillus anthracis at 2.57a resolution.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
LKIGSHVSMSGKKMLLAASEEAVSYGATTFMIYTGAPQNTRRKPIEELNIEAGRKHMEQNGIEEIIIHAPYIINVGNTTKPETFQLGVDFLRMEIERTSALGVAKQIVLHPGAHVGAGADAGIQQIIKGLNEVLTPDQTVNIALETMAGKGTECGRSFEEIAKIIDGVKYNEKLSVCFDTCHTHDAGYDIVNNFDGVLNEFDKIVGIDRLQVLHINDSKNVRGAGKDRHENIGFGHIGYKALHHIVHHPQLTHVPKILETPYVGEDKKDKKPPYKLEIEMLKNGTFDEGLLEKIKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Endonuclease IV (BA4508) from Bacillus anthracis at 2.57A Resolution.
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords endonuclease IV
total genus 98
structure length 297
sequence length 297
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2004-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1xp3A00
3M0XA 3QXBA 3AAMA 3WQOA 2OU4A 3VNKA 4HGXA 4EAYA 6XIMA 2QUNA 4K3ZA 4XSLA 4YTSA 5H6HA 1D8WA 1A0EA 4DUOA 4PGLA 4A8LA 1XLFA 4US6A 4YTQA 3TVAA 1XIBA 3L23A 3KBSA 4QE4A 3XISA 3U0HA 1XLEA 1QUMA 3KBMA 3QC0A 4QDWA 2HCVA 3BZJA 1XLGA 3KBWA 5H1WA 3M0VA 4A8IA 3CQKA 3OBEA 3KTCA 4XIMA 1DIDA 4LNCA 3U3HA 1DE6A 4PFHA 4EACA 5B7YA 2XINA 4HNOA 3UU0A 6XIAA 5EMJA 3DBNA 4YTRA 1MNZA 3N4AA 5B80A 5XIAA 1O1HA 3XINA 4A8NA 3KWSA 4QE1A 4X61A 3KCJA 4XKMA 3UA3A 3CQIA 3KCOA 3UVAA 4ZBCA 1XLJA 3CQHA 2NQJA 2GYIA 1XIDA 9XIMA 2G4JA 4ZB0A 3ITYA 1XIMA 3BANA 1CLKA 2XISA 4X63A 1XIEA 4ZB2A 1DXIA 2QULA 5EMMA 1XLKA 1XINA 1XYBA 4HHLA 3IUIA 5XIMA 2I56A 3DX5A 3ITVA 3VNIA 1TZ9A 5AVNA 3M0YA 8XIAA 2NQHA 1I6NA 3VYLA 1A0DA 3P6LA 4ZB5A 3VNMA 2HK0A 3ITOA 4A8RA 1DIEA 1XLBA 1XLLA 3AYVA 3BDKA 1XYCA 2X7VA 4X60A 4YTUA 4OVXA 1XYAA 3QZAA 2G0WA 3XIMA 1A0CA 1S5MA 3QYSA 3CNYA 1XLAA 5EMKA 4GQBA 3CQJA 8XIMA 3GNXA 4QDPA 1QT1A 5FA5A 1I60A 4Q7IA 3JU2A 2GLKA 5I7GA 1XYMA 1BXBA 3ITTA 2ZVRA 4KW2A 4YTTA 1YX1A 3AYTA 4G56A 5EMLA 1S5NA 5TNVA 1QTWA 4GJJA 3LMZA 1XIIA 9XIAA 3C0LA 3KBJA 3C0QA 2GVEA 2XIMA 4XIAA 1XLMA 1BXCA 2GUBA 4E3VA 3TC3A 1XLCA 1K77A 3KBVA 1XYLA 3UA4A 3UXIA 2HK1A 1GW9A 1XLDA 1XIGA 5J8LA 3VNLA 7XIMA 3M0MA 5AVHA 4QE5A 4GLEA 2ZDSA 4QEEA 1MUWA 3M0LA 3AALA 3ITXA 3CWHA 2QUMA 4DVOA 2I57A 1XP3A 3KCLA 2NQ9A 5XINA 1DE5A 1XLIA 3BZGA 1XLHA 4W4QA 3P14A 4XSMA 1XICA 4J4KA 1XIHA 2Q02A 3KBNA 1XISA 1XIJA 3M0HA 4XISA 3NGFA 3VNJA 4K1GA 3IUDA 3C0SA 1XIFA 2QW5A 4GJIA 1OADA 2X7WA 3ITLA 2J6VA 4HHMA 3BWWA 5C9ZA 3FVMA 5B7ZA 4QEHA 3IUHA
chains in the Genus database with same CATH superfamily
3WQWA 4MZYA 3WDRA 1KCXA 1MVYA 1ESWA 2V82A 4R85A 1UKQA 2UY2A 1JDAA 2YL6A 4GIAA 3OBEA 1Y7VA 4PFHA 2GK1B 2V5JA 2ACUA 3MO7A 2H8ZA 2YCEA 1ITUA 4UOJA 1MW1A 3L2IA 1WBHA 1IT0A 1TB3A 2ZZ7A 5F1UA 3PSWA 2HE8A 1V03A 3DI1A 1K3UA 1HKWA 4M51A 3GNOA 1SQ7A 2XIOA 4LAKA 4H41A 1Q63A 1TJRA 4Y7EA 2VR2A 1E73M 1VD6A 1P43A 3CB8A 4HA1A 2BG5A 3TQ0A 4NXSA 4A4AA 4QJ4B 1EIXA 3FDKA 3NEHA 3CNYA 4O4WA 2AL2B 3VCNA 4TX6A 4AC7C 1TKKA 4JD4A 4ZO9A 1C90A 3KBJA 1X38A 3II1A 1R5YA 4JPGA 2BB0A 4QR6A 3VPLA 1R3TA 2GJPA 3DECA 4OT7A 4PB4A 3F4NA 4LGXA 3WX7A 5BRBA 4JXCA 1PX4A 1SO4A 1WDSA 4IH3A 4LV4A 2QUMA 3BAKA 3HG3A 4C6IA 2NQ5A 2V5LA 4DJFC 1PAMA 5H2ZA 2Y89A 1FHVA 4PH6A 3AMCA 3KVLA 4NZ1A 2AAMA 3MKKA 3VDCA 3WBWA 3TTOA 3GC5A 2KX9A 3I4KA 1B3YA 1QRQA 2X1RA 5H8MA 4S39A 4ZMGA 3GVWA 1XIBA 5A69A 3KW3A 3CJPA 3FHAA 3W7RA 4W85A 2OZTA 3DESA 1T5AA 2PFHA 4D6CA 5LA1A 2Y8UA 1DE6A 3PWGA 3M7SA 1TCMA 1LWJA 3HPFA 1ZAIA 1HJQA 1X8CA 3CQIA 2OSWA 3GVQA 2WVUA 3ABRA 4IGHA 2VC9A 3GX9A 3HGRA 4IF2A 1Z32X 1EKOA 3NOEA 4ZB2A 4JQ2A 5A3HA 1Q2SA 5LIUX 3KDOA 1CEOA 5E0CA 2Y6ZA 2DH3A 5FSDC 3T05A 1E4LA 1EWDA 1JAEA 3WLQA 2OTDA 1AJZA 2OT0A 1LDCA 3NSXA 2ACQA 3BSMA 4IOTA 1UZ4A 2DVUA 2HRWA 2JIWA 1XCFA 1T40A 3ZVHB 1W1A1 3GG8A 2PD9A 3WBXA 1MFUA 3VNLA 2NLYA 3S9ZA 4MYXA 3CU2A 4RNHA 3SRHA 2UZ9A 2F61A 5D03A 1DVJA 1GKRA 6REQB 3M0HA 3GU1A 1C8XA 3ITLA 1C9DA 3QOMA 4E2VA 2OEJA 2FZMA 2PDJA 4HPJA 2VURA 5HA7A 3IK2A 4LSBA 1B57A 3QOKA 3G6LA 1NWUA 1UIOA 3E3HA 3MQTA 3VTRA 3KLKA 3DBNA 4EIVA 4K7YA 1D3HA 3I65A 2XG9A 3KWSA 5EL1A 1JPKA 3KS5A 3UETA 1LRNA 2O55A 3URBA 1XH1A 3WDHA 5LXXA 2DY3A 1K4GA 3CUXA 3IS4A 3CAKA 2OKTA 3PFRA 2FH6A 4GKLA 4E2DA 4MIMA 3LQGA 3S1XA 5A6JA 4IUGA 1V93A 1KM6A 2X40A 4KFPA 4QQUA 1WV2A 5E6YA 5FL1A 3AIQA 3IGSA 2PU1A 4N4QA 3OYXA 5JIPA 4Z08A 4V28A 3RGTA 5LNSA 3QFWA 4MZ8A 1S5NA 5K9XA 3QMTA 2PCQA 5EBUA 1J96A 2CLFA 1VF8A 5CPTA 1OD8A 1F9CA 7REQB 4TVCA 2D73A 5XINA 1L8PA 1TE6A 2BXZA 3GD6A 3J7HA 2TSYA 2GSJA 4EAMA 2YDSA 4GG9A 4GI6A 5ECVA 4GH3A 3LU2A 4DLFA 4A3YA 1Z41A 4GH1A 5K3VA 4JCMA 3PVFA 2P0OA 3M5VA 5I24A 2QCHA 4JYDA 2FMNA 2BHZA 2ZUNA 2DORA 4AUBA 4C90A 2WSKA 2OYMA 2F6UA 4PYSA 4GYJA 2Z6IA 3EOEA 1U22A 2RKXA 3RM4A 5AY7A 3VDGA 2INFA 3AISA 3ANVA 4HQVA 1A53A 4O13A 4ACZA 4IG2B 2OX1A 2Z26A 2EG7A 6ALDA 2WVTA 1QDSA 3WD2A 2EGZA 4AMAA 3QPYA 3GIQA 4UTLA 4U3AA 5AOUA 4LUJA 3QQ0A 1NOWA 1J18A 4IX2A 1G1YA 2GQ8A 4UNIA 2G3MA 3PPGA 3WDJA 4PL1A 4GYPC 3GNDA 3WF4A 2QDHA 4CNUA 3V0TA 4YNGA 4DF0A 3GDBA 4H6RA 1JFXA 3WLRA 1J0HA 3OVQA 1TUXA 4DLMA 3N12A 1QNVA 2BNJA 2NWRA 4FNQA 2Z1KA 2A3BA 8XIMA 1XH0A 5HWJA 2VZOA 1UR2A 4LF1A 4K36A 5EU9A 2PBGA 4H7CA 5M3WA 4LVGA 4QCFA 1IXOA 2FGLA 3NPUA 4H6KA 1R6WA 2DV0A 5FJJA 1K02A 3WNLA 4ZL1A 3SCTA 3BJFA 1DJNA 2DT3A 1K9TA 4L9YA 1DJWA 5I0DA 4JL2A 3R0KA 2CZVA 3BO9A 3GHTA 3BMWA 5C9ZA 4UMBA 4H7VA 2VOTA 1YBQA 3GUGA 3CM4A 3G8RA 3I4EA 3KBSA 4NASA 3PSVA 5SWUA 1ZBKA 1X7FA 1CWYA 2J7BA 4AEFA 1QFEA 5AHMA 1ICSA 1S3HA 3LRMA 1GYMA 2PURA 4I90A 1L6SA 1A4MA 3FEMA 3LHUA 3MJYA 5F4XA 4YLWA 4KS0A 4OV4A 2CITA 1ISVA 4RE2A 2WZTA 3CASA 3DG3A 4ONVA 4W5ZA 3OA5A 4MB4A 1NWTA 2ZE0A 1GQJA 4R9XA 3V3WA 1KFEA 3LBCA 3JR2A 2DZWA 1S5VA 4WZHA 5JBDA 2NVAA 8RUCA 3QV9A 4AVOA 4YCOA 2PA6A 3B0UX 2ZRUA 5FAGA 2WZEA 3BDKA 4WDXA 3TJLA 5JQ9A 4EXAA 4CD8A 1GVQA 4ORMA 2OPJA 4X22A 2HS6A 1JYWA 1MDLA 3B3DA 4FX6M 5TNVA 4GJJA 4QROA 2NVDA 1HX0A 1MXGA 3B4UA 1M7XA 4X2PA 3WF1A 1DJGA 2WMKA 1KBJA 1EPXA 1FCQA 3LG3A 4XSMA 4AYGA 2NX9A 3EOLA 1ALDA 1DWGM 4C6QA 3C0SA 1E3ZA 4JCLA 5M17A 3I6EA 3VMPA 3P0XA 1TV7A 2X1IA 2R1PA 2VP8A 4GX8A 3ZS4A 5U4NA 1YPXA 3SCPA 4UTHA 2X41A 2XWEA 3S5NA 3CHFA 4S3JA 3QGKC 3U3HA 2Y62A 3MHUA 1Z89A 2C71A 3PWAA 2FDSA 2KZHA 1PDZA 3VZYA 1GORA 2V8ZA 1R9ZA 1R85A 3XINA 3BUVA 4B3KA 1IZKA 4ZSTA 3GH4A 3VXGA 3F5LA 4NZ3A 7REQA 3UZXA 4XUYA 1Q8AA 1A5KC 1XIEA 3H7RA 5ABHA 1XINA 2I56A 2PLCA 1LYXA 1ZY9A 5IHRA 3TNOA 3ITGA 4JNYA 2J9ZA 3W53A 1PE1A 4ZE4A 3SRFA 1ODZA 4PCTA 2ZTJA 4GNVA 2NV2A 1P1XA 1XGZA 3U2CA 3I10A 3M16A 2Z1SA 3FX4A 4WY0A 3CTLA 3MYOA 1ME8A 2OQHA 3R58A 2GDUA 4JQAA 1TTIA 4HYWA 1E15A 3VO0A 4GIEA 4HNLA 1XCXA 2FGZA 2W63A 2QDGA 1M7PA 1BFNA 3H2OA 3BW4A 3AMLA 2WV8A 3F4WA 3RRXA 4FNRA 4J3UA 3L4TA 4FK9A 3W1LA 3NSMA 3W02A 1IQ8A 4HGXA 4LOCA 3TROA 4B5NA 4DJED 3VIJA 4D8AA 1I8JA 3MV11 3NIYA 4JOMA 3KRSA 3W7PA 1J2WA 4KGLA 1TPUA 1UD8A 2CIPA 3TXVA 1VBHA 4I5RA 3BTNA 4ILSA 3SUUA 1X1NA 4UMCA 4KWSA 3RJXA 1K03A 4W7UA 4S3KA 1OC6A 2E1DA 2YJQA 1DIOA 3SY1A 1KM4A 4LH8A 4LFYA 2Y8KA 1C93A 1OIMA 1E1CA 1LUCA 3VNIA 4L65A 3P6LA 2XIJA 4IHCA 5BZAA 5C9XA 1IT7A 5BNKA 1RPXA 2GFTA 4DF2A 4C65A 2DZAA 4WOQA 1ADDA 1CLXA 1GQKA 1VENA 4XVEA 3ITTA 6REQA 3UJSA 4R88A 1EJWC 1KFBA 1RQBA 3SCSA 4MKSA 1NFBA 4PBFA 2OXNA 2Z27A 2PP0A 2NV1A 3FV9A 1JIBA 4LUSB 1O95A 3H53A 1A80A 1E3XA 3LXCA 4ML9A 4R9OA 4HMEA 1VBUA 3TAOA 2C7FA 2PDQA 1JCJA 2JFEX 4GJ1A 3S5SA 1RD6A 1G4EA 4QEHA 2WMIA 5BROA 4GIYA 3I6TA 3V1HA 3NR0A 5FJUA 3OQEA 1TV2A 3UZWA 3ANYA 1L0PA 1IWAA 2IKGA 2VTFA 1JDFA 1VPQA 3VX0A 2INZA 4MLJA 1ISYA 4KKXA 4IPIA 3GDMA 5AYYA 1U2YA 4LCSA 1Q85A 2WZHA 4CKQA 4O57A 4BQ5A 2OB3A 3OLIA 3AI0A 3UPWA 1EQPA 3WH8A 3GYCA 4DIAA 1WDDA 1YRRA 2WHLA 1OBAA 2OX4A 1T41A 4DO7A 4GYPA 2E6DA 3UT0A 3SQLA 2QJHA 1TMLA 3QN3A 1RP9A 1RCOB 1I9CB 1NF0A 3QGAC 3WQEA 4X60A 1E1FA 5D9NA 4J3WA 1QK0A 4UTMA 5PTDA 4DUWA 4JTTA 2YW3A 4H8NA 2PWUA 4HSOA 5HNTA 4FA3A 1ME9A 3CWOX 4I6VA 5A2CA 3SN0A 5HDRA 3THUA 2FVMA 1TPEA 4CN6A 4RPQA 5HK4A 2WC7A 1Q5MA 1O5KA 4HJWA 3RLVA 1M5WA 3UZJA 3PWIA 3CZKA 2RDUA 2DGAA 3H7VA 1G9HA 2IKJA 4O16A 1SM9A 2YX0A 4Q3MA 2GGHA 3TKFA 1E71M 4PGLA 3PZQA 4CU6A 3O6YX 3TONA 5JMUA 3QBUA 3ARZA 5IBXC 1RXOB 4LNCA 4C6NA 3S1VA 5I79A 4O52A 4L6DA 2WKGA 1QBBA 3CWNA 1LLZA 3K1DA 2D1ZA 3LUTA 4K6AA 1GYNA 4JL1A 4JX5A 1MEHA 2E5BA 4W89A 4W5UA 4UFKA 1WZLA 3F03K 1JCNA 2VGBA 3RMEA 3TNBA 1GOQA 3RX2A 3V5OA 1EDQA 2E09A 3WY1A 2ZX9A 3A5FA 3KHDA 2IKIA 1BXNA 3N6JA 1F2JA 5EMKA 2D3NA 5C9WA 1KM0A 3RM8A 1XYMA 3UY7A 1V02E 3VINA 3FN9A 2J66A 3SR7A 1G4TA 4GBDA 1O12A 4MY8A 2Z0IA 3GE7A 1XYLA 5AC5A 4EPBC 3F2BA 3GWQA 1F76A 1ONRA 1PIGA 1IF2A 4TUFA 3RJYA 1YNQA 1G67A 1RCQA 4OZOA 1TMQA 2A0NA 3TFCA 4I9AA 4IGNA 2DZSA 4PTWA 1CXIA 3JZUA 2D2GA 2YYUA 1ZUAX 3K2GA 1OHLA 4YCPA 1ZHAA 5E6ZA 1XGDA 3GXNA 1EEPA 2ISFA 3WMBA 1UOZA 1BAGA 1D2KA 2OQLA 3FGCA 2DT0A 1K8XA 3W7CA 2WVVB 2DPEA 4XZBA 4JS3A 3ARUA 3EOUA 4F48A 4LUSA 3VD4A 5HUPA 2PLJA 2PAJA 4S1FA 1LG1A 2ZUSA 1UKPA 1I0BA 4F79A 3UY8A 2PEVA 5A8GA 1YE4A 4PEKA 4MHBA 3Q45A 1JQVA 4NJGA 3FIGA 1A5OC 3MB9A 1TA3A 1TPB1 4Z2HA 4JICA 3R4IA 3W1QA 4MWAD 4RZ6A 5A8MA 2CXGA 4ADSA 3LCGA 5BU6A 2D69A 3STCA 1XCWA 1TPVA 5C71A 2PD5A 4CNNA 3E02A 4AZ6A 1MMFA 1Q4NX 4RDZA 1Z69A 4OFCA 4E3TA 4OBSA 4Q6XA 1YX1A 3VDHA 4HZMA 3UGRA 3Q65A 3FYYA 3VKKA 4LUIA 3RCMA 1KFWA 3S5OA 2HTMA 4MJMA 1KXQA 1W32A 4IQDA 3HJEA 4EP8C 1WKYA 4HHHA 3H24A 1UWTA 2B4GA 3MBDA 2PWFA 5KZ6A 4AD2A 1M9HA 2P88A 4RNFA 2ACRA 1GZ1A 1XBXA 3JRKA 4UIOA 4BKNA 3GXFA 1OYAA 1GQNA 1UD4A 1BWVA 1SFLA 4US6A 3ZMRA 3KBMA 5BMXA 1W8SA 2W3ZA 3KBWA 4FLOA 2FJKA 1PPIA 2PWEA 3WLSA 1TSIA 2WJZA 3UU0A 4W8BA 1R9XA 7TAAA 4CD5A 1NU5A 1SZFA 1VPYA 3GXIA 4D6GA 1UH3A 3WLOA 5CJMA 3T2QA 1RHCA 3CQHA 4MJ4A 3IGHX 4MUZA 1XIDA 3R0DA 4C1KA 1LBMA 3UXKA 3NPVA 3S5YA 4Q7BA 4A2RA 4B5TA 3W7DA 3IANA 4TU1A 4YU1A 5GQBA 5TD4A 4YL2A 3M0IA 5LZLA 3BL3A 3B40A 1JXKA 2NW0A 1A5AA 1GJWA 3TN5A 2X7VA 2VMFA 2I5IA 2AL2A 4RZ5A 2J8FA 2ZA2A 1V3JA 3LLXA 4FB7A 5KZEA 1KXVA 3IAQA 1FCBA 3KEHA 1PKLA 4AU0A 5EBAA 2CU0A 4H19A 4WOZA 2OEKA 4JIHA 1E5JA 4P7RA 1NEYA 1J01A 4NIRA 4K7VA 2DSVA 3WG6A 1O6IA 4XD4A 3O1NA 4YYCA 3WEZA 3NYZA 4W86A 4IQEA 3GU9A 2VCAA 1M68A 3MMUA 3SIMA 1H7XA 4RZBA 2BVDA 3AS0A 1DYSA 3EWBX 1W1YA 3NQEA 2YXOA 3SN1A 1MEWA 1X39A 1FH8A 1UWQA 2WSPA 3RO6A 3MYPA 3TFXA 4NYYA 4LAZA 4W8AA 3TLLA 4OE7A 4Z2LA 3UR2A 2D2OA 3A23A 3A21A 4D1JA 1UWAA 1KRBC 5C6MA 5G2HA 4NJKA 3BANA 1BVNP 4EOUA 1HO1A 1PB0A 4J28A 2PWDA 4AEEA 3FDGA 4WXZA 2XVNA 4EX4A 4BF7A 5DEZA 1GZJA 2JBMA 1JGIA 2WVVA 2ZX5A 1JVNA 3S1GA 1VFOA 3EBVA 4OVXA 1BD0A 3WLIA 4BY3A 4LAUA 3FSUA 2Z1WA 2J7GA 3HPZA 4FALA 4FNUA 3I3EA 3D47A 1F3EA 5HMSA 5I07A 1YTEA 3UWQA 3N6HA 1CB2A 1NDYA 1QASA 3AYSA 1JNDA 1YPFA 2O9PA 4HP5A 2DSWA 3TR2A 3C3UA 1PIIA 5FACA 1WPCA 5F2GA 2FZ8A 1FWRA 4JHZA 4L4MA 4U3CA 4QRNA 4JIEA 2Z29A 4B15A 1Q2RA 5CC6A 3V1PA 4N9EA 4XISA 3B97A 1QO2A 1DWIM 3HMCA 3KRZA 2X42A 2ZUTA 1SGJA 4L6OA 1DL3A 1NFGA 4XTDA 3G1HA 3L2LA 4MPQA 4B4HA 1XC4A 2GGGA 4AF0A 3L4UA 4ORIA 1PEZA 1XLGA 3QZ6A 3S4TA 1ODUA 3ARTA 5EMJA 1H63A 4YTRA 1RK5A 2HWGA 2BFGA 1UA7A 1MUCA 3KE0A 1EOKA 4ZBCA 2DJLA 4LJ3A 3WFZA 2ZRVA 1XUZA 3G1YA 1W5NA 1GVEA 3O07A 3CXOA 4GC4A 2BMBA 2YXGA 1MNSA 4G2DA 1M65A 2F38A 5A6KA 4PB5A 1VBGA 4RE3A 4G8TA 3G1VA 4UTWA 1W31A 2WOQA 1HGYA 1UUQA 1Q13A 1RUSA 3M0ZA 4AG0A 3WMLA 4NSBA 3TW6A 5D2TA 1LOLA 3SGUA 5K2ZA 1PBGA 4JTCA 2NUXA 5DF0A 3R79A 2UBPC 4NF7A 9XIAA 4JTRA 1W1PA 4I8YA 2VEIA 1IGSA 2D0GA 3ABSA 5CPMA 3WL1A 4S3CA 1OCQA 2YZ5A 2CKRA 1J5SA 2BVWA 1SFTA 5MKGB 2GJNA 4HZ6A 3LOTA 3GVRA 4AB4A 5FJRA 3PUOA 1MQQA 4LBRA 3H4WA 4M19A 1BSIA 4AISA 4ZENA 4WKHA 4KPLA 4MWAB 4L5ZA 5JH2A 3O6DA 3QJAA 1J0ZA 1YE6A 2YFOA 3RILA 5DLCA 3OHIA 4AZ5A 5CEWA 4C6FA 4CNTA 1Z48A 3O0FA 3TU9A 4PUUA 2R1KA 1MQPA 1TFVA 2R1NA 3GTIA 4MDPA 3MW7A 1UD5A 2CXEA 4K39A 1NWRA 4AZ7A 1VFMA 5ABEA 3SY8A 1GJPA 3BV4A 2I1OA 3GXDA 3BQ6A 3TZFA 2G95A 3WKZA 3GW3A 4HMCA 1HVXA 2XFWA 3MP3A 4DEFA 3IUIA 4DB7A 2J7HA 2PGWA 1E43A 1LQ0A 1PCWA 1QWKA 4PTNA 3H2CA 4DX3A 1WDPA 3LZ3A 5HPCA 3H6OA 4FI4A 2XUCA 2PDMA 2YBUA 1PUDA 1B54A 1XRTA 1H1NA 2Y88A 1EO5A 4DNMA 2Q3RA 3S6TA 2IQ0A 5IBXA 1XPYA 1JCXA 2QCCA 2ANUA 3ATYA 5I5RA 3R94A 1OABA 3M0MA 3TLQA 1JPIA 4XVDA 1XPGA 1QJWA 3E0IA 1ZQ5A 1NM9A 1GT8A 2PWGA 4M29A 4DM2A 5D38A 3SFKA 3M9YA 3AIRA 4J3XA 4R34A 1OF8A 2ZZ2A 4JR5A 3BMVA 2GGEA 2DP3A 1V0LA 3RNDA 3E1F1 3PBMA 2VEGA 4QTGA 1B9ZA 5IM51 4Y2WA 5IFTA 4A8IA 4YS1A 4I8DA 1VBRA 1P1MA 5DMLA 1WDQA 3QR1A 2Y7FA 3VZXA 1ZBWA 1W3JA 3UWVA 4A8NA 3AIWA 3L9CA 3BC9A 1I4NA 3GH7A 1IE7C 3NPWA 3CQ0A 1W37A 1H5YA 3U48A 1HNYA 3DYMA 1TX0A 3M6DA 2C0AA 4ES4A 1FP9A 2OMAA 5AVNA 3QW3A 5KZDA 3HURA 1W3IA 1X6LA 4L1GA 3G1XA 4AD4A 3XIMA 2JEPA 4N0RA 3ZZ1A 2VCBA 4TOQA 4PBGA 2EJ1A 3AYTA 4G56A 2E6FA 3UWZA 3R1ZA 4N02A 3NG3A 1YKWA 3OLGA 1AMKA 3H26A 4AZIA 3TCEA 3OLDA 4IMCA 3LS9A 3RCNA 3EEZA 2AOSA 3AUOA 1QCWA 2ZFAA 4PMRA 3VNJA 2YSWA 3MPGA 3PBVA 1G7VA 2J6VA 3PZVA 1EF3A 1T99A 1R3WA 4FMVA 4FXFA 1SO5A 5ABFB 2ACSA 2W79A 2OVLA 5HMEA 2I7GA 3M44A 2HSAA 3ARPA 4HYRA 4M7SA 3KTCA 1UWIA 3ARWA 3BJTA 5HAOA 2ZC8A 1YXDA 1NQKA 5K9DA 4JTKA 3C2YA 3ABQA 1QI2A 4ADUA 2GWGA 3MUXA 4DRSA 5GVJA 2QJMA 3MHGA 3O06A 4FF5A 3WH9A 3ZJ7A 2Y70A 3M43A 4IFRA 5L9FA 1FTXA 3W76A 3TMLA 3ZXWA 4ZTXA 3H7UA 1RCXB 3AIEA 3SSZA 1Q3NA 3VNDA 4LYKA 3NZRA 4N2YA 1PSCA 1BXBA 4GCXA 4J2MA 5I78A 2FZDA 1CXKA 4L80A 1GZGA 3GAYA 4K37A 5FD0A 1LT8A 3UESA 4KFNA 3LZ5A 2WZIA 1L6YA 1QI4A 3VMNA 1V3HA 4GUFA 4WHBA 1XISA 1E55A 4PUKA 4AYSA 3T0CA 4RDWA 2OFJA 1BRLA 5FJIA 5BXSA 2WKLA 4DWDA 3EOOA 3W82A 5TQLA 1NSJA 4CVWA 3A47A 2GUUA 1ZENA 4HN8A 1BWLA 1A47A 4ZOAA 1GPFA 3QHNA 4G7EB 3WBYA 4DELA 2J7EA 2XJ7A 2YL8A 1MNZA 6A3HA 1SFSA 1KA9F 2Z2AA 3VNZA 5HWNA 1VLIA 3F1QA 2GWNA 3HPAA 3OODA 1HO4A 2Y7DA 1RBLA 3SURA 3W1RA 2JKAA 3NZ1A 1ADOA 1TO3A 1QO5A 4JTJA 1W1B1 2PDPA 2FQIA 3D3FA 5CPQA 1Z3NA 2G4FA 2TYSA 3ISIX 2OZ8A 1W1ZA 1EP2A 2ZRXA 3OA3A 4QAWA 1V6VA 4CVUA 3MUIA 1W0MA 1H2JA 1U33A 1HVQA 1OSEA 4A05A 4RV3A 2VOMA 4Y9PA 3P8IA 4PMNA 3B8WA 2CETA 3N9KA 1W1TA 1X6NA 4WDTA 5FJPA 3AU2A 2VC5A 4Y96A 2BHUA 3HG5A 2V2HA 3PB2A 4DN1A 3KWXA 1WP6A 3W38A 1GVSA 2XH2A 1EHAA 3HV9A 1YDVA 4RCXA 2JGQA 2GZXA 4AVFA 4D6IA 2XGBA 4ZA0A 3FGCB 3K5XA 3MUZ1 2Z1XA 3T1GA 1XS2A 1UH2A 3TN6A 5IHSA 2CLLA 4P7QA 4EWND 5LNUA 4F8XA 1TVLA 3GUWA 4LV9A 4D6HA 3D3AA 3ALFA 4POCA 4LUTB 1M7JA 5A6BD 4PR4A 3CMJA 4LCQA 2RFGA 2QCEA 5LNWA 3NCOA 4JEQA 1PHQA 4HVXA 2V38A 4LWWA 5CJNA 3LHWA 4MADA 4DI9A 4CNPA 4U5KA 5E5CA 3IJQA 3MP5A 3U4FA 2NQJA 1W3TA 1T7LA 5BXTA 3B8SA 4ACYA 4M3PA 3KM8A 3P84A 1JCTA 2F6KA 2W67A 4V2XA 3ITOA 4H3DA 3WELA 4UC5A 3QV7A 5HJXA 2D23A 1F4HA 3ORWA 1KGWA 1N8IA 3E5BA 3U5UA 1BG9A 2W66A 1QT1A 6TIMA 1UPPA 3BCJA 4HOZA 1GWJA 1CXHA 3WNOA 3BLPX 3UWYA 2JF6A 1TPH1 3SQMA 4V33A 3SUTA 4ALDA 3UJ2A 4N9DA 3R11A 1EQCA 3R10A 1FBAA 2ISSA 2C1HA 2QCGA 4JTIA 4A3QA 1WB0A 4S3AA 1GTEA 3P61A 1G4SA 2C8NA 4GQ0A 1FA2A 2CLOA 3VC6A 4PCSA 3M0JA 2OELA 5AHLA 2W9MA 4GGHA 1XLFA 4QG6A 1FWCC 2Y61A 3LY0A 1ITCA 2BSLA 2VRQA 3L2MA 4C7DA 2Q3OA 2PCEA 3PTQA 5EMYA 3M5YA 4OBTA 1QNQA 1W5PA 3EA3A 1F73A 2V2DA 4MNKA 2B31A 2P0IA 2FPVA 1QNPA 4DXXA 1BQGA 3S1UA 1B4EA 1D8CA 4NZ5A 4HD5A 1CIUA 2XISA 5HNRA 2DIKA 3LNPA 1RQEA 5AFDA 1EYWA 3EA2A 3STPA 1SZEA 4G5DA 3IJ7A 1Q8JA 3VNMA 3N15A 1XJBA 3G1DA 4DJDD 1T6MA 1SZNA 2A3EA 3BICA 3G1FA 3PZUA 3PULA 4Q7IA 4H7ZA 5A2AA 4E8DA 5BXPA 2ON3A 2YB1A 3M4HA 5F1VA 1TWIA 2XIMA 3VDBA 3GR4A 4JFTA 4UFMA 4EXQA 4LYQA 1J10A 1KBBA 5HOSA 4C91A 1AUSL 3PPHA 2IKHA 2XIIA 3DOPA 3MSGA 2JKPA 2EPOA 3P80A 3IVSA 1UH4A 1ZL1A 3ZR6A 1EUNA 3BLLA 1R87A 4JGDA 1JF5A 3CH9A 4EXBA 2FJUB 1Y8BA 3Q2DA 2DSKA 5I09A 1Q7ZA 4Q7NA 4XTIA 2F2KA 4M6UA 4FPSA 1SYTA 2BP1A 3DCPA 4BF5A 4IIBA 3B4YA 3CQKA 4GXPA 4IJBA 5G5IA 4AVNA 3UCDA 3VX1A 4H2HA 4C6MA 3BSHA 4IMGA 3GRIA 1TTPA 4L4LA 4P61A 4B92A 2NX1A 4L4OA 1GHRA 4HA0A 1SR0A 5AYZA 1FXPA 2ZICA 1K9FA 1X1OA 2PF0A 4XKYB 4LS0A 3G22A 1PS9A 4XG1A 1ZTVA 3W84A 1KV5A 3SCNA 4UTIA 4CU8A 4NKCA 3DX5A 1CGUA 3ZT6A 3IVTA 3LYEA 1Q45A 3FNDA 3TE9A 1UD3A 3DC0A 3GQYA 1A5CA 4TIMA 5C55A 4AZCB 1JD7A 2ATMA 3OZMA 5EB8A 4C5YA 3G1SA 5T8GA 4DYEA 3B8TA 3QC3A 3PBGA 2J74A 4LC8A 1OFQA 3TX9A 3GG1A 3UA4A 4D6FA 4WVXA 3UFYA 2IPWA 3UPMA 2B7NA 4ZQPA 2FB3A 2BLEA 1S1PA 4UFIA 4UTFA 1JAKA 5I00A 1OC5A 1J11A 4EE9A 5CLTA 4PODA 2FB2A 4PMQA 4AFYA 2PRHA 4X3ZA 1R3YA 5I3FA 2A85A 3VOFA 4CNSA 4QNEA 1IIHA 5C7HA 4FNPA 4BS0A 5KINA 4TVDA 3NXLA 3E6EA 2Q8ZA 3QLLA 1VEOA 4CU7A 1O5QA 3D46A 1JJKA 4LBSA 3S9IA 4MNLA 2PGRA 3HGSA 4DWSD 3W1AA 2MNRA 9CGTA 3N4AA 2PRLA 1W2VA 1QVBA 1L6WA 2EBNA 2WBKA 4ZQRA 3STGA 3B04A 4WR3A 1S1RA 3FOKA 3M41A 4GFSA 1Q7QA 2GJRA 2J8GA 4K38A 4U10A 1FHUA 4REQA 3WEOA 3EGJA 1A0DA 3FXGA 3WUGA 1G7UA 1P6BA 4US5A 4KMQA 3AXXA 2XVKA 3UCQA 1HXJA 3N2OA 3E0LA 1WBJA 1JPHA 3UW6A 2X0SA 5FEPA 4LB3A 3E9AA 2P3EA 3T7VA 1OT2A 4JN7A 1BXCA 1B3ZA 3RPTA 1GGOA 3UBPC 1OEPA 1XI3A 1QNRA 3W25A 4N6EA 1LQAA 3KCLA 2XU2A 4O18A 4FX7A 3URAA 3EOSA 4QFUA 1EX5A 3H2FA 1GQLA 8CGTA 1DIKA 2AMGA 5FF4A 5GPRA 1KWKA 1AZ2A 4IFKA 2QR6A 4UXDA 4BZYA 3QTPA 1IZJA 5CBIA 6ENLA 5GJNA 1PKMA 5ECUA 2E68A 3RO8A 4XSLA 2HE5A 3OQ8A 1JYVA 1TUFA 3CUGA 4QIUA 4FOJA 2XGIA 2Z25A 1Y5XA 1MQRA 3LCFA 5BOFA 1FWAC 1E40A 5DY3A 3A9IA 3YPIA 1JZ6A 2W5FA 3LBMA 1EB3A 5CCZA 1VKFA 3QGVA 4I9MA 4JTGA 2P10A 3A12A 4IPLA 4B2DD 1TV5A 1XH2A 3UD6A 4DBDA 5BRQA 2X1TA 4JTEA 1E1CB 1CXLA 4DJFD 5FF7A 3B9DA 1JUKA 3PZNA 1W3HA 4C6CA 3W2MA 1ZLPA 4IJRA 3G1AA 4B3LA 1K4HA 1GKQA 2J88A 1AG1O 4H8UA 3SFWA 9RUBA 4CN4A 4OGZA 4F2BA 2VWTA 2PLMA 4G6CA 5D05A 1JRCA 1H50A 3LHZA 4MGGA 1E9LA 1JZ8A 5BU9A 4DUXA 3W1MA 2PSNA 3C5QA 4Q4KA 4GVFA 1XLMA 2EXOA 4EF8A 4F0HA 2J78A 3OBAA 3WQDA 1SJAA 4JIQA 3N2MA 3H22A 1IEXA 5FI8A 1DP0A 2HZGA 1YNYA 2DUAA 3ANUA 4MF4A 1J0YA 3P60A 3C2VA 3PUGA 1XIJA 3KP0A 4B5WA 4FOKA 3W3OA 3GHUA 3WLLA 3EDFA 1MRQA 2FPYA 3UJRA 1V3MA 3IPWA 3N3TA 2Q6ZA 4P8WA 4NAFA 3D6NA 4JTAA 4UNLA 3CLMA 5LIKX 1M01A 1N82A 2QCDA 5IDIA 2GQ3A 1UR1A 1PJ9A 4I6KA 1FFRA 4OTKA 2V3EA 2VGIA 1SPQA 2WMFA 1E6XM 4DXVA 2OWXA 4NI8A 1UBSA 3VM5A 4Q8OA 1EJUC 1CECA 3AZSA 1I1XA 1S2TA 2XGZA 2CLMA 1I6NA 1WZMA 3WUFA 1PHWA 2VI0A 3REQB 1QNSA 1WKDA 3G3MA 1CENA 4CQ9A 2QF8A 4J3SA 4CQBA 1LZOA 3C2OA 1S5TA 4CQ8A 3CK5A 4C1NA 4ICNA 3QV8A 3VNYA 4P7NA 2DZPA 4IFOA 5A5WA 3M7WA 2W92A 2ZIDA 5D9OA 2Y5SA 3ITXA 2GGIA 1CW2A 2HJPA 3L4ZA 4RKAA 1J79A 1TWWA 4M56A 2XH7A 1Q6RA 4JQ1A 4ZQOA 3GFXA 3H21A 4V1XA 1UQYA 4GA8A 5IOBA 2CC0A 2QHAA 5HNUA 3LBOA 1KKRA 1ZPTA 2XPKA 4C6KA 3H2MA 2QKFA 4DBEA 4W7WA 4ZSUA 4LAMA 1EGMA 1FH7A 4FHAA 1IEWA 2X8RA 1UKOA 4E6MA 4HZ7A 4IQLA 5TF0A 3W2NA 3H55A 1C91A 4AC1X 3U6WA 3DH7A 4ZZ9A 1TG7A 1GG0A 2DUXA 2BY1A 1AL7A 2BWGA 5DCDA 2ASHA 2WANA 4NNAA 3E2VA 2VRKA 1J2BA 3MY9A 3K8KA 1F74A 4W88A 3USBA 4Q4SA 3QY8A 2DU2A 2QPXA 2GQ9A 5DT7A 4AWEA 4LCRA 4Y9OA 1HL9A 4UQCA 2QCMA 3R0UA 2F7FA 3ZJ6A 1IHIA 4MKVA 4U33A 1GUVA 1J0IA 3NO3A 1CYGA 3DYOA 3NNTA 5JIWA 2PC8A 3N11A 3R25A 3ARRA 1B30A 5EMLA 3G8EA 1I2NA 3N18A 1WDWA 4DBUA 3DFOA 3G2GA 1UD2A 5BOOA 4GY1A 4O28A 4XUGA 1J8VA 1GW9A 4HOXA 4UTKA 1ME7A 1UROA 4NQ1A 1XRVA 4LVDA 2Y8VA 4QS6A 3OVPA 3AZTA 3VD7A 1HN1A 4GD0A 5ENLA 4D1IA 3V0UA 2VEMA 4BFAA 2C16A 3GS6A 3MDUA 1EXPA 1QNOA 2YLAA 3NA8A 1NY1A 3AFBA 1E4IA 3VIMA 4A21A 4L64A 4OKDA 4GZJA 4FAMA 1OCNA 1UP0A 2UV8G 4C6PA 4DUOA 2P76A 2MANA 3I7SA 5FF3A 1XDLA 3IJDA 4R5EA 1YADA 2IPGA 5EFFA 4MYAA 4CGTA 1CPUA 1SR9A 3HF3A 1G69A 3WQ5A 4TVUA 3LCIA 3OG2A 3AYRA 3PF3A 1X98A 4O50A 2ZXQA 4QAIA 2PB1A 3QF0A 3MHFA 9XIMA 1ICQA 4JKKA 1XIMA 1FVPA 3LN3A 3A4WA 1KQZA 3MUAA 3ZFHA 1GNXA 5LKYA 2JE8A 2EKCA 2Q01A 4HHLA 4CD7A 3HOJA 5LA2A 4M24A 1AH0A 4DPPA 1UIPA 3N2TA 3T44A 2EG6A 4UWMA 2VT0A 1TR1A 4ZXLA 3QRHA 3GNXA 1FDJA 4MKNA 1EC8A 2G3IA 3HGJA 5AC8A 1RY8A 1QWGA 1AJ0A 4KCUA 3W81A 3E0VA 2X2GA 1A3WA 3C0QA 5HMDA 3SSJA 2QXWA 4GPNA 4IUOA 2INEA 2ISWA 3NQ7A 4W7VA 3IVUA 2EO7A 1RQHA 1E6RA 2H9AA 4HA3A 4AHPA 1S2CA 2X2YA 2CW6A 2ABAA 4LAOA 3VKBA 1K1DA 4TV5A 4KESA 4FP1A 1OZQA 3CUZA 3KP1A 4LU0A 1WCGA 4PRTA 3M5ZA 1BYCA 3QHOA 2ZRZA 3A6OA 1KO0A 2QPUA 1VPXA 3RLGA 4HK5A 1D3CA 1A5BA 1NP0A 3DYPA 4XD6A 4QISA 2XINA 2PS2A 3HJZA 3K4DA 3FY1A 5DX7A 1VBJA 2X0HA 3K4WA 3TN3A 3APTA 4IICA 3M64A 3SCVA 1O4UA 1QPOA 3VCCA 1US0A 3A4JA 1NIUA 1MW0A 2W27A 3N9SA 2PDIA 3ZJKA 5AC6A 3BK0A 1YTDA 3CTTA 3QZEA 2DIEA 1W9UA 2GL5A 3URNA 3O15A 5FF0A 4YJ5A 4RDYA 2Y24A 3CO4A 1HP5A 2Y0FA 1XQKA 3WF0A 3VZZA 2E5CA 1QW8A 3TJ4A 1U83A 2D3LA 4QG9A 2R91A 1XWYA 5G1MA 3PPFA 3W1PA 3W7EA 4QEEA 1ZRQA 4U2YA 2JKEA 1VIWA 1WAUA 4BR1A 5EA9A 2WWDA 1JF6A 4WD0A 2PDFA 3WUEA 3W7JA 1OJXA 5T9CE 2V9DA 1OCBA 2NSXA 3W00A 4IP4A 1P0EA 1EP1A 4KT2A 5FSEC 2VFHA 4DBSA 2G3JA 3ZLGA 3P67A 2ABBA 2GVLA 1YXYA 5DQPA 4MWAC 1EA9C 1TIMA 1W91A 3P5ZA 4RJEA 2V3GA 4GINA 5M1TA 1PZ2A 2YDAA 4LUYA 3WK2A 4Y9AA 4BI5A 4KH2A 3OZOA 1VAHA 1UR3M 3BE7A 4H6EA 3PNUA 1KM5A 2HROA 2I5QA 4LYRA 3LTPA 4XWUA 1OC7A 1K7XA 4L6HA 1P0BA 3V5CA 2A3CA 3STEA 4AXNA 2VGFA 4BI6A 3VK5A 2VD8A 1Q6GA 3CHEA 4Z1YA 4PRWA 4G1KA 5KZMA 5REQA 1KBKA 1LL4A 2WKJA 2R82A 4YWIA 3O3RA 1OFOA 3L5AA 2Z1VA 1V02A 1ELSA 4Y8EA 2PP3A 3HM7A 3VGHA 3RX4A 1W9XA 4GXMA 1WKEA 3C2RA 2NZLA 2HV5A 1HG3A 3BAWA 2O4MA 3K8MA 4WKAA 3W2JA 2J24A 2WC4A 2QJIA 4Z1BA 5CZTA 1D7FA 3S2JA 1YPIA 3KX6A 4MNJA 2ZA1A 4FZIA 4RL3A 1H7OA 2WBGA 4Z2IA 1K8ZA 4MWAE 1FWGC 1TR9A 4MTVA 1AVAA 3TIMA 1JULA 1TV8A 3R12A 1PX8A 3KOYA 4DZHA 3AIUA 4O17A 5D04C 1JFHA 2OGYA 3LTYA 4IL2A 3QKZA 4JQ3A 3KOFA 4C6BA 2FTYA 2CLKA 3AHTA 4MLRA 4DBWA 4MAVA 3UZZA 3QKEA 1W2PA 7ODCA 3VIOA 1R2RA 3NYDA 2HVNA 3D5HA 4AIEA 4MAZA 1XRSA 1PCKA 3EX6A 3ZWTA 2CNCA 3H2EA 3R13A 2OYLA 1F3WA 4S3FA 5GJMA 2QCNA 4IM4A 2PP1A 3T2OA 4J9JA 3OG3A 7A3HA 3AXKA 3I3BA 1I0DA 2YIHA 3AXIA 2ZZ1A 1MI3A 2XN0A 3TXZA 4XAYA 1CX9A 1RR2A 2XSBA 2B7OA 5K4XA 3SN4A 4KCVA 3LXAA 4MFEA 2ISVA 3KL3A 2XZ7A 4WXYA 2FZNA 1RALA 2ZDSA 3WIJA 2DW6A 4GWEA 4EVZA 3TN4A 3DN5A 4R27A 3RPMA 2WPBA 2PDHA 3GDRA 4J35A 3MU7A 3BWWA 3W73A 2C3ZA 1KC7A 1R7AA 2WQPA 2CBIA 2EAWA 5A2BA 4HU0A 1E0WA 1UWRA 4GACA 4C60A 4HKPA 3QY6A 1O68A 1EBHA 4GUHA 1XLEA 5FESA 4REQB 3VKCA 1SZRA 3BG3A 4IMAA 3BMXA 3R43A 3QW4B 3VCRA 4ROPA 4HNUA 1HJUA 1VIZA 1UOKA 1ZSXA 1XL9A 4AAJA 3RF9A 1S3TC 2VKZG 3GTHA 1B5TA 2BOGX 1U1UA 4IG2A 5I77A 4A6GA 5FF2A 1XYBA 5J5DA 1FWSA 3GTNA 1MYRA 2TRSA 3M0YA 3L65A 3POHA 1SMDA 1VHCA 3DXIA 1BSLA 2NLIA 3WDQA 1FY6A 4F2TA 3E0FA 3UWEA 3PJXA 1GVRA 1UCWA 3MWCA 3ZT5A 2W62A 4WSJA 3NDZA 4NAEB 1F4AA 3Q37A 2OG9A 4GYFA 4KWWA 2FHFA 3AMDA 3IIPA 3LGEA 1XIGA 4KETA 3TC7A 1PTDA 3C2EA 4JTLA 2YFNA 1SFJA 1KXTA 1Z9AA 3G6MA 4W4QA 3SRDA 4AWUA 4OOUA 1PTGA 3EWWA 3W86A 2YA2A 3WEMA 2J7CA 2E6AA 1Q66A 3DFQA 3IUHA 3MZNA 4MDOA 3WK1A 4Q4QA 2EG8A 1A5LC 1CI1A 4R7OA 3W7GA 4D72A 3WD4A 4GZ7A 3LPPA 3WF3A 3W75A 5EMUA 1J5TA 2WSYA 2QIIA 1RK6A 3NL3A 3GNNA 1JGMA 3EX4A 3FA3A 1UR8A 4UR8A 4X61A 3KCJA 4GI4A 3V75A 2O56A 1ZB5A 3HFYA 1VLWA 3E38A 2QVNA 1BTMA 2E25A 4RNIA 4I9TA 4EPKA 2PWVA 3M5XA 3TZNA 4DY1A 3RX3A 4UQEA 2J4GA 1FWIC 2HEJA 3CLWA 4GOAA 3UR8A 3E74A 4OUIA 1CGTA 4C6OA 2REQA 4H9XA 1VJIA 4HSNA 1DQXA 2XH0A 1FWFC 2NQLA 1V6UA 3LHYA 2E9LA 3NOYA 4P8UA 4MOZA 1AMYA 5C8BB 4IMDA 3NWRA 1HKKA 4PBEA 4OBRA 3GR7A 3CWHA 4RE0A 4O15A 4DO6A 4LVFA 1H3GA 2DIJA 4UCFA 5HUOA 3SJ3A 1OADA 3H4XA 2SFPA 2GOUA 1E6PA 1LBFA 2YGYA 3EB2A 2DZXA 2QV5A 3GM8A 4F0MA 2F84A 4CQCA 2VFEA 2PU0A 2PDNA 3EX1A 4R7WA 1YDNA 1QXLA 1DIDA 1MFVA 2HBXA 3NZGA 3O2LA 6XIAA 1QOPA 1UD6A 3ZJ8A 3UG5A 5CSRA 3L5LA 3QH2A 4XD5A 1ZJAA 3HPSA 5E9AA 2YCLA 4O8RA 2TMDA 2VNCA 3FJ4A 3TK7A 7TIMA 2Z2BA 5D8WA 4NXKA 4RW3A 3HG2A 3ITYA 3QEZA 4GUIA 4X63A 3CYJA 3K4AA 1DXIA 2OKOA 5A6LA 4NJIA 3NTYA 3ZLFA 3NO5A 2HK0A 4ACZB 1KW1A 5G2IA 4LC6A 3K13A 4Z0JA 1PYFA 3SO7A 5JXQA 3F2DA 1RD5A 4TX9A 5AZ1A 3MCOA 2J8TA 4RK8A 4HT3A 5I23A 1VJSA 3DZ1A 3NEVA 1IEVA 3R8HA 3EWCA 3NL2A 1YEYA 2HPIA 3T0BA 1H1YA 3W7HA 1TWDA 1UUOA 2P1FA 4I7UA 4K8EA 3S3GA 1H60A 3LQLA 4Q4PA 2RAGA 4FF7A 4HHMA 4QJ1A 4GZIA 4MG4A 3M0XA 4R33A 3CL7A 4DJEA 1FDZA 4PTVA 3VAVA 3PZOA 4HU8A 2D2HA 4KFOA 3S42A 1TWSA 1OFRA 1E72M 3PFMA 2PDKA 1XM3A 3ZIZA 5E70A 1IR1A 4O1EA 5A8OA 3DKJA 3N34A 4MY9A 2E67A 1WKFA 1FCUA 2QCLA 1PYMA 2DH2A 3G0SA 5C9RA 1EP3A 1TQXA 2YPIA 4ZQCA 5I3HA 4LS1A 3W27A 1LM1A 5LA0A 3ZLHA 2VX5A 1UYQA 2O7SA 2Z2UA 5AYBA 1RLDA 4QDMA 1QOXA 1AH4A 5EGRA 5FA5A 1RP8A 4YTTA 3W7MA 4M6PA 4D8ZA 3PJTA 1DWFM 2EKGA 3NQFA 4PMDA 2VFFA 4Z2JA 3EMQA 4CCCA 2CBUA 2WSQA 1VFHA 1KM3A 4BWLA 2Z28A 4ZO6A 1RPKA 3VE7A 3DHPA 3KTXA 4O10A 3W72A 3RLHA 1V0KA 3CZEA 5HQEA 2DEPA 2OCZA 3RR1A 4KRZA 1ZS2A 5D2XA 2J75A 3QLDA 1VYPX 5HBFA 3M0KA 3W7KA 4ZTYA 3COTA 1JZ3A 4N42A 3FS2A 1HJWA 3V18A 1M7OA 3A64A 3TJXA 4NG3A 4E5TA 3UWUA 4O14A 2HCVA 4IXXA 3V7PA 2ZZ3A 3TYZA 4Y9MA 4GZEA 4ZEPA 3BLOA 2F6XA 3HQNA 4ZR8A 3U57A 1ZJIA 1E0XA 5EYWA 3ZSSA 2J77A 1IWPA 1D9EA 4QE1A 1WZAA 2D0HA 3EZ4A 4TTUA 3TW9A 1B4KA 4GISA 3P93A 3C4UA 4AY1A 2OWCA 3CUHA 2A4AA 3O05A 4UTUA 3ZVIA 3MMTA 4DZIA 5JBEA 1FQ0A 4O4VA 1FX6A 3KAOA 4A8RA 3PANA 5LGZA 1ZAHA 3T55A 3T6CA 1VYSX 1GCYA 1SO6A 2HQAA 3O6CA 4CNOA 3LPFA 1B3XA 3EDDA 3EPNA 1OM0A 1J0JA 5DO8A 2VFGA 4F0RA 1H09A 1R86A 5E0FA 4DWSA 4JIRA 1K77A 1Q6QA 2HK1A 1UZHA 1WXYA 3S2CA 3VDAA 3AIVA 5AHFA 1X97A 2YLLA 4QCEA 1QHPA 1ZALA 4XZLX 2UY3A 1U5JA 1IYXA 1XIFA 3WQPA 1E4NA 3JUGA 3SRKA 5IXEA 2F2HA 3JS3A 1TPFA 3KRBA 3APGA 6XIMA 3TEVA 3G24A 2XVGA 3FKRA 1EJRC 1AK5A 1W6TA 3WJSA 2ADAA 5I3DA 4GYKA 1G6CA 3T8LA 4NP7A 1T8QA 5C2GA 1ZGDA 3GXMA 3VI2A 3GZAA 4Q8MA 4X9SA 3VA8A 3PTDA 2WCSA 4M82A 5LGXA 1CXEA 5TIMA 4D71A 3VMOA 5J04A 2CZ5A 1M1BA 4H83A 2WHMA 1FDYA 1N8FA 1QHOA 3FK4A 3C61A 2WHJA 2QQ6A 1R7OA 4GVHA 2VQTA 1C92A 3CV6A 4LTSA 1DJIA 4Q8QA 3L4WA 3E0WA 1F5ZA 5CPSA 3NQMA 1XFCA 4JTHA 1VEMA 3VUSA 1ISZA 1AW2A 1Q6OA 2NXIA 3ARSA 1VYRA 4G9PA 3TYUA 3K46A 4DZ5A 1OZMA 1TCDA 1IXNA 4UTJA 1Y5VA 3DFTA 5CJ5A 2QDEA 3B05A 3ITCA 3GFYA 3LLFA 3DFPA 4S3EA 1TWZA 4FXRA 4LRSA 4QX4A 5U7SA 3E49A 5HULA 4TR9A 3RR4A 3C8NA 1G94A 4GUGA 4UQBA 3UG3A 1R2SA 2QJJA 3T0AA 1XYFA 2J7FA 2OU4A 5CZSA 2QUNA 4FXJA 1HT6A 2ZUMA 3N19B 1NELA 3VD9A 4YHGA 4LNYA 2AAAA 1CGVA 1D7KA 1THFD 2BV9A 4JYFA 1NOUA 5CSUA 3CGTA 3OGSA 3C8FA 3UZ5A 2GJXA 1KRMA 4PRRA 3LM7A 5GNXA 1ZCCA 2XSAA 3AS1A 5LHEA 1P5BA 2PDBA 1GEHA 3HN3A 1JNEA 3N9RA 3HA1A 4Q22A 1GHSA 4PSPA 1EOMA 1W8GA 3AWNA 2J7DA 5F2MA 5F7UA 3DERA 2CHRA 3KDNA 1Q6FA 4HBKA 4QITA 4C1NB 2QS8A 4KWVA 4Z1AA 1CNVA 3WH7A 4LF2A 1AL8A 3GIYA 1UW9A 1MZRA 1VP5A 3MUY1 1UHVA 4FNTA 4O11A 4GVIA 3IRSA 5E93A 3W87A 1XIIA 2VXNA 2IXUA 5DCBA 1H51A 1JQXA 3UR5A 1Z6KA 3L66A 1IV8A 3S2LA 3UERA 1JCYA 4GLEA 2UY4A 1CDGA 1C8VA 2H3BA 1BHGA 1XICA 2A21A 1XIHA 2A1YA 3OVGA 1A4LA 5CBBA 3GU2A 1XDJA 3H8AA 4AZHA 3EDJA 3N73A 3GO2A 5T91A 4Q8VA 4A3RA 2ZQ0A 1CGXA 1KTNA 4YIWA 3QC0A 1AW5A 5FJTA 1JD9A 2GDVA 4LPCA 3SCOA 3CL6A 4Y8FA 3W1NA 3W70A 5XIAA 1FWWA 1BYAA 1FHLA 5G1YA 5ABFA 5TBOA 5CZJA 2Y7EA 1LRQA 4QQ3A 1G5AA 1B3WA 4AIBA 3AO0A 1RBAA 1JZ4A 4HK6A 1B3OA 2WVSA 3GBDA 2JQXA 2HXUA 2YBVA 3IJIA 4HHPA 3OLEA 2ALRA 3QYSA 5LSMA 3FFSA 1IXPA 4HPGA 4PN2A 3B9OA 1GOOA 2E9BA 3ECQA 4ENLA 1GVOA 2PUZA 3M46A 4C6JA 4WJ8A 1T8XA 2X09A 4RV8A 1LL7A 2QGYA 4LQ1A 1A5UA 5JVLA 1RVKA 3ABXA 3RXZA 4XO6A 2V30A 5HR6A 4X2RA 1KLYA 1WXZA 1XHGA 2JALA 2BOFX 2EF9A 4GABA 2G3NA 1Y0EA 2OLHA 1VS1A 1F07A 3BXWA 2WM0A 4BQ2A 4DNHA 4R53A 4KEZA 4JKLA 3CZJA 1KR1A 2ZKMX 2C13A 2CBVA 4IFKB 1EC9A 4ZVJA 3W7QA 4QE4A 3CPRA 1TPWA 1WAWA 4OHQA 4OJYA 3LPOA 3M1ZA 1W9VA 1BVZA 1LOQA 1CBGA 1Q65A 3W07A 2DW7A 3NQCA 2O4QA 4XZ9A 1BPLB 1OFDA 3EDEA 1UP2A 3A24A 3H23A 2ZXAA 4LT9A 4MUPA 3C2FA 3STFA 3MI2A 5CQ1A 5LNRA 2YA1A 2VDIA 4GCAA 2E0PA 4XKYA 1CCWB 1E1EA 3GVVA 2PMQA 4AF0B 1LOSA 2ZBTA 4P7LA 4TV6A 2YL5A 5EPDA 1Q7MA 3NQ8A 3L0GA 3APYA 3VGFA 1K70A 3EWZA 4GY7A 3WCZA 2VZSA 3KRUA 3PK7A 1S2VA 2ZADA 3E2SA 1L2QA 4H2CA 2TPSA 2QF7A 4XZIA 1U1HA 1XDMA 4NNCA 1US3A 3IJLA 5A6MA 4JFUA 4FS9A 1OX4B 1H7NA 1CB7B 2OZ3A 1EEXA 1ECEA 1RAKA 3OO2A 4A29A 1QW9A 3MSDA 3VD5A 6CGTA 1AZ1A 4NY2A 4O8AA 4FO4A 5HJLA 5KSWA 3OZPA 1L6FA 4B91A 3R6IA 4MZ1A 3T81A 4NVTA 5RUBA 2VDGA 1XC6A 2E8ZA 3L23A 4QHRA 4WCJA 3EA1A 4O0QA 3VNKA 4WDWA 1D8WA 3CHDA 4NRRA 2XH4A 5A94A 2KAUC 1FWDC 4I5UA 4GGBA 2ZX7A 4L56A 2L5HA 5DFAA 3IIZA 1LLOA 5CPLA 3DFHA 1F7BA 1W3NA 3NPXA 3WJWA 4V15A 1O94A 5D4YA 1J93A 4AY8A 1RZMA 3DBPA 3PZMA 2Y5EA 1U1JA 3TTSA 1N2VA 5BRPA 4J2PA 1K9DA 4JKMA 4JTUA 1V79A 3HZ3A 3T08A 3SIZA 3IV8A 3SECA 2TAAA 4M0XA 4HOWA 2WSRA 2PDGA 1EO7A 1K6AA 2BGQA 2CCRA 4WIWA 3MCMA 5A1AA 5E0KA 1GQIA 4AZBA 2A7PA 1EIBA 3EKGA 1MO0A 1BTCA 2FDMA 2WMGA 3RN6A 4PMZA 1RVGA 1XP3A 4HNCA 3BZGA 3UXAA 4DO4A 2ZXDA 5I3JA 2VR5A 3P2VA 4K1WA 4QLKA 3HIJA 4IZGA 1Q6LA 3EKLA 1SO3A 1H62A 3RK8A 2ZZ4A 5MKGA 3BG5A 2C1GA 2X1SA 4Z2KA 2QV4A 1N8WA 2I16A 1TPDA 2HNHA 3AZRA 5FEWA 2IQTA 4JZ5A 2EPHA 4A3HA 4H04A 3G18A 2BVYA 1HKJA 1Q6EA 1AFSA 2E5DA 3GKAA 3P62A 1OF6A 2E77A 3FAWA 4F40A 3AJXA 3KCOA 1WUFA 2PBOA 3V5FA 3KOWA 4JTQA 2OOFA 1YNPA 3GVGA 2RHGA 1LJYA 4GHRA 5FIPA 4IIDA 3LGGA 2QULA 1AQHA 3PAJA 3V16A 1JI1A 4NILA 3SI9A 1P48A 4QGCA 1XLLA 2CLPA 2IPFA 2BY3A 3WO8A 3IRDA 2YYTA 1S5MA 2QZRA 3QHMA 3GAKA 4H9ZA 1UMLA 4F0KA 1CXFA 4AD3A 3IIXA 3L0KA 3WQCA 3OBKA 1JI2A 4ZQNA 3W37A 1XW8A 5AC4A 3ME3A 5DELA 3B06A 1DEDA 1ITQA 3AALA 3V36A 3TP4A 3O6AA 4ZFMA 1X1ZA 2WJFA 3CT7A 3UG8A 3L67A 3IUDA 3KLLA 4UOQA 5DXXA 5GNZA 4UCGA 3HG4A 1PVNA 3TJIA 2QT3A 4LYPA 3B0VC 3AU6A 3VIGA 1FXQA 1MEIA 2HISA 3JZEA 4HPNA 4Z1DA 1L9WA 2HPMA 4CEXC 5IFPA 4LBUA 3ALGA 1QBAA 3FCPA 3OIXA 3PBUA 3F5JA 4LVAA 2GVJA 3ZSTA 5G4EA 2OODA 2V69A 1DJZA 1ISXA 1REQB 3T2PA 1B3VA 2X30A 5BXRA 3ZR5A 3SCQA 3H12A 4WUIA 3CEPA 4S3GA 1JR1A 8XIAA 2J62A 3ZO9A 4DUVA 4FR6A 4U5IA 2D20A 4EWJA 1UWUA 2FLIA 3PJWA 1C7TA 1BVWA 3KFTA 4DM1A 3K30A 3B0YA 4WQ6A 4BWLC 1UJPA 1DXFA 4GBUA 3KXQA 1TZ7A 3CB3A 4O1BA 1E5NA 1JXJA 2G97A 5J8LA 3BAXA 1YLVA 4WK9A 3OW1A 2C19A 3TSDA 3A3HA 1EJVC 4HJFA 1HKIA 3VILA 1QPNA 1TTJA 3CV2A 1RV8A 3SJNA 1OFEA 3KVJA 1VJZA 4ZFCA 5E09A 1E9ZB 2B7QA 2PE4A 5FKYA 3ES8A 2WNWA 3C6CA 4UTTC 4AWSA 2VC6A 4W9TA 4MNMA 3UJEA 1UP3A 2NUYA 4DJEC 3TV8A 3N2CA 3ZWSA 1DV7A 3WDIA 3KOZA 4YN5A 4ZB0A 1MWOA 2C6QA 5CG0A 3P81A 4UNKA 1EZ2A 1E0VA 1OK6A 1NP2A 1XBVA 3VVGA 4G7FA 2H6RA 1AQ0A 1XLBA 4KF1A 1GONA 4XZHA 3WFAA 1KTBA 2J47A 1A0CA 5AN7A 3WQ4A 4O0KA 3LXBA 4J27A 4FIRA 4EPDC 4Q4OA 4XIAA 2JIEA 4JNMA 5K9CA 1H4PA 1LTDA 3CS2A 3HPXA 4JTFA 2W6RA 4UTTA 1OGBA 2XYLA 1SJCA 5DMYA 3T4WA 3UYCA 2FZ9A 4ASTA 2X7WA 1Z8AA 3AAMA 3WQFA 1FWJC 3PUDA 3ENLA 2WNQA 1P6WA 1W5OA 1C3FA 4CN1A 1HF6A 4EACA 3HU7A 1KQYA 3N17A 4LX4A 3NQVA 1XD0A 1ZCOA 2H3DA 4M8UA 4GQQA 2NVCA 4J3TA 3KTSA 4C7GA 3CV1A 2D22A 2I5GA 2XN2A 4LB4A 2DT1A 1VFSA 4XAZA 4CUCA 4EK7A 4A22A 1M6JA 2GSEA 3VGDA 3IGXA 4GNJA 4UZSA 1ZZMA 4PUJA 1KFLA 3LV6A 4PTXA 2AL1A 5DMMA 2BHYA 4US5D 4V27A 3GY1A 1LF1A 5C5YA 1XBYA 1QPKA 5JH1A 2G3FA 3W2KA 4PL2A 1W1IE 3I3DA 4IPNB 2WMJA 3P3BA 4DAFA 4H9YA 2VZTA 4IMEA 2ZXBA 2YOCA 3CMGA 3L12A 2Z1BA 2PDUA 5C2XA 3KL0A 3BW3A 1HL2A 2RDWA 2XWDA 4P2VA 3P5YA 3F2CA 3SADA 1KR0A 3EXSA 3WQ6A 4S23A 2R1LA 2A7RA 1P6CA 1EC7A 1EDGA 3B9NA 3GHSA 1DJXA 1IXQA 3HO8A 4PZVA 4DAIA 1TX2A 1S38A 1GOKA 4MVAA 3WYZA 4E2BA 4PUNA 5M2FX 4HZ8A 1FUYA 1HGWA 3EKZA 1K7EA 2FPTA 3CYVA 2IXVA 3B0XA 3UXLA 3VKAA 3MSYA 4P8VA 2AQVA 1PXGA 3N3MA 4A2SA 1XLKA 2E3ZA 4ZOBA 4QXIA 5AECA 1KLZA 3EYPA 5HNNA 2VCCA 3CBWA 4WF7A 1VZWA 1ML1A 2BTMA 3DU0A 2VZVA 2VENA 4GRSA 3MP4A 2XFFA 1NF7A 4JDYA 1NDZA 3H2AA 4D6EA 2ZUWA 1N7KA 3GNRA 3B9EA 3TWBA 3VOJA 2YB4A 3AMKA 3PTKA 3CAVA 1ZU8A 5AYIA 2VO5A 1A3HA 5CC3A 3HQ1A 3TTYA 2ZA3A 1FP8A 1JRBA 1XLHA 2VRJA 2I14A 3TW7A 1Y65A 3BGGA 5HR7A 3R89A 1AD1A 1TMHA 1R30A 2YW4A 1KCLA 1HKMA 2QNEA 4DWSC 4PMYA 2VX6A 2PGFA 1FCVA 2EPKX 1VCFA 4U31A 4PUWA 4YTQA 1J6PA 4WRHA 1WOAA 5A6SA 2NT0A 2EPMX 2R8WA 2WCGA 3IJ9A 3RCYA 4HPHA 2BOEX 1V0MA 3U9IA 2PRMA 3GHRA 1K7FA 3OP2A 2XN1A 1AQMA 4GE8A 1MSSA 2VELA 2ZWZA 3HV8A 1DJQA 2O7QA 1A5SA 3HFTA 2D0FA 1VEPA 3FYPA 3SGGA 1QAPA 1O1ZA 2Y7GA 4EPEC 1SZGA 1H7PA 1HJSA 5G4WA 3MZ2A 5D33A 2CFFA 1E70M 2DZBA 3BAJA 2WXDM 2A3HA 2QMKA 1SU5A 3TUUA 3VABA 4TQTA 2CZDA 3TA9A 2GLKA 4IIFA 2PODA 4PB3A 3VUPA 1SMAA 3LTSA 3N25A 4J3ZA 4UMAA 4CCZA 4XZNX 4B16A 3M07A 5J5RA 4ATLA 4ZE5A 1TJ0A 1HL8A 2FYMA 5ABGA 3UR7A 1E0UA 5LIYX 4TTGA 5AC7A 1YMYA 4NT0A 3NUKA 2WMHA 1YHTA 5DY2A 3S83A 4I3GA 4EAYA 1RJRA 4ICCX 3W4RA 4UQDA 4PMVA 2YCIX 3CZ8A 3U0HA 2ZC1A 1F3TA 5E1QA 4JY8A 3QR3A 3LHTA 5A6BA 4XIMA 3WLMA 3A5VA 4WY0F 4PMOA 1R8LA 3GXPA 3VIPA 2GDQA 4IGMA 3NQBA 4Z2GA 4F9DA 4LRTA 1WOBA 1TQJA 4ERIA 4PEEA 4H8VA 3G0XA 2Q8LA 1OFAA 1DHKA 4MY1A 4Y9NA 2XM2A 1LG2A 4RXGA 2Y1HA 1PDYA 1G4PA 5KTLA 2DQXA 4ICMA 3VU2A 1U5HA 4M1BA 3ITVA 3BLIA 1W9DM 1C7SA 5KEZA 3DUGA 4ZB5A 2PGEA 2B81A 2CPUA 2O9RA 4K8HA 4WSKA 1KV8A 3QZAA 1T96A 3B8VA 3U4AA 1MXDA 1DJYA 2WQDA 4OUEA 5I3KA 1SW3A 1XKJA 4MB3A 2OJPA 2VD9A 2VEKA 4QDPA 3VGGA 1E6ZA 2ONEA 3T09A 4H6QA 2ESCA 2VQUA 4PUDA 4B5UA 1AW1A 1GOMA 4UBPC 4JYEA 1MUMA 4OU1A 4FNSA 3W26A 4E4PA 2XFRA 3SBFA 2ZZ6A 3QM3A 5KITA 2Z24A 1C29A 4NZFA 3PAOA 3PB0A 4FX8A 5DRCA 1VQTA 2WJDA 4Q8NA 4AIOA 1WYIA 3WJXA 5B7ZA 5BWFA 3GW0A 4ZOCA 1GPWA 3NZQA 1VFLA 5FL0A 1NQ6A 4AIUA 3B8DA 1XG4A 2R9RA 3E12A 3GYEA 5HINA 3AICA 2IMRA 3GB6A 3OTRA 1BF2A 3TAKA 4HCDA 5B80A 5A8QA 2OWWA 1PWLA 3UVAA 4NUWA 2VDHA 2ZRYA 3QYQA 3WUBA 1ECQA 1JZ5A 1CZ1A 1V6TA 2VR4A 4G7EA 1BEUA 1DTNA 2C1IA 3EWYA 3ZVHA 4ML4A 2XFYA 2V6AA 3VGBA 1H49A 1ZP3A 4PCPA 3S2MA 3FW6A 4JAWA 1X8FA 4YXGA 4HU4A 1BRLB 4H00A 2XZ9A 1V5XA 2PI6A 1TYGA 3PJUA 4B3ZA 3CL8A 5LIXX 3WFLA 2V5BA 2VFDA 3A4AA 3GFZA 2GUBA 3F4VA 2HDJA 1UR4A 1VFTA 1BYBA 2GVGA 5AKQA 3S6OA 2VVNA 3WD0A 2OLSA 1V3IA 3H4GA 2B0MA 3DFNA 3TH6A 2NQ9A 4S2CA 3QV6A 3BV7A 3M6YA 3AS2A 3N4FA 3P14A 3SW6A 3OZYA 4DYJA 5MHBA 3GBEA 3WQ8A 2Z00A 4JTDA 3LK6A 2BS9A 2PZNA 2CZFA 1JYNA 3DHFA 1YBQB 3RRAA 1A5MC 2PTDA 3NJ3A 4HN4A 3R5EA 1GKPA 2DFAA 4QSHA 1XG3A 2WPGA 4WGHA 2J13A 2PDLA 3A3WA 1F8IA 5H1WA 3QR0A 2PC4A 3EPMA 2OGJA 2E40A 3GC4A 1TE1A 2EQDA 1UJQA 4GMEA 1WX0A 4Q4RA 4B2DA 4TO8A 5L6UA 3DG7A 1DWJM 3W28A 3EEGA 3TSBA 1V4YA 4L1WA 3GTFA 1KFCA 3TCSA 3FYOA 3UWWA 1W56A 2G41A 4HMDA 4FR1A 4QJ3B 3FJLA 4AY7A 3BLEA 3WNPA 2BGSA 3OJGA 2OR2A 5C54A 4ZO8A 3V35A 2F8QA 1KKOA 1BLIA 2X0YA 1EBGA 1OFBA 3OB8A 4S2BA 4GQGA 3ZM8A 3L4YA 3H2NA 1HQTA 4BCEA 4J40A 5HQLA 5A6AA 4RUBA 4E3VA 2YDRA 4O0ZA 3VIHA 4D6DA 5DN1A 4UFHA 5M03A 1ZNNA 2WW5A 2G50A 3W24A 1NVMA 2VFIA 3PP7A 4NJJA 3E96A 4HNNA 3BCFA 3EDKA 3S5ZA 1UWSA 1VCVA 3GDKA 1O66A 3LV5A 1JZ2A 4PMJA 4D8LA 1EJ7L 1QI0A 4PUEA 3O9NA 4GK8A 4M5PA 1OX5A 3W6YA 1QPQA 3XISA 4CD4A 1RA5A 2WWCA 5HQMA 3OHMB 4DYKA 3MT1A 4QNWA 3PN8A 2FTPA 3E2RA 4IJCA 3T0DA 2IQDA 4WDUA 1J4EA 1RY0A 2YR1A 3W9ZA 5AB3A 4XO7A 3UVIA 3RG6A 4GQRA 3PS7A 1FH9A 3W7IA 3MUCA 3UXDA 3DI0A 3PZIA 4GVGA 4Q6JA 3UCCA 4RXFA 2OSXA 3WQGA 4GIRA 3W23A 1HKVA 4BEQA 5K4ZA 3PUEA 1S2UA 4ZODA 1WDRA 2Z7GA 1WUEA 2ALDA 1OIFA 4UR7A 4KQNA 4UZUA 3WDPP 2AMXA 1KCKA 4NX5A 3NL5A 2XVPA 4IPPA 1KTCA 1LT7A 2DVXA 4GUJA 5IDZA 4AD5A 3UNDA 4E4FA 2A6NA 2EHHA 2OYKA 1ZBVA 3TOPA 4PMXA 1LROA 4UTWC 5D32A 2Q02A 3LD5A 1H11A 2BXYA 4NI3A 3ZOAA 3UZYA 4S38A 5CZKA 2O9OA 3N1AA 2NWSA 2Q71A 3W6LA 1JZ7A 1CLVA 1DPMA 4AW7A 1S5WA 5H6HA 1TRDA 1DJHA 4YVVA 3W85A 1SJBA 1KGXA 1LUCB 4AH7A 2IS7A 5BCAA 2DSUA 1DBTA 1VGAA 4W87A 1O5RA 4I7WA 5HATA 3NFUA 3UGVA 1LWHA 3EX2A 4FIQA 2VEFA 2EEXA 4XAGA 3THAA 2XSXA 3FLUA 4JHMA 5HPOA 4N4PA 2AGTA 1UASA 3BH4A 1HJXA 2R14A 2CWNA 1AQFA 2RUSA 2HS8A 2VUNA 3NVTA 3GXTA 3WMSA 4OECA 1TZ9A 3IIVA 2FHBA 4L7ZA 2AGKA 3N04A 4LS2A 4UR9A 3DKLA 3SGZA 2V63A 1AA1B 4ECLA 3AHYA 3AXMA 4KGJA 1V7AA 4EKJA 3UYIA 3LX9A 3QPEA 4ZQMA 4RNJA 3BOXA 4QBXA 5D9PA 2V5KA 1X7IA 2QJGA 5JU6A 2WNZA 4MJZA 4HSHA 4E4UA 4UQAA 1XX1A 2ZE3A 2P3ZA 2QAPA 3ICJA 3GH5A 3TC6A 4QG8A 5H91A 4IQJA 3LCWA 2VYOA 3PBWA 4QP0A 4NNBA 4D2JA 3RAOA 5EY5A 1JG9A 4LANA 5GNYA 1DXEA 3VIIA 3GSMA 2J9XA 2HXTA 3GDLA 4F0SA 2BGNE 1SJDA 3BZJA 4JNZA 3JVAA 1WXJA 1ONXA 1C8QA 1KRCC 2JGYA 4MSSA 4FLQA 1XBZA 5A95A 3AHVA 4F0LA 5I2UA 1W9BM 4UFLA 1R3RA 3W2LA 4DPQA 1E6QM 4PCNA 3LCHA 3WK0A 2GYIA 3M47A 3RM9A 2GQAA 5CGTA 2G96A 1E0TA 2TODA 1NH6A 3ARXA 2QMJA 4FLSA 1N55A 2J6XA 3GC2A 3TMQA 3G77A 3LI0A 3C56A 1RH9A 3WMCA 1KM2A 4ERAA 3T42A 3GG7A 1H1ZA 4ZXOA 1O60A 4PTDA 3W71A 3WN6A 3ONCA 2V2CA 3KOXA 3LMZA 1EL3A 2B7PA 1ENUA 1ISWA 2CBJA 3UNTA 1VRDA 4C6LA 3VKJA 3SEPA 5T26A 3UP8A 3L4VA 3LENA 2WCAA 1V6WA 2QLYA 3B03A 1XSIA 2NV9A 1FWTA 4NU7A 3N4EA 1GOWA 4PE8A 1PKYA 1XF0A 3VIFA 3MVIA 1V3KA 3LHVA 3REQA 2V68A 4UQ9A 1DTUA 5MF5A 1NDVA 1P7TA 1EF2A 3NQAA 4GI8A 5D09A 3S8HA 2Z4GA 3DGBA 2R1MA 2Y5JA 2I9UA 1SSDA 3T0TA 3U2ZA 1ZBCA 4A35A 1JUEA 2HMCA 1OINA 4F3HA 3ES7A 3GTXA 3OVRA 3QVQA 1O1HA 3RPDA 2GUYA 4AQLA 1L2UA 4WLCA 4IPJA 5BW6A 5BYWA 1P0NA 2PPGA 2AQOA 4YMZA 1A5NC 3W7LA 4P5UA 3BOLA 3MJMA 2QUVA 2AQWA 5I6SA 1J9YA 4Q8PA 2ZX8A 3O0KA 2BY2A 4HMNA 2CHNA 2IUZA 2R24A 3EB3A 1OY0A 3QMSA 4YVXA 1E4MM 4XAPA 3UJFA 1YQ2A 3GDTA 3IACA 4JN6A 3NAVA 5CSSA 1HIZA 3BPWA 4DQWA 1TVNA 1YTKA 2BX7A 3CAQA 3WF2A 5M5DA 4LXFA 3O7UA 3T8QA 4NZJA 4W93A 1R47A 1BWKA 4PMUA 5G1TA 3TC3A 3U7BA 3UEQA 1R2TA 1V0NA 2CLIA 3ZR4A 2VEPA 1OYBA 4XV0A 1M3UA 4O12A 1V3LA 3LCXA 3VOHA 2ODOA 1ADSA 4GI9A 3NGFA 1MXSA 3ERPA 2YL9A 4Z17A 2PF8A 1TA3B 2RH9A 3L21A 2YCKX 3MKVA 4AD0A 4NX0A 3AXHA 4FSAA 1O5XA 3VD3A 1UB3A 2VX7A 1R3VA 1JDDA 2WB5A 4DXKA 4LVBA 4MB5A 1B0IA 2Z6JA 3GR8A 4E2OA 3VFLA 4X0VA 3L68A 1UBPC 2WAGA 1JYXA 4UB9A 1VRXA 3PY2A 3AS3A 1YYAA 1KRAC 4JX4A 1RLCL 3NQ2A 4BJHA 2ATSA 2QCDB 4NL1A 1OG6A 1GYLA 2J9YA 2YBTA 3FSTA 3DG6A 2V3FA 3SUSA 1JDEA 3FA5A 1DORA 1V6XA 2C18A 1DIEA 2XHYA 4DJDA 1AJ2A 4JFSA 2C0HA 1OVDA 3S6DA 4A3UA 4L9XA 4FXSA 5CAHA 5DXYA 3LDVA 1BQCA 3AMGA 3DEQA 2QJNA 1QMLA 1YDOA 2W0UA 3CUIA 3PZTA 3BSGA 3IEBA 3M0LA 4WJEA 3PBYA 3WD1A 1H7WA 4I7VA 3GK0A 3T9PA 2VJXA 2QW5A 1FKXA 3W83A 1BYDA 5CGQA 3CPGA 4U2ZA 4Y6GA 3WQVA 4AZCA 3WSUA 2RDTA 4QJ5B 3TQKA 3GNPA 1GW1A 1DKWA 3B8IA 3KHJA 3KUMA 3FKKA 1LQ2A 4IT1A 4K8GA 4WKFA 5KETA 4H9MA 4QDWA 1PV8A 2P5NA 4QSFA 3CEUA 3Q67A 3DDMA 4NJHA 4RLIA 5CH9A 3SY5A 5CBJA 3TTQA 5DT5A 3LSCA 4EF9A 4B5VA 1KCZA 4J7RA 3USZA 4XKMA 3UA3A 2POZA 3RHGA 4PSRA 2Z7KA 3ARVA 1ZAJA 4E8CA 4WSHA 3TYCA 1JPDX 4LEFA 1W1VA 4XD3A 4Q4MA 1WZKA 4O1DA 4CD6A 4OWGA 2VVSA 2WLYA 4M6VA 4WX2A 3WBAA 1OGSA 1YIXA 1XYZA 3V4BA 5IRPA 4BEUA 1ONEA 4GQBA 4PTMA 3VIKA 5TAOA 1TZZA 3H70A 1TIWA 1QU4A 4S3DA 3QQ1A 3CUJA 1QK2A 1NAL1 4DHGA 2WLZA 1B1YA 2FMOA 2GPTA 3W74A 2PTXA 4CQAA 1TTQA 1F6YA 3W2UA 4DO5A 1JCLA 1PX3A 2NX3A 4YHEA 4J4KA 4LY8A 4KRTA 3KBNA 4K1GA 1T0OA 3CMFA 5BWAA 3CV7A 2A5HA 1CT5A 2QCFA 1VFUA 4IIEA 2QGHA 4A8LA 1V51A 1MDRA 4JHOA 4H1ZA 4R3UA 4ZCWA 1SVDA 1FWBC 4J3VA 2OEMA 3PR2A 1OWQA 3BGAA 2RGLA 4KCTA 3WL0A 2YKKA 1FHDA 1I1WA 1S39A 2Y4SA 3NM3A 4BF9A 3PHAA 2E6YA 3LPGA 1XGEA 1OCJA 3N13A 2VL4A 1EHNA 3L0NA 4IX0A 3NGJA 5DBUA 3P0WA 3FVDA 2OQYA 1W5MA 1OD0A 3EB4A 1LLWA 3RDKA 3O8AA 4HNVA 3OU8A 4IP7A 1IZCA 3AYVA 1OYCA 4MMWA 3WJZA 4RW5A 1XYAA 3C52A 5I03A 3WD3A 4HIBA 2DZTA 4Y90A 3U7VA 5AHEA 4C5ZA 3L5MA 4BQ3A 3EMZA 1VB9A 4RE4A 3O16A 8TIMA 4XB3A 1W3KA 1X96A 1JPMA 1J6OA 2R6OA 3MANA 3KBVA 1B9BA 2E4TA 3MC5A 1XLDA 4ADTA 4BA0A 4CLMA 1XRFA 2C91A 5DMNA 3EWDA 3MSRA 3FXYA 2ZUUA 2JF7A 4FLRA 1S2AA 3AHXA 4P8XA 3DHDA 4XX6A 1QHZA 1NDWA 4GJIA 4HB7A 1UKTA 3DAQA 2AKZA 3FVMA 4QLLA 3W22A 3IV3A 2G8ZA 4K3ZA 1L6GA 3NM1A 4NZ4A 3IIOA 4U4MA 1P0DA 3N14A 5REQB 3DIPA 2O9TA 4CEUC 1Z7AA 1BGGA 3QQWA 3VC5A 1UPMB 5C9UA 4IIGA 1LBLA 3SCUA 3LSBA 1DQWA 4QLJA 4GO9A 5HMFA 1EH9A 4LW7A 3TOYA 1PZ3A 3CIXA 2NXGA 4JFVA 3T40A 3BJSA 3MWAA 4DJFA 5F2IA 4AX7A 2YZRA 2YCLB 3BLKA 4GO8A 2P50A 1AH3A 2EPLX 2OOGA 4XZWA 4Z0SA 3L4XA 5D9MA 4Q8WA 3TYAA 1US2A 4BK9A 1XYCA 3G0UA 2CZEA 1HP4A 3A22A 4W8LA 1ZP4A 3N6QA 4WY0B 3W29A 1I60A 5AHIA 1OT1A 3OOQA 4O54A 4KWUA 1F05A 3TYBA 4XK2A 1FWNA 2OT1A 2V5CA 3DFYA 1EJXC 1J12A 1EGZA 2YCJA 1MUWA 1OGGA 1VH7A 1IWBA 2FHCA 1TJ1A 2V67A 3S2NA 2HNEA 4MWAA 4PFMA 2R94A 4O53A 3IARA 2E9MA 3MO4A 5FJOA 2G37A 1IIGA 3CZGA 4KEUA 1Q6DA 3K1GA 1V6YA 3WQOA 4B90A 2WNNA 3CIWA 3IGUA 5AYXA 1RBOB 3BURA 4Q33A 4AX6A 3UQNA 4JEJA 4J1OA 1KNWA 1XQLA 1VR6A 2I17A 3EAUA 2A3AA 2W4XA 4XQ6A 2HVOA 4KIEA 3UG4A 1I2QA 1Y5WA 3N2BA 4NZCA 3P74A 3TYEA 5HANA 4E0CA 3SAZA 4JN8A 1SSGA 3W88A 3ZQ9A 3W01A 1V77A 1YDYA 2DQWA 4P7OA 4KERA 1R0MA 1IT8A 2XIBA 2G4JA 3R8GA 1WE5A 1V7YA 3I7RA 5CGMA 3BVJA 4E8GA 1R3QA 5I02A 3W1TA 1WNOA 1IGWA 1ONWA 1RA0A 3BW2A 3VYLA 3IJ8A 3F5KA 3CQJA 3OIHA 2DVTA 2ZVRA 4Q8UA 4YWSA 1R9YA 1POJA 1OB0A 1W5QA 3EXTA 4Q32A 4GFIA 1PZ0A 1DWAM 1UQZA 4EANA 1X6UA 1VCGA 4UFJA 5EKYA 2DJXA 3W7NA 2FZBA 1XV8A 1S2WA 4ROQA 1GOIA 2QEZA 3LMYA 4W84A 3W1UA 3KL5A 2PDYA 3BAYA 2PWHA 3WLTA 3KS6A 2QVHA 3AUJA 1Z42A 2PLKA 4KCWA 1B31A 3EMCA 1KFJA 3NQGA 4H4IA 1R38A 3WNKA 3R7MA 4S3BA 5FEZA 3WLJA 3FA4A 3ARQA 1MRAA 1F3XA 4JIPA 1TELA 3O63A 4Q8TA 5CC7A 3LNMA 4WEVX 1DWHM 1XUUA 1A49A 1W54A 2ZCGA 1REQA 2J27A 3NURA 1LCOA 4IL0A 3C86A 5BMWA 1BF6A 1C9WA 1H0IA 1VC4A 2QPSA 5CC5A 2FVLA 3QTGA 4GKTA 2I9EA 4HPXA 2Y85A 3K8LA 4HNTA 2VM8A 5DRIA 3HGOA 4AD1A 3QMRA 3JW7A 3G1RA 4UOZA 3CZLA 1O7AA 3Q4DA 1XKYA 3SCWA 3FHQA 1QI3A 2OSYA 1V08A 3S0CA 4M1RA 2CHOA 4H01A 1JCMP 2ZWYA 2GJXB 5A8NA 4QS5A 2IW0A 1ITXA 2Q8XA 2WC3A 3CIVA 4NAFB 1UZ1A 3NL6A 1HTIA 1EDTA 1R46A 4I9JA 1H61A 3QPZA 3WJYA 4L1XA 2GVEA 2J79A 1UZDA 1WA3A 3MMDA 1XLCA 1DQUA 5CXPA 2Y63A 2JEQA 1U5VA 5E9XA 4M80A 4PULA 2FFIA 4B5SA 3U2OA 3A13A 3WNMA 1PWMA 1LL6A 5CPNA 3U5YA 5AHNA 3BARA 1GVIA 8A3HA 1M53A 5LIWX 3DENA 1EFZA 4KEVA 3A9BA 3WLHA 1AD4A 5D2YA 5H8PA 2W91A 2GGJA 4JDBA 4O1AA 1OG0A 1A0EA 4JQ4A 3NQDA 4OOZA 5LNVA 2REQB 2HVMA 2QAFA 3PZGA 2V81A 3I68A 1I2RA 4D6JA 2PTWA 1M41A 1BKHA 3HBLA 2IPJA 1UA3A 4JFWA 3RIKA 3WBEA 3E2QA 4PUMA 6TAAA 2VUYA 4B9YA 1Q4WA 7CGTA 4PA8A 1CLKA 1H41A 3GKFA 2GSHA 4M7TA 5XIMA 3BOFA 1W17A 1LRTA 1NFPA 3ABZA 1AODA 3KZSA 3F7JA 4JY9A 3VKDA 3WH5A 3MI6A 1FKWA 3BAIA 5D8ZA 2X16A 3SDOA 4IISA 1XLAA 1ZFJA 5A8PA 4MJ2A 2G5WA 2PTYA 4D9PA 1KBLA