1XPIA

Crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
229
Chain Sequence
AALADVILYEDDHILVLNKPSGTAVHGGSGLSFGVIEGLRALRARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKRCLQKLRNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal large subunit pseudouridine synthase C
publication title Possible RNA binding domains of RluC and RluD
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 71
structure length 229
sequence length 231
chains with identical sequence B
ec nomenclature ec 5.4.99.24: 23S rRNA pseudouridine(955/2504/2580) synthase.
pdb deposition date 2004-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 1xpiA00
1ZL3A 2AB4A 2ISTA 3HJWA 3LWPA 1KSLA 1V9FA 3LWOA 3U28A 2HVYA 3HAXA 3DH3A 2I82A 2RFKA 1ZE1A 3MQKA 1ZE2A 2APOA 1V9KA 1XPIA 4LABA 1KSVA 2AUSA 1SGVA 1QYUA 1KSKA 3LWVA 2EY4A 3UAIA 1R3FA 3LWQA 1PRZA 1K8WA 4LGTA 3LWRA 3HJYA 1R3EA
chains in the Genus database with same CATH superfamily
1ZL3A 2AB4A 2ISTA 3HJWA 3LWPA 1KSLA 1V9FA 3LWOA 3U28A 2HVYA 3HAXA 3DH3A 2I82A 2RFKA 1ZE1A 3MQKA 1ZE2A 2APOA 1V9KA 1Z2ZA 1SZWA 1XPIA 4LABA 1KSVA 2AUSA 1SGVA 1QYUA 1KSKA 3LWVA 2EY4A 3UAIA 1R3FA 3LWQA 1PRZA 1K8WA 4LGTA 3LWRA 1SI7A 3HJYA 1R3EA 1SB7A
chains in the Genus database with same CATH topology
1ZL3A 2AB4A 2ISTA 3HJWA 3LWPA 1KSLA 1V9FA 3LWOA 3U28A 2HVYA 3HAXA 3DH3A 2I82A 2RFKA 1ZE1A 3MQKA 1ZE2A 2APOA 1V9KA 1Z2ZA 1SZWA 1XPIA 4LABA 1KSVA 2AUSA 1SGVA 1QYUA 1KSKA 3LWVA 2EY4A 3UAIA 1R3FA 3LWQA 1PRZA 1K8WA 4LGTA 3LWRA 1SI7A 3HJYA 1R3EA 1SB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL3 A;  2AB4 A;  2IST A;  3HJW A;  3LWP A;  1KSL A;  1V9F A;  3LWO A;  3U28 A;  2HVY A;  3HAX A;  3DH3 A;  2I82 A;  2RFK A;  1ZE1 A;  3MQK A;  1ZE2 A;  2APO A;  1V9K A;  1XPI A;  4LAB A;  1KSV A;  2AUS A;  1SGV A;  1QYU A;  1KSK A;  3LWV A;  2EY4 A;  3UAI A;  1R3F A;  3LWQ A;  1PRZ A;  1K8W A;  4LGT A;  3LWR A;  3HJY A;  1R3E A; 
#chains in the Genus database with same CATH topology
 1ZL3 A;  2AB4 A;  2IST A;  3HJW A;  3LWP A;  1KSL A;  1V9F A;  3LWO A;  3U28 A;  2HVY A;  3HAX A;  3DH3 A;  2I82 A;  2RFK A;  1ZE1 A;  3MQK A;  1ZE2 A;  2APO A;  1V9K A;  1Z2Z A;  1SZW A;  1XPI A;  4LAB A;  1KSV A;  2AUS A;  1SGV A;  1QYU A;  1KSK A;  3LWV A;  2EY4 A;  3UAI A;  1R3F A;  3LWQ A;  1PRZ A;  1K8W A;  4LGT A;  3LWR A;  1SI7 A;  3HJY A;  1R3E A;  1SB7 A; 
#chains in the Genus database with same CATH homology
 1ZL3 A;  2AB4 A;  2IST A;  3HJW A;  3LWP A;  1KSL A;  1V9F A;  3LWO A;  3U28 A;  2HVY A;  3HAX A;  3DH3 A;  2I82 A;  2RFK A;  1ZE1 A;  3MQK A;  1ZE2 A;  2APO A;  1V9K A;  1Z2Z A;  1SZW A;  1XPI A;  4LAB A;  1KSV A;  2AUS A;  1SGV A;  1QYU A;  1KSK A;  3LWV A;  2EY4 A;  3UAI A;  1R3F A;  3LWQ A;  1PRZ A;  1K8W A;  4LGT A;  3LWR A;  1SI7 A;  3HJY A;  1R3E A;  1SB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...