1XPPA

Crystal structure of ta1416,dna-directed rna polymerase subunit l, from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'AESSLRVISKEKNSITVEMINYDNTLLRTLVEEILKDDQVDEARYYIKHPVIDNPQIYVRVKSGKPQSAIKRAVRKLSKLYEDLGTQFQKEFQRYESDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit L
publication title Crystal structure of TA1416, DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1xppA00
4ZH4A 2PMZL 1I6VA 2Y0SD 2NVTK 3GTLC 4BXXK 4XSXA 4XSZA 1I6HC 5FLMC 1Y1VK 5C4JK 1Y1WK 4A3GC 4AYBD 5IYBC 5M5YK 3GTGC 4QJVA 3GTJC 2WB1L 3GTMC 3PO2C 2JA6C 3S14K 3GTQC 2R93C 5FLMK 2NVYK 4Y52C 3HOUC 2JA7C 4OINA 4NOIA 2WAQL 4A3MC 3GTGK 1TWFC 5IYCK 3GTJK 3HOWC 4A93C 2YU9C 4LJZA 4X6AK 4KN4A 5C4XK 2E2IK 2PPBA 2R92K 5C3EC 4OIRA 3S15C 4Y52K 4A3MK 3FKIC 4BBRC 3I4NC 3M3YK 3HOVC 4A3EK 3GTOC 1I3QK 5IP9C 4A3FC 3H0GC 3S17K 2PMZD 3S2HK 4BY7K 1TWGC 5D4DA 5IP7K 3S1MC 3S1NC 5C44K 3DXJA 3GTOK 3HOZC 4C2MK 1SFOK 2PA8L 1XPPA 3M4OC 1TWGK 2JA5C 3HOYK 4KN7A 2WB1D 4A3BC 3H3VL 2E2JK 3PO3K 2VUMC 1SMYA 1YNJA 3K7AK 1I50C 4OIPA 2WAQD 5FJ8K 3GTQK 4BBSC 3GTLK 4A3KC 3S2DC 1K83C 4QJVB 2CW0A 5IYDC 3HOXC 3S16C 1I6HK 3I4MC 4YFKA 3WODA 4A3GK 3RZDC 5IYBK 4OIOA 2B63C 3PO2K 3GTMK 2R93K 2JA6K 5M5XK 4MQ9A 3HOUK 4QIWL 2JA7K 4G7HA 4A93K 3HOWK 3S1QC 4JK1A 1TWFK 1TWHC 4YFNA 4C3IK 2YU9K 3RZOC 2PA8D 2R7ZC 3S15K 2NVXC 5C3EK 1BDFA 3FKIK 4BBRK 1IW7A 4C3HK 4YFXA 3H3VD 1TWHK 3HOVK 3I4NK 4Y7NC 5IP9K 4A3FK 2R7ZK 3H0GK 4G7OA 3GTKC 2O5JA 4A3JC 3S1MK 3S1NK 4Y7NK 3HOZK 1TWAC 5M3FK 3M4OK 1R9TC 5M3MK 2JA5K 4A3BK 2A6EA 3CQZC 2A68A 4A3CC 4XLPA 4QIWD 2VUMK 4BBSK 1WCMC 1I50K 1ZYRA 3S1RC 4A3DC 4LK1A 4A3LC 3CQZK 4A3KK 3S2DK 1K83K 2NVQC 3GTPC 4OIQA 5IYDK 3HOXK 2E2HC 3S16K 4BY1C 3I4MK 1YNNA 2JA8C 4A3IC 3RZDK 4A3LK 4BXXC 2NVTC 2B63K 3HKZL 4C3JK 2A6HA 2BE5A 1Y1VC 5C4JC 1Y1WC 4MEYA 3S1QK 4G7ZA 4XLNA 3RZOK 3S14C 2NVXK 2NVYC 1HQMA 4A3IK 2Y0SL 5IYCC 5TMCA 5M5WK 4X6AC 5C4XC 4YG2A 2E2IC 2R92C 3GTKK 4A3JK 1TWCC 4AYBL 3M3YC 5TMFA 4A3EC 1TWAK 1I3QC 3S17C 3S2HC 4BY7C 1R9TK 4GZYA 5IP7C 1TWCK 4Q4ZA 2A69A 3HKZD 4Q5SA 3EQLA 4LLGA 5C44C 4A3CK 4LK0A 1SFOC 1WCMK 4A3DK 3S1RK 4MEXA 3HOYC 4KMUA 3GTPK 2NVQK 2E2HK 2E2JC 3PO3C 4BY1K 2JA8K 2O5IA 3K7AC
chains in the Genus database with same CATH superfamily
2PMZL 1I6VA 2Y0SD 2XCRB 1EFWA 3GTLC 4BXXK 4XSXA 1I6HC 2B63A 1Y1VK 4AYBD 3GTGC 1IQ0A 3ADAC 4QJVA 2WB1L 1IL2A 3GTMC 4BKWA 1VRQC 4Y52C 2JA7C 4A93C 2R7ZA 3HOWC 5EGEA 5C4XK 2R92K 4BBRC 1WSVA 4A3FC 3S17K 2PMZD 3AQPA 1TWGC 5D4DA 1O25A 5IP7K 1IE0A 3TTGA 1R9TA 1WOOA 3S1NC 3SZZA 1VLOA 3M4OC 1XZQB 2WB1D 4KN7A 3PO3K 1VGXA 4BBSC 4KB2A 1K83C 3S16C 1UV7A 4A3GK 3GEIA 1RU0A 1HI9A 3AD8C 4M1XA 4G7HA 4BLAA 1TWFK 4O2DA 1TWHC 4YFNA 2YU9K 3AQOA 3FOEA 1V5VA 5C3EK 3T01A 5IOQA 3I4NK 1IW7A 2GAHC 2E2IA 3TFJA 4Y7NC 1TWCA 5IP9K 2R7ZK 4G7OA 4RMFA 1ISEA 3HOZK 1EK8A 4A3BK 1INNA 2A68A 2V6TA 2KWAA 2VUMK 1WCMC 1I50K 1ZYRA 4P5AA 4LK1A 4A3KK 3SZYA 4GTDA 4BLBA 4BY1C 4BXXC 2XCQA 3G4AA 4C3JK 2A6HA 3GTJA 2R93A 1Y1VC 1XXAA 2JA6A 4KMAA 3TFIA 1ZQ1C 1B4AA 3AH5A 3T00A 2NVXK 2ZUEA 1ZXOA 1XZPB 3GEHA 5IORA 4YG2A 5CHPA 2R92C 2XCOA 3GTKK 5C4XC 3H0GA 2GAGC 3GSIA 2ZUFA 1TWAK 3S17C 3HXAA 2W7VA 5IP7C 1TWCK 3ERED 4LLGA 4A3CK 4LK0A 4KARA 4A3DK 3S1RK 1WQGA 3LAJA 2NVQK 3GTPK 3PO3C 2JA8K 2O5IA 1BJTA 3GDZA 4A3GC 3N0CA 4LR2A 5M5YK 3G4CA 4LQYA 1IS1A 1YCLA 5FLMK 2NVYK 4GT9A 4WJ3M 1O28A 4NOIA 1L0WA 1TWFC 3GTJK 2YU9C 4LJZA 2EBBA 3S0XA 4KN4A 2PPBA 5C3EC 4A3MK 4WILA 3I4NC 3AD7C 3GTOC 1I3QK 5IP9C 5C44K 3HOZC 1XPPA 1G51A 4A3BC 2RH6A 4GTFA 2VUMC 1I50C 2E2HA 5FJ8K 5JFEA 4A3KC 2CW0A 1O2BA 5IYBK 4OIOA 1WOPA 1Y1WA 3PO2K 4C3IC 4GTLA 5M5XK 4C3JC 4QIWL 2ZFZA 1J6VA 3S15K 3MMLB 2NVXC 1BDFA 1PJ6A 3FKIK 4C3HK 1DCOA 4G0VA 2CFAB 3GTKC 4KASA 1WIHA 3TFHA 2PHCB 1TWAC 1C0AA 1YX2A 5M3MK 2JA5K 1XXBA 3CQZC 1SFOA 3BUEA 2V6UA 3GEEA 4ILDA 4LOWA 1USOA 4A3CC 4XLPA 4QIWD 5EGHA 4A3DC 3S1RC 3GTQA 1XXCA 2NVQC 3GTPC 4OIQA 5IYDK 3GTLA 4AH6A 5IOSA 2JA8C 4A3LK 1VH2A 2B63K 4C45A 3GTGA 3HKZL 2BE5A 3GTMA 4KMHA 1F9NA 4PABA 3S1QK 4G7ZA 2JA7A 2NVYC 1HQMA 1F7UA 3N3YA 2Y3PA 5IOTA 4A3JK 4KB4A 5TMFA 1TWGA 4KMDA 1I3QC 1R9TK 4J3NA 4GTEA 3HKZD 4FZBA 3GIRA 5C44C 3OREA 1BS2A 4KM9A 4MEXA 1AB4A 1K83A 3BP3A 4A3IK 1XZQA 2NVTK 3FHZA 1X31C 5C4JK 3OPFA 5IYBC 4GTCA 1J6WA 3PO2C 3S14K 1TWHA 1WQHA 4OINA 3GTGK 2WAQL 5IYCK 1DCPA 4X6AK 2E2IK 3S15C 4Y52K 4OIRA 1PJ5A 3FKIC 4C3HC 3M3YK 4KATA 1O27A 2GSNA 3S2HK 4GFQA 2P8TA 2FQTA 4PAAA 4C2MK 4GTBA 1TWGK 2JA5C 3HOYK 1SMYA 5E68A 4OIPA 3L4KA 2WAQD 4QJVB 5IYDC 4YFKA 3WODA 1B4BA 3AD9C 1Y1VA 2B63C 2R93K 2JA6K 3HOUK 3S1QC 4JK1A 2GSOA 1O2AA 1JVIA 2R7ZC 3LAPA 3LPXA 3A8IA 2R92A 4YFXA 1TWHK 3HOVK 5L46A 3H0GK 1DCHA 3FOFA 1PJ7A 4A3JC 4P5BA 3S1MK 4Y7NK 1XZPA 5M3FK 1R9TC 1O24A 1DD5A 3S2DK 3HOXK 4XCHA 1O26A 3I4MK 1YNNA 4A3IC 3RZDK 2NVTC 2D6FC 5C4JC 4MEYA 3A8KA 3RZOK 3S14C 1TWFA 2YU9A 4P9SA 4GTAA 5IYCC 5TMCA 4X6AC 2E2IC 1WSRA 3GTOA 1TWCC 3M3YC 1VJEA 4KDDA 3S2HC 4GZYA 3NUHA 3VA7A 4Q4ZA 4Q5SA 3IPJA 4C2MC 1F93A 3HOYC 2VUMA 1I50A 2E2HK 4ZH4A 1IBAA 4XSZA 3V4GA 5FLMC 5JVOA 1Y1WK 4FM9A 4G0UA 3GTJC 2R93C 2JA6C 4G0WA 2V6SA 3HOUC 4A3MC 2NVXA 4KAWX 3GTKA 3HOVC 4A3EK 1KQ4A 3H0GC 4BY7K 1O29A 1TWAA 3S1MC 3A8JA 1F7VA 3CQZA 3DXJA 3GTOK 1SFOK 2CFAA 2PA8L 1JQWA 1EI6A 5TJ3A 3H3VL 2E2JK 1WQFA 3GTPA 1YNJA 3GTQK 3K7AK 3GTLK 3OEPA 1EQRA 3S2DC 3HOXC 1I6HK 3I4MC 5CJ9A 3RZDC 5HL8A 3GTMK 3CAGA 4MQ9A 2JA7K 4A93K 3HOWK 2NVYA 4C3IK 3RZOC 2PA8D 1EH1A 4BBRK 3H3VD 4WJ4A 3Q3QA 4A3FK 1WOSA 2O5JA 1I3QA 1WCMA 3S1NK 3M4OK 2A6EA 2JH3A 4BBSK 2P5MA 4A3LC 3CQZK 1K83K 3S16K 2E2HC 3N0BA 1GE9A 1USMA 1ZVUA 1J6XA 3T02A 1O2FB 1BGWA 1Y1WC 2FQOA 4XLNA 1J98A 1JOEA 3QX3A 1WORA 2Y0SL 3FKIA 5M5WK 4DDQA 4KC6A 4AYBL 1ZBSA 4A3EC 3L4JA 4BY7C 4KM8A 2A69A 3EQLA 3JSTA 2JA5A 1SFOC 1WCMK 2GSUA 3BP8C 4KMUA 2RGRA 2E2JC 4BY1K 3GTQC 3K7AC
chains in the Genus database with same CATH topology
4ZH4A 2PMZL 1I6VA 2Y0SD 2NVTK 3GTLC 4BXXK 4XSXA 4XSZA 1I6HC 5FLMC 1Y1VK 5C4JK 1Y1WK 4A3GC 4AYBD 5IYBC 5M5YK 3GTGC 4QJVA 3GTJC 2WB1L 3GTMC 3PO2C 2JA6C 3S14K 3GTQC 2R93C 5FLMK 2NVYK 4Y52C 3HOUC 2JA7C 4OINA 4NOIA 2WAQL 4A3MC 3GTGK 1TWFC 5IYCK 3GTJK 3HOWC 4A93C 2YU9C 4LJZA 4X6AK 4KN4A 5C4XK 2E2IK 2PPBA 2R92K 5C3EC 4OIRA 3S15C 4Y52K 4A3MK 3FKIC 4BBRC 3I4NC 3M3YK 3HOVC 4A3EK 3GTOC 1I3QK 5IP9C 4A3FC 3H0GC 3S17K 2PMZD 3S2HK 4BY7K 1TWGC 5D4DA 5IP7K 3S1MC 3S1NC 5C44K 3DXJA 3GTOK 3HOZC 4C2MK 1SFOK 2PA8L 1XPPA 3M4OC 1TWGK 2JA5C 3HOYK 4KN7A 2WB1D 4A3BC 3H3VL 2E2JK 3PO3K 2VUMC 1SMYA 1YNJA 3K7AK 1I50C 4OIPA 2WAQD 5FJ8K 3GTQK 4BBSC 3GTLK 4A3KC 3S2DC 1K83C 4QJVB 2CW0A 5IYDC 3HOXC 3S16C 1I6HK 3I4MC 4YFKA 3WODA 4A3GK 3RZDC 5IYBK 4OIOA 2B63C 3PO2K 3GTMK 2R93K 2JA6K 5M5XK 4MQ9A 3HOUK 4QIWL 2JA7K 4G7HA 4A93K 3HOWK 3S1QC 4JK1A 1TWFK 1TWHC 4YFNA 4C3IK 2YU9K 3RZOC 2PA8D 2R7ZC 3S15K 2NVXC 5C3EK 1BDFA 3FKIK 4BBRK 1IW7A 4C3HK 4YFXA 3H3VD 1TWHK 3HOVK 3I4NK 4Y7NC 5IP9K 4A3FK 2R7ZK 3H0GK 4G7OA 3GTKC 2O5JA 4A3JC 3S1MK 3S1NK 4Y7NK 3HOZK 1TWAC 5M3FK 3M4OK 1R9TC 5M3MK 2JA5K 4A3BK 2A6EA 3CQZC 2A68A 4A3CC 4XLPA 4QIWD 2VUMK 4BBSK 1WCMC 1I50K 1ZYRA 3S1RC 4A3DC 4LK1A 4A3LC 3CQZK 4A3KK 3S2DK 1K83K 2NVQC 3GTPC 4OIQA 5IYDK 3HOXK 2E2HC 3S16K 4BY1C 3I4MK 1YNNA 2JA8C 4A3IC 3RZDK 4A3LK 4BXXC 2NVTC 2B63K 3HKZL 4C3JK 2A6HA 2BE5A 1Y1VC 5C4JC 1Y1WC 4MEYA 3S1QK 4G7ZA 4XLNA 3RZOK 3S14C 2NVXK 2NVYC 1HQMA 4A3IK 2Y0SL 5IYCC 5TMCA 5M5WK 4X6AC 5C4XC 4YG2A 2E2IC 2R92C 3GTKK 4A3JK 1TWCC 4AYBL 3M3YC 5TMFA 4A3EC 1TWAK 1I3QC 3S17C 3S2HC 4BY7C 1R9TK 4GZYA 5IP7C 1TWCK 4Q4ZA 2A69A 3HKZD 4Q5SA 3EQLA 4LLGA 5C44C 4A3CK 4LK0A 1SFOC 1WCMK 4A3DK 3S1RK 4MEXA 3HOYC 4KMUA 3GTPK 2NVQK 2E2HK 2E2JC 3PO3C 4BY1K 2JA8K 2O5IA 3K7AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZH4 A;  2PMZ L;  1I6V A;  2Y0S D;  2NVT K;  3GTL C;  4BXX K;  4XSX A;  4XSZ A;  1I6H C;  5FLM C;  1Y1V K;  5C4J K;  1Y1W K;  4A3G C;  4AYB D;  5IYB C;  5M5Y K;  3GTG C;  4QJV A;  3GTJ C;  2WB1 L;  3GTM C;  3PO2 C;  2JA6 C;  3S14 K;  3GTQ C;  2R93 C;  5FLM K;  2NVY K;  4Y52 C;  3HOU C;  2JA7 C;  4OIN A;  4NOI A;  2WAQ L;  4A3M C;  3GTG K;  1TWF C;  5IYC K;  3GTJ K;  3HOW C;  4A93 C;  2YU9 C;  4LJZ A;  4X6A K;  4KN4 A;  5C4X K;  2E2I K;  2PPB A;  2R92 K;  5C3E C;  4OIR A;  3S15 C;  4Y52 K;  4A3M K;  3FKI C;  4BBR C;  3I4N C;  3M3Y K;  3HOV C;  4A3E K;  3GTO C;  1I3Q K;  5IP9 C;  4A3F C;  3H0G C;  3S17 K;  2PMZ D;  3S2H K;  4BY7 K;  1TWG C;  5D4D A;  5IP7 K;  3S1M C;  3S1N C;  5C44 K;  3DXJ A;  3GTO K;  3HOZ C;  4C2M K;  1SFO K;  2PA8 L;  1XPP A;  3M4O C;  1TWG K;  2JA5 C;  3HOY K;  4KN7 A;  2WB1 D;  4A3B C;  3H3V L;  2E2J K;  3PO3 K;  2VUM C;  1SMY A;  1YNJ A;  3K7A K;  1I50 C;  4OIP A;  2WAQ D;  5FJ8 K;  3GTQ K;  4BBS C;  3GTL K;  4A3K C;  3S2D C;  1K83 C;  4QJV B;  2CW0 A;  5IYD C;  3HOX C;  3S16 C;  1I6H K;  3I4M C;  4YFK A;  3WOD A;  4A3G K;  3RZD C;  5IYB K;  4OIO A;  2B63 C;  3PO2 K;  3GTM K;  2R93 K;  2JA6 K;  5M5X K;  4MQ9 A;  3HOU K;  4QIW L;  2JA7 K;  4G7H A;  4A93 K;  3HOW K;  3S1Q C;  4JK1 A;  1TWF K;  1TWH C;  4YFN A;  4C3I K;  2YU9 K;  3RZO C;  2PA8 D;  2R7Z C;  3S15 K;  2NVX C;  5C3E K;  1BDF A;  3FKI K;  4BBR K;  1IW7 A;  4C3H K;  4YFX A;  3H3V D;  1TWH K;  3HOV K;  3I4N K;  4Y7N C;  5IP9 K;  4A3F K;  2R7Z K;  3H0G K;  4G7O A;  3GTK C;  2O5J A;  4A3J C;  3S1M K;  3S1N K;  4Y7N K;  3HOZ K;  1TWA C;  5M3F K;  3M4O K;  1R9T C;  5M3M K;  2JA5 K;  4A3B K;  2A6E A;  3CQZ C;  2A68 A;  4A3C C;  4XLP A;  4QIW D;  2VUM K;  4BBS K;  1WCM C;  1I50 K;  1ZYR A;  3S1R C;  4A3D C;  4LK1 A;  4A3L C;  3CQZ K;  4A3K K;  3S2D K;  1K83 K;  2NVQ C;  3GTP C;  4OIQ A;  5IYD K;  3HOX K;  2E2H C;  3S16 K;  4BY1 C;  3I4M K;  1YNN A;  2JA8 C;  4A3I C;  3RZD K;  4A3L K;  4BXX C;  2NVT C;  2B63 K;  3HKZ L;  4C3J K;  2A6H A;  2BE5 A;  1Y1V C;  5C4J C;  1Y1W C;  4MEY A;  3S1Q K;  4G7Z A;  4XLN A;  3RZO K;  3S14 C;  2NVX K;  2NVY C;  1HQM A;  4A3I K;  2Y0S L;  5IYC C;  5TMC A;  5M5W K;  4X6A C;  5C4X C;  4YG2 A;  2E2I C;  2R92 C;  3GTK K;  4A3J K;  1TWC C;  4AYB L;  3M3Y C;  5TMF A;  4A3E C;  1TWA K;  1I3Q C;  3S17 C;  3S2H C;  4BY7 C;  1R9T K;  4GZY A;  5IP7 C;  1TWC K;  4Q4Z A;  2A69 A;  3HKZ D;  4Q5S A;  3EQL A;  4LLG A;  5C44 C;  4A3C K;  4LK0 A;  1SFO C;  1WCM K;  4A3D K;  3S1R K;  4MEX A;  3HOY C;  4KMU A;  3GTP K;  2NVQ K;  2E2H K;  2E2J C;  3PO3 C;  4BY1 K;  2JA8 K;  2O5I A;  3K7A C; 
#chains in the Genus database with same CATH topology
 2PMZ L;  1I6V A;  2Y0S D;  2XCR B;  1EFW A;  3GTL C;  4BXX K;  4XSX A;  1I6H C;  2B63 A;  1Y1V K;  4AYB D;  3GTG C;  1IQ0 A;  3ADA C;  4QJV A;  2WB1 L;  1IL2 A;  3GTM C;  4BKW A;  1VRQ C;  4Y52 C;  2JA7 C;  4A93 C;  2R7Z A;  3HOW C;  5EGE A;  5C4X K;  2R92 K;  4BBR C;  1WSV A;  4A3F C;  3S17 K;  2PMZ D;  3AQP A;  1TWG C;  5D4D A;  1O25 A;  5IP7 K;  1IE0 A;  3TTG A;  1R9T A;  1WOO A;  3S1N C;  3SZZ A;  1VLO A;  3M4O C;  1XZQ B;  2WB1 D;  4KN7 A;  3PO3 K;  1VGX A;  4BBS C;  4KB2 A;  1K83 C;  3S16 C;  1UV7 A;  4A3G K;  3GEI A;  1RU0 A;  1HI9 A;  3AD8 C;  4M1X A;  4G7H A;  4BLA A;  1TWF K;  4O2D A;  1TWH C;  4YFN A;  2YU9 K;  3AQO A;  3FOE A;  1V5V A;  5C3E K;  3T01 A;  5IOQ A;  3I4N K;  1IW7 A;  2GAH C;  2E2I A;  3TFJ A;  4Y7N C;  1TWC A;  5IP9 K;  2R7Z K;  4G7O A;  4RMF A;  1ISE A;  3HOZ K;  1EK8 A;  4A3B K;  1INN A;  2A68 A;  2V6T A;  2KWA A;  2VUM K;  1WCM C;  1I50 K;  1ZYR A;  4P5A A;  4LK1 A;  4A3K K;  3SZY A;  4GTD A;  4BLB A;  4BY1 C;  4BXX C;  2XCQ A;  3G4A A;  4C3J K;  2A6H A;  3GTJ A;  2R93 A;  1Y1V C;  1XXA A;  2JA6 A;  4KMA A;  3TFI A;  1ZQ1 C;  1B4A A;  3AH5 A;  3T00 A;  2NVX K;  2ZUE A;  1ZXO A;  1XZP B;  3GEH A;  5IOR A;  4YG2 A;  5CHP A;  2R92 C;  2XCO A;  3GTK K;  5C4X C;  3H0G A;  2GAG C;  3GSI A;  2ZUF A;  1TWA K;  3S17 C;  3HXA A;  2W7V A;  5IP7 C;  1TWC K;  3ERE D;  4LLG A;  4A3C K;  4LK0 A;  4KAR A;  4A3D K;  3S1R K;  1WQG A;  3LAJ A;  2NVQ K;  3GTP K;  3PO3 C;  2JA8 K;  2O5I A;  1BJT A;  3GDZ A;  4A3G C;  3N0C A;  4LR2 A;  5M5Y K;  3G4C A;  4LQY A;  1IS1 A;  1YCL A;  5FLM K;  2NVY K;  4GT9 A;  4WJ3 M;  1O28 A;  4NOI A;  1L0W A;  1TWF C;  3GTJ K;  2YU9 C;  4LJZ A;  2EBB A;  3S0X A;  4KN4 A;  2PPB A;  5C3E C;  4A3M K;  4WIL A;  3I4N C;  3AD7 C;  3GTO C;  1I3Q K;  5IP9 C;  5C44 K;  3HOZ C;  1XPP A;  1G51 A;  4A3B C;  2RH6 A;  4GTF A;  2VUM C;  1I50 C;  2E2H A;  5FJ8 K;  5JFE A;  4A3K C;  2CW0 A;  1O2B A;  5IYB K;  4OIO A;  1WOP A;  1Y1W A;  3PO2 K;  4C3I C;  4GTL A;  5M5X K;  4C3J C;  4QIW L;  2ZFZ A;  1J6V A;  3S15 K;  3MML B;  2NVX C;  1BDF A;  1PJ6 A;  3FKI K;  4C3H K;  1DCO A;  4G0V A;  2CFA B;  3GTK C;  4KAS A;  1WIH A;  3TFH A;  2PHC B;  1TWA C;  1C0A A;  1YX2 A;  5M3M K;  2JA5 K;  1XXB A;  3CQZ C;  1SFO A;  3BUE A;  2V6U A;  3GEE A;  4ILD A;  4LOW A;  1USO A;  4A3C C;  4XLP A;  4QIW D;  5EGH A;  4A3D C;  3S1R C;  3GTQ A;  1XXC A;  2NVQ C;  3GTP C;  4OIQ A;  5IYD K;  3GTL A;  4AH6 A;  5IOS A;  2JA8 C;  4A3L K;  1VH2 A;  2B63 K;  4C45 A;  3GTG A;  3HKZ L;  2BE5 A;  3GTM A;  4KMH A;  1F9N A;  4PAB A;  3S1Q K;  4G7Z A;  2JA7 A;  2NVY C;  1HQM A;  1F7U A;  3N3Y A;  2Y3P A;  5IOT A;  4A3J K;  4KB4 A;  5TMF A;  1TWG A;  4KMD A;  1I3Q C;  1R9T K;  4J3N A;  4GTE A;  3HKZ D;  4FZB A;  3GIR A;  5C44 C;  3ORE A;  1BS2 A;  4KM9 A;  4MEX A;  1AB4 A;  1K83 A;  3BP3 A;  4A3I K;  1XZQ A;  2NVT K;  3FHZ A;  1X31 C;  5C4J K;  3OPF A;  5IYB C;  4GTC A;  1J6W A;  3PO2 C;  3S14 K;  1TWH A;  1WQH A;  4OIN A;  3GTG K;  2WAQ L;  5IYC K;  1DCP A;  4X6A K;  2E2I K;  3S15 C;  4Y52 K;  4OIR A;  1PJ5 A;  3FKI C;  4C3H C;  3M3Y K;  4KAT A;  1O27 A;  2GSN A;  3S2H K;  4GFQ A;  2P8T A;  2FQT A;  4PAA A;  4C2M K;  4GTB A;  1TWG K;  2JA5 C;  3HOY K;  1SMY A;  5E68 A;  4OIP A;  3L4K A;  2WAQ D;  4QJV B;  5IYD C;  4YFK A;  3WOD A;  1B4B A;  3AD9 C;  1Y1V A;  2B63 C;  2R93 K;  2JA6 K;  3HOU K;  3S1Q C;  4JK1 A;  2GSO A;  1O2A A;  1JVI A;  2R7Z C;  3LAP A;  3LPX A;  3A8I A;  2R92 A;  4YFX A;  1TWH K;  3HOV K;  5L46 A;  3H0G K;  1DCH A;  3FOF A;  1PJ7 A;  4A3J C;  4P5B A;  3S1M K;  4Y7N K;  1XZP A;  5M3F K;  1R9T C;  1O24 A;  1DD5 A;  3S2D K;  3HOX K;  4XCH A;  1O26 A;  3I4M K;  1YNN A;  4A3I C;  3RZD K;  2NVT C;  2D6F C;  5C4J C;  4MEY A;  3A8K A;  3RZO K;  3S14 C;  1TWF A;  2YU9 A;  4P9S A;  4GTA A;  5IYC C;  5TMC A;  4X6A C;  2E2I C;  1WSR A;  3GTO A;  1TWC C;  3M3Y C;  1VJE A;  4KDD A;  3S2H C;  4GZY A;  3NUH A;  3VA7 A;  4Q4Z A;  4Q5S A;  3IPJ A;  4C2M C;  1F93 A;  3HOY C;  2VUM A;  1I50 A;  2E2H K;  4ZH4 A;  1IBA A;  4XSZ A;  3V4G A;  5FLM C;  5JVO A;  1Y1W K;  4FM9 A;  4G0U A;  3GTJ C;  2R93 C;  2JA6 C;  4G0W A;  2V6S A;  3HOU C;  4A3M C;  2NVX A;  4KAW X;  3GTK A;  3HOV C;  4A3E K;  1KQ4 A;  3H0G C;  4BY7 K;  1O29 A;  1TWA A;  3S1M C;  3A8J A;  1F7V A;  3CQZ A;  3DXJ A;  3GTO K;  1SFO K;  2CFA A;  2PA8 L;  1JQW A;  1EI6 A;  5TJ3 A;  3H3V L;  2E2J K;  1WQF A;  3GTP A;  1YNJ A;  3GTQ K;  3K7A K;  3GTL K;  3OEP A;  1EQR A;  3S2D C;  3HOX C;  1I6H K;  3I4M C;  5CJ9 A;  3RZD C;  5HL8 A;  3GTM K;  3CAG A;  4MQ9 A;  2JA7 K;  4A93 K;  3HOW K;  2NVY A;  4C3I K;  3RZO C;  2PA8 D;  1EH1 A;  4BBR K;  3H3V D;  4WJ4 A;  3Q3Q A;  4A3F K;  1WOS A;  2O5J A;  1I3Q A;  1WCM A;  3S1N K;  3M4O K;  2A6E A;  2JH3 A;  4BBS K;  2P5M A;  4A3L C;  3CQZ K;  1K83 K;  3S16 K;  2E2H C;  3N0B A;  1GE9 A;  1USM A;  1ZVU A;  1J6X A;  3T02 A;  1O2F B;  1BGW A;  1Y1W C;  2FQO A;  4XLN A;  1J98 A;  1JOE A;  3QX3 A;  1WOR A;  2Y0S L;  3FKI A;  5M5W K;  4DDQ A;  4KC6 A;  4AYB L;  1ZBS A;  4A3E C;  3L4J A;  4BY7 C;  4KM8 A;  2A69 A;  3EQL A;  3JST A;  2JA5 A;  1SFO C;  1WCM K;  2GSU A;  3BP8 C;  4KMU A;  2RGR A;  2E2J C;  4BY1 K;  3GTQ C;  3K7A C; 
#chains in the Genus database with same CATH homology
 4ZH4 A;  2PMZ L;  1I6V A;  2Y0S D;  2NVT K;  3GTL C;  4BXX K;  4XSX A;  4XSZ A;  1I6H C;  5FLM C;  1Y1V K;  5C4J K;  1Y1W K;  4A3G C;  4AYB D;  5IYB C;  5M5Y K;  3GTG C;  4QJV A;  3GTJ C;  2WB1 L;  3GTM C;  3PO2 C;  2JA6 C;  3S14 K;  3GTQ C;  2R93 C;  5FLM K;  2NVY K;  4Y52 C;  3HOU C;  2JA7 C;  4OIN A;  4NOI A;  2WAQ L;  4A3M C;  3GTG K;  1TWF C;  5IYC K;  3GTJ K;  3HOW C;  4A93 C;  2YU9 C;  4LJZ A;  4X6A K;  4KN4 A;  5C4X K;  2E2I K;  2PPB A;  2R92 K;  5C3E C;  4OIR A;  3S15 C;  4Y52 K;  4A3M K;  3FKI C;  4BBR C;  3I4N C;  3M3Y K;  3HOV C;  4A3E K;  3GTO C;  1I3Q K;  5IP9 C;  4A3F C;  3H0G C;  3S17 K;  2PMZ D;  3S2H K;  4BY7 K;  1TWG C;  5D4D A;  5IP7 K;  3S1M C;  3S1N C;  5C44 K;  3DXJ A;  3GTO K;  3HOZ C;  4C2M K;  1SFO K;  2PA8 L;  1XPP A;  3M4O C;  1TWG K;  2JA5 C;  3HOY K;  4KN7 A;  2WB1 D;  4A3B C;  3H3V L;  2E2J K;  3PO3 K;  2VUM C;  1SMY A;  1YNJ A;  3K7A K;  1I50 C;  4OIP A;  2WAQ D;  5FJ8 K;  3GTQ K;  4BBS C;  3GTL K;  4A3K C;  3S2D C;  1K83 C;  4QJV B;  2CW0 A;  5IYD C;  3HOX C;  3S16 C;  1I6H K;  3I4M C;  4YFK A;  3WOD A;  4A3G K;  3RZD C;  5IYB K;  4OIO A;  2B63 C;  3PO2 K;  3GTM K;  2R93 K;  2JA6 K;  5M5X K;  4MQ9 A;  3HOU K;  4QIW L;  2JA7 K;  4G7H A;  4A93 K;  3HOW K;  3S1Q C;  4JK1 A;  1TWF K;  1TWH C;  4YFN A;  4C3I K;  2YU9 K;  3RZO C;  2PA8 D;  2R7Z C;  3S15 K;  2NVX C;  5C3E K;  1BDF A;  3FKI K;  4BBR K;  1IW7 A;  4C3H K;  4YFX A;  3H3V D;  1TWH K;  3HOV K;  3I4N K;  4Y7N C;  5IP9 K;  4A3F K;  2R7Z K;  3H0G K;  4G7O A;  3GTK C;  2O5J A;  4A3J C;  3S1M K;  3S1N K;  4Y7N K;  3HOZ K;  1TWA C;  5M3F K;  3M4O K;  1R9T C;  5M3M K;  2JA5 K;  4A3B K;  2A6E A;  3CQZ C;  2A68 A;  4A3C C;  4XLP A;  4QIW D;  2VUM K;  4BBS K;  1WCM C;  1I50 K;  1ZYR A;  3S1R C;  4A3D C;  4LK1 A;  4A3L C;  3CQZ K;  4A3K K;  3S2D K;  1K83 K;  2NVQ C;  3GTP C;  4OIQ A;  5IYD K;  3HOX K;  2E2H C;  3S16 K;  4BY1 C;  3I4M K;  1YNN A;  2JA8 C;  4A3I C;  3RZD K;  4A3L K;  4BXX C;  2NVT C;  2B63 K;  3HKZ L;  4C3J K;  2A6H A;  2BE5 A;  1Y1V C;  5C4J C;  1Y1W C;  4MEY A;  3S1Q K;  4G7Z A;  4XLN A;  3RZO K;  3S14 C;  2NVX K;  2NVY C;  1HQM A;  4A3I K;  2Y0S L;  5IYC C;  5TMC A;  5M5W K;  4X6A C;  5C4X C;  4YG2 A;  2E2I C;  2R92 C;  3GTK K;  4A3J K;  1TWC C;  4AYB L;  3M3Y C;  5TMF A;  4A3E C;  1TWA K;  1I3Q C;  3S17 C;  3S2H C;  4BY7 C;  1R9T K;  4GZY A;  5IP7 C;  1TWC K;  4Q4Z A;  2A69 A;  3HKZ D;  4Q5S A;  3EQL A;  4LLG A;  5C44 C;  4A3C K;  4LK0 A;  1SFO C;  1WCM K;  4A3D K;  3S1R K;  4MEX A;  3HOY C;  4KMU A;  3GTP K;  2NVQ K;  2E2H K;  2E2J C;  3PO3 C;  4BY1 K;  2JA8 K;  2O5I A;  3K7A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...