1XPPA

Crystal structure of ta1416,dna-directed rna polymerase subunit l, from thermoplasma acidophilum
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
AESSLRVISKEKNSITVEMINYDNTLLRTLVEEILKDDQVDEARYYIKHPVIDNPQIYVRVKSGKPQSAIKRAVRKLSKLYEDLGTQFQKEFQRYESDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit L
publication title Crystal structure of TA1416, DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 30
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1xppA00
2WAQD 1R9TK 4A3DK 3GTPC 4G7ZA 3GTOC 3GTJC 1SFOK 2JA5C 2A69A 3RZOC 3K7AK 3I4NC 1TWHK 4BBSK 2WB1L 2JA7K 4Q4ZA 4LJZA 1K83C 5C3EK 2R92C 1TWCC 1WCMC 1I6VA 3S16K 1I50K 5IYCC 3WODA 3HOUK 4GZYA 4OIPA 2VUMC 4MQ9A 3S1MK 4A3GC 2R93C 2NVTK 4A3KC 2R7ZC 1TWGK 3GTLK 3S1NC 4ZH4A 2Y0SL 3HOZK 5M5WK 1I6HC 5C4XK 2YU9C 3FKIK 3PO3K 3I4MK 4A3IC 3M3YC 5C4JC 4A3LK 4XSZA 5IYBK 4Y7NK 1Y1VK 4A3JC 2E2JC 3GTQK 3HOWK 1TWFC 2JA8C 2E2HK 3GTPK 4KMUA 1I3QC 4A3CK 4G7OA 1TWAC 3GTOK 2JA6C 2A6EA 2JA5K 2NVQC 3S2HK 3H0GC 3RZDC 3GTMK 2NVYK 2WB1D 4AYBL 4A3MK 2B63K 3PO2K 4A3BC 4A93C 3S2DK 5IYCK 1Y1WK 4BY7C 2VUMK 5IP9C 3GTKC 3S1QK 4C3HK 4YFXA 4QJVA 4A3GK 3HKZL 3GTGC 3H3VL 3S1NK 1IW7A 1SMYA 5D4DA 5FLMC 1HQMA 4Y52K 4KN7A 2BE5A 4C3IK 4A3FK 4YG2A 3CQZK 5C44K 5IP7C 3S14K 4MEYA 5C4JK 2NVXC 2E2JK 2O5JA 4X6AC 1TWFK 4BBRK 3M4OC 4Q5SA 4QIWL 4A3EC 3S1RC 4OIRA 1TWAK 2E2IK 1ZYRA 2PMZL 3HOVC 3S17K 3HOYC 4OINA 3H0GK 5IYDC 2CW0A 2PPBA 5M5YK 3GTJK 3RZOK 1R9TC 4A3DC 3I4NK 4KN4A 2R92K 5M3FK 1K83K 4BBSC 1TWCK 1WCMK 3K7AC 1TWHC 4BXXC 2JA7C 5C3EC 3HOXC 3HKZD 4OIQA 3H3VD 4LK0A 3S16C 1I50C 2R93K 2A68A 4A3KK 3HOUC 2R7ZK 1BDFA 3S1MC 4OIOA 5FJ8K 3S15C 4LK1A 2NVTC 1I6HK 1TWGC 2Y0SD 2YU9K 4A3EK 4A3IK 3HOZC 3M3YK 5C4XC 3FKIC 4A3JK 3PO3C 3I4MC 4BY1C 1YNNA 2JA8K 4A3LC 2PMZD 3GTQC 5IYDK 1I3QK 1Y1VC 4JK1A 4Y7NC 5M3MK 4XLPA 2PA8L 2JA6K 2NVQK 5TMFA 4C2MK 2E2HC 4A3CC 4XLNA 2A6HA 3RZDK 4MEXA 2WAQL 4G7HA 1XPPA 4A3BK 3S2HC 4A93K 1YNJA 4BXXK 4AYBD 3HOXK 3GTMC 4BY7K 2NVYC 2B63C 4A3MC 3PO2C 1SFOC 5IP9K 3GTKK 3S2DC 1Y1WC 4LLGA 3GTGK 4NOIA 4QJVB 3DXJA 3S15K 3S1QC 5FLMK 2O5IA 5TMCA 5M5XK 5IP7K 4YFNA 4Y52C 3EQLA 2NVXK 3GTLC 4A3FC 4X6AK 3CQZC 5C44C 4BY1K 3S14C 3M4OK 3S1RK 4XSXA 4QIWD 4BBRC 4C3JK 3HOVK 3HOYK 4YFKA 2PA8D 5IYBC 2E2IC 3HOWC 3S17C
chains in the Genus database with same CATH superfamily
5EGHA 2Y3PA 4G7ZA 4WJ3M 4BBSK 2A69A 2WB1L 4Q4ZA 4LJZA 1TWCC 3ERED 3S16K 4GZYA 2EBBA 4A3KC 2R7ZC 1TWGK 3GTLK 1I6HC 4KB4A 1JOEA 5M5WK 4KATA 4AH6A 5C4XK 3AD8C 3MMLB 4XSZA 2E2JC 3GTQK 3N3YA 3GTPK 4KMUA 1L0WA 4G7OA 1TWAC 2JA6C 2R92A 2A6EA 1EH1A 1K83A 2JA5K 3H0GC 4KDDA 1JVIA 2B63K 3IPJA 4AYBL 3PO2K 1B4BA 3LAPA 4GTFA 5IYCK 4BY7C 1B4AA 4A3GK 4KM8A 1IW7A 1XZPB 5D4DA 3TFHA 4BLBA 5C44K 3S14K 1TWFK 4A3EC 1V5VA 3S17K 2GAGC 1TWHA 1X31C 2JA7A 1O28A 5IOQA 3I4NK 3GTKA 4C45A 5M3FK 3GTGA 5EGEA 4BBSC 1INNA 1WCMK 1C0AA 4GTBA 3HOXC 3H3VD 4OIQA 1ZQ1C 3S16C 5FJ8K 1TWGC 4KM9A 3ADAC 3M3YK 2ZUEA 5C4XC 4A3JK 1XZQB 2PMZD 3GTQC 3GTMA 1G51A 2A6HA 3RZDK 1XPPA 4KARA 4A3BK 1YNJA 4AYBD 4KC6A 2B63C 3PO2C 1SFOC 5IP9K 1UV7A 5IOTA 1YCLA 4PAAA 1EK8A 3DXJA 3S15K 4KB2A 5TMCA 5M5XK 1ZXOA 4WILA 3FKIA 1J98A 5IP7K 2NVXK 5C44C 3S14C 4BY1K 2E2IA 2RH6A 3HOVK 3N0CA 3HOYK 3SZYA 5IYBC 3S17C 1TWCA 1R9TK 4A3DK 3TTGA 3BP8C 2RGRA 3GTOC 1IL2A 3I4NC 3K7AK 4BKWA 2W7VA 3SZZA 1O29A 1WOOA 2R7ZA 1EI6A 1WCMC 1I50K 2V6TA 2VUMC 4MQ9A 2ZUFA 2V6UA 4C3HC 2NVTK 1BS2A 3S1NC 1DCPA 3PO3K 1WOPA 1TWAA 2D6FC 2JA6A 3M3YC 3G4AA 3H0GA 4A3JC 3HOWK 2E2HK 3GTJA 2PHCB 2P5MA 3S2HK 3RZDC 2NVYK 4A3BC 4KMDA 1F93A 2R93A 5IP9C 4YFXA 1DCOA 3H3VL 4RMFA 3OREA 2YU9A 1XXBA 4GTDA 2CFAA 1IE0A 1XXAA 5IP7C 5C4JK 2NVXC 1VH2A 1PJ6A 4BBRK 1WOSA 2XCQA 3HOVC 2PMZL 3HOYC 4OINA 4O2DA 2KWAA 2PPBA 1XXCA 1R9TC 3L4KA 4A3DC 4KN4A 1WORA 2R92K 1K83K 3K7AC 4BXXC 1J6VA 1RU0A 1TWGA 4LK0A 1I50C 4OIOA 4LK1A 2NVTC 2GSNA 3AH5A 4A3IK 1J6WA 1ZVUA 3HXAA 3PO3C 1YNNA 5IYDK 3OEPA 1I3QK 4JK1A 2B63A 2NVQK 5TMFA 4GFQA 4C2MK 1SFOA 1BJTA 2E2HC 4XLNA 4G7HA 2P8TA 3S2HC 4A93K 5JVOA 4WJ4A 2NVYC 3GTKK 4LLGA 3GTGK 4QJVB 1ZBSA 2O5IA 1XZPA 1DCHA 1USMA 3GTLC 4P9SA 5HL8A 3M4OK 2GSOA 3S1RK 4BBRC 3GTOA 2FQOA 1WQFA 2WAQD 3GTPC 3G4CA 3QX3A 3S0XA 4G0VA 1F7UA 2JA5C 5IOSA 2VUMA 2R92C 1K83C 1WIHA 3GSIA 2FQTA 5IYCC 4P5AA 3WODA 3HOUK 3S1MK 3AQPA 3JSTA 4A3GC 3CQZA 4ZH4A 3N0BA 3OPFA 3FKIK 3I4MK 4A3IC 4A3LK 1O27A 1Y1VK 1PJ5A 1XZQA 1DD5A 1TWFC 4KMHA 4FZBA 4A3CK 1I3QC 3AD7C 4C2MC 2NVQC 4A3MK 4A93C 1WQGA 3AD9C 3S2DK 1Y1WK 1J6XA 3GTKC 3S1QK 3GTGC 1IQ0A 5IORA 1HQMA 4KN7A 2BE5A 4YG2A 4MEYA 2E2JK 2O5JA 3M4OC 4Q5SA 2XCRB 3S1RC 1TWAK 3H0GK 5M5YK 3GTJK 1VRQC 3RZOK 1I50A 3T01A 1KQ4A 3HKZD 2R93K 3HOUC 3BUEA 1BDFA 4M1XA 3S1MC 3S15C 3AQOA 4J3NA 3GIRA 2YU9K 4GTEA 4LQYA 4A3EK 2E2HA 3FKIC 3I4MC 1EFWA 4GTLA 4BY1C 2JA8K 4A3LC 1Y1VC 2NVYA 4A3CC 1WSVA 4MEXA 2WAQL 3HOXK 1PJ7A 4A3MC 3FOEA 4GT9A 3BP3A 1Y1WC 3S2DC 5L46A 3GTLA 3S1QC 1VGXA 5FLMK 3T00A 1O2AA 4KASA 1O25A 4X6AK 3GTQA 4PABA 1HI9A 3NUHA 4GTAA 3GTPA 3Q3QA 4C3JK 2JH3A 2JA5A 2PA8D 3HOWC 1JQWA 3GTJC 1SFOK 3RZOC 1TWHK 2JA7K 5C3EK 3GEEA 3TFIA 1EQRA 1I6VA 4LR2A 1O26A 4OIPA 1YX2A 2R93C 2GAHC 4KMAA 5CJ9A 2Y0SL 1TWFA 3HOZK 2YU9C 1I3QA 2XCOA 3A8IA 5C4JC 3A8KA 5IYBK 4Y7NK 4LOWA 1USOA 2JA8C 3GTOK 4G0UA 1WCMA 3GTMK 2WB1D 1F9NA 2VUMK 1WQHA 4C3HK 4QJVA 3HKZL 3S1NK 1SMYA 5FLMC 4Y52K 5E68A 1WSRA 4C3IK 4A3FK 3CQZK 4X6AC 3V4GA 3GDZA 4QIWL 4GTCA 4OIRA 2E2IK 1ZYRA 4C3JC 4BLAA 5IYDC 3TFJA 2CW0A 1TWCK 1TWHC 2JA7C 5C3EC 1F7VA 4FM9A 2ZFZA 4ILDA 3FOFA 2A68A 4A3KK 2R7ZK 2NVXA 3LAJA 1O2BA 1ISEA 1VJEA 1I6HK 2Y0SD 3LPXA 1Y1VA 5JFEA 1IBAA 3HOZC 3L4JA 4Y7NC 1R9TA 1O24A 3GEHA 5CHPA 5M3MK 4XLPA 2PA8L 2JA6K 3VA7A 1Y1WA 1AB4A 5TJ3A 2V6SA 4BXXK 3GTMC 4BY7K 1GE9A 3CAGA 3FHZA 1VLOA 4NOIA 3A8JA 4DDQA 3T02A 1IS1A 2CFAB 4YFNA 4Y52C 3EQLA 4KAWX 4C3IC 4A3FC 4P5BA 3CQZC 4G0WA 2GSUA 3GEIA 4QIWD 4XSXA 1BGWA 4XCHA 4YFKA 1O2FB 2E2IC
chains in the Genus database with same CATH topology
2WAQD 1R9TK 4A3DK 3GTPC 4G7ZA 3GTOC 3GTJC 1SFOK 2JA5C 2A69A 3RZOC 3K7AK 3I4NC 1TWHK 4BBSK 2WB1L 2JA7K 4Q4ZA 4LJZA 1K83C 5C3EK 2R92C 1TWCC 1WCMC 1I6VA 3S16K 1I50K 5IYCC 3WODA 3HOUK 4GZYA 4OIPA 2VUMC 4MQ9A 3S1MK 4A3GC 2R93C 2NVTK 4A3KC 2R7ZC 1TWGK 3GTLK 3S1NC 4ZH4A 2Y0SL 3HOZK 5M5WK 1I6HC 5C4XK 2YU9C 3FKIK 3PO3K 3I4MK 4A3IC 3M3YC 5C4JC 4A3LK 4XSZA 5IYBK 4Y7NK 1Y1VK 4A3JC 2E2JC 3GTQK 3HOWK 1TWFC 2JA8C 2E2HK 3GTPK 4KMUA 1I3QC 4A3CK 4G7OA 1TWAC 3GTOK 2JA6C 2A6EA 2JA5K 2NVQC 3S2HK 3H0GC 3RZDC 3GTMK 2NVYK 2WB1D 4AYBL 4A3MK 2B63K 3PO2K 4A3BC 4A93C 3S2DK 5IYCK 1Y1WK 4BY7C 2VUMK 5IP9C 3GTKC 3S1QK 4C3HK 4YFXA 4QJVA 4A3GK 3HKZL 3GTGC 3H3VL 3S1NK 1IW7A 1SMYA 5D4DA 5FLMC 1HQMA 4Y52K 4KN7A 2BE5A 4C3IK 4A3FK 4YG2A 3CQZK 5C44K 5IP7C 3S14K 4MEYA 5C4JK 2NVXC 2E2JK 2O5JA 4X6AC 1TWFK 4BBRK 3M4OC 4Q5SA 4QIWL 4A3EC 3S1RC 4OIRA 1TWAK 2E2IK 1ZYRA 2PMZL 3HOVC 3S17K 3HOYC 4OINA 3H0GK 5IYDC 2CW0A 2PPBA 5M5YK 3GTJK 3RZOK 1R9TC 4A3DC 3I4NK 4KN4A 2R92K 5M3FK 1K83K 4BBSC 1TWCK 1WCMK 3K7AC 1TWHC 4BXXC 2JA7C 5C3EC 3HOXC 3HKZD 4OIQA 3H3VD 4LK0A 3S16C 1I50C 2R93K 2A68A 4A3KK 3HOUC 2R7ZK 1BDFA 3S1MC 4OIOA 5FJ8K 3S15C 4LK1A 2NVTC 1I6HK 1TWGC 2Y0SD 2YU9K 4A3EK 4A3IK 3HOZC 3M3YK 5C4XC 3FKIC 4A3JK 3PO3C 3I4MC 4BY1C 1YNNA 2JA8K 4A3LC 2PMZD 3GTQC 5IYDK 1I3QK 1Y1VC 4JK1A 4Y7NC 5M3MK 4XLPA 2PA8L 2JA6K 2NVQK 5TMFA 4C2MK 2E2HC 4A3CC 4XLNA 2A6HA 3RZDK 4MEXA 2WAQL 4G7HA 1XPPA 4A3BK 3S2HC 4A93K 1YNJA 4BXXK 4AYBD 3HOXK 3GTMC 4BY7K 2NVYC 2B63C 4A3MC 3PO2C 1SFOC 5IP9K 3GTKK 3S2DC 1Y1WC 4LLGA 3GTGK 4NOIA 4QJVB 3DXJA 3S15K 3S1QC 5FLMK 2O5IA 5TMCA 5M5XK 5IP7K 4YFNA 4Y52C 3EQLA 2NVXK 3GTLC 4A3FC 4X6AK 3CQZC 5C44C 4BY1K 3S14C 3M4OK 3S1RK 4XSXA 4QIWD 4BBRC 4C3JK 3HOVK 3HOYK 4YFKA 2PA8D 5IYBC 2E2IC 3HOWC 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ D;  1R9T K;  4A3D K;  3GTP C;  4G7Z A;  3GTO C;  3GTJ C;  1SFO K;  2JA5 C;  2A69 A;  3RZO C;  3K7A K;  3I4N C;  1TWH K;  4BBS K;  2WB1 L;  2JA7 K;  4Q4Z A;  4LJZ A;  1K83 C;  5C3E K;  2R92 C;  1TWC C;  1WCM C;  1I6V A;  3S16 K;  1I50 K;  5IYC C;  3WOD A;  3HOU K;  4GZY A;  4OIP A;  2VUM C;  4MQ9 A;  3S1M K;  4A3G C;  2R93 C;  2NVT K;  4A3K C;  2R7Z C;  1TWG K;  3GTL K;  3S1N C;  4ZH4 A;  2Y0S L;  3HOZ K;  5M5W K;  1I6H C;  5C4X K;  2YU9 C;  3FKI K;  3PO3 K;  3I4M K;  4A3I C;  3M3Y C;  5C4J C;  4A3L K;  4XSZ A;  5IYB K;  4Y7N K;  1Y1V K;  4A3J C;  2E2J C;  3GTQ K;  3HOW K;  1TWF C;  2JA8 C;  2E2H K;  3GTP K;  4KMU A;  1I3Q C;  4A3C K;  4G7O A;  1TWA C;  3GTO K;  2JA6 C;  2A6E A;  2JA5 K;  2NVQ C;  3S2H K;  3H0G C;  3RZD C;  3GTM K;  2NVY K;  2WB1 D;  4AYB L;  4A3M K;  2B63 K;  3PO2 K;  4A3B C;  4A93 C;  3S2D K;  5IYC K;  1Y1W K;  4BY7 C;  2VUM K;  5IP9 C;  3GTK C;  3S1Q K;  4C3H K;  4YFX A;  4QJV A;  4A3G K;  3HKZ L;  3GTG C;  3H3V L;  3S1N K;  1IW7 A;  1SMY A;  5D4D A;  5FLM C;  1HQM A;  4Y52 K;  4KN7 A;  2BE5 A;  4C3I K;  4A3F K;  4YG2 A;  3CQZ K;  5C44 K;  5IP7 C;  3S14 K;  4MEY A;  5C4J K;  2NVX C;  2E2J K;  2O5J A;  4X6A C;  1TWF K;  4BBR K;  3M4O C;  4Q5S A;  4QIW L;  4A3E C;  3S1R C;  4OIR A;  1TWA K;  2E2I K;  1ZYR A;  2PMZ L;  3HOV C;  3S17 K;  3HOY C;  4OIN A;  3H0G K;  5IYD C;  2CW0 A;  2PPB A;  5M5Y K;  3GTJ K;  3RZO K;  1R9T C;  4A3D C;  3I4N K;  4KN4 A;  2R92 K;  5M3F K;  1K83 K;  4BBS C;  1TWC K;  1WCM K;  3K7A C;  1TWH C;  4BXX C;  2JA7 C;  5C3E C;  3HOX C;  3HKZ D;  4OIQ A;  3H3V D;  4LK0 A;  3S16 C;  1I50 C;  2R93 K;  2A68 A;  4A3K K;  3HOU C;  2R7Z K;  1BDF A;  3S1M C;  4OIO A;  5FJ8 K;  3S15 C;  4LK1 A;  2NVT C;  1I6H K;  1TWG C;  2Y0S D;  2YU9 K;  4A3E K;  4A3I K;  3HOZ C;  3M3Y K;  5C4X C;  3FKI C;  4A3J K;  3PO3 C;  3I4M C;  4BY1 C;  1YNN A;  2JA8 K;  4A3L C;  2PMZ D;  3GTQ C;  5IYD K;  1I3Q K;  1Y1V C;  4JK1 A;  4Y7N C;  5M3M K;  4XLP A;  2PA8 L;  2JA6 K;  2NVQ K;  5TMF A;  4C2M K;  2E2H C;  4A3C C;  4XLN A;  2A6H A;  3RZD K;  4MEX A;  2WAQ L;  4G7H A;  1XPP A;  4A3B K;  3S2H C;  4A93 K;  1YNJ A;  4BXX K;  4AYB D;  3HOX K;  3GTM C;  4BY7 K;  2NVY C;  2B63 C;  4A3M C;  3PO2 C;  1SFO C;  5IP9 K;  3GTK K;  3S2D C;  1Y1W C;  4LLG A;  3GTG K;  4NOI A;  4QJV B;  3DXJ A;  3S15 K;  3S1Q C;  5FLM K;  2O5I A;  5TMC A;  5M5X K;  5IP7 K;  4YFN A;  4Y52 C;  3EQL A;  2NVX K;  3GTL C;  4A3F C;  4X6A K;  3CQZ C;  5C44 C;  4BY1 K;  3S14 C;  3M4O K;  3S1R K;  4XSX A;  4QIW D;  4BBR C;  4C3J K;  3HOV K;  3HOY K;  4YFK A;  2PA8 D;  5IYB C;  2E2I C;  3HOW C;  3S17 C; 
#chains in the Genus database with same CATH topology
 5EGH A;  2Y3P A;  4G7Z A;  4WJ3 M;  4BBS K;  2A69 A;  2WB1 L;  4Q4Z A;  4LJZ A;  1TWC C;  3ERE D;  3S16 K;  4GZY A;  2EBB A;  4A3K C;  2R7Z C;  1TWG K;  3GTL K;  1I6H C;  4KB4 A;  1JOE A;  5M5W K;  4KAT A;  4AH6 A;  5C4X K;  3AD8 C;  3MML B;  4XSZ A;  2E2J C;  3GTQ K;  3N3Y A;  3GTP K;  4KMU A;  1L0W A;  4G7O A;  1TWA C;  2JA6 C;  2R92 A;  2A6E A;  1EH1 A;  1K83 A;  2JA5 K;  3H0G C;  4KDD A;  1JVI A;  2B63 K;  3IPJ A;  4AYB L;  3PO2 K;  1B4B A;  3LAP A;  4GTF A;  5IYC K;  4BY7 C;  1B4A A;  4A3G K;  4KM8 A;  1IW7 A;  1XZP B;  5D4D A;  3TFH A;  4BLB A;  5C44 K;  3S14 K;  1TWF K;  4A3E C;  1V5V A;  3S17 K;  2GAG C;  1TWH A;  1X31 C;  2JA7 A;  1O28 A;  5IOQ A;  3I4N K;  3GTK A;  4C45 A;  5M3F K;  3GTG A;  5EGE A;  4BBS C;  1INN A;  1WCM K;  1C0A A;  4GTB A;  3HOX C;  3H3V D;  4OIQ A;  1ZQ1 C;  3S16 C;  5FJ8 K;  1TWG C;  4KM9 A;  3ADA C;  3M3Y K;  2ZUE A;  5C4X C;  4A3J K;  1XZQ B;  2PMZ D;  3GTQ C;  3GTM A;  1G51 A;  2A6H A;  3RZD K;  1XPP A;  4KAR A;  4A3B K;  1YNJ A;  4AYB D;  4KC6 A;  2B63 C;  3PO2 C;  1SFO C;  5IP9 K;  1UV7 A;  5IOT A;  1YCL A;  4PAA A;  1EK8 A;  3DXJ A;  3S15 K;  4KB2 A;  5TMC A;  5M5X K;  1ZXO A;  4WIL A;  3FKI A;  1J98 A;  5IP7 K;  2NVX K;  5C44 C;  3S14 C;  4BY1 K;  2E2I A;  2RH6 A;  3HOV K;  3N0C A;  3HOY K;  3SZY A;  5IYB C;  3S17 C;  1TWC A;  1R9T K;  4A3D K;  3TTG A;  3BP8 C;  2RGR A;  3GTO C;  1IL2 A;  3I4N C;  3K7A K;  4BKW A;  2W7V A;  3SZZ A;  1O29 A;  1WOO A;  2R7Z A;  1EI6 A;  1WCM C;  1I50 K;  2V6T A;  2VUM C;  4MQ9 A;  2ZUF A;  2V6U A;  4C3H C;  2NVT K;  1BS2 A;  3S1N C;  1DCP A;  3PO3 K;  1WOP A;  1TWA A;  2D6F C;  2JA6 A;  3M3Y C;  3G4A A;  3H0G A;  4A3J C;  3HOW K;  2E2H K;  3GTJ A;  2PHC B;  2P5M A;  3S2H K;  3RZD C;  2NVY K;  4A3B C;  4KMD A;  1F93 A;  2R93 A;  5IP9 C;  4YFX A;  1DCO A;  3H3V L;  4RMF A;  3ORE A;  2YU9 A;  1XXB A;  4GTD A;  2CFA A;  1IE0 A;  1XXA A;  5IP7 C;  5C4J K;  2NVX C;  1VH2 A;  1PJ6 A;  4BBR K;  1WOS A;  2XCQ A;  3HOV C;  2PMZ L;  3HOY C;  4OIN A;  4O2D A;  2KWA A;  2PPB A;  1XXC A;  1R9T C;  3L4K A;  4A3D C;  4KN4 A;  1WOR A;  2R92 K;  1K83 K;  3K7A C;  4BXX C;  1J6V A;  1RU0 A;  1TWG A;  4LK0 A;  1I50 C;  4OIO A;  4LK1 A;  2NVT C;  2GSN A;  3AH5 A;  4A3I K;  1J6W A;  1ZVU A;  3HXA A;  3PO3 C;  1YNN A;  5IYD K;  3OEP A;  1I3Q K;  4JK1 A;  2B63 A;  2NVQ K;  5TMF A;  4GFQ A;  4C2M K;  1SFO A;  1BJT A;  2E2H C;  4XLN A;  4G7H A;  2P8T A;  3S2H C;  4A93 K;  5JVO A;  4WJ4 A;  2NVY C;  3GTK K;  4LLG A;  3GTG K;  4QJV B;  1ZBS A;  2O5I A;  1XZP A;  1DCH A;  1USM A;  3GTL C;  4P9S A;  5HL8 A;  3M4O K;  2GSO A;  3S1R K;  4BBR C;  3GTO A;  2FQO A;  1WQF A;  2WAQ D;  3GTP C;  3G4C A;  3QX3 A;  3S0X A;  4G0V A;  1F7U A;  2JA5 C;  5IOS A;  2VUM A;  2R92 C;  1K83 C;  1WIH A;  3GSI A;  2FQT A;  5IYC C;  4P5A A;  3WOD A;  3HOU K;  3S1M K;  3AQP A;  3JST A;  4A3G C;  3CQZ A;  4ZH4 A;  3N0B A;  3OPF A;  3FKI K;  3I4M K;  4A3I C;  4A3L K;  1O27 A;  1Y1V K;  1PJ5 A;  1XZQ A;  1DD5 A;  1TWF C;  4KMH A;  4FZB A;  4A3C K;  1I3Q C;  3AD7 C;  4C2M C;  2NVQ C;  4A3M K;  4A93 C;  1WQG A;  3AD9 C;  3S2D K;  1Y1W K;  1J6X A;  3GTK C;  3S1Q K;  3GTG C;  1IQ0 A;  5IOR A;  1HQM A;  4KN7 A;  2BE5 A;  4YG2 A;  4MEY A;  2E2J K;  2O5J A;  3M4O C;  4Q5S A;  2XCR B;  3S1R C;  1TWA K;  3H0G K;  5M5Y K;  3GTJ K;  1VRQ C;  3RZO K;  1I50 A;  3T01 A;  1KQ4 A;  3HKZ D;  2R93 K;  3HOU C;  3BUE A;  1BDF A;  4M1X A;  3S1M C;  3S15 C;  3AQO A;  4J3N A;  3GIR A;  2YU9 K;  4GTE A;  4LQY A;  4A3E K;  2E2H A;  3FKI C;  3I4M C;  1EFW A;  4GTL A;  4BY1 C;  2JA8 K;  4A3L C;  1Y1V C;  2NVY A;  4A3C C;  1WSV A;  4MEX A;  2WAQ L;  3HOX K;  1PJ7 A;  4A3M C;  3FOE A;  4GT9 A;  3BP3 A;  1Y1W C;  3S2D C;  5L46 A;  3GTL A;  3S1Q C;  1VGX A;  5FLM K;  3T00 A;  1O2A A;  4KAS A;  1O25 A;  4X6A K;  3GTQ A;  4PAB A;  1HI9 A;  3NUH A;  4GTA A;  3GTP A;  3Q3Q A;  4C3J K;  2JH3 A;  2JA5 A;  2PA8 D;  3HOW C;  1JQW A;  3GTJ C;  1SFO K;  3RZO C;  1TWH K;  2JA7 K;  5C3E K;  3GEE A;  3TFI A;  1EQR A;  1I6V A;  4LR2 A;  1O26 A;  4OIP A;  1YX2 A;  2R93 C;  2GAH C;  4KMA A;  5CJ9 A;  2Y0S L;  1TWF A;  3HOZ K;  2YU9 C;  1I3Q A;  2XCO A;  3A8I A;  5C4J C;  3A8K A;  5IYB K;  4Y7N K;  4LOW A;  1USO A;  2JA8 C;  3GTO K;  4G0U A;  1WCM A;  3GTM K;  2WB1 D;  1F9N A;  2VUM K;  1WQH A;  4C3H K;  4QJV A;  3HKZ L;  3S1N K;  1SMY A;  5FLM C;  4Y52 K;  5E68 A;  1WSR A;  4C3I K;  4A3F K;  3CQZ K;  4X6A C;  3V4G A;  3GDZ A;  4QIW L;  4GTC A;  4OIR A;  2E2I K;  1ZYR A;  4C3J C;  4BLA A;  5IYD C;  3TFJ A;  2CW0 A;  1TWC K;  1TWH C;  2JA7 C;  5C3E C;  1F7V A;  4FM9 A;  2ZFZ A;  4ILD A;  3FOF A;  2A68 A;  4A3K K;  2R7Z K;  2NVX A;  3LAJ A;  1O2B A;  1ISE A;  1VJE A;  1I6H K;  2Y0S D;  3LPX A;  1Y1V A;  5JFE A;  1IBA A;  3HOZ C;  3L4J A;  4Y7N C;  1R9T A;  1O24 A;  3GEH A;  5CHP A;  5M3M K;  4XLP A;  2PA8 L;  2JA6 K;  3VA7 A;  1Y1W A;  1AB4 A;  5TJ3 A;  2V6S A;  4BXX K;  3GTM C;  4BY7 K;  1GE9 A;  3CAG A;  3FHZ A;  1VLO A;  4NOI A;  3A8J A;  4DDQ A;  3T02 A;  1IS1 A;  2CFA B;  4YFN A;  4Y52 C;  3EQL A;  4KAW X;  4C3I C;  4A3F C;  4P5B A;  3CQZ C;  4G0W A;  2GSU A;  3GEI A;  4QIW D;  4XSX A;  1BGW A;  4XCH A;  4YFK A;  1O2F B;  2E2I C; 
#chains in the Genus database with same CATH homology
 2WAQ D;  1R9T K;  4A3D K;  3GTP C;  4G7Z A;  3GTO C;  3GTJ C;  1SFO K;  2JA5 C;  2A69 A;  3RZO C;  3K7A K;  3I4N C;  1TWH K;  4BBS K;  2WB1 L;  2JA7 K;  4Q4Z A;  4LJZ A;  1K83 C;  5C3E K;  2R92 C;  1TWC C;  1WCM C;  1I6V A;  3S16 K;  1I50 K;  5IYC C;  3WOD A;  3HOU K;  4GZY A;  4OIP A;  2VUM C;  4MQ9 A;  3S1M K;  4A3G C;  2R93 C;  2NVT K;  4A3K C;  2R7Z C;  1TWG K;  3GTL K;  3S1N C;  4ZH4 A;  2Y0S L;  3HOZ K;  5M5W K;  1I6H C;  5C4X K;  2YU9 C;  3FKI K;  3PO3 K;  3I4M K;  4A3I C;  3M3Y C;  5C4J C;  4A3L K;  4XSZ A;  5IYB K;  4Y7N K;  1Y1V K;  4A3J C;  2E2J C;  3GTQ K;  3HOW K;  1TWF C;  2JA8 C;  2E2H K;  3GTP K;  4KMU A;  1I3Q C;  4A3C K;  4G7O A;  1TWA C;  3GTO K;  2JA6 C;  2A6E A;  2JA5 K;  2NVQ C;  3S2H K;  3H0G C;  3RZD C;  3GTM K;  2NVY K;  2WB1 D;  4AYB L;  4A3M K;  2B63 K;  3PO2 K;  4A3B C;  4A93 C;  3S2D K;  5IYC K;  1Y1W K;  4BY7 C;  2VUM K;  5IP9 C;  3GTK C;  3S1Q K;  4C3H K;  4YFX A;  4QJV A;  4A3G K;  3HKZ L;  3GTG C;  3H3V L;  3S1N K;  1IW7 A;  1SMY A;  5D4D A;  5FLM C;  1HQM A;  4Y52 K;  4KN7 A;  2BE5 A;  4C3I K;  4A3F K;  4YG2 A;  3CQZ K;  5C44 K;  5IP7 C;  3S14 K;  4MEY A;  5C4J K;  2NVX C;  2E2J K;  2O5J A;  4X6A C;  1TWF K;  4BBR K;  3M4O C;  4Q5S A;  4QIW L;  4A3E C;  3S1R C;  4OIR A;  1TWA K;  2E2I K;  1ZYR A;  2PMZ L;  3HOV C;  3S17 K;  3HOY C;  4OIN A;  3H0G K;  5IYD C;  2CW0 A;  2PPB A;  5M5Y K;  3GTJ K;  3RZO K;  1R9T C;  4A3D C;  3I4N K;  4KN4 A;  2R92 K;  5M3F K;  1K83 K;  4BBS C;  1TWC K;  1WCM K;  3K7A C;  1TWH C;  4BXX C;  2JA7 C;  5C3E C;  3HOX C;  3HKZ D;  4OIQ A;  3H3V D;  4LK0 A;  3S16 C;  1I50 C;  2R93 K;  2A68 A;  4A3K K;  3HOU C;  2R7Z K;  1BDF A;  3S1M C;  4OIO A;  5FJ8 K;  3S15 C;  4LK1 A;  2NVT C;  1I6H K;  1TWG C;  2Y0S D;  2YU9 K;  4A3E K;  4A3I K;  3HOZ C;  3M3Y K;  5C4X C;  3FKI C;  4A3J K;  3PO3 C;  3I4M C;  4BY1 C;  1YNN A;  2JA8 K;  4A3L C;  2PMZ D;  3GTQ C;  5IYD K;  1I3Q K;  1Y1V C;  4JK1 A;  4Y7N C;  5M3M K;  4XLP A;  2PA8 L;  2JA6 K;  2NVQ K;  5TMF A;  4C2M K;  2E2H C;  4A3C C;  4XLN A;  2A6H A;  3RZD K;  4MEX A;  2WAQ L;  4G7H A;  1XPP A;  4A3B K;  3S2H C;  4A93 K;  1YNJ A;  4BXX K;  4AYB D;  3HOX K;  3GTM C;  4BY7 K;  2NVY C;  2B63 C;  4A3M C;  3PO2 C;  1SFO C;  5IP9 K;  3GTK K;  3S2D C;  1Y1W C;  4LLG A;  3GTG K;  4NOI A;  4QJV B;  3DXJ A;  3S15 K;  3S1Q C;  5FLM K;  2O5I A;  5TMC A;  5M5X K;  5IP7 K;  4YFN A;  4Y52 C;  3EQL A;  2NVX K;  3GTL C;  4A3F C;  4X6A K;  3CQZ C;  5C44 C;  4BY1 K;  3S14 C;  3M4O K;  3S1R K;  4XSX A;  4QIW D;  4BBR C;  4C3J K;  3HOV K;  3HOY K;  4YFK A;  2PA8 D;  5IYB C;  2E2I C;  3HOW C;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...