1XPWA

Solution nmr structure of human protein hspco34. northeast structural genomics target hr1958
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
143
structure length
143
Chain Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords LOC51668 protein
total genus 28
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1xpwA00
5CZKA 3T0DA 2CDOA 3LE0A 2VCAA 1NKGA 3I3BA 1BHGA 3LPGA 4QDSA 3I2FA 1RYYA 1K12A 2E32A 2X10A 2BERA 4QDRA 3SEPA 2QQIA 4XUOA 4AAXA 3ABZA 4ZZ5A 4JKKA 2EIBA 3LQCA 3NNGA 5IJRA 3GM8A 3J7HA 3FHQA 4OMCA 3SKVA 2L9LA 4QAWA 3WNMA 3VDBA 3E1F1 2J1RA 5CYYA 2VR4A 2HYXA 1K42A 1J83A 4CU8A 4A3ZA 3NJVA 1UX7A 2WQ8A 4ZXEA 1GMMA 2VL4A 4DUXA 1SG3A 2RV9A 2Y6LA 1JZ5A 2JKXA 3I97A 2VZ3A 3VD7A 1W0NA 1SDDB 2V5DA 2W92A 3U37A 2VZOA 5F7UA 2C26A 3C7OA 4LHSA 3OGSA 3C7HA 3IB3A 1JI6A 4GWIA 3T09A 2WUHA 2VMDA 5JXGA 3EYPA 5JXIA 2J22A 3T2OA 2WBKA 3LEIA 4CU9A 2JD9A 3CIHA 4E8CA 5JMOA 5IYYA 3HNYM 3WSOA 3HNMA 5JXJA 4A41A 3I2GA 2W1QA 3PUHA 2WAAA 2X09A 2WO2A 1WCQA 1XPWA 3WF1A 4P08A 3WEZA 4E8DA 2EICA 3IDAA 3MUZ1 5A1AA 3GGLA 3OGRA 5DQ0A 3UESA 4CUAA 4BDVB 4XVHA 1OD3A 1O8PA 2Z4FA 4AG4A 3PUIA 2W1UA 4JX0A 4OUEA 1JU4A 3NQHA 1GNYA 1JYXA 2VZTA 2YFZA 2WABA 1UXZA 1JZ2A 4ET7A 5B4XA 3WNNA 3I2JA 3P6BA 3WNPA 2Y6JA 2BZDA 2Y8KA 2C9KA 4UOJA 1UZ0A 2XONA 4JKMA 2C4XA 2ORXA 3EB7A 1JU3A 2B4KA 1L7QA 4L0PA 1IQDC 4PT6A 4QX0A 2DCKA 3ACGA 2VQTA 2CDPA 1CZTA 1EUTA 2VTFA 2VZSA 4MGQA 4MGSA 3ACFA 3A22A 2BGOA 4XZUG 2VC9A 2W1WA 3ZM8A 5G04L 3JXSA 5LA1A 4DUVA 4ARYA 1XNTA 3CZUA 4PQQA 2W1SA 1W99A 3OBAA 1CZSA 2VZVA 3T2PA 1D7PM 1PMJX 3CDZB 4KI5M 3BGAA 4MO3M 3OG2A 3VDAA 1CIYA 2YFUA 4DUWA 4GWJA 2VCBA 3K46A 2R7EB 3ETPA 1JZ3A 2KD7A 4OMDA 2VZQA 4BJ0A 4W4ZA 4DEQA 3LPFA 1SHWB 2WAOA 3A21A 2Y6HA 5C70A 1PX4A 5DPNA 3IAQA 1TVGA 5B4NA 4JHZA 2J1UA 1W9TA 4HG6B 4A6OA 4IUGA 2RJ2A 2ZXQA 1CZVA 2ORZA 2QQJA 5IHRA 2E33A 3NJXA 4CUBA 3K77A 2YC4A 3MV01 5G05L 2ZEWA 1OH4A 1GOFA 2QQOA 4QPWA 5EJZB 3I2KA 1WKYA 4M4PA 4DXTA 4GZ9A 4BK5A 3K4AA 4MADA 4A45A 2E31A 4QX1A 3UNPA 3VDCA 3MBWA 1W9SA 3WF2A 2X05A 1R64A 4D8MA 3W5MA 3AC0A 2E26A 2WZ8A 1NAEA 2WO1A 3CKHA 2XHNA 4ARXA 1OF3A 1MPXA 2EIDA 4P00B 3HEIA 2OKXA 1KEXA 3HNBM 4XUQA 4LKSA 3A23A 4QX2A 5LA2A 4XUNA 1KGYA 3WQBA 3OB8A 1O59A 1JYWA 2VZ1A 2JE8A 4CVUA 4LQRA 3MUY1 2VOTA 1J84A 2XQXA 4XUTA 1UWWA 4CU6A 1GQPA 2VM9A 2W95A 2VO5A 4P02B 1DYOA 4MOAA 2J1VA 3VD5A 4ZY9A 1W8OA 4W8JA 4CU7A 3WNOA 1GU3A 1W8NA 3WF3A 3WNKA 2B9VA 3UETA 4CUCA 1GUIA 3C7EA 2V4VA 3BN6A 2Y6GA 4RN5A 1LNSA 2VMFA 4BXSV 3ECQA 5EIYB 2ZEYA 2EIEA 3VD3A 5C71A 5IFPA 4OZOA 3LEKA 1JHJA 1EUUA 4UAPA 3SEEA 4DXRA 3GDBA 1UY0A 1OF4A 2Y6KA 2BBAA 3LEGA 4TXWA 3I2IA 3FN9A 2JDAA 2WZEA 1JYNA 2QQMA 1DLCA 4M4RA 2PQSA 1F4AA 5LA0A 3DECA 3K75B 4YPJA 1UY3A 1UY2A 1UYZA 4LPLA 3DYOA 4QB6A 3VD4A 3T2QA 2QQNA 3THDA 4W50A 1ULPA 3FHAA 1GOHA 5EJ1B 4Z2AA 1TG7A 1UYYA 5JR2A 2W5FA 5J1XA 4BK4A 2VCCA 3HPNA 2BGPA 2WN3A 1JZ8A 1UYXA 1H6YA 2ZEZA 5IFTA 2QQKA 1PMHX 1W9WA 2WDBA 1F4HA 3ACIA 4QB2A 2VZPA 4QX3A 4KMQA 1H6XA 3CQOA 1I5PA 5HPOA 2ZEXA 4PF1A 3T08A 3CMGA 3OEAA 2WO3A 2VZUA 1CX1A 2J1SA 4P5YA 3I3EA 3C8XA 2WYSA 4XUPA 3A7QA 2WN2A 2YC2A 3DYPA 3W5NA 3MO4A 1HN1A 2J1TA 4TTGA 4XURA 2VJXA 1GOGA 3C7FA 5JUVA 5LCWL 2W87A 2W3JA 4A44A 2W47A 1NX9A 3C7GA 3GXUA 1XC6A 1JYVA 1JZ6A 2W94A 1DP0A 3I3DA 2J1AA 3WNLA 3FL7A 3HOBA 3WF0A 4DXSA 3VD9A 3P1IA 1L7RA 5DN2A 1UY1A 2J7MA 2VZRA 4FI9A 3DYMA 4JKLA 1PX3A 2LS6A 4QDQA 2RVAA 1US3A 3IIIA 1UY4A 1JZ4A 3K4DA 3IAPA 3MV11 2DCJA 3OGVA 4QB1A 1K45A 2VMEA 2XOMA 5HXMA 3HN3A 5JXHA 4UI9L 2LW8A 2V72A 4RYDA 1ULOA 4DEVA 3THCA 2YG0A 3HJRA 3T0AA 3ACHA 3NRUA 5DMYA 1US2A 2VMCA 2J1EA 1O8SA 1YQ2A 4D0QA 5I0DA 3D3AA 1UMHA 4A42A 2QBXA 4KWUA 2ID4A 3F2ZA 1NUKA 5C7GA 3I2HA 2QQLA 3SKJE 3T0BA 2VQUA 2W46A 4ZZ8A 1T2XA 1K3IA 4OYUA 3K4ZA 1P8JA 2HLEA 2W9XA 4A4AA 2Y64A 1OT5A 1UMIA 1XNAA 5FUIA 2YB7A 3OEBA 2DDUA 2W91A 1UXXX 3WF4A 3CZJA 1JZ7A
chains in the Genus database with same CATH superfamily
4C0BA 2OVUA 1RUD3 4IDZA 1NKGA 3WZ1A 1VMFA 4WZFA 1S0BA 2IXIA 5F3EA 1UN1A 2HEWF 3S30A 4I0AA 2C9AA 4EQVA 4OHVA 4Y24A 5F3CA 5KR7A 2E32A 2DVBA 2AREA 1R082 2BERA 1HB2A 3HVDA 5FKCA 5GKAC 1NCRA 3THPA 4Q4W3 2QQIA 3SEPA 4AAXA 3I59A 4BQYA 5HI0A 3ZN4A 1NCQC 2A6VA 4NHYA 4XDPA 1JODA 1IOAA 4AFBA 1S0DA 4Y4YA 3VZJA 3NNGA 3VLBB 5CFDA 3PLQA 2DUQA 3GM8A 2ZHNA 2VPVA 3Q8AA 3UKTA 4UXAA 3WY6A 1W6OA 1PO11 1S2KA 5J98B 3VZOA 3KM5A 4QQLA 2VMHA 3ZDVA 1UL9A 2LALA 5EV7A 3N9PA 5L7OB 1EYBA 4QAWA 4FO9A 1CAUA 1ULFA 3E1F1 3OF1A 1IS3A 2ZGSA 4N8MA 3GYDA 5E16A 3KT7A 4CU8A 2HWD2 3VBHA 2W0XA 1W8HA 1UX7A 1A3KA 5DZEA 2ZA9A 3MW4A 2WQ8A 1UOFA 1CN1A 1TMF2 2UWCA 4P9LA 4ZXEA 5A3LA 1ASJ1 4B3NA 1UW8A 1UZWA 3GZAA 2MNGA 2RV9A 1SQ4A 3GJBA 3UV9A 5C5UA 5DZFA 1Z7S1 2ARAA 2BNOA 1FT9A 4IW3A 1JZ5A 3LFIA 1AR92 1G6NA 1FOD3 5F3IA 4GKYA 5A6ZA 1UF2C 4ZU7A 2QKDA 3D4KA 5FO7B 3SMHA 4GMP0 5FQ0B 2Y0OA 4LLOA 3OSDA 3UKVA 5GLVA 5C8CA 2RR12 4N90A 1ENSA 4BYYA 1W05A 2NN8A 4JGYB 4D7TA 4Q26A 2XWJB 4AK3A 2BRTA 2HWF1 3KV6A 4NR1A 3TB0A 1VAVA 3ZXGA 5C3PA 4IE7A 1PZ9A 1REEA 2C6SA 3UGGA 3LEIA 2AYHA 3J7LA 3AMHA 3JBG2 3ZLIA 1COV1 2WNVA 1W6MB 2QCSB 5A33A 3WSOA 4LJHA 4AI2A 2UY9A 4QPGC 1S0EA 3QH6A 1LGCA 3MFAA 1Z7S2 2WO2A 4Q4X1 1YYNA 5FPBA 1PNFA 1XPWA 4P08A 1IQAA 3O5SA 5FJKA 2EICA 4XE9A 3WW3A 2B46X 4NAMA 4PI0A 3QCWA 1ZREA 2NQYA 3ZFFA 3OD4A 1W2AX 2P3YA 3ENRA 1D0GA 5HCBA 4XF3A 1OH3A 4BQ1A 1O8PA 2AC1A 5CADA 1X9TA 1I6XA 2R1BA 3PJQA 3EBRA 4I0WB 4NJ4A 3EO6A 3RPQA 2XL9A 4COVA 1FX5A 2XXZA 1GNYA 1E5RA 2HWE2 2YFZA 2JE7A 4AVCA 4PDWC 3I59B 4XTMA 4AQSA 3IKWA 3S57A 3H8UA 3M1HA 5HV4A 2QTWB 1X36A 2VQ0A 3I54A 5B4XA 3TNQA 4QMAA 1W06A 2D93A 4DB5A 4IEPA 4DXZA 3PVNA 2HWB1 3BU7A 3GZUC 5EWSA 2DCZA 4MXWB 4NIAA 3D0JA 1AHSA 5FDBA 5CG8A 5GZFA 3MW2A 1UZ0A 4K8RB 4JKMA 4QQHA 4NAOA 4BCUA 2VBPA 3E6BA 3WV6A 3O1MA 1GZTA 5I93A 4XF9A 1Q8VA 3LFMA 3T1LA 1O4ZA 3T4HB 3DKWA 3S5AA 3U07A 3V56A 2FBEA 2O8OA 4Y20B 4B7KA 4HSJA 2HWC1 1WGPA 1GYKA 2RR11 2VQTA 2XDVA 2XMLA 2YBKA 3U0ZA 1TME1 2JIGA 3WQ0A 1PIV2 2WLPA 5G04L 4AGRA 2LROA 5JR7B 1VRH2 1YCIA 1S0IA 5FYVA 4XDQA 4BWOA 1U0AA 3IMNA 2WNUC 1MQTA 3ZSKA 2E53A 2IZWA 1G8WA 3PUAA 4FOQA 5E6HA 4KI5M 4JCKA 3H0OA 1ND3B 1SLTA 4GWNA 1LOCA 3I3MA 5I0RA 1ND2B 2DVFA 3ZXAC 1PNGA 3F95A 4GWJA 3NSTA 3ZFFC 1JZ3A 2GSYA 1SBEA 1JHNA 3VHPA 2B42B 3W9AA 4OMDA 5KXDA 1F8VA 4BJ0A 4DEQA 1FOD1 3B3QE 4LUKA 1SLCA 3K2OA 1SHWB 4FPKA 1IS6A 2HWF3 2WAOA 3RMXA 4CCNA 3R6SA 3A21A 4JTOA 3T4VA 2Y6HA 4WVVA 4CDXC 3PVBB 3IAQA 5B4NA 2E7TA 1DQ4A 3GF6A 1LGNA 4DY5A 1W9TA 4Q4Y1 1VLNA 5KHKA 1V9U1 4BHPA 1XU1A 4L8QA 3CJIB 4OVEA 3V65A 5CG9A 1CAXB 1VBE3 2RS31 1ZX5A 1GP6A 2ES3A 2PHXA 2V5YA 1RUC1 5F9TA 1GWKA 2P1BA 1NZIA 2ZHKA 3MLKA 3NJXA 5FZOA 4G3YC 1C4RA 1RHI1 1ZZCA 3K77A 3LA3A 3MIFA 4LBQD 5A7OA 2EXKA 1AF9A 1HX6A 2YC4A 4LOSA 2Q30A 5A3NA 3NAPC 4B7EA 1X82A 3OUJA 1DDLA 1XE8A 1RUC2 3VZLA 5CA6A 5EJZB 5KXCA 1R1ZA 4LBJA 2GH8A 1SPPB 5ACA1 3MI8A 2D5FA 3PIJA 1HN0A 1DFQA 5FYHA 5JOWA 1KRIA 4HKLA 1RUH3 2PXJA 3UNPA 1FI2A 1PK6B 3MBWA 3RMYA 3NV3A 3WF2A 4XTPA 2XBO3 1UX6A 1H1IA 4KWKA 1XNBA 2DBNA 3LIGA 3VZKA 2FMYA 4EWEA 2V09A 2IUWA 3CKHA 4NIGA 4HMZA 3DN7A 3KS7A 1SEFA 3DXTA 4NMIA 1MS5A 4O9EA 4OUSA 4RHV2 5FV3A 1GQGA 1S0CA 5LZ6A 4IV3B 1RUF3 2A6YA 4XBLA 2SBAA 4RR3C 5FREA 1CGPA 1SFYA 3AZVA 4XDOA 3VL8A 1PGL1 3HEIA 2OKXA 1U5ZA 4HFSA 4ATEA 1KEXA 3HNBM 4Y22A 1M06G 3I8TA 4RFT0 1RUJ2 4XQ4A 2ZX2A 4N9IA 3AKSA 4TLGA 1XBFA 5A70A 2IFRA 4AF9A 3OB8A 1O59A 1JYWA 3OOXA 4GQ7A 2PN5A 3BU0A 1MZ6A 4FTBA 3RRDA 4LQRA 1NY71 4CDXA 1LODA 1DQ1A 1OBNA 1RUF2 3AX4A 2WSVA 5F6LB 3VBHC 2GC0A 1PZ8A 1LOAA 4GALA 1GQPA 1Q56A 3PVOA 1H9WA 2QJVA 2W95A 1GZWB 4LKEA 5DXDA 2VO5A 1VE0A 1XYNA 1QOTA 4AI1A 1RUD2 5F6KA 2A1XA 1W8OA 3BB6A 2NM1A 3ELNA 2XH6A 1C5IA 4LIVA 1RUOA 4N7IA 4N53B 3WNKA 4QXCA 5SV5A 3JBG1 5KC5A 4PBOA 1EPWA 3H3LA 1XE0A 3BN6A 4FPLA 1SCRA 2VMFA 3GALA 5C8CC 4F8AA 3ECQA 4LHNA 1TE1B 1WLDA 3VBSC 5IFPA 3VD3A 1D4M3 1C1FA 4KU8A 4AOCA 3ZSMA 1WW5A 4R4ZA 4DXRA 3VZNA 3PNAA 4YZ4A 2WFF1 5IW0A 2CSGA 4QPIB 3N9QA 1ZBA3 1VBC2 2XBO1 3KF5A 4MGYE 2VUJA 3O1UA 1OF4A 2RDSA 2Y6KA 2BBAA 2ZX4A 3PMEA 3N7KA 5F5CA 4TXWA 4ES9A 3RZJA 5IUQA 5FXWA 4UF0A 1YFUA 3LOBA 1H2MA 1NLQA 1W6MA 5JI7A 1V9U3 4Q0VA 5A33B 1F5JA 4IEXA 1V6LA 2D6MA 1YIFA 1W3VA 2JG8B 2R30A 4L11A 5AVPA 5LY2A 3VL9A 1QKQA 2B9UA 1CD3G 1UYZA 4Q0QA 4XMIA 3TN93 3DYOA 4YARA 1DCSA 4QB6A 4NPMA 2XHKA 5JZGA 3T2QA 2O14A 4KGGA 2QQNA 5FZ9A 3THDA 3AVSA 3VBRB 4CEWC 4I2OA 5FZMA 4Z2AA 1JS9A 2P34A 2ZGKA 4NHXA 5GALA 1V9U2 2OXBA 2YGMA 3B01A 3ZDSA 3HPNA 5FMBA 3V0AB 4XJUA 2QQWA 1JZ8A 1UYXA 3UT0A 1WMEA 1NCRB 5FZ0A 1H2NA 1W9WA 3ACIA 1DGRA 5D8AC 3SXWA 4ASLA 3JD71 1AVBA 4LT5A 1RJ7A 2DF7A 4KMQA 1N1TA 1H6XA 1IPJA 3DXUA 3NNLA 4OQ9A 2WQ4A 3U10A 2CGPA 3WOGA 1YJLA 1O3TA 1GZ9A 2ETEA 1PVC3 2HEYF 1W6NA 2ZEXA 3CMGA 5D21A 1BJQA 2WO3A 4Y22B 4FFGA 2JD4A 4K21A 5FFOC 2J1SA 4IXLA 2IVIB 3C8XA 4P5HA 1XYOA 2HEVF 3NKGA 3M3CA 4IEVA 4XFGA 1V70A 1VBA1 2WYFA 5FY5A 1W3XA 3W5NA 4TTGA 2PHFA 4K6BA 4FPFA 4Q0SA 5IAXA 1D4M1 4WM8C 5JUVA 1QJX1 4LLFA 1YI9A 2W3JA 3LEMA 4AEDC 2W47A 5BNPA 1NX9A 1QNYA 1R1A2 3AJYA 5HBAA 1FYUA 2FDFA 5F8PA 1J59A 1GICA 1QJY2 4Q4V1 3M70A 2R1DA 4QWNA 1H1MA 2WS92 1HRI3 4W6XA 3N7LA 1W6QA 5BNNA 5KC6A 2K2SA 3WF0A 4AEKA 5GLTA 4DXSA 2WQZC 3ZXEA 3P1IA 4KU7A 2ZGTA 3I2OA 2DTWA 4ORFA 3M4FA 2E7AA 3VHNA 1MEC1 2VZRA 5FPVA 2HWE3 1CQ9A 4LO5B 2LS6A 1WD3A 1A8DA 4QU2A 4ISQA 5DABA 2DTYA 1UY4A 1PIV1 1OLQA 2A71A 3IAPA 1L7LA 2JENA 1QJU3 5CFCC 1DIWA 3J4UH 3PHMA 1K45A 1LHOA 2VMEA 4BXFA 3SCFA 3ZOIA 2HBUA 3KWVA 4HL0A 4QGMA 2B8MA 2HYKA 1FATA 2DWRA 2ET1A 2AENA 2JG8A 5DAWA 1VMJA 1W9YA 3GBFA 4FPJA 1XSRA 5I8YA 3AP7A 5D1IA 1PIV3 3Q8FA 2WL1A 4HT1T 3Q8EA 3RNSA 1VP6A 2X5IC 5BNOC 2YG0A 3NRUA 3IT8A 4P9WA 5DMYA 5CKQA 2DYCA 3RZLA 4GJZA 2VMCA 1VBC1 1WD4A 1VRBA 1XJAA 2XBO2 1YQ2A 3B5LB 2H0BA 4PDWB 2B45X 4ZKTB 4LUMA 2OZ6A 3U14A 1W8FA 1QJX3 1UMHA 4A42A 1XXNA 1Y9GA 2DFCA 2ZX1A 4N43B 2BNNA 4IE0A 4XXPA 1NUKA 1K5MA 3HR9A 3BKZA 2KM2A 4QXBA 3N9LA 4XBQA 3NJZA 4XMAA 3ZYIB 4QGNA 4Y5Z0 2XJTA 3VBFB 5EPAA 3MICA 3MIHA 1DZQA 4LK6A 1BK0A 3BPZA 3WX5A 1AR62 1HB1A 1PK6A 4WM7C 4ZZ8A 2A5ZA 1ZZ9A 3E6DA 2FDGA 3WDUA 1RTVA 4D7YA 4IQPA 2CAVA 5BNNC 4JGYA 1JW6A 1OPMA 1WCDJ 2GP5A 2HLEA 3N9OA 2HWE1 2Y64A 4Y1VA 3WP6A 4CSWA 1UMIA 1XNAA 1VIWB 1BLZA 4XCBA 2UY8A 5JIAA 5BNQA 2YB7A 1GBGA 3AL5A 4AI0A 1VBA2 1WW6A 5FZDA 1N1SA 3SCHA 4BIFA 5IVEA 4DMIA 3ALQA 3MLJA 4D6RA 3PL0A 4B1LA 4PLOA 4DRRA 3V0BA 3VKOA 2WS93 1JZ7A 1QDOA 5CZKA 3T0DA 2CDOA 1YFYA 2UWBA 3JD72 2VCAA 2ENRA 3K3OA 3LE0A 5DG1A 1LULA 1J3RA 1MR5A 1KXGA 2VAUA 1J58A 4QDSA 1VBD1 3I2FA 5LBEA 1FNYA 1UPIA 4MGIE 2QQPA 1MQTB 1O91A 3TRSB 2P5BA 1GZWA 5GZGA 2VE1A 3SH5A 1RUC3 4D69A 3AL6A 2Y34A 1RUH2 3J7HA 1NA1B 4LBLA 5F5IA 1PO22 2H6CA 5FYUA 3MEPA 3O0XA 3WG3A 2BYVE 4KBZA 4XJZA 3OGGA 4FTSA 3KCYA 3ZFEA 1B35C 3T2TA 2Z79A 2R16A 3HQRA 4E4SA 4HONA 3WNMA 1PGSA 4D6SA 3O1VA 1TNFA 1AR93 5IK8A 2VR4A 4E27A 2YXSA 1D2QA 3AP4A 1ASJ3 1K42A 3QOPA 5F39A 4A3ZA 3NJVA 4GMP1 2JWPA 3WQ7A 1PZ7A 2TEPA 3KB5A 1ENXA 2E7QA 4PIXA 5DDJ3 3NL1A 2VL4A 4DUXA 1BQPA 3CJIA 4TSVA 1UU4A 2D3SA 1MS0A 3AJZA 2RM23 4IV1A 4JAAA 4JRLA 5L19A 1CPNA 2P17A 3Q8BA 3HMYA 1N1VA 3H3UA 2AACA 4G9SB 3USUB 5B2GB 1F31A 2PYTA 1UYPA 2XJRA 4HN1A 1R091 4MHUA 3VD7A 2R041 2V5DA 1X33A 3DKQA 5CAZA 1U12A 4V1PA 1HRV3 3MGUA 4BQ5A 5LRSA 4IE5A 4S2FA 4BM8A 5E8AA 4Z82A 5F7UA 2C26A 1ZBA1 1H8TC 3C7OA 1Q8PA 4C91A 1WA4A 4YZ1A 3AZXA 3IB3A 1TQ5A 1JI6A 4GWIA 4NPLA 3EXUA 3JCIA 3MPBA 2VMDA 3E97A 5JXGA 5FZHA 1IGOA 1ST8A 5L9RA 3EYPA 5JXIA 2LTNA 1UZZA 2J22A 3DCQA 4JDMA 3NO8A 2WBKA 3J7MA 5ISLA 2JD9A 2V73A 5FZ3A 1BCXA 1ND2A 4EZHA 4XJAA 4XFFA 2Y26A 1URXA 1VB2A 4E4ZA 1MVQA 4L2NA 4Q4X3 4X8NA 1HJFA 4YW5A 4Z1VA 2JECA 3I2GA 5A3TA 5C6CA 3BI3A 2D6PA 3C3VA 1OI6A 1TNRA 1RUJ1 1XOYA 4LE3A 5FMOS 1WCQA 1W90A 1AXKA 1ZYBA 2OPWA 1OHFA 1QJFA 4UFKA 3WEZA 3WUDA 3ZMOA 4E8DA 4TLFA 5C9AC 1R1A3 2YC0A 3GGLA 3NW4A 1UMZA 2JE9A 4UW4A 1C57A 1O4TA 3DEMA 2XLAA 5FYMA 3UESA 2GZWA 2C5DA 2AR6A 4RHV1 5CISA 5A80A 4Q4X2 2Z4FA 5F5AA 4R9BA 2XQRA 5FYSA 1AYN2 1W0OA 4I02A 4OUEA 4MGZE 3INAA 4ES8A 4R9CA 3HQUA 4WM8A 1N1YA 3RFRA 1UIKA 2D3PA 4JV4A 2BOIA 1E5HA 4PI2A 4Y26A 2VVEA 4YZ5A 1PO23 5F1RA 3AYDA 4BQWA 4JGZB 4FCAA 5BNPB 4LMFA 4P9GA 5AVAA 4KG8A 3AYEA 4RFRB 5CKMA 2G9FA 3OPWA 3POEA 2Q8CA 3URFA 2Y6JA 2A3WA 4D3WA 2ZJCA 1J1LA 3AP6A 2I74A 4HLTA 4LTAA 2IXKA 5FLJA 1PVC1 1S2EA 2HKXA 2HWD3 2ORXA 3ZFEB 5DUUA 2DV9A 1V6MA 4KH9A 3H3ZA 2B4KA 2D6OX 3WDTA 4TZDA 3EHKA 1POQA 3ZSJA 4PT6A 5FP4A 1UIJA 5ABJC 1BVP1 2DCKA 5FRAA 5A7PA 5FMDA 5EYYA 3VDDB 1RUG1 3KGZA 5A1FA 3O12A 2VZSA 1AZDA 1NLRA 2ZKLA 5FXZA 1SBDA 3W58A 2MPFA 3WCRA 2VW1A 3A22A 5JLVA 5CFCA 1BBT3 2W1WA 5A3MA 2R6QA 3VZMA 4HKWA 3H7JA 3CEWA 2Q1ZB 1A8MA 4ARYA 2R0FA 3THTA 1ULGA 1JMUB 1OVPA 4DOUA 2JDUA 3DPRA 5JCTA 1HQWA 1W99A 3OBAA 2WT1A 1SLBA 2XKOA 1FNZA 2AUYA 2VZVA 2YUEA 3N7MA 1PMJX 3CDZB 4MO3M 2X5IA 3ZN6A 2VUAA 3VDAA 5BNOA 1OVSA 5GZCA 1RMU2 4A6SA 4F83A 4P9JA 4D7SA 3GBWA 1H30A 1JXNA 3ZXDA 4PHZA 4CPBD 4H7MA 4I0BA 1VBE2 1QJY3 1OQEA 2BW8A 2RS51 3ES1A 3WUCA 3FLRA 2ZPXA 3M3OA 5BUVA 1HRI2 1PO21 3L2YA 4CDQC 4OI0A 1KS5A 4P9XA 3PUSA 1K5MC 2O0OA 4LO6B 3ZXKA 4K9SA 1AYN1 5FZIA 4DRVA 5DPNA 5FKBA 1TVGA 3OPZA 5FZ8A 2VNRA 4JHZA 3U75A 4B29A 4YGEA 1V0AA 1C1LA 4FFFA 5KHIA 4WVZA 1AR61 2ZXQA 2VOVA 4LBMA 2RS12 1LRHA 4JGYC 4KBBA 3AYCA 4IEYA 1VBD2 4PBPA 5DUXA 3NJYA 3USSA 4AQ2A 3U11A 5AC91 3MPPG 4YSFA 4RGGA 1YO8A 5IHRA 2FCVA 5CNAA 1CR7A 4QPIA 2VNOA 5IAVA 3ATGA 1KJRA 5IVYA 4CCDA 2O8QA 5IVFA 3MV01 5G05L 1KDKA 3CF6E 3HWJA 1OH4A 1QH7A 5FLHA 1LCLA 4UFHA 5J09A 1UOGA 3KV4A 5LEJA 4MH0E 3BOWA 2FMDA 1O7FA 2PLV2 2D98A 4DXTA 5FO9B 3K4AA 5DUWA 5EQUA 4P9YA 3VDCA 3TBDA 4BH9A 1HKDA 2HJIA 2X29A 1R64A 5FZ1A 5IK5A 3AC0A 1CAWA 1V00A 3ZVXA 4XXAA 2WZ8A 4XHXA 3MIGA 1CPMA 4E9KA 4JRAA 1FV2A 2BU9A 2XHNA 4ARXA 4X6RB 1RC6A 4UW3A 1XB9A 3POJA 1I9RA 4TWTA 4UFLA 1H2LA 5IVJA 1C8M1 2DBIA 2DU0A 4QX2A 5LA2A 1J1TA 4CP9A 4XBNA 3TEZA 4YW2A 3WQBA 3E6CC 3HBZA 4NPRA 4RGKA 2CU5A 4FQ4A 4CVUA 2ZGPA 1J84A 2UYAA 1GP5A 2ZAHA 3KCXA 4H2AA 1UWWA 4CU6A 4M3CB 2O1QA 5FUNA 4C1WA 5FZGA 4F7ZA 3X29B 1N3OA 4YM2A 5JWPA 3MLLA 1EAH2 2WWSA 1IHMA 2A6XA 1CIWA 1YXWA 4P02B 5T54A 2WR9A 5LBFA 3FBYA 4I09A 3E5XA 2ERFA 2RE9A 4RQPA 4W8JA 1GV9A 4FP2A 5FYIA 1IZ3A 2HBTA 1GU3A 1W8NA 3HIFA 5F2SA 2JG9A 3WW1A 2P4EA 4AXOA 4CUCA 1RUI2 2YMZA 1R083 2QZ2A 4M0NA 1DF0A 2V4AA 2PMWB 4RN5A 3AKQA 4PDWA 2VY0A 3AKPA 4HETA 2ZEYA 2EIEA 4K1YA 5C71A 3FUOA 4XYXA 2C24A 4UAPA 3AMMA 1HQNA 3ZKUA 4K20A 2ZCWA 2ZGOA 3JZVA 4NWVA 5DAPA 5GZEA 4ZHNA 1VBD3 2GN7A 3S0MA 4FOWA 3JU9A 4Q1PA 5FPXA 1LOGA 1RUI3 4FQZA 1G86A 1ND2C 3H1MA 1B09A 2WS91 2QDRA 3I2IA 3LA7A 2YPDA 3FN9A 3LEGA 3R4SA 4IE6A 1Y4WA 4UW6A 2QFEA 2XG3A 5JSOA 2QQMA 4M4RA 2VULA 1MZEA 2PQSA 5T5JA 5FYYA 3K75B 2ZABA 4AHYA 4NHLA 5HCFA 2XVGA 4NRQA 3T30A 5C9AA 1OLMA 1Y9MA 3L2HA 4YVSB 2P2KA 2Q8DA 3WW4A 5J3UA 3CJXA 1OLRA 3ZFGB 2N7GA 2XL7A 3B00A 3KQ4B 1ULPA 4CDXB 1LTEA 4E2QA 5C4WC 2WNUA 3DGTA 1MQTC 4NRMA 5JSPA 1DGLA 3NNFA 3V0BB 1JUIA 3R4UA 1BMV2 1TG7A 1RXGA 1UYYA 5JR2A 2G1MA 5J1XA 1NZCA 2CHHA 2R49A 3WQ1A 5JMCA 3H8XA 3KGLA 3BTXA 1JYCA 2XLFA 2VCCA 4AHWA 2W08A 1LOFA 1Y3TA 2WN3A 4AWDA 2ET7A 1Q43A 5EFUA 2P6HA 2QQKA 4MX3A 5C3RA 4BMBA 3UYJA 2Y60A 3AXDA 4IGPA 3O7OA 2A70A 3D8CA 2GC2A 3CQOA 4HBNA 3ZYJB 2IC1A 2JG9C 3EMRA 1YI7A 5A7QA 4Y5SA 4XEZA 4HVOA 2VZUA 4FPOB 4PF5A 3TEXA 3ZR6A 1C8M2 1ZRFA 1CX1A 1OOPC 3ASIA 1AX1A 1GANA 1RXFA 1VJ2A 2WYSA 3I3EA 4GH4A 3A7QA 5LEKA 3BUCA 2WN2A 2WZR2 3OY8B 4WBBA 4M3CE 4XETA 3MO4A 2JDKA 4TN7A 1HN1A 1EAH3 4CCMA 4NVPA 3L9JT 3GBGA 1QWRA 2VJXA 4XURA 1W0PA 3JUUA 4OULA 1O3QA 2EXJA 2WFPA 5C8WA 4ASKA 1QNWA 2EALA 4H14A 4LHLA 5K8SA 3GZTB 5LCWL 2PQQA 5KWRA 2GMEA 2B39A 2ZGNA 4XFBA 1OD5A 1C8M3 2XKPA 2WC2A 4AGVA 2RG4A 1RUD1 4INDA 5CU1A 3RI8A 3K48A 4J1XA 3VHOA 1PGL2 5FP8A 1JYVA 2SLIA 2WZPP 1JZ6A 3AFKA 1DP0A 3I3DA 1D4M2 4ISRA 2PA7A 1SFPA 3NAPA 4URTA 4ZS2A 2J1AA 2YZ4A 4Q4V3 3LDKA 5K7PA 2DU1A 2WA3A 5JVVA 3WP5A 1EV12 1L7RA 1VBC3 5F32A 1AL22 3ZKYA 4MLOA 3V0AA 4HK9A 1R093 4QDQA 4OUMA 3POBA 4GA9A 5FTTC 1US3A 1UKGA 4AL9A 3IIIA 3UL2A 2VD7A 3N9MA 4CE8A 3K4DA 2DCJA 1V6KA 2YDEA 4CDQA 5FQ0A 1GP4A 1BXHA 2OT7A 2PAMA 2WLQA 5FY9A 1XYPA 2G4IA 4YG3A 3S7EA 1D4VB 1IPKA 5JXHA 2XJUA 2WKKA 1IG0A 2LW8A 2D5HA 4YWAA 4YW1A 4CP2A 1APNA 1F9KA 4JZRA 4RYDA 1SCSA 5F3GA 3THCA 1W8UA 5L7OC 4ZONA 2PLV3 1V6OA 4AFCA 1ZZ7A 1NQJA 5L73A 2PHWA 3HJRA 3ACHA 3J26N 3OBTA 2GALA 4QPIC 1BMV1 2JB4A 2WNOA 3H42B 4UFIA 4ATFA 5FP9A 1W2UA 5J48A 2TBVA 1YFXA 1QDCA 3D82A 5DG2A 4CEYA 4QX5A 3TOJA 2QBXA 3LDRA 4GJYA 2ID4A 2C0ZA 3OD0A 4YM3A 2PTMA 5H9SA 1BBT1 2RDNA 3AP5A 1OXCA 4U36A 1W6QB 5FOJB 1WCSA 2P3IA 5BYNA 1WMXA 2VQAA 2ZZQA 3T0BA 1QQP1 2DUOA 4KL1A 5J7MA 2RJLA 4O61A 2VXJA 2W46A 3BALA 1T2XA 1UQXA 4YNIA 2JX9A 4CDUC 1K3IA 4OYUA 3VBRC 3APBA 3B94A 5FY7A 2PHDA 3NV2A 4CEWB 1W6PB 1QJY1 5ABJB 2GNTA 3LAGA 1D2SA 2PELA 2JDMA 1YIPA 3HT1A 3CBNA 5KXBA 4CCOA 3OEBA 2Y6FA 4AI9A 2DDUA 4SLIA 1UOBA 1NCRC 4LBNA 1X9PA 2HWB2 3WF4A 5HCHA 2JDNA 3CZJA 3H1WA 4HK8A 3KV5A 2QQUA 1AL0G 2CGNA 3LGRA 1NCQA 4IERA 4CA9A 4ZS3A 4JC1A 4AI3A 4B4PA 4BQXA 4YW7A 1NXD1 1BHGA 3LPGA 3OBRA 4Q0UA 1SLAA 2XGXA 4C90A 2XJQA 1AL23 3O14A 4QDRA 3FFQA 3KMHA 5FZAA 4CCKA 1OQDA 3ABZA 4ZZ5A 4AR2A 4FPGA 1V6NA 4RQPC 2EIBA 5IJRA 1H9PA 1G9CA 3TEYA 2GMPA 5FZKA 1AJKA 4M0HA 4OMCA 4WM8B 5CBLA 1K5MB 4LK7A 2BWCA 2JXAA 4CCJA 3VHRA 1CWPA 4AQ6A 1ZA4A 5C3SA 5ERLA 2ZGRA 5JSRA 1FPN1 4FPCA 2A3YA 3UJQA 4GXLA 5SV8A 3PU3A 2BPA2 4CEYC 2VGDA 1ZBE1 2J1RA 5CYYA 5CFDB 1PM7A 2WFF3 3VDDC 2HYXA 2R062 1YQ5A 5FZBA 2Q4SA 2W39A 2WINB 4MZUA 4YGBA 1ZZ6A 3ZYHA 3CNAA 4F3JA 1EAH1 3DL3A 4IV1C 4YW6A 2F4PA 1SMVA 3PUQA 1W8WA 2F4LA 2GMMA 4QM9A 4GKXA 4C1XA 4TYSA 1QJX2 1HRV1 1QEXA 2VZ3A 1BEV3 3I97A 2CYFA 3LF7A 4Z8BA 1ZRDA 1VBB3 4ASMB 1SDDB 1HXS1 2W92A 3U37A 3ETQA 4HVRA 1JOBA 4Y1YA 3MF9A 2CY6A 4K8FA 1LB2A 5FXVA 4XPVA 2WNVC 1JTZX 1PM4A 1GSLA 4LHSA 5GZDA 3IDCB 3ILNA 3OGSA 3ZSEA 2YHJA 2BP6A 1VAKA 3C7HA 2WO7A 2ZHMA 3ORJA 4FPEA 4MSVA 1W04A 4QPGA 5T5OA 3T09A 1PGW2 3ZIWA 3TAYA 1AL21 5FZOB 5A6XA 4HKOA 3ES4A 1LOFC 1XNKA 3NMBA 1AR71 2R061 4GIQA 5C8CB 1OUSA 4XHBA 1SZBA 4HVQA 2ZKNA 3CIHA 4E8CA 5JMOA 1ODNA 5IYYA 1CAWB 1IS5A 1O4YA 3HNYM 3POIA 4CDWB 4YYOA 5EP9A 4A41A 4LULA 5JOXA 1EPZA 1UZVA 2RS33 2JEMA 1SPPA 5F2WA 4CCEA 5E89A 4XF1A 2WAAA 3Q9OA 4JQRA 3KSCA 4A3XA 4BIOA 2GNDA 2X09A 4XZPA 2A75A 1H4GA 1OKOA 1DGRN 1COV2 1T6BX 3IDAA 3MUZ1 1QQP3 3RDIA 1ULDA 1UKRA 1OOPA 1VBE1 4CP9B 1AYM3 4GH4B 5FXXA 4CUAA 4BDVB 4EROA 2JICA 4NUBA 4XVHA 3RYPA 1OD3A 2DVDA 1YRZA 2EXHA 3OY8A 1F15A 3ZFGC 4J6GA 1MS4A 5ACA3 3ZYRA 3MIDA 2GDFA 4M01A 3TN92 1JU4A 2Z5WA 5HCAA 3NQHA 1LEMA 4U2AA 2ZMKA 5FO8B 3AB0A 4M3CA 2VZTA 3VN4A 2RHPA 2Y0IA 1WBLA 4H7LA 1O3SA 1GNHA 1UXZA 3N4MA 2D6KA 1MZ5A 4ET7A 1QOOA 1W8ZA 4NIIA 5A32B 3RYKA 4BQ3A 4ZU5A 1IS4A 3UGFA 1OKQA 3WNPA 5LWBA 2C9KA 4UOJA 5JOYA 2ZGUA 4V2WA 3ILFA 3IM0A 1UNBA 3ZYBA 3NWKA 2P3JA 4CUGA 4NWWA 4Q29A 1I1EA 3BCWA 1AR82 5DDJ2 2P3KA 3D5OA 3A4UA 3GJAA 1XU2A 4D94A 4AZZA 4ITCA 4L0PA 1ACCA 4WM7A 1QY4A 4N43A 4EJRA 5KHJA 4EE2A 3RJRA 5JI9A 1AR73 3U4SA 2CDPA 1CZTA 3RI9A 4MGSA 3O1SA 1PVC2 1LESA 3AZWA 4FAGA 4AEMA 4COZA 1BEV2 1OA4A 3QH7A 4BA6A 2VC9A 5L36A 2FZ1A 1RMU3 1UCXA 2ZTNA 4KWJA 3ZM8A 1U5IA 5LA1A 4NIHA 2G19A 1RUE3 5CKNA 5FMOL 4XACA 2GU9A 5I8TA 2WZR3 2VH9A 1D0HA 2CTVA 1DG6A 3NV4A 4RR3B 3CZUA 2FHRA 2NZ9A 5K4LA 4WZCA 2RDQA 1TME2 2AZ5A 3VGIA 3H8RA 4K1ZA 2W1SA 3OGJA 2QNKA 2FDJA 2I07B 1S55A 4YVWA 2OYZA 5C3OA 3T2PA 1D7PM 3BGAA 3IDBB 3SH4A 1MVEA 4M3CF 4DZGA 4QX8A 1DGWA 1UPSA 2VCBA 5FAXA 3WDVA 4QPYA 2BV4A 2R7EB 3LSEA 2JDPA 2ZGLA 3ETPA 1Z0HA 4S2GA 4I01A 3ON7A 4QPGB 2KD7A 5T52A 5E88A 2GC3A 2XJPA 5T50A 3ZFGA 5K9YA 3M3EA 2D6LX 4QXKA 2VZQA 4QKBA 4W4ZA 3BIWE 2I45A 4LKDA 1QGLA 2PHUA 3NV1A 1U5XA 4EN9B 5FWEA 1A78A 1U5YA 3WLUA 1IG3A 4B4RA 5K0UA 1PX4A 4BLIA 2JG9B 5JPNB 2DVAA 2R072 3SISA 2HWB3 3BTAA 5EYXA 2OQ7A 3MW3A 5T5LA 1W2NA 4AVSA 1AYM2 4H55A 4A6OA 2VMGA 5FZEA 4IUGA 2BJSA 2ARCA 2RJ2A 5FPUA 1CZVA 2FCTA 3MZHA 2R32A 3W20A 1RVF1 2QQJA 3VBOA 1FMD2 3AK0A 2RMU1 1FV3A 1W8TA 3RG0A 2E33A 3BODA 4LO4B 3H50A 1KQRA 4CUBA 1VB4A 5LATA 1UU5A 2NMOA 3KVBA 3OYWB 4PIYA 4RA0A 3W59A 2E6VA 5A7WA 2RS11 2ZEWA 4FAHA 1DU3D 1JH5A 2A3XA 3WG2A 4PQ9A 2QQOA 4OQ8A 4QPWA 1OA2A 1S4CA 3FUQA 1YEWA 3I2KA 4LBKA 4Y33A 3WDWA 3ZPYA 1WKYA 4YM0A 2ZHLA 1HRI1 4NN0A 1FMD3 2R0HA 2WT0A 4A45A 4AHZA 4BU2A 4QX1A 5C9AB 4QHOA 4CCLA 1DHKB 2NMNA 2K0GA 5E1RA 4XF0A 1MZFA 1A34A 5KHHA 4NOTA 2OIIA 4D8MA 3W5MA 1XE7A 4B8EA 3USUA 4QX7A 3ZYPA 5CEHA 1NQDA 4CXWA 3POSA 3LB9A 1MPXA 1LHNA 4LOTA 1UAIA 1BBT2 2CNAA 3HN1A 3U78A 4QGLA 1QIQA 1F2NA 4LR4A 1TMF3 4XUQA 4LKSA 3A23A 3KF3A 5H9RA 2XJVA 4XUNA 2C1FA 4PJYA 1AR91 3GHNA 1KGYA 3IBMA 5L9BA 4C8DA 2VZ1A 4DO0A 1GLHA 2R042 3IPVB 3NNJA 2JE8A 4FFHA 5JPMB 4EN7B 2FDHA 2CGOA 4QKDA 4X6QB 3B9IA 2VOTA 5K0UC 1ODMA 1ZM1A 3FHIB 4N53A 2RJKA 2DCYA 4RR3A 1VBA3 5IK7A 2OZJA 4UYBA 1QU0A 4UFMA 5T5PA 4YGCA 3I4IA 4DY3A 1RUE1 5DAQA 1UZYA 3KD4A 4Y1XA 2P6CA 4QU1A 1G7YA 3OJBA 3M3QA 2CWSA 1Q5OA 2VCMA 1NG0A 5GLZA 5T55A 3VD5A 5FY8A 3VBUB 4RS5C 2W2IA 4XQWA 2YU1A 3WNOA 2ZX3A 4Y20A 4LBQB 4DFSA 4CU7A 2VECA 1E5IA 2VVFA 3OUHA 1OURA 4XJWA 2Q8EA 3UETA 3FFZA 3MIEA 1PO12 1GUIA 3QBQA 4DINB 2EA7A 1STMA 2PAEA 3GHMA 5EIYB 1JYIA 2MEV1 2ZS6B 2JJ6A 4DPNA 3S7IA 2YV8A 4OZOA 4Q4W1 3LEKA 4QHBA 1JHJA 1EUUA 1LHWA 1Y43B 1LU2A 2VTXA 1AX2A 3SEEA 2Q8OA 4XF4A 4WVWA 1RGSA 3LSDA 1WZXA 4KGQA 4EYUA 4MG2A 1X8EA 2PHTA 1CAVA 3AP9A 3WDYA 3WCSA 4FSJA 3LD8A 1ND3A 3R0RA 4LA2A 1B35B 3SCGA 4DS0A 2JDAA 1JYNA 4CEWA 1GFF2 5TSWA 1OFSA 3G7DA 4N9HA 4FBFA 1WLWA 1L3JA 2WFF2 5ABJA 1F4AA 2RMU2 4FXKB 2XVLA 3I49A 2PHRA 4YPJA 1UY3A 3AYAA 2AH2A 2YGLA 5FUPA 4AE2A 4JDOA 4LPLA 1WCKA 1HXS3 2Q0AA 2HWD1 4A2UA 4W50A 1DQ6A 3VV1A 3OBZA 2IWGB 3FE5A 3FHAA 3DPRC 3GCWA 5EJ1B 5J37A 4YM1A 4UBHA 5C3QA 2EXIA 4LITA 5BPXA 1LOBA 4AI8A 4BK4A 2BVVA 1DZRA 2BGPA 2OA2A 3B9CA 1CAXA 2IVJA 1HRV2 1NE6A 1SFNA 4FPHA 2YY1A 1HB4A 3H1YA 1O6UA 1FMD1 2XVKA 3IZOA 1ALYA 1H6YA 1HXS2 2ZEZA 3B93A 4FP3A 3HT2A 1QXPA 1PMHX 3AKTA 4FFIA 1F4HA 4QB2A 2GH2A 2XPJA 1DQ2A 1X7NA 1YNAA 2VXRA 4QX3A 3S6PA 1NYWA 1HIXA 5I0TA 4OI2A 1POV0 4QKNA 5FLIA 2EAKA 2JDZA 3QD6A 3FBMA 3C2UA 3RZHA 3HBKA 5A3WA 3VKFC 1I5PA 1KITA 4CEYB 3WHUA 5HPOA 3BVCA 4PF1A 4AEJA 3T08A 2ZAAA 1ZBE2 4N7UA 3OEAA 1C8NA 4Z07A 2ZZJA 4YW4A 5FYBA 3S5QA 3HD8B 4P5YA 4FXGB 4I3PA 3NKTA 1M4WA 1O5UA 1JOPA 2DCTA 3FC0A 2YC2A 4ONUA 1Y7BA 2A73B 3DYPA 5M0TA 2WIIB 4HXCA 5FYCA 5C33A 4WM7B 3A0KA 2RS53 4MXVA 4RD7A 2H6BA 1W6PA 2HWC2 4LA3A 1X8MA 4XAAA 5BNNB 4XILA 4BLJA 4BPZA 4YFZA 3WXPA 1ND3C 1ZBE3 3JQWA 1X50A 2W87A 4A44A 1YLLA 3VBSB 1R092 4COWA 3C7GA 3GCXA 3P3PA 3N9NA 4G4FA 1XC6A 5LBCA 5AFEA 5IWFA 2CL2A 4H3WA 1W9FA 2W94A 2DURA 3CLPA 1LKNA 4IETA 5ACA2 2WNVB 3M8LA 3WNLA 1O5LA 3HOBA 3EQEA 1IKQA 2FQPA 1AR81 4AFAA 3VD9A 2HWF2 4R4XA 3AXEA 4JGZC 1UY1A 4I3GA 3KLSA 4FI9A 4BQ4A 2CV6A 3ZXFA 1XQNA 2AEYA 1PX3A 2EVXA 1RMU1 4E4DX 2PFWA 3FLPA 5I8SA 2JG8C 1LGBA 1W2TA 1N3PA 3MV11 4CYDA 4QB1A 1KD7A 3LCPA 2KXLA 3LWCA 1AR83 3WR0A 5LBBA 2XOMA 1C5HA 2WT2A 4JDNA 1S0JA 1RL3A 3CO2A 4XAEA 2MEV3 3KVAA 1FAYA 4UI9L 4BMEA 2V72A 1UU6A 3ZR5A 4DEVA 3J7NA 2VW0A 3U4XA 4E2SA 2ADEA 1OFNA 1RUG2 3VBOC 2G9ZA 3T0AA 3UK9A 1C28A 1RUE2 1Q8SA 1BKZA 1US2A 1WW4A 4CXYA 4ZU4A 3TN91 1VMHA 2VUCA 5A3PA 3RZGA 1O8SA 2VVDA 1ZZ8A 1PK6C 4PIZA 2P37A 5LK5A 3OYWA 4WV8A 2LM3A 4AQTA 5ANQA 5FP7A 2NP0A 2WRAA 3ZYFA 4KNCA 4HOOA 5H9PA 2Y33A 4O9GA 3J8F1 3F2ZA 3WHTA 1LENA 4OZXA 5DZGA 4EZ4A 5C7GA 2E63A 3I2HA 4YRDA 1OUXA 1WWYA 5H9QA 3PDQA 4JVAA 1LJ7A 2RR13 1WUVA 3RWNA 3FZ3A 3AVRA 1SDWA 4DQAA 3H9AA 5C4WB 1PVXA 4O65A 1RUJ3 1LAJA 1LOEA 4UBGA 4XIOA 5GM0A 1HW5A 1XRUA 3OTFA 4OLLA 4A4AA 2NYYA 5IK4A 3KT4A 2BVBA 1OT5A 4JGZA 2UWAA 4MUVA 1Q8OA 4YGDA 5FZ4A 5FUIA 1SBFA 2QZ3A 3OUIA 4XCAA 4D6QA 1G9AA 5C5TA 3K3NA 3LA2A 3P3NA 3POWA 2W91A 2R073 3P5BA 1O3RA 4XIKA 4OI4A 2RS13 3IN9A 4JHTA 1QHDA 2VBBA 2Q1MA 2KA3A 2VTXJ 1UO9A 2KR2A 3I3BA 1ZVFA 5IVCA 3SHRA 5FZ7A 4IEUA 1RIRA 2FCUA 4N53C 1RYYA 1K12A 2X10A 2YROA 4MVTA 4FPYA 4XFHA 3WG4A 1HQLA 1NOVA 5APAA 3JQXA 4XUOA 4YVWB 5FK7A 4NROA 1K5JA 4BQ2A 1QF3A 3B69A 5J96B 2FZ2A 4HZFA 1BEV1 1JYTA 4JKKA 4RS5A 3LQCA 2ARBA 1KJLA 2NPIA 4AFMA 1FPN3 3FHQA 1ZRIA 1XNDA 4YW3A 1NLSA 2WNUB 3JB4C 1ZBA2 5IT6A 1I5ZA 5EJ3A 4L92A 2DVGA 2GP3A 5FY4A 2Z69A 4QQOA 4XFAA 2W68A 3J8F3 1YWKA 3SKVA 1R1A1 3RQ0A 4BISA 2L9LA 4Q8KA 2RMU3 5CVRA 3VDBA 2XUMA 4GB31 2D6NA 2X5IB 3ZN6B 2VOXA 4NHMA 4QM8A 1VBB2 2BNMA 5EZWA 4OHZA 2IXJA 1J83A 4R9DA 1RJ8A 4DNYA 2ZGQA 4UFJA 3ZFFB 2GNMA 3O1OA 2OX0A 1FPN2 1CAVB 4OHYA 4RGAA 4URAA 1GMMA 2A6WA 1AUYA 1QOSA 1KDMA 2YU2A 4RSUA 3PVEA 1B35A 5FJHA 3ZFEC 1SG3A 1H8TA 2UURA 2Y6LA 3UJOA 4E2GA 1BK1A 1ZNPA 2JKXA 1DBNA 1LHVA 4GWMA 4AVAA 1KS4A 3J9SA 1WMFA 1EP0A 4LIUA 1V6JA 4M00A 1QH6A 3I2DA 4WVMA 1W0NA 4XJ9A 1AX0A 1Q8QA 1PMIA 1WLTA 2R071 3CU7A 5KHGA 4P14A 4GMP3 4ZPIA 4META 2XWBB 2VZOA 1HB3A 3AKRA 1S0FA 2UYBA 3CJIC 2TUNA 3I7DA 4IGOA 1CVNA 4EN6B 4MXWA 3NNMA 5D8AB 5LW9A 5J36A 2GAUA 2WUHA 4XJ8A 2E9QA 4EWAA 4AFDA 1OPOA 2G9GA 1COV3 3ME2A 1H2KA 3T2OA 4UW5A 1N3QA 4CU9A 2K9ZA 5GJ6A 3RVHA 1YJKA 3NAPB 3HNMA 4FT8A 3A0NA 4KQ7A 4CRQA 5A6YA 5JXJA 1KFUL 1YUDA 3AZZA 3BPSA 3QACA 4LBOA 5A6QA 4GD4A 2W1QA 1S2BA 3PUHA 5FY1A 3WP4A 3LIHA 1ULCA 3M2MA 3POFA 3MYXA 1MS9A 1WA6X 5FPZA 4Y5TA 1XNCA 4QXHA 4R52A 4YZ2A 3SQOA 1VAMA 3WF1A 3ZN5A 1LR5A 4Y4RA 1VR3A 2BTVC 2OQ6A 3PU8A 4GULA 5A1AA 2VMIA 3U1XA 3DF0A 3OGRA 5DQ0A 3M7AA 3KHBA 3ZSLA 4W6WA 2JIJA 5K0UB 3O1TA 3MDPA 4AEDB 5BV6A 1XSQA 5F37A 5I0SA 3RZKA 1BYHA 5LK7B 5LRRA 5JAXA 4AG4A 1QJZA 4CDUB 4EWDA 4IV3C 1RB8G 3QLQA 3PUIA 2W1UA 1ENRA 4JX0A 4IGQA 4GB32 3LDBA 3VBUC 1JYXA 5A3OA 4FOVA 4Z2WA 2LRPA 2WABA 3OCPA 4LO7A 2YBPA 4JTNA 1JZ2A 3POYA 3VBSA 3WNNA 2UU8A 3VKLA 3I2JA 1Z78A 3P6BA 3TYJA 3KCCA 2BZDA 3O0VA 2Y8KA 3VDDA 4AVBA 3VBHB 5A3UA 2FD8A 4FTEA 1DZTA 2R063 2XONA 4B1MA 1QJU2 4QKFA 2C4XA 3EB7A 5CFCB 1JU3A 1LEDA 4IEQA 2BEOA 4MGTA 3GZEA 4MV2A 1W2OA 5FYZA 4S2HA 5IVBA 2TNFA 3WT3A 1LU1A 1L7QA 1TME3 1IQDC 1MEC2 3KZ4C 4QX0A 2VNVA 3ACGA 4K7JA 3VBRA 3H7YA 4OCTA 1EUTA 2VTFA 2YPJA 2VOWA 4MGQA 2Z42A 3ACFA 3KQRA 1CESA 3SLIA 2BGOA 3ILRA 4XZUG 5GLUA 2IFWA 4Q27A 3JXSA 5BNOB 5JZGC 1H8TB 3H8OA 4DUVA 5JIUA 3ZXJA 4KG0A 3N7JA 4NE9A 2WJSA 1XNTA 3AMQA 3AM2A 4W6YA 4AVTA 1HV0A 4PQQA 4CP0A 3BYWA 2WZR1 5IATA 2BQPA 1POV3 1CZSA 5AFBA 2AGSA 4OFGA 3IWZA 5LASA 3IPVA 3OG2A 1HDKA 1CIYA 3WW2A 1LHUA 2YFUA 1ENQA 2PAKA 3SNMA 2AEZA 4Q1RA 1YHFA 4DUWA 3MFCA 3K46A 4XABA 1VRH3 1QJU1 3SH3A 4YG0A 3OPTA 5D8AA 4L9BA 5LY1A 1W6OB 1NCQB 2BUKA 3POGA 3IIAA 1AR63 5DUVA 1QXJA 4GAZA 1HJGA 2F6BA 4Q4V2 4LXLA 3LPFA 5FPLA 3V64A 3PMSA 1YQ8A 2VOKA 3PURA 1MACA 4YVSA 4NHKA 4HANA 1EV13 1SACA 3T3YA 4Z92B 4MHRA 5C70A 2D3RA 3ZPOA 3AMPA 2HH9A 2WSUA 3DUIA 1Q3EA 2J1UA 4HPKA 4BE3A 5AC92 4HG6B 1DYKA 1QJEA 1RHI2 3RZZA 1GWLA 4CPBA 1E57A 3HQXA 3ZIXA 1F5FA 1PHMA 3ST7A 3ACLA 4QQ2A 4Y1UA 2OPKA 2ORZA 3WD5A 4J1WA 1ZRCA 1C3HA 1VALA 1WW7A 3JD73 2QQVA 1NE4A 4LHKA 5T3NA 1WLCA 4AEDA 5BNPC 3FWEA 2MEV2 4AAPA 1H1AA 1S1AA 2OS2A 2ZACA 4OI1A 4CP1A 1WMDA 2ZGMA 4BZ4A 5KXEA 3JB8A 1GOFA 4LEJA 5EHDA 1CONA 2XLGA 2RDRA 4V2VA 1H0BA 2OW4A 3ZX7A 4M4PA 4AYUA 2BFUL 3AFGA 4XFCA 4KWLA 3MHZA 3LOIA 4GZ9A 4BK5A 4MADA 4Y3OA 4B4QA 3KT1A 2E31A 1EY2A 3RWKX 1W9SA 4Q8LA 5FY0A 1E5SA 2X05A 3TEWA 4QHZA 5FIXA 5FMCA 3FMGA 3N36A 5FBZA 3PTRB 1AXZA 2E26A 2Q1FA 2ZBJA 1GWMA 4LKFA 1NAEA 2WO1A 3ZXLA 4AW7A 1UD1A 4SBVA 1G9FA 1AR72 1RINA 1KFXL 4LORA 1J3PA 1OF3A 2BGCA 5JOZA 1ASJ2 3BTYA 2EIDA 5BY5A 4C0HA 3GNEA 4P00B 3IMMA 2X8KA 2D43A 1JBCA 4O7XA 1H8VA 3WG1A 1OC1A 2A7AA 1DQ0A 3WNXA 4NIDA 3LZZA 4HN0A 2JDHA 3RJ2X 1PO13 3MUY1 1DGWX 1FOD2 2XQXA 3ZO0B 4XUTA 1G9BA 2ILMA 3E5QA 3VBOB 2PLV1 3VB9A 3MF6A 3TWIA 2VM9A 4IEOA 5FP3A 4CXXA 1T6GC 2QVSB 3TNPB 1PGW1 2CWMA 1DYOA 4MOAA 2J1VA 1BVVA 5FWJA 4ZY9A 2WWUA 1NY72 4Q2FA 1AYM1 3PTYA 3R05A 1OQ1A 1MS8A 3HAGA 5A7WB 5EXOA 1POV1 5F5QA 5FCCA 2XJSA 3WF3A 2B9VA 3C7EA 1ONAA 3Q8CA 3B7MA 2FDIA 2V4VA 3CL1A 4I30A 5LA9A 2Y6GA 2K46A 1LNSA 4BXSV 1FXZA 1EV11 2J42A 2Z2SB 1CAUB 1VBB1 2VU9A 4RQPB 4AGGA 2XR4A 4QD2A 5FOBB 4IL7A 2D40A 3RGBA 1BZWA 4RL7A 3GDBA 5FK8A 3O0WA 4HPKB 1UY0A 2W52A 2GC1A 4L99A 5ANNA 5JDBA 5A32A 1QMJA 2CAUA 2BWAA 2WZEA 5GLWA 5C4WA 4ZXKA 3ZYGA 1YC61 1DLCA 1IKPA 2EF6A 4AVVA 3J8F2 3K51A 4N43C 2OUHA 4XOGA 4EV0A 2LUWA 1CJDA 1SLLA 4GB33 3DECA 4LE4A 5LA0A 3RZMA 4XW3A 1UY2A 3VBFC 4CTEA 5A1LA 1AYN3 5A7SA 3WVJA 1LECA 4IV1B 1GR3A 2VBDA 3KHCA 1AXYA 1OSGA 2Q5TA 4UT5A 1GNZA 1ZZBA 1AJOA 4EN0A 5FZFA 3VD4A 5DAVA 2ZMLA 1N47A 2ATFA 2EIGA 2I2SA 4CZSA 1GOHA 3FX3A 3D0SA 2W5FA 4IEZA 4YVWC 4OHWA 4IV3A 5L9VA 2OUJA 5DDJ1 3VBUA 4A7ZA 5FYTA 2ZMNA 3SITA 4K3UA 4LBQA 1S0GA 1H4HA 5IFTA 1CJPA 1MEC3 2WDBA 2VZPA 2PHLA 4IEWA 5FBJA 4COYA 1JN2P 1Y9QA 4EN8B 1W39A 3MIBA 1SLIA 2QUOA 2R043 3B02A 4Y1ZA 2QE3A 2JKBA 4PLMA 3W21A 1OLME 3E5UA 4UWDA 3ZMNA 1QXRA 2RM21 3R4DB 4HSLA 4A7YA 2BDRA 4XUPA 1YFWA 4P9IA 3I3QA 2RS32 4DIQA 3BOPA 1RITA 4QQPA 1JUHA 1ZRRA 4X8PA 2J1TA 4NRPA 1IPSA 3CHXA 5FZCA 1RUH1 1GOGA 1NA1C 4E4HA 1Z7S3 3FLTA 1QQP2 3C7FA 1VPHA 4CDWA 1W03A 2WWJA 1OMIA 2YBSA 4GH4C 3BTZA 1HLCA 3N3HA 1GQHA 3GXUA 3WDXA 2FDKA 4COUA 2YYOA 1G9DA 3LKJA 1V6IA 1REDA 3FJSA 4XC9A 4MYEA 5FZ6A 3D6EA 5A7NA 3VUOA 3O1PA 3FL7A 3VBFA 4IESA 1MS3A 4JQTA 1TMF1 4CDQB 5IVVA 2B5HA 3VKNA 3DV8A 5DN2A 3N35A 4LO8A 4Q4Y2 2ZX0A 2J7MA 2D44A 4S2DA 2GNBA 3T1MA 1TZOA 2BOJA 2GN3A 3AZYA 3DYMA 1RHI3 4JKLA 4Q4W2 3O1RA 2RVAA 3PJYA 3EJKA 1NT0A 2F17A 2BFUS 1ULEA 4AHXA 1JZ4A 2JDYA 4Q5OA 5KBFA 4QT6A 1RUG3 3OGVA 5I91A 5L7OA 3BIEA 2QDNA 4YVSC 2B7YA 4RS5B 3AMNA 1R081 5LB6A 1HV1A 4OHXA 3RYRA 2DUPA 3NVCA 5HXMA 4Q4Y3 3HN3A 1RUI1 1DQ5A 2D97A 4YG6A 1DYPA 3WP3A 2VNGA 4PLNA 1ULOA 1YQCA 2ADDA 1A6CA 4Q0PA 4XQDA 1RUNA 5CIRA 5CFDC 1REFA 4PCRA 2WNEA 3RS6A 3RSJA 4YZ3A 2DFBA 2J1EA 2XB6C 3SC7X 2IXLA 3M3IA 3PIGA 4XFIA 1VRH1 1NXMA 1DLLA 1GZCA 2WA4A 4D0QA 5I0DA 1RVF3 1TEIA 1W28A 2RM22 2JB8A 4MGKE 3D3AA 4CDUA 5HV0A 2D7FA 4BB3A 1GKBA 4A7KA 1NA1A 4R8HA 4KWUA 4IE4A 5D2AA 1JOJA 1W6NB 1CX4A 3G6JB 4FVVA 4RHV3 1WBFA 2ARXA 2IXCA 1OOPB 4K40A 3WINE 4CDWC 2E51A 4WVMB 2X53S 2ZOEB 3ITQA 4J25A 4YFWA 2QQLA 1YQ6A 3SKJE 1J3QA 4NO4A 4L97A 2EAAA 5DAXA 3UGHA 2VQUA 3KV9A 2BBVA 2Y38A 5BXXA 1F35A 5FZLA 1RVF2 1UOJA 1ZA7A 2VUDA 3K4ZA 4UF0B 1P8JA 3DPRB 3VKMA 2W9XA 1RUF1 4FOYA 4W65A 2RS52 4R9AA 2VW2A 4YLZA 3UKNA 2HWC3 4LNVA 1I3HA 2MHFA 5AC93 5HXVA 5FPAA 4BOWA 3JBG3 1WCUA 5I0UA 2XUEA 1OA3A 4CCCA 5FR3A 2A6ZA 1MS1A 5JZGB 3ROUA 1UXXX 5CB7A 2IXHA 3IDEA 2NLRA 2VG9A 2H0VA
chains in the Genus database with same CATH topology
5CZKA 3T0DA 2CDOA 3LE0A 2VCAA 1NKGA 3I3BA 1BHGA 3LPGA 4QDSA 3I2FA 1RYYA 1K12A 2E32A 2X10A 2BERA 4QDRA 3SEPA 2QQIA 4XUOA 4AAXA 3ABZA 4ZZ5A 4JKKA 2EIBA 3LQCA 3NNGA 5IJRA 3GM8A 3J7HA 3FHQA 4OMCA 3SKVA 2L9LA 4QAWA 3WNMA 3VDBA 3E1F1 2J1RA 5CYYA 2VR4A 2HYXA 1K42A 1J83A 4CU8A 4A3ZA 3NJVA 1UX7A 2WQ8A 4ZXEA 1GMMA 2VL4A 4DUXA 1SG3A 2RV9A 2Y6LA 1JZ5A 2JKXA 3I97A 2VZ3A 3VD7A 1W0NA 1SDDB 2V5DA 2W92A 3U37A 2VZOA 5F7UA 2C26A 3C7OA 4LHSA 3OGSA 3C7HA 3IB3A 1JI6A 4GWIA 3T09A 2WUHA 2VMDA 5JXGA 3EYPA 5JXIA 2J22A 3T2OA 2WBKA 3LEIA 4CU9A 2JD9A 3CIHA 4E8CA 5JMOA 5IYYA 3HNYM 3WSOA 3HNMA 5JXJA 4A41A 3I2GA 2W1QA 3PUHA 2WAAA 2X09A 2WO2A 1WCQA 1XPWA 3WF1A 4P08A 3WEZA 4E8DA 2EICA 3IDAA 3MUZ1 5A1AA 3GGLA 3OGRA 5DQ0A 3UESA 4CUAA 4BDVB 4XVHA 1OD3A 1O8PA 2Z4FA 4AG4A 3PUIA 2W1UA 4JX0A 4OUEA 1JU4A 3NQHA 1GNYA 1JYXA 2VZTA 2YFZA 2WABA 1UXZA 1JZ2A 4ET7A 5B4XA 3WNNA 3I2JA 3P6BA 3WNPA 2Y6JA 2BZDA 2Y8KA 2C9KA 4UOJA 1UZ0A 2XONA 4JKMA 2C4XA 2ORXA 3EB7A 1JU3A 2B4KA 1L7QA 4L0PA 1IQDC 4PT6A 4QX0A 2DCKA 3ACGA 2VQTA 2CDPA 1CZTA 1EUTA 2VTFA 2VZSA 4MGQA 4MGSA 3ACFA 3A22A 2BGOA 4XZUG 2VC9A 2W1WA 3ZM8A 5G04L 3JXSA 5LA1A 4DUVA 4ARYA 1XNTA 3CZUA 4PQQA 2W1SA 1W99A 3OBAA 1CZSA 2VZVA 3T2PA 1D7PM 1PMJX 3CDZB 4KI5M 3BGAA 4MO3M 3OG2A 3VDAA 1CIYA 2YFUA 4DUWA 4GWJA 2VCBA 3K46A 2R7EB 3ETPA 1JZ3A 2KD7A 4OMDA 2VZQA 4BJ0A 4W4ZA 4DEQA 3LPFA 1SHWB 2WAOA 3A21A 2Y6HA 5C70A 1PX4A 5DPNA 3IAQA 1TVGA 5B4NA 4JHZA 2J1UA 1W9TA 4HG6B 4A6OA 4IUGA 2RJ2A 2ZXQA 1CZVA 2ORZA 2QQJA 5IHRA 2E33A 3NJXA 4CUBA 3K77A 2YC4A 3MV01 5G05L 2ZEWA 1OH4A 1GOFA 2QQOA 4QPWA 5EJZB 3I2KA 1WKYA 4M4PA 4DXTA 4GZ9A 4BK5A 3K4AA 4MADA 4A45A 2E31A 4QX1A 3UNPA 3VDCA 3MBWA 1W9SA 3WF2A 2X05A 1R64A 4D8MA 3W5MA 3AC0A 2E26A 2WZ8A 1NAEA 2WO1A 3CKHA 2XHNA 4ARXA 1OF3A 1MPXA 2EIDA 4P00B 3HEIA 2OKXA 1KEXA 3HNBM 4XUQA 4LKSA 3A23A 4QX2A 5LA2A 4XUNA 1KGYA 3WQBA 3OB8A 1O59A 1JYWA 2VZ1A 2JE8A 4CVUA 4LQRA 3MUY1 2VOTA 1J84A 2XQXA 4XUTA 1UWWA 4CU6A 1GQPA 2VM9A 2W95A 2VO5A 4P02B 1DYOA 4MOAA 2J1VA 3VD5A 4ZY9A 1W8OA 4W8JA 4CU7A 3WNOA 1GU3A 1W8NA 3WF3A 3WNKA 2B9VA 3UETA 4CUCA 1GUIA 3C7EA 2V4VA 3BN6A 2Y6GA 4RN5A 1LNSA 2VMFA 4BXSV 3ECQA 5EIYB 2ZEYA 2EIEA 3VD3A 5C71A 5IFPA 4OZOA 3LEKA 1JHJA 1EUUA 4UAPA 3SEEA 4DXRA 3GDBA 1UY0A 1OF4A 2Y6KA 2BBAA 3LEGA 4TXWA 3I2IA 3FN9A 2JDAA 2WZEA 1JYNA 2QQMA 1DLCA 4M4RA 2PQSA 1F4AA 5LA0A 3DECA 3K75B 4YPJA 1UY3A 1UY2A 1UYZA 4LPLA 3DYOA 4QB6A 3VD4A 3T2QA 2QQNA 3THDA 4W50A 1ULPA 3FHAA 1GOHA 5EJ1B 4Z2AA 1TG7A 1UYYA 5JR2A 2W5FA 5J1XA 4BK4A 2VCCA 3HPNA 2BGPA 2WN3A 1JZ8A 1UYXA 1H6YA 2ZEZA 5IFTA 2QQKA 1PMHX 1W9WA 2WDBA 1F4HA 3ACIA 4QB2A 2VZPA 4QX3A 4KMQA 1H6XA 3CQOA 1I5PA 5HPOA 2ZEXA 4PF1A 3T08A 3CMGA 3OEAA 2WO3A 2VZUA 1CX1A 2J1SA 4P5YA 3I3EA 3C8XA 2WYSA 4XUPA 3A7QA 2WN2A 2YC2A 3DYPA 3W5NA 3MO4A 1HN1A 2J1TA 4TTGA 4XURA 2VJXA 1GOGA 3C7FA 5JUVA 5LCWL 2W87A 2W3JA 4A44A 2W47A 1NX9A 3C7GA 3GXUA 1XC6A 1JYVA 1JZ6A 2W94A 1DP0A 3I3DA 2J1AA 3WNLA 3FL7A 3HOBA 3WF0A 4DXSA 3VD9A 3P1IA 1L7RA 5DN2A 1UY1A 2J7MA 2VZRA 4FI9A 3DYMA 4JKLA 1PX3A 2LS6A 4QDQA 2RVAA 1US3A 3IIIA 1UY4A 1JZ4A 3K4DA 3IAPA 3MV11 2DCJA 3OGVA 4QB1A 1K45A 2VMEA 2XOMA 5HXMA 3HN3A 5JXHA 4UI9L 2LW8A 2V72A 4RYDA 1ULOA 4DEVA 3THCA 2YG0A 3HJRA 3T0AA 3ACHA 3NRUA 5DMYA 1US2A 2VMCA 2J1EA 1O8SA 1YQ2A 4D0QA 5I0DA 3D3AA 1UMHA 4A42A 2QBXA 4KWUA 2ID4A 3F2ZA 1NUKA 5C7GA 3I2HA 2QQLA 3SKJE 3T0BA 2VQUA 2W46A 4ZZ8A 1T2XA 1K3IA 4OYUA 3K4ZA 1P8JA 2HLEA 2W9XA 4A4AA 2Y64A 1OT5A 1UMIA 1XNAA 5FUIA 2YB7A 3OEBA 2DDUA 2W91A 1UXXX 3WF4A 3CZJA 1JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZK A;  3T0D A;  2CDO A;  3LE0 A;  2VCA A;  1NKG A;  3I3B A;  1BHG A;  3LPG A;  4QDS A;  3I2F A;  1RYY A;  1K12 A;  2E32 A;  2X10 A;  2BER A;  4QDR A;  3SEP A;  2QQI A;  4XUO A;  4AAX A;  3ABZ A;  4ZZ5 A;  4JKK A;  2EIB A;  3LQC A;  3NNG A;  5IJR A;  3GM8 A;  3J7H A;  3FHQ A;  4OMC A;  3SKV A;  2L9L A;  4QAW A;  3WNM A;  3VDB A;  3E1F 1;  2J1R A;  5CYY A;  2VR4 A;  2HYX A;  1K42 A;  1J83 A;  4CU8 A;  4A3Z A;  3NJV A;  1UX7 A;  2WQ8 A;  4ZXE A;  1GMM A;  2VL4 A;  4DUX A;  1SG3 A;  2RV9 A;  2Y6L A;  1JZ5 A;  2JKX A;  3I97 A;  2VZ3 A;  3VD7 A;  1W0N A;  1SDD B;  2V5D A;  2W92 A;  3U37 A;  2VZO A;  5F7U A;  2C26 A;  3C7O A;  4LHS A;  3OGS A;  3C7H A;  3IB3 A;  1JI6 A;  4GWI A;  3T09 A;  2WUH A;  2VMD A;  5JXG A;  3EYP A;  5JXI A;  2J22 A;  3T2O A;  2WBK A;  3LEI A;  4CU9 A;  2JD9 A;  3CIH A;  4E8C A;  5JMO A;  5IYY A;  3HNY M;  3WSO A;  3HNM A;  5JXJ A;  4A41 A;  3I2G A;  2W1Q A;  3PUH A;  2WAA A;  2X09 A;  2WO2 A;  1WCQ A;  1XPW A;  3WF1 A;  4P08 A;  3WEZ A;  4E8D A;  2EIC A;  3IDA A;  3MUZ 1;  5A1A A;  3GGL A;  3OGR A;  5DQ0 A;  3UES A;  4CUA A;  4BDV B;  4XVH A;  1OD3 A;  1O8P A;  2Z4F A;  4AG4 A;  3PUI A;  2W1U A;  4JX0 A;  4OUE A;  1JU4 A;  3NQH A;  1GNY A;  1JYX A;  2VZT A;  2YFZ A;  2WAB A;  1UXZ A;  1JZ2 A;  4ET7 A;  5B4X A;  3WNN A;  3I2J A;  3P6B A;  3WNP A;  2Y6J A;  2BZD A;  2Y8K A;  2C9K A;  4UOJ A;  1UZ0 A;  2XON A;  4JKM A;  2C4X A;  2ORX A;  3EB7 A;  1JU3 A;  2B4K A;  1L7Q A;  4L0P A;  1IQD C;  4PT6 A;  4QX0 A;  2DCK A;  3ACG A;  2VQT A;  2CDP A;  1CZT A;  1EUT A;  2VTF A;  2VZS A;  4MGQ A;  4MGS A;  3ACF A;  3A22 A;  2BGO A;  4XZU G;  2VC9 A;  2W1W A;  3ZM8 A;  5G04 L;  3JXS A;  5LA1 A;  4DUV A;  4ARY A;  1XNT A;  3CZU A;  4PQQ A;  2W1S A;  1W99 A;  3OBA A;  1CZS A;  2VZV A;  3T2P A;  1D7P M;  1PMJ X;  3CDZ B;  4KI5 M;  3BGA A;  4MO3 M;  3OG2 A;  3VDA A;  1CIY A;  2YFU A;  4DUW A;  4GWJ A;  2VCB A;  3K46 A;  2R7E B;  3ETP A;  1JZ3 A;  2KD7 A;  4OMD A;  2VZQ A;  4BJ0 A;  4W4Z A;  4DEQ A;  3LPF A;  1SHW B;  2WAO A;  3A21 A;  2Y6H A;  5C70 A;  1PX4 A;  5DPN A;  3IAQ A;  1TVG A;  5B4N A;  4JHZ A;  2J1U A;  1W9T A;  4HG6 B;  4A6O A;  4IUG A;  2RJ2 A;  2ZXQ A;  1CZV A;  2ORZ A;  2QQJ A;  5IHR A;  2E33 A;  3NJX A;  4CUB A;  3K77 A;  2YC4 A;  3MV0 1;  5G05 L;  2ZEW A;  1OH4 A;  1GOF A;  2QQO A;  4QPW A;  5EJZ B;  3I2K A;  1WKY A;  4M4P A;  4DXT A;  4GZ9 A;  4BK5 A;  3K4A A;  4MAD A;  4A45 A;  2E31 A;  4QX1 A;  3UNP A;  3VDC A;  3MBW A;  1W9S A;  3WF2 A;  2X05 A;  1R64 A;  4D8M A;  3W5M A;  3AC0 A;  2E26 A;  2WZ8 A;  1NAE A;  2WO1 A;  3CKH A;  2XHN A;  4ARX A;  1OF3 A;  1MPX A;  2EID A;  4P00 B;  3HEI A;  2OKX A;  1KEX A;  3HNB M;  4XUQ A;  4LKS A;  3A23 A;  4QX2 A;  5LA2 A;  4XUN A;  1KGY A;  3WQB A;  3OB8 A;  1O59 A;  1JYW A;  2VZ1 A;  2JE8 A;  4CVU A;  4LQR A;  3MUY 1;  2VOT A;  1J84 A;  2XQX A;  4XUT A;  1UWW A;  4CU6 A;  1GQP A;  2VM9 A;  2W95 A;  2VO5 A;  4P02 B;  1DYO A;  4MOA A;  2J1V A;  3VD5 A;  4ZY9 A;  1W8O A;  4W8J A;  4CU7 A;  3WNO A;  1GU3 A;  1W8N A;  3WF3 A;  3WNK A;  2B9V A;  3UET A;  4CUC A;  1GUI A;  3C7E A;  2V4V A;  3BN6 A;  2Y6G A;  4RN5 A;  1LNS A;  2VMF A;  4BXS V;  3ECQ A;  5EIY B;  2ZEY A;  2EIE A;  3VD3 A;  5C71 A;  5IFP A;  4OZO A;  3LEK A;  1JHJ A;  1EUU A;  4UAP A;  3SEE A;  4DXR A;  3GDB A;  1UY0 A;  1OF4 A;  2Y6K A;  2BBA A;  3LEG A;  4TXW A;  3I2I A;  3FN9 A;  2JDA A;  2WZE A;  1JYN A;  2QQM A;  1DLC A;  4M4R A;  2PQS A;  1F4A A;  5LA0 A;  3DEC A;  3K75 B;  4YPJ A;  1UY3 A;  1UY2 A;  1UYZ A;  4LPL A;  3DYO A;  4QB6 A;  3VD4 A;  3T2Q A;  2QQN A;  3THD A;  4W50 A;  1ULP A;  3FHA A;  1GOH A;  5EJ1 B;  4Z2A A;  1TG7 A;  1UYY A;  5JR2 A;  2W5F A;  5J1X A;  4BK4 A;  2VCC A;  3HPN A;  2BGP A;  2WN3 A;  1JZ8 A;  1UYX A;  1H6Y A;  2ZEZ A;  5IFT A;  2QQK A;  1PMH X;  1W9W A;  2WDB A;  1F4H A;  3ACI A;  4QB2 A;  2VZP A;  4QX3 A;  4KMQ A;  1H6X A;  3CQO A;  1I5P A;  5HPO A;  2ZEX A;  4PF1 A;  3T08 A;  3CMG A;  3OEA A;  2WO3 A;  2VZU A;  1CX1 A;  2J1S A;  4P5Y A;  3I3E A;  3C8X A;  2WYS A;  4XUP A;  3A7Q A;  2WN2 A;  2YC2 A;  3DYP A;  3W5N A;  3MO4 A;  1HN1 A;  2J1T A;  4TTG A;  4XUR A;  2VJX A;  1GOG A;  3C7F A;  5JUV A;  5LCW L;  2W87 A;  2W3J A;  4A44 A;  2W47 A;  1NX9 A;  3C7G A;  3GXU A;  1XC6 A;  1JYV A;  1JZ6 A;  2W94 A;  1DP0 A;  3I3D A;  2J1A A;  3WNL A;  3FL7 A;  3HOB A;  3WF0 A;  4DXS A;  3VD9 A;  3P1I A;  1L7R A;  5DN2 A;  1UY1 A;  2J7M A;  2VZR A;  4FI9 A;  3DYM A;  4JKL A;  1PX3 A;  2LS6 A;  4QDQ A;  2RVA A;  1US3 A;  3III A;  1UY4 A;  1JZ4 A;  3K4D A;  3IAP A;  3MV1 1;  2DCJ A;  3OGV A;  4QB1 A;  1K45 A;  2VME A;  2XOM A;  5HXM A;  3HN3 A;  5JXH A;  4UI9 L;  2LW8 A;  2V72 A;  4RYD A;  1ULO A;  4DEV A;  3THC A;  2YG0 A;  3HJR A;  3T0A A;  3ACH A;  3NRU A;  5DMY A;  1US2 A;  2VMC A;  2J1E A;  1O8S A;  1YQ2 A;  4D0Q A;  5I0D A;  3D3A A;  1UMH A;  4A42 A;  2QBX A;  4KWU A;  2ID4 A;  3F2Z A;  1NUK A;  5C7G A;  3I2H A;  2QQL A;  3SKJ E;  3T0B A;  2VQU A;  2W46 A;  4ZZ8 A;  1T2X A;  1K3I A;  4OYU A;  3K4Z A;  1P8J A;  2HLE A;  2W9X A;  4A4A A;  2Y64 A;  1OT5 A;  1UMI A;  1XNA A;  5FUI A;  2YB7 A;  3OEB A;  2DDU A;  2W91 A;  1UXX X;  3WF4 A;  3CZJ A;  1JZ7 A; 
#chains in the Genus database with same CATH topology
 4C0B A;  2OVU A;  1RUD 3;  4IDZ A;  1NKG A;  3WZ1 A;  1VMF A;  4WZF A;  1S0B A;  2IXI A;  5F3E A;  1UN1 A;  2HEW F;  3S30 A;  4I0A A;  2C9A A;  4EQV A;  4OHV A;  4Y24 A;  5F3C A;  5KR7 A;  2E32 A;  2DVB A;  2ARE A;  1R08 2;  2BER A;  1HB2 A;  3HVD A;  5FKC A;  5GKA C;  1NCR A;  3THP A;  4Q4W 3;  2QQI A;  3SEP A;  4AAX A;  3I59 A;  4BQY A;  5HI0 A;  3ZN4 A;  1NCQ C;  2A6V A;  4NHY A;  4XDP A;  1JOD A;  1IOA A;  4AFB A;  1S0D A;  4Y4Y A;  3VZJ A;  3NNG A;  3VLB B;  5CFD A;  3PLQ A;  2DUQ A;  3GM8 A;  2ZHN A;  2VPV A;  3Q8A A;  3UKT A;  4UXA A;  3WY6 A;  1W6O A;  1PO1 1;  1S2K A;  5J98 B;  3VZO A;  3KM5 A;  4QQL A;  2VMH A;  3ZDV A;  1UL9 A;  2LAL A;  5EV7 A;  3N9P A;  5L7O B;  1EYB A;  4QAW A;  4FO9 A;  1CAU A;  1ULF A;  3E1F 1;  3OF1 A;  1IS3 A;  2ZGS A;  4N8M A;  3GYD A;  5E16 A;  3KT7 A;  4CU8 A;  2HWD 2;  3VBH A;  2W0X A;  1W8H A;  1UX7 A;  1A3K A;  5DZE A;  2ZA9 A;  3MW4 A;  2WQ8 A;  1UOF A;  1CN1 A;  1TMF 2;  2UWC A;  4P9L A;  4ZXE A;  5A3L A;  1ASJ 1;  4B3N A;  1UW8 A;  1UZW A;  3GZA A;  2MNG A;  2RV9 A;  1SQ4 A;  3GJB A;  3UV9 A;  5C5U A;  5DZF A;  1Z7S 1;  2ARA A;  2BNO A;  1FT9 A;  4IW3 A;  1JZ5 A;  3LFI A;  1AR9 2;  1G6N A;  1FOD 3;  5F3I A;  4GKY A;  5A6Z A;  1UF2 C;  4ZU7 A;  2QKD A;  3D4K A;  5FO7 B;  3SMH A;  4GMP 0;  5FQ0 B;  2Y0O A;  4LLO A;  3OSD A;  3UKV A;  5GLV A;  5C8C A;  2RR1 2;  4N90 A;  1ENS A;  4BYY A;  1W05 A;  2NN8 A;  4JGY B;  4D7T A;  4Q26 A;  2XWJ B;  4AK3 A;  2BRT A;  2HWF 1;  3KV6 A;  4NR1 A;  3TB0 A;  1VAV A;  3ZXG A;  5C3P A;  4IE7 A;  1PZ9 A;  1REE A;  2C6S A;  3UGG A;  3LEI A;  2AYH A;  3J7L A;  3AMH A;  3JBG 2;  3ZLI A;  1COV 1;  2WNV A;  1W6M B;  2QCS B;  5A33 A;  3WSO A;  4LJH A;  4AI2 A;  2UY9 A;  4QPG C;  1S0E A;  3QH6 A;  1LGC A;  3MFA A;  1Z7S 2;  2WO2 A;  4Q4X 1;  1YYN A;  5FPB A;  1PNF A;  1XPW A;  4P08 A;  1IQA A;  3O5S A;  5FJK A;  2EIC A;  4XE9 A;  3WW3 A;  2B46 X;  4NAM A;  4PI0 A;  3QCW A;  1ZRE A;  2NQY A;  3ZFF A;  3OD4 A;  1W2A X;  2P3Y A;  3ENR A;  1D0G A;  5HCB A;  4XF3 A;  1OH3 A;  4BQ1 A;  1O8P A;  2AC1 A;  5CAD A;  1X9T A;  1I6X A;  2R1B A;  3PJQ A;  3EBR A;  4I0W B;  4NJ4 A;  3EO6 A;  3RPQ A;  2XL9 A;  4COV A;  1FX5 A;  2XXZ A;  1GNY A;  1E5R A;  2HWE 2;  2YFZ A;  2JE7 A;  4AVC A;  4PDW C;  3I59 B;  4XTM A;  4AQS A;  3IKW A;  3S57 A;  3H8U A;  3M1H A;  5HV4 A;  2QTW B;  1X36 A;  2VQ0 A;  3I54 A;  5B4X A;  3TNQ A;  4QMA A;  1W06 A;  2D93 A;  4DB5 A;  4IEP A;  4DXZ A;  3PVN A;  2HWB 1;  3BU7 A;  3GZU C;  5EWS A;  2DCZ A;  4MXW B;  4NIA A;  3D0J A;  1AHS A;  5FDB A;  5CG8 A;  5GZF A;  3MW2 A;  1UZ0 A;  4K8R B;  4JKM A;  4QQH A;  4NAO A;  4BCU A;  2VBP A;  3E6B A;  3WV6 A;  3O1M A;  1GZT A;  5I93 A;  4XF9 A;  1Q8V A;  3LFM A;  3T1L A;  1O4Z A;  3T4H B;  3DKW A;  3S5A A;  3U07 A;  3V56 A;  2FBE A;  2O8O A;  4Y20 B;  4B7K A;  4HSJ A;  2HWC 1;  1WGP A;  1GYK A;  2RR1 1;  2VQT A;  2XDV A;  2XML A;  2YBK A;  3U0Z A;  1TME 1;  2JIG A;  3WQ0 A;  1PIV 2;  2WLP A;  5G04 L;  4AGR A;  2LRO A;  5JR7 B;  1VRH 2;  1YCI A;  1S0I A;  5FYV A;  4XDQ A;  4BWO A;  1U0A A;  3IMN A;  2WNU C;  1MQT A;  3ZSK A;  2E53 A;  2IZW A;  1G8W A;  3PUA A;  4FOQ A;  5E6H A;  4KI5 M;  4JCK A;  3H0O A;  1ND3 B;  1SLT A;  4GWN A;  1LOC A;  3I3M A;  5I0R A;  1ND2 B;  2DVF A;  3ZXA C;  1PNG A;  3F95 A;  4GWJ A;  3NST A;  3ZFF C;  1JZ3 A;  2GSY A;  1SBE A;  1JHN A;  3VHP A;  2B42 B;  3W9A A;  4OMD A;  5KXD A;  1F8V A;  4BJ0 A;  4DEQ A;  1FOD 1;  3B3Q E;  4LUK A;  1SLC A;  3K2O A;  1SHW B;  4FPK A;  1IS6 A;  2HWF 3;  2WAO A;  3RMX A;  4CCN A;  3R6S A;  3A21 A;  4JTO A;  3T4V A;  2Y6H A;  4WVV A;  4CDX C;  3PVB B;  3IAQ A;  5B4N A;  2E7T A;  1DQ4 A;  3GF6 A;  1LGN A;  4DY5 A;  1W9T A;  4Q4Y 1;  1VLN A;  5KHK A;  1V9U 1;  4BHP A;  1XU1 A;  4L8Q A;  3CJI B;  4OVE A;  3V65 A;  5CG9 A;  1CAX B;  1VBE 3;  2RS3 1;  1ZX5 A;  1GP6 A;  2ES3 A;  2PHX A;  2V5Y A;  1RUC 1;  5F9T A;  1GWK A;  2P1B A;  1NZI A;  2ZHK A;  3MLK A;  3NJX A;  5FZO A;  4G3Y C;  1C4R A;  1RHI 1;  1ZZC A;  3K77 A;  3LA3 A;  3MIF A;  4LBQ D;  5A7O A;  2EXK A;  1AF9 A;  1HX6 A;  2YC4 A;  4LOS A;  2Q30 A;  5A3N A;  3NAP C;  4B7E A;  1X82 A;  3OUJ A;  1DDL A;  1XE8 A;  1RUC 2;  3VZL A;  5CA6 A;  5EJZ B;  5KXC A;  1R1Z A;  4LBJ A;  2GH8 A;  1SPP B;  5ACA 1;  3MI8 A;  2D5F A;  3PIJ A;  1HN0 A;  1DFQ A;  5FYH A;  5JOW A;  1KRI A;  4HKL A;  1RUH 3;  2PXJ A;  3UNP A;  1FI2 A;  1PK6 B;  3MBW A;  3RMY A;  3NV3 A;  3WF2 A;  4XTP A;  2XBO 3;  1UX6 A;  1H1I A;  4KWK A;  1XNB A;  2DBN A;  3LIG A;  3VZK A;  2FMY A;  4EWE A;  2V09 A;  2IUW A;  3CKH A;  4NIG A;  4HMZ A;  3DN7 A;  3KS7 A;  1SEF A;  3DXT A;  4NMI A;  1MS5 A;  4O9E A;  4OUS A;  4RHV 2;  5FV3 A;  1GQG A;  1S0C A;  5LZ6 A;  4IV3 B;  1RUF 3;  2A6Y A;  4XBL A;  2SBA A;  4RR3 C;  5FRE A;  1CGP A;  1SFY A;  3AZV A;  4XDO A;  3VL8 A;  1PGL 1;  3HEI A;  2OKX A;  1U5Z A;  4HFS A;  4ATE A;  1KEX A;  3HNB M;  4Y22 A;  1M06 G;  3I8T A;  4RFT 0;  1RUJ 2;  4XQ4 A;  2ZX2 A;  4N9I A;  3AKS A;  4TLG A;  1XBF A;  5A70 A;  2IFR A;  4AF9 A;  3OB8 A;  1O59 A;  1JYW A;  3OOX A;  4GQ7 A;  2PN5 A;  3BU0 A;  1MZ6 A;  4FTB A;  3RRD A;  4LQR A;  1NY7 1;  4CDX A;  1LOD A;  1DQ1 A;  1OBN A;  1RUF 2;  3AX4 A;  2WSV A;  5F6L B;  3VBH C;  2GC0 A;  1PZ8 A;  1LOA A;  4GAL A;  1GQP A;  1Q56 A;  3PVO A;  1H9W A;  2QJV A;  2W95 A;  1GZW B;  4LKE A;  5DXD A;  2VO5 A;  1VE0 A;  1XYN A;  1QOT A;  4AI1 A;  1RUD 2;  5F6K A;  2A1X A;  1W8O A;  3BB6 A;  2NM1 A;  3ELN A;  2XH6 A;  1C5I A;  4LIV A;  1RUO A;  4N7I A;  4N53 B;  3WNK A;  4QXC A;  5SV5 A;  3JBG 1;  5KC5 A;  4PBO A;  1EPW A;  3H3L A;  1XE0 A;  3BN6 A;  4FPL A;  1SCR A;  2VMF A;  3GAL A;  5C8C C;  4F8A A;  3ECQ A;  4LHN A;  1TE1 B;  1WLD A;  3VBS C;  5IFP A;  3VD3 A;  1D4M 3;  1C1F A;  4KU8 A;  4AOC A;  3ZSM A;  1WW5 A;  4R4Z A;  4DXR A;  3VZN A;  3PNA A;  4YZ4 A;  2WFF 1;  5IW0 A;  2CSG A;  4QPI B;  3N9Q A;  1ZBA 3;  1VBC 2;  2XBO 1;  3KF5 A;  4MGY E;  2VUJ A;  3O1U A;  1OF4 A;  2RDS A;  2Y6K A;  2BBA A;  2ZX4 A;  3PME A;  3N7K A;  5F5C A;  4TXW A;  4ES9 A;  3RZJ A;  5IUQ A;  5FXW A;  4UF0 A;  1YFU A;  3LOB A;  1H2M A;  1NLQ A;  1W6M A;  5JI7 A;  1V9U 3;  4Q0V A;  5A33 B;  1F5J A;  4IEX A;  1V6L A;  2D6M A;  1YIF A;  1W3V A;  2JG8 B;  2R30 A;  4L11 A;  5AVP A;  5LY2 A;  3VL9 A;  1QKQ A;  2B9U A;  1CD3 G;  1UYZ A;  4Q0Q A;  4XMI A;  3TN9 3;  3DYO A;  4YAR A;  1DCS A;  4QB6 A;  4NPM A;  2XHK A;  5JZG A;  3T2Q A;  2O14 A;  4KGG A;  2QQN A;  5FZ9 A;  3THD A;  3AVS A;  3VBR B;  4CEW C;  4I2O A;  5FZM A;  4Z2A A;  1JS9 A;  2P34 A;  2ZGK A;  4NHX A;  5GAL A;  1V9U 2;  2OXB A;  2YGM A;  3B01 A;  3ZDS A;  3HPN A;  5FMB A;  3V0A B;  4XJU A;  2QQW A;  1JZ8 A;  1UYX A;  3UT0 A;  1WME A;  1NCR B;  5FZ0 A;  1H2N A;  1W9W A;  3ACI A;  1DGR A;  5D8A C;  3SXW A;  4ASL A;  3JD7 1;  1AVB A;  4LT5 A;  1RJ7 A;  2DF7 A;  4KMQ A;  1N1T A;  1H6X A;  1IPJ A;  3DXU A;  3NNL A;  4OQ9 A;  2WQ4 A;  3U10 A;  2CGP A;  3WOG A;  1YJL A;  1O3T A;  1GZ9 A;  2ETE A;  1PVC 3;  2HEY F;  1W6N A;  2ZEX A;  3CMG A;  5D21 A;  1BJQ A;  2WO3 A;  4Y22 B;  4FFG A;  2JD4 A;  4K21 A;  5FFO C;  2J1S A;  4IXL A;  2IVI B;  3C8X A;  4P5H A;  1XYO A;  2HEV F;  3NKG A;  3M3C A;  4IEV A;  4XFG A;  1V70 A;  1VBA 1;  2WYF A;  5FY5 A;  1W3X A;  3W5N A;  4TTG A;  2PHF A;  4K6B A;  4FPF A;  4Q0S A;  5IAX A;  1D4M 1;  4WM8 C;  5JUV A;  1QJX 1;  4LLF A;  1YI9 A;  2W3J A;  3LEM A;  4AED C;  2W47 A;  5BNP A;  1NX9 A;  1QNY A;  1R1A 2;  3AJY A;  5HBA A;  1FYU A;  2FDF A;  5F8P A;  1J59 A;  1GIC A;  1QJY 2;  4Q4V 1;  3M70 A;  2R1D A;  4QWN A;  1H1M A;  2WS9 2;  1HRI 3;  4W6X A;  3N7L A;  1W6Q A;  5BNN A;  5KC6 A;  2K2S A;  3WF0 A;  4AEK A;  5GLT A;  4DXS A;  2WQZ C;  3ZXE A;  3P1I A;  4KU7 A;  2ZGT A;  3I2O A;  2DTW A;  4ORF A;  3M4F A;  2E7A A;  3VHN A;  1MEC 1;  2VZR A;  5FPV A;  2HWE 3;  1CQ9 A;  4LO5 B;  2LS6 A;  1WD3 A;  1A8D A;  4QU2 A;  4ISQ A;  5DAB A;  2DTY A;  1UY4 A;  1PIV 1;  1OLQ A;  2A71 A;  3IAP A;  1L7L A;  2JEN A;  1QJU 3;  5CFC C;  1DIW A;  3J4U H;  3PHM A;  1K45 A;  1LHO A;  2VME A;  4BXF A;  3SCF A;  3ZOI A;  2HBU A;  3KWV A;  4HL0 A;  4QGM A;  2B8M A;  2HYK A;  1FAT A;  2DWR A;  2ET1 A;  2AEN A;  2JG8 A;  5DAW A;  1VMJ A;  1W9Y A;  3GBF A;  4FPJ A;  1XSR A;  5I8Y A;  3AP7 A;  5D1I A;  1PIV 3;  3Q8F A;  2WL1 A;  4HT1 T;  3Q8E A;  3RNS A;  1VP6 A;  2X5I C;  5BNO C;  2YG0 A;  3NRU A;  3IT8 A;  4P9W A;  5DMY A;  5CKQ A;  2DYC A;  3RZL A;  4GJZ A;  2VMC A;  1VBC 1;  1WD4 A;  1VRB A;  1XJA A;  2XBO 2;  1YQ2 A;  3B5L B;  2H0B A;  4PDW B;  2B45 X;  4ZKT B;  4LUM A;  2OZ6 A;  3U14 A;  1W8F A;  1QJX 3;  1UMH A;  4A42 A;  1XXN A;  1Y9G A;  2DFC A;  2ZX1 A;  4N43 B;  2BNN A;  4IE0 A;  4XXP A;  1NUK A;  1K5M A;  3HR9 A;  3BKZ A;  2KM2 A;  4QXB A;  3N9L A;  4XBQ A;  3NJZ A;  4XMA A;  3ZYI B;  4QGN A;  4Y5Z 0;  2XJT A;  3VBF B;  5EPA A;  3MIC A;  3MIH A;  1DZQ A;  4LK6 A;  1BK0 A;  3BPZ A;  3WX5 A;  1AR6 2;  1HB1 A;  1PK6 A;  4WM7 C;  4ZZ8 A;  2A5Z A;  1ZZ9 A;  3E6D A;  2FDG A;  3WDU A;  1RTV A;  4D7Y A;  4IQP A;  2CAV A;  5BNN C;  4JGY A;  1JW6 A;  1OPM A;  1WCD J;  2GP5 A;  2HLE A;  3N9O A;  2HWE 1;  2Y64 A;  4Y1V A;  3WP6 A;  4CSW A;  1UMI A;  1XNA A;  1VIW B;  1BLZ A;  4XCB A;  2UY8 A;  5JIA A;  5BNQ A;  2YB7 A;  1GBG A;  3AL5 A;  4AI0 A;  1VBA 2;  1WW6 A;  5FZD A;  1N1S A;  3SCH A;  4BIF A;  5IVE A;  4DMI A;  3ALQ A;  3MLJ A;  4D6R A;  3PL0 A;  4B1L A;  4PLO A;  4DRR A;  3V0B A;  3VKO A;  2WS9 3;  1JZ7 A;  1QDO A;  5CZK A;  3T0D A;  2CDO A;  1YFY A;  2UWB A;  3JD7 2;  2VCA A;  2ENR A;  3K3O A;  3LE0 A;  5DG1 A;  1LUL A;  1J3R A;  1MR5 A;  1KXG A;  2VAU A;  1J58 A;  4QDS A;  1VBD 1;  3I2F A;  5LBE A;  1FNY A;  1UPI A;  4MGI E;  2QQP A;  1MQT B;  1O91 A;  3TRS B;  2P5B A;  1GZW A;  5GZG A;  2VE1 A;  3SH5 A;  1RUC 3;  4D69 A;  3AL6 A;  2Y34 A;  1RUH 2;  3J7H A;  1NA1 B;  4LBL A;  5F5I A;  1PO2 2;  2H6C A;  5FYU A;  3MEP A;  3O0X A;  3WG3 A;  2BYV E;  4KBZ A;  4XJZ A;  3OGG A;  4FTS A;  3KCY A;  3ZFE A;  1B35 C;  3T2T A;  2Z79 A;  2R16 A;  3HQR A;  4E4S A;  4HON A;  3WNM A;  1PGS A;  4D6S A;  3O1V A;  1TNF A;  1AR9 3;  5IK8 A;  2VR4 A;  4E27 A;  2YXS A;  1D2Q A;  3AP4 A;  1ASJ 3;  1K42 A;  3QOP A;  5F39 A;  4A3Z A;  3NJV A;  4GMP 1;  2JWP A;  3WQ7 A;  1PZ7 A;  2TEP A;  3KB5 A;  1ENX A;  2E7Q A;  4PIX A;  5DDJ 3;  3NL1 A;  2VL4 A;  4DUX A;  1BQP A;  3CJI A;  4TSV A;  1UU4 A;  2D3S A;  1MS0 A;  3AJZ A;  2RM2 3;  4IV1 A;  4JAA A;  4JRL A;  5L19 A;  1CPN A;  2P17 A;  3Q8B A;  3HMY A;  1N1V A;  3H3U A;  2AAC A;  4G9S B;  3USU B;  5B2G B;  1F31 A;  2PYT A;  1UYP A;  2XJR A;  4HN1 A;  1R09 1;  4MHU A;  3VD7 A;  2R04 1;  2V5D A;  1X33 A;  3DKQ A;  5CAZ A;  1U12 A;  4V1P A;  1HRV 3;  3MGU A;  4BQ5 A;  5LRS A;  4IE5 A;  4S2F A;  4BM8 A;  5E8A A;  4Z82 A;  5F7U A;  2C26 A;  1ZBA 1;  1H8T C;  3C7O A;  1Q8P A;  4C91 A;  1WA4 A;  4YZ1 A;  3AZX A;  3IB3 A;  1TQ5 A;  1JI6 A;  4GWI A;  4NPL A;  3EXU A;  3JCI A;  3MPB A;  2VMD A;  3E97 A;  5JXG A;  5FZH A;  1IGO A;  1ST8 A;  5L9R A;  3EYP A;  5JXI A;  2LTN A;  1UZZ A;  2J22 A;  3DCQ A;  4JDM A;  3NO8 A;  2WBK A;  3J7M A;  5ISL A;  2JD9 A;  2V73 A;  5FZ3 A;  1BCX A;  1ND2 A;  4EZH A;  4XJA A;  4XFF A;  2Y26 A;  1URX A;  1VB2 A;  4E4Z A;  1MVQ A;  4L2N A;  4Q4X 3;  4X8N A;  1HJF A;  4YW5 A;  4Z1V A;  2JEC A;  3I2G A;  5A3T A;  5C6C A;  3BI3 A;  2D6P A;  3C3V A;  1OI6 A;  1TNR A;  1RUJ 1;  1XOY A;  4LE3 A;  5FMO S;  1WCQ A;  1W90 A;  1AXK A;  1ZYB A;  2OPW A;  1OHF A;  1QJF A;  4UFK A;  3WEZ A;  3WUD A;  3ZMO A;  4E8D A;  4TLF A;  5C9A C;  1R1A 3;  2YC0 A;  3GGL A;  3NW4 A;  1UMZ A;  2JE9 A;  4UW4 A;  1C57 A;  1O4T A;  3DEM A;  2XLA A;  5FYM A;  3UES A;  2GZW A;  2C5D A;  2AR6 A;  4RHV 1;  5CIS A;  5A80 A;  4Q4X 2;  2Z4F A;  5F5A A;  4R9B A;  2XQR A;  5FYS A;  1AYN 2;  1W0O A;  4I02 A;  4OUE A;  4MGZ E;  3INA A;  4ES8 A;  4R9C A;  3HQU A;  4WM8 A;  1N1Y A;  3RFR A;  1UIK A;  2D3P A;  4JV4 A;  2BOI A;  1E5H A;  4PI2 A;  4Y26 A;  2VVE A;  4YZ5 A;  1PO2 3;  5F1R A;  3AYD A;  4BQW A;  4JGZ B;  4FCA A;  5BNP B;  4LMF A;  4P9G A;  5AVA A;  4KG8 A;  3AYE A;  4RFR B;  5CKM A;  2G9F A;  3OPW A;  3POE A;  2Q8C A;  3URF A;  2Y6J A;  2A3W A;  4D3W A;  2ZJC A;  1J1L A;  3AP6 A;  2I74 A;  4HLT A;  4LTA A;  2IXK A;  5FLJ A;  1PVC 1;  1S2E A;  2HKX A;  2HWD 3;  2ORX A;  3ZFE B;  5DUU A;  2DV9 A;  1V6M A;  4KH9 A;  3H3Z A;  2B4K A;  2D6O X;  3WDT A;  4TZD A;  3EHK A;  1POQ A;  3ZSJ A;  4PT6 A;  5FP4 A;  1UIJ A;  5ABJ C;  1BVP 1;  2DCK A;  5FRA A;  5A7P A;  5FMD A;  5EYY A;  3VDD B;  1RUG 1;  3KGZ A;  5A1F A;  3O12 A;  2VZS A;  1AZD A;  1NLR A;  2ZKL A;  5FXZ A;  1SBD A;  3W58 A;  2MPF A;  3WCR A;  2VW1 A;  3A22 A;  5JLV A;  5CFC A;  1BBT 3;  2W1W A;  5A3M A;  2R6Q A;  3VZM A;  4HKW A;  3H7J A;  3CEW A;  2Q1Z B;  1A8M A;  4ARY A;  2R0F A;  3THT A;  1ULG A;  1JMU B;  1OVP A;  4DOU A;  2JDU A;  3DPR A;  5JCT A;  1HQW A;  1W99 A;  3OBA A;  2WT1 A;  1SLB A;  2XKO A;  1FNZ A;  2AUY A;  2VZV A;  2YUE A;  3N7M A;  1PMJ X;  3CDZ B;  4MO3 M;  2X5I A;  3ZN6 A;  2VUA A;  3VDA A;  5BNO A;  1OVS A;  5GZC A;  1RMU 2;  4A6S A;  4F83 A;  4P9J A;  4D7S A;  3GBW A;  1H30 A;  1JXN A;  3ZXD A;  4PHZ A;  4CPB D;  4H7M A;  4I0B A;  1VBE 2;  1QJY 3;  1OQE A;  2BW8 A;  2RS5 1;  3ES1 A;  3WUC A;  3FLR A;  2ZPX A;  3M3O A;  5BUV A;  1HRI 2;  1PO2 1;  3L2Y A;  4CDQ C;  4OI0 A;  1KS5 A;  4P9X A;  3PUS A;  1K5M C;  2O0O A;  4LO6 B;  3ZXK A;  4K9S A;  1AYN 1;  5FZI A;  4DRV A;  5DPN A;  5FKB A;  1TVG A;  3OPZ A;  5FZ8 A;  2VNR A;  4JHZ A;  3U75 A;  4B29 A;  4YGE A;  1V0A A;  1C1L A;  4FFF A;  5KHI A;  4WVZ A;  1AR6 1;  2ZXQ A;  2VOV A;  4LBM A;  2RS1 2;  1LRH A;  4JGY C;  4KBB A;  3AYC A;  4IEY A;  1VBD 2;  4PBP A;  5DUX A;  3NJY A;  3USS A;  4AQ2 A;  3U11 A;  5AC9 1;  3MPP G;  4YSF A;  4RGG A;  1YO8 A;  5IHR A;  2FCV A;  5CNA A;  1CR7 A;  4QPI A;  2VNO A;  5IAV A;  3ATG A;  1KJR A;  5IVY A;  4CCD A;  2O8Q A;  5IVF A;  3MV0 1;  5G05 L;  1KDK A;  3CF6 E;  3HWJ A;  1OH4 A;  1QH7 A;  5FLH A;  1LCL A;  4UFH A;  5J09 A;  1UOG A;  3KV4 A;  5LEJ A;  4MH0 E;  3BOW A;  2FMD A;  1O7F A;  2PLV 2;  2D98 A;  4DXT A;  5FO9 B;  3K4A A;  5DUW A;  5EQU A;  4P9Y A;  3VDC A;  3TBD A;  4BH9 A;  1HKD A;  2HJI A;  2X29 A;  1R64 A;  5FZ1 A;  5IK5 A;  3AC0 A;  1CAW A;  1V00 A;  3ZVX A;  4XXA A;  2WZ8 A;  4XHX A;  3MIG A;  1CPM A;  4E9K A;  4JRA A;  1FV2 A;  2BU9 A;  2XHN A;  4ARX A;  4X6R B;  1RC6 A;  4UW3 A;  1XB9 A;  3POJ A;  1I9R A;  4TWT A;  4UFL A;  1H2L A;  5IVJ A;  1C8M 1;  2DBI A;  2DU0 A;  4QX2 A;  5LA2 A;  1J1T A;  4CP9 A;  4XBN A;  3TEZ A;  4YW2 A;  3WQB A;  3E6C C;  3HBZ A;  4NPR A;  4RGK A;  2CU5 A;  4FQ4 A;  4CVU A;  2ZGP A;  1J84 A;  2UYA A;  1GP5 A;  2ZAH A;  3KCX A;  4H2A A;  1UWW A;  4CU6 A;  4M3C B;  2O1Q A;  5FUN A;  4C1W A;  5FZG A;  4F7Z A;  3X29 B;  1N3O A;  4YM2 A;  5JWP A;  3MLL A;  1EAH 2;  2WWS A;  1IHM A;  2A6X A;  1CIW A;  1YXW A;  4P02 B;  5T54 A;  2WR9 A;  5LBF A;  3FBY A;  4I09 A;  3E5X A;  2ERF A;  2RE9 A;  4RQP A;  4W8J A;  1GV9 A;  4FP2 A;  5FYI A;  1IZ3 A;  2HBT A;  1GU3 A;  1W8N A;  3HIF A;  5F2S A;  2JG9 A;  3WW1 A;  2P4E A;  4AXO A;  4CUC A;  1RUI 2;  2YMZ A;  1R08 3;  2QZ2 A;  4M0N A;  1DF0 A;  2V4A A;  2PMW B;  4RN5 A;  3AKQ A;  4PDW A;  2VY0 A;  3AKP A;  4HET A;  2ZEY A;  2EIE A;  4K1Y A;  5C71 A;  3FUO A;  4XYX A;  2C24 A;  4UAP A;  3AMM A;  1HQN A;  3ZKU A;  4K20 A;  2ZCW A;  2ZGO A;  3JZV A;  4NWV A;  5DAP A;  5GZE A;  4ZHN A;  1VBD 3;  2GN7 A;  3S0M A;  4FOW A;  3JU9 A;  4Q1P A;  5FPX A;  1LOG A;  1RUI 3;  4FQZ A;  1G86 A;  1ND2 C;  3H1M A;  1B09 A;  2WS9 1;  2QDR A;  3I2I A;  3LA7 A;  2YPD A;  3FN9 A;  3LEG A;  3R4S A;  4IE6 A;  1Y4W A;  4UW6 A;  2QFE A;  2XG3 A;  5JSO A;  2QQM A;  4M4R A;  2VUL A;  1MZE A;  2PQS A;  5T5J A;  5FYY A;  3K75 B;  2ZAB A;  4AHY A;  4NHL A;  5HCF A;  2XVG A;  4NRQ A;  3T30 A;  5C9A A;  1OLM A;  1Y9M A;  3L2H A;  4YVS B;  2P2K A;  2Q8D A;  3WW4 A;  5J3U A;  3CJX A;  1OLR A;  3ZFG B;  2N7G A;  2XL7 A;  3B00 A;  3KQ4 B;  1ULP A;  4CDX B;  1LTE A;  4E2Q A;  5C4W C;  2WNU A;  3DGT A;  1MQT C;  4NRM A;  5JSP A;  1DGL A;  3NNF A;  3V0B B;  1JUI A;  3R4U A;  1BMV 2;  1TG7 A;  1RXG A;  1UYY A;  5JR2 A;  2G1M A;  5J1X A;  1NZC A;  2CHH A;  2R49 A;  3WQ1 A;  5JMC A;  3H8X A;  3KGL A;  3BTX A;  1JYC A;  2XLF A;  2VCC A;  4AHW A;  2W08 A;  1LOF A;  1Y3T A;  2WN3 A;  4AWD A;  2ET7 A;  1Q43 A;  5EFU A;  2P6H A;  2QQK A;  4MX3 A;  5C3R A;  4BMB A;  3UYJ A;  2Y60 A;  3AXD A;  4IGP A;  3O7O A;  2A70 A;  3D8C A;  2GC2 A;  3CQO A;  4HBN A;  3ZYJ B;  2IC1 A;  2JG9 C;  3EMR A;  1YI7 A;  5A7Q A;  4Y5S A;  4XEZ A;  4HVO A;  2VZU A;  4FPO B;  4PF5 A;  3TEX A;  3ZR6 A;  1C8M 2;  1ZRF A;  1CX1 A;  1OOP C;  3ASI A;  1AX1 A;  1GAN A;  1RXF A;  1VJ2 A;  2WYS A;  3I3E A;  4GH4 A;  3A7Q A;  5LEK A;  3BUC A;  2WN2 A;  2WZR 2;  3OY8 B;  4WBB A;  4M3C E;  4XET A;  3MO4 A;  2JDK A;  4TN7 A;  1HN1 A;  1EAH 3;  4CCM A;  4NVP A;  3L9J T;  3GBG A;  1QWR A;  2VJX A;  4XUR A;  1W0P A;  3JUU A;  4OUL A;  1O3Q A;  2EXJ A;  2WFP A;  5C8W A;  4ASK A;  1QNW A;  2EAL A;  4H14 A;  4LHL A;  5K8S A;  3GZT B;  5LCW L;  2PQQ A;  5KWR A;  2GME A;  2B39 A;  2ZGN A;  4XFB A;  1OD5 A;  1C8M 3;  2XKP A;  2WC2 A;  4AGV A;  2RG4 A;  1RUD 1;  4IND A;  5CU1 A;  3RI8 A;  3K48 A;  4J1X A;  3VHO A;  1PGL 2;  5FP8 A;  1JYV A;  2SLI A;  2WZP P;  1JZ6 A;  3AFK A;  1DP0 A;  3I3D A;  1D4M 2;  4ISR A;  2PA7 A;  1SFP A;  3NAP A;  4URT A;  4ZS2 A;  2J1A A;  2YZ4 A;  4Q4V 3;  3LDK A;  5K7P A;  2DU1 A;  2WA3 A;  5JVV A;  3WP5 A;  1EV1 2;  1L7R A;  1VBC 3;  5F32 A;  1AL2 2;  3ZKY A;  4MLO A;  3V0A A;  4HK9 A;  1R09 3;  4QDQ A;  4OUM A;  3POB A;  4GA9 A;  5FTT C;  1US3 A;  1UKG A;  4AL9 A;  3III A;  3UL2 A;  2VD7 A;  3N9M A;  4CE8 A;  3K4D A;  2DCJ A;  1V6K A;  2YDE A;  4CDQ A;  5FQ0 A;  1GP4 A;  1BXH A;  2OT7 A;  2PAM A;  2WLQ A;  5FY9 A;  1XYP A;  2G4I A;  4YG3 A;  3S7E A;  1D4V B;  1IPK A;  5JXH A;  2XJU A;  2WKK A;  1IG0 A;  2LW8 A;  2D5H A;  4YWA A;  4YW1 A;  4CP2 A;  1APN A;  1F9K A;  4JZR A;  4RYD A;  1SCS A;  5F3G A;  3THC A;  1W8U A;  5L7O C;  4ZON A;  2PLV 3;  1V6O A;  4AFC A;  1ZZ7 A;  1NQJ A;  5L73 A;  2PHW A;  3HJR A;  3ACH A;  3J26 N;  3OBT A;  2GAL A;  4QPI C;  1BMV 1;  2JB4 A;  2WNO A;  3H42 B;  4UFI A;  4ATF A;  5FP9 A;  1W2U A;  5J48 A;  2TBV A;  1YFX A;  1QDC A;  3D82 A;  5DG2 A;  4CEY A;  4QX5 A;  3TOJ A;  2QBX A;  3LDR A;  4GJY A;  2ID4 A;  2C0Z A;  3OD0 A;  4YM3 A;  2PTM A;  5H9S A;  1BBT 1;  2RDN A;  3AP5 A;  1OXC A;  4U36 A;  1W6Q B;  5FOJ B;  1WCS A;  2P3I A;  5BYN A;  1WMX A;  2VQA A;  2ZZQ A;  3T0B A;  1QQP 1;  2DUO A;  4KL1 A;  5J7M A;  2RJL A;  4O61 A;  2VXJ A;  2W46 A;  3BAL A;  1T2X A;  1UQX A;  4YNI A;  2JX9 A;  4CDU C;  1K3I A;  4OYU A;  3VBR C;  3APB A;  3B94 A;  5FY7 A;  2PHD A;  3NV2 A;  4CEW B;  1W6P B;  1QJY 1;  5ABJ B;  2GNT A;  3LAG A;  1D2S A;  2PEL A;  2JDM A;  1YIP A;  3HT1 A;  3CBN A;  5KXB A;  4CCO A;  3OEB A;  2Y6F A;  4AI9 A;  2DDU A;  4SLI A;  1UOB A;  1NCR C;  4LBN A;  1X9P A;  2HWB 2;  3WF4 A;  5HCH A;  2JDN A;  3CZJ A;  3H1W A;  4HK8 A;  3KV5 A;  2QQU A;  1AL0 G;  2CGN A;  3LGR A;  1NCQ A;  4IER A;  4CA9 A;  4ZS3 A;  4JC1 A;  4AI3 A;  4B4P A;  4BQX A;  4YW7 A;  1NXD 1;  1BHG A;  3LPG A;  3OBR A;  4Q0U A;  1SLA A;  2XGX A;  4C90 A;  2XJQ A;  1AL2 3;  3O14 A;  4QDR A;  3FFQ A;  3KMH A;  5FZA A;  4CCK A;  1OQD A;  3ABZ A;  4ZZ5 A;  4AR2 A;  4FPG A;  1V6N A;  4RQP C;  2EIB A;  5IJR A;  1H9P A;  1G9C A;  3TEY A;  2GMP A;  5FZK A;  1AJK A;  4M0H A;  4OMC A;  4WM8 B;  5CBL A;  1K5M B;  4LK7 A;  2BWC A;  2JXA A;  4CCJ A;  3VHR A;  1CWP A;  4AQ6 A;  1ZA4 A;  5C3S A;  5ERL A;  2ZGR A;  5JSR A;  1FPN 1;  4FPC A;  2A3Y A;  3UJQ A;  4GXL A;  5SV8 A;  3PU3 A;  2BPA 2;  4CEY C;  2VGD A;  1ZBE 1;  2J1R A;  5CYY A;  5CFD B;  1PM7 A;  2WFF 3;  3VDD C;  2HYX A;  2R06 2;  1YQ5 A;  5FZB A;  2Q4S A;  2W39 A;  2WIN B;  4MZU A;  4YGB A;  1ZZ6 A;  3ZYH A;  3CNA A;  4F3J A;  1EAH 1;  3DL3 A;  4IV1 C;  4YW6 A;  2F4P A;  1SMV A;  3PUQ A;  1W8W A;  2F4L A;  2GMM A;  4QM9 A;  4GKX A;  4C1X A;  4TYS A;  1QJX 2;  1HRV 1;  1QEX A;  2VZ3 A;  1BEV 3;  3I97 A;  2CYF A;  3LF7 A;  4Z8B A;  1ZRD A;  1VBB 3;  4ASM B;  1SDD B;  1HXS 1;  2W92 A;  3U37 A;  3ETQ A;  4HVR A;  1JOB A;  4Y1Y A;  3MF9 A;  2CY6 A;  4K8F A;  1LB2 A;  5FXV A;  4XPV A;  2WNV C;  1JTZ X;  1PM4 A;  1GSL A;  4LHS A;  5GZD A;  3IDC B;  3ILN A;  3OGS A;  3ZSE A;  2YHJ A;  2BP6 A;  1VAK A;  3C7H A;  2WO7 A;  2ZHM A;  3ORJ A;  4FPE A;  4MSV A;  1W04 A;  4QPG A;  5T5O A;  3T09 A;  1PGW 2;  3ZIW A;  3TAY A;  1AL2 1;  5FZO B;  5A6X A;  4HKO A;  3ES4 A;  1LOF C;  1XNK A;  3NMB A;  1AR7 1;  2R06 1;  4GIQ A;  5C8C B;  1OUS A;  4XHB A;  1SZB A;  4HVQ A;  2ZKN A;  3CIH A;  4E8C A;  5JMO A;  1ODN A;  5IYY A;  1CAW B;  1IS5 A;  1O4Y A;  3HNY M;  3POI A;  4CDW B;  4YYO A;  5EP9 A;  4A41 A;  4LUL A;  5JOX A;  1EPZ A;  1UZV A;  2RS3 3;  2JEM A;  1SPP A;  5F2W A;  4CCE A;  5E89 A;  4XF1 A;  2WAA A;  3Q9O A;  4JQR A;  3KSC A;  4A3X A;  4BIO A;  2GND A;  2X09 A;  4XZP A;  2A75 A;  1H4G A;  1OKO A;  1DGR N;  1COV 2;  1T6B X;  3IDA A;  3MUZ 1;  1QQP 3;  3RDI A;  1ULD A;  1UKR A;  1OOP A;  1VBE 1;  4CP9 B;  1AYM 3;  4GH4 B;  5FXX A;  4CUA A;  4BDV B;  4ERO A;  2JIC A;  4NUB A;  4XVH A;  3RYP A;  1OD3 A;  2DVD A;  1YRZ A;  2EXH A;  3OY8 A;  1F15 A;  3ZFG C;  4J6G A;  1MS4 A;  5ACA 3;  3ZYR A;  3MID A;  2GDF A;  4M01 A;  3TN9 2;  1JU4 A;  2Z5W A;  5HCA A;  3NQH A;  1LEM A;  4U2A A;  2ZMK A;  5FO8 B;  3AB0 A;  4M3C A;  2VZT A;  3VN4 A;  2RHP A;  2Y0I A;  1WBL A;  4H7L A;  1O3S A;  1GNH A;  1UXZ A;  3N4M A;  2D6K A;  1MZ5 A;  4ET7 A;  1QOO A;  1W8Z A;  4NII A;  5A32 B;  3RYK A;  4BQ3 A;  4ZU5 A;  1IS4 A;  3UGF A;  1OKQ A;  3WNP A;  5LWB A;  2C9K A;  4UOJ A;  5JOY A;  2ZGU A;  4V2W A;  3ILF A;  3IM0 A;  1UNB A;  3ZYB A;  3NWK A;  2P3J A;  4CUG A;  4NWW A;  4Q29 A;  1I1E A;  3BCW A;  1AR8 2;  5DDJ 2;  2P3K A;  3D5O A;  3A4U A;  3GJA A;  1XU2 A;  4D94 A;  4AZZ A;  4ITC A;  4L0P A;  1ACC A;  4WM7 A;  1QY4 A;  4N43 A;  4EJR A;  5KHJ A;  4EE2 A;  3RJR A;  5JI9 A;  1AR7 3;  3U4S A;  2CDP A;  1CZT A;  3RI9 A;  4MGS A;  3O1S A;  1PVC 2;  1LES A;  3AZW A;  4FAG A;  4AEM A;  4COZ A;  1BEV 2;  1OA4 A;  3QH7 A;  4BA6 A;  2VC9 A;  5L36 A;  2FZ1 A;  1RMU 3;  1UCX A;  2ZTN A;  4KWJ A;  3ZM8 A;  1U5I A;  5LA1 A;  4NIH A;  2G19 A;  1RUE 3;  5CKN A;  5FMO L;  4XAC A;  2GU9 A;  5I8T A;  2WZR 3;  2VH9 A;  1D0H A;  2CTV A;  1DG6 A;  3NV4 A;  4RR3 B;  3CZU A;  2FHR A;  2NZ9 A;  5K4L A;  4WZC A;  2RDQ A;  1TME 2;  2AZ5 A;  3VGI A;  3H8R A;  4K1Z A;  2W1S A;  3OGJ A;  2QNK A;  2FDJ A;  2I07 B;  1S55 A;  4YVW A;  2OYZ A;  5C3O A;  3T2P A;  1D7P M;  3BGA A;  3IDB B;  3SH4 A;  1MVE A;  4M3C F;  4DZG A;  4QX8 A;  1DGW A;  1UPS A;  2VCB A;  5FAX A;  3WDV A;  4QPY A;  2BV4 A;  2R7E B;  3LSE A;  2JDP A;  2ZGL A;  3ETP A;  1Z0H A;  4S2G A;  4I01 A;  3ON7 A;  4QPG B;  2KD7 A;  5T52 A;  5E88 A;  2GC3 A;  2XJP A;  5T50 A;  3ZFG A;  5K9Y A;  3M3E A;  2D6L X;  4QXK A;  2VZQ A;  4QKB A;  4W4Z A;  3BIW E;  2I45 A;  4LKD A;  1QGL A;  2PHU A;  3NV1 A;  1U5X A;  4EN9 B;  5FWE A;  1A78 A;  1U5Y A;  3WLU A;  1IG3 A;  4B4R A;  5K0U A;  1PX4 A;  4BLI A;  2JG9 B;  5JPN B;  2DVA A;  2R07 2;  3SIS A;  2HWB 3;  3BTA A;  5EYX A;  2OQ7 A;  3MW3 A;  5T5L A;  1W2N A;  4AVS A;  1AYM 2;  4H55 A;  4A6O A;  2VMG A;  5FZE A;  4IUG A;  2BJS A;  2ARC A;  2RJ2 A;  5FPU A;  1CZV A;  2FCT A;  3MZH A;  2R32 A;  3W20 A;  1RVF 1;  2QQJ A;  3VBO A;  1FMD 2;  3AK0 A;  2RMU 1;  1FV3 A;  1W8T A;  3RG0 A;  2E33 A;  3BOD A;  4LO4 B;  3H50 A;  1KQR A;  4CUB A;  1VB4 A;  5LAT A;  1UU5 A;  2NMO A;  3KVB A;  3OYW B;  4PIY A;  4RA0 A;  3W59 A;  2E6V A;  5A7W A;  2RS1 1;  2ZEW A;  4FAH A;  1DU3 D;  1JH5 A;  2A3X A;  3WG2 A;  4PQ9 A;  2QQO A;  4OQ8 A;  4QPW A;  1OA2 A;  1S4C A;  3FUQ A;  1YEW A;  3I2K A;  4LBK A;  4Y33 A;  3WDW A;  3ZPY A;  1WKY A;  4YM0 A;  2ZHL A;  1HRI 1;  4NN0 A;  1FMD 3;  2R0H A;  2WT0 A;  4A45 A;  4AHZ A;  4BU2 A;  4QX1 A;  5C9A B;  4QHO A;  4CCL A;  1DHK B;  2NMN A;  2K0G A;  5E1R A;  4XF0 A;  1MZF A;  1A34 A;  5KHH A;  4NOT A;  2OII A;  4D8M A;  3W5M A;  1XE7 A;  4B8E A;  3USU A;  4QX7 A;  3ZYP A;  5CEH A;  1NQD A;  4CXW A;  3POS A;  3LB9 A;  1MPX A;  1LHN A;  4LOT A;  1UAI A;  1BBT 2;  2CNA A;  3HN1 A;  3U78 A;  4QGL A;  1QIQ A;  1F2N A;  4LR4 A;  1TMF 3;  4XUQ A;  4LKS A;  3A23 A;  3KF3 A;  5H9R A;  2XJV A;  4XUN A;  2C1F A;  4PJY A;  1AR9 1;  3GHN A;  1KGY A;  3IBM A;  5L9B A;  4C8D A;  2VZ1 A;  4DO0 A;  1GLH A;  2R04 2;  3IPV B;  3NNJ A;  2JE8 A;  4FFH A;  5JPM B;  4EN7 B;  2FDH A;  2CGO A;  4QKD A;  4X6Q B;  3B9I A;  2VOT A;  5K0U C;  1ODM A;  1ZM1 A;  3FHI B;  4N53 A;  2RJK A;  2DCY A;  4RR3 A;  1VBA 3;  5IK7 A;  2OZJ A;  4UYB A;  1QU0 A;  4UFM A;  5T5P A;  4YGC A;  3I4I A;  4DY3 A;  1RUE 1;  5DAQ A;  1UZY A;  3KD4 A;  4Y1X A;  2P6C A;  4QU1 A;  1G7Y A;  3OJB A;  3M3Q A;  2CWS A;  1Q5O A;  2VCM A;  1NG0 A;  5GLZ A;  5T55 A;  3VD5 A;  5FY8 A;  3VBU B;  4RS5 C;  2W2I A;  4XQW A;  2YU1 A;  3WNO A;  2ZX3 A;  4Y20 A;  4LBQ B;  4DFS A;  4CU7 A;  2VEC A;  1E5I A;  2VVF A;  3OUH A;  1OUR A;  4XJW A;  2Q8E A;  3UET A;  3FFZ A;  3MIE A;  1PO1 2;  1GUI A;  3QBQ A;  4DIN B;  2EA7 A;  1STM A;  2PAE A;  3GHM A;  5EIY B;  1JYI A;  2MEV 1;  2ZS6 B;  2JJ6 A;  4DPN A;  3S7I A;  2YV8 A;  4OZO A;  4Q4W 1;  3LEK A;  4QHB A;  1JHJ A;  1EUU A;  1LHW A;  1Y43 B;  1LU2 A;  2VTX A;  1AX2 A;  3SEE A;  2Q8O A;  4XF4 A;  4WVW A;  1RGS A;  3LSD A;  1WZX A;  4KGQ A;  4EYU A;  4MG2 A;  1X8E A;  2PHT A;  1CAV A;  3AP9 A;  3WDY A;  3WCS A;  4FSJ A;  3LD8 A;  1ND3 A;  3R0R A;  4LA2 A;  1B35 B;  3SCG A;  4DS0 A;  2JDA A;  1JYN A;  4CEW A;  1GFF 2;  5TSW A;  1OFS A;  3G7D A;  4N9H A;  4FBF A;  1WLW A;  1L3J A;  2WFF 2;  5ABJ A;  1F4A A;  2RMU 2;  4FXK B;  2XVL A;  3I49 A;  2PHR A;  4YPJ A;  1UY3 A;  3AYA A;  2AH2 A;  2YGL A;  5FUP A;  4AE2 A;  4JDO A;  4LPL A;  1WCK A;  1HXS 3;  2Q0A A;  2HWD 1;  4A2U A;  4W50 A;  1DQ6 A;  3VV1 A;  3OBZ A;  2IWG B;  3FE5 A;  3FHA A;  3DPR C;  3GCW A;  5EJ1 B;  5J37 A;  4YM1 A;  4UBH A;  5C3Q A;  2EXI A;  4LIT A;  5BPX A;  1LOB A;  4AI8 A;  4BK4 A;  2BVV A;  1DZR A;  2BGP A;  2OA2 A;  3B9C A;  1CAX A;  2IVJ A;  1HRV 2;  1NE6 A;  1SFN A;  4FPH A;  2YY1 A;  1HB4 A;  3H1Y A;  1O6U A;  1FMD 1;  2XVK A;  3IZO A;  1ALY A;  1H6Y A;  1HXS 2;  2ZEZ A;  3B93 A;  4FP3 A;  3HT2 A;  1QXP A;  1PMH X;  3AKT A;  4FFI A;  1F4H A;  4QB2 A;  2GH2 A;  2XPJ A;  1DQ2 A;  1X7N A;  1YNA A;  2VXR A;  4QX3 A;  3S6P A;  1NYW A;  1HIX A;  5I0T A;  4OI2 A;  1POV 0;  4QKN A;  5FLI A;  2EAK A;  2JDZ A;  3QD6 A;  3FBM A;  3C2U A;  3RZH A;  3HBK A;  5A3W A;  3VKF C;  1I5P A;  1KIT A;  4CEY B;  3WHU A;  5HPO A;  3BVC A;  4PF1 A;  4AEJ A;  3T08 A;  2ZAA A;  1ZBE 2;  4N7U A;  3OEA A;  1C8N A;  4Z07 A;  2ZZJ A;  4YW4 A;  5FYB A;  3S5Q A;  3HD8 B;  4P5Y A;  4FXG B;  4I3P A;  3NKT A;  1M4W A;  1O5U A;  1JOP A;  2DCT A;  3FC0 A;  2YC2 A;  4ONU A;  1Y7B A;  2A73 B;  3DYP A;  5M0T A;  2WII B;  4HXC A;  5FYC A;  5C33 A;  4WM7 B;  3A0K A;  2RS5 3;  4MXV A;  4RD7 A;  2H6B A;  1W6P A;  2HWC 2;  4LA3 A;  1X8M A;  4XAA A;  5BNN B;  4XIL A;  4BLJ A;  4BPZ A;  4YFZ A;  3WXP A;  1ND3 C;  1ZBE 3;  3JQW A;  1X50 A;  2W87 A;  4A44 A;  1YLL A;  3VBS B;  1R09 2;  4COW A;  3C7G A;  3GCX A;  3P3P A;  3N9N A;  4G4F A;  1XC6 A;  5LBC A;  5AFE A;  5IWF A;  2CL2 A;  4H3W A;  1W9F A;  2W94 A;  2DUR A;  3CLP A;  1LKN A;  4IET A;  5ACA 2;  2WNV B;  3M8L A;  3WNL A;  1O5L A;  3HOB A;  3EQE A;  1IKQ A;  2FQP A;  1AR8 1;  4AFA A;  3VD9 A;  2HWF 2;  4R4X A;  3AXE A;  4JGZ C;  1UY1 A;  4I3G A;  3KLS A;  4FI9 A;  4BQ4 A;  2CV6 A;  3ZXF A;  1XQN A;  2AEY A;  1PX3 A;  2EVX A;  1RMU 1;  4E4D X;  2PFW A;  3FLP A;  5I8S A;  2JG8 C;  1LGB A;  1W2T A;  1N3P A;  3MV1 1;  4CYD A;  4QB1 A;  1KD7 A;  3LCP A;  2KXL A;  3LWC A;  1AR8 3;  3WR0 A;  5LBB A;  2XOM A;  1C5H A;  2WT2 A;  4JDN A;  1S0J A;  1RL3 A;  3CO2 A;  4XAE A;  2MEV 3;  3KVA A;  1FAY A;  4UI9 L;  4BME A;  2V72 A;  1UU6 A;  3ZR5 A;  4DEV A;  3J7N A;  2VW0 A;  3U4X A;  4E2S A;  2ADE A;  1OFN A;  1RUG 2;  3VBO C;  2G9Z A;  3T0A A;  3UK9 A;  1C28 A;  1RUE 2;  1Q8S A;  1BKZ A;  1US2 A;  1WW4 A;  4CXY A;  4ZU4 A;  3TN9 1;  1VMH A;  2VUC A;  5A3P A;  3RZG A;  1O8S A;  2VVD A;  1ZZ8 A;  1PK6 C;  4PIZ A;  2P37 A;  5LK5 A;  3OYW A;  4WV8 A;  2LM3 A;  4AQT A;  5ANQ A;  5FP7 A;  2NP0 A;  2WRA A;  3ZYF A;  4KNC A;  4HOO A;  5H9P A;  2Y33 A;  4O9G A;  3J8F 1;  3F2Z A;  3WHT A;  1LEN A;  4OZX A;  5DZG A;  4EZ4 A;  5C7G A;  2E63 A;  3I2H A;  4YRD A;  1OUX A;  1WWY A;  5H9Q A;  3PDQ A;  4JVA A;  1LJ7 A;  2RR1 3;  1WUV A;  3RWN A;  3FZ3 A;  3AVR A;  1SDW A;  4DQA A;  3H9A A;  5C4W B;  1PVX A;  4O65 A;  1RUJ 3;  1LAJ A;  1LOE A;  4UBG A;  4XIO A;  5GM0 A;  1HW5 A;  1XRU A;  3OTF A;  4OLL A;  4A4A A;  2NYY A;  5IK4 A;  3KT4 A;  2BVB A;  1OT5 A;  4JGZ A;  2UWA A;  4MUV A;  1Q8O A;  4YGD A;  5FZ4 A;  5FUI A;  1SBF A;  2QZ3 A;  3OUI A;  4XCA A;  4D6Q A;  1G9A A;  5C5T A;  3K3N A;  3LA2 A;  3P3N A;  3POW A;  2W91 A;  2R07 3;  3P5B A;  1O3R A;  4XIK A;  4OI4 A;  2RS1 3;  3IN9 A;  4JHT A;  1QHD A;  2VBB A;  2Q1M A;  2KA3 A;  2VTX J;  1UO9 A;  2KR2 A;  3I3B A;  1ZVF A;  5IVC A;  3SHR A;  5FZ7 A;  4IEU A;  1RIR A;  2FCU A;  4N53 C;  1RYY A;  1K12 A;  2X10 A;  2YRO A;  4MVT A;  4FPY A;  4XFH A;  3WG4 A;  1HQL A;  1NOV A;  5APA A;  3JQX A;  4XUO A;  4YVW B;  5FK7 A;  4NRO A;  1K5J A;  4BQ2 A;  1QF3 A;  3B69 A;  5J96 B;  2FZ2 A;  4HZF A;  1BEV 1;  1JYT A;  4JKK A;  4RS5 A;  3LQC A;  2ARB A;  1KJL A;  2NPI A;  4AFM A;  1FPN 3;  3FHQ A;  1ZRI A;  1XND A;  4YW3 A;  1NLS A;  2WNU B;  3JB4 C;  1ZBA 2;  5IT6 A;  1I5Z A;  5EJ3 A;  4L92 A;  2DVG A;  2GP3 A;  5FY4 A;  2Z69 A;  4QQO A;  4XFA A;  2W68 A;  3J8F 3;  1YWK A;  3SKV A;  1R1A 1;  3RQ0 A;  4BIS A;  2L9L A;  4Q8K A;  2RMU 3;  5CVR A;  3VDB A;  2XUM A;  4GB3 1;  2D6N A;  2X5I B;  3ZN6 B;  2VOX A;  4NHM A;  4QM8 A;  1VBB 2;  2BNM A;  5EZW A;  4OHZ A;  2IXJ A;  1J83 A;  4R9D A;  1RJ8 A;  4DNY A;  2ZGQ A;  4UFJ A;  3ZFF B;  2GNM A;  3O1O A;  2OX0 A;  1FPN 2;  1CAV B;  4OHY A;  4RGA A;  4URA A;  1GMM A;  2A6W A;  1AUY A;  1QOS A;  1KDM A;  2YU2 A;  4RSU A;  3PVE A;  1B35 A;  5FJH A;  3ZFE C;  1SG3 A;  1H8T A;  2UUR A;  2Y6L A;  3UJO A;  4E2G A;  1BK1 A;  1ZNP A;  2JKX A;  1DBN A;  1LHV A;  4GWM A;  4AVA A;  1KS4 A;  3J9S A;  1WMF A;  1EP0 A;  4LIU A;  1V6J A;  4M00 A;  1QH6 A;  3I2D A;  4WVM A;  1W0N A;  4XJ9 A;  1AX0 A;  1Q8Q A;  1PMI A;  1WLT A;  2R07 1;  3CU7 A;  5KHG A;  4P14 A;  4GMP 3;  4ZPI A;  4MET A;  2XWB B;  2VZO A;  1HB3 A;  3AKR A;  1S0F A;  2UYB A;  3CJI C;  2TUN A;  3I7D A;  4IGO A;  1CVN A;  4EN6 B;  4MXW A;  3NNM A;  5D8A B;  5LW9 A;  5J36 A;  2GAU A;  2WUH A;  4XJ8 A;  2E9Q A;  4EWA A;  4AFD A;  1OPO A;  2G9G A;  1COV 3;  3ME2 A;  1H2K A;  3T2O A;  4UW5 A;  1N3Q A;  4CU9 A;  2K9Z A;  5GJ6 A;  3RVH A;  1YJK A;  3NAP B;  3HNM A;  4FT8 A;  3A0N A;  4KQ7 A;  4CRQ A;  5A6Y A;  5JXJ A;  1KFU L;  1YUD A;  3AZZ A;  3BPS A;  3QAC A;  4LBO A;  5A6Q A;  4GD4 A;  2W1Q A;  1S2B A;  3PUH A;  5FY1 A;  3WP4 A;  3LIH A;  1ULC A;  3M2M A;  3POF A;  3MYX A;  1MS9 A;  1WA6 X;  5FPZ A;  4Y5T A;  1XNC A;  4QXH A;  4R52 A;  4YZ2 A;  3SQO A;  1VAM A;  3WF1 A;  3ZN5 A;  1LR5 A;  4Y4R A;  1VR3 A;  2BTV C;  2OQ6 A;  3PU8 A;  4GUL A;  5A1A A;  2VMI A;  3U1X A;  3DF0 A;  3OGR A;  5DQ0 A;  3M7A A;  3KHB A;  3ZSL A;  4W6W A;  2JIJ A;  5K0U B;  3O1T A;  3MDP A;  4AED B;  5BV6 A;  1XSQ A;  5F37 A;  5I0S A;  3RZK A;  1BYH A;  5LK7 B;  5LRR A;  5JAX A;  4AG4 A;  1QJZ A;  4CDU B;  4EWD A;  4IV3 C;  1RB8 G;  3QLQ A;  3PUI A;  2W1U A;  1ENR A;  4JX0 A;  4IGQ A;  4GB3 2;  3LDB A;  3VBU C;  1JYX A;  5A3O A;  4FOV A;  4Z2W A;  2LRP A;  2WAB A;  3OCP A;  4LO7 A;  2YBP A;  4JTN A;  1JZ2 A;  3POY A;  3VBS A;  3WNN A;  2UU8 A;  3VKL A;  3I2J A;  1Z78 A;  3P6B A;  3TYJ A;  3KCC A;  2BZD A;  3O0V A;  2Y8K A;  3VDD A;  4AVB A;  3VBH B;  5A3U A;  2FD8 A;  4FTE A;  1DZT A;  2R06 3;  2XON A;  4B1M A;  1QJU 2;  4QKF A;  2C4X A;  3EB7 A;  5CFC B;  1JU3 A;  1LED A;  4IEQ A;  2BEO A;  4MGT A;  3GZE A;  4MV2 A;  1W2O A;  5FYZ A;  4S2H A;  5IVB A;  2TNF A;  3WT3 A;  1LU1 A;  1L7Q A;  1TME 3;  1IQD C;  1MEC 2;  3KZ4 C;  4QX0 A;  2VNV A;  3ACG A;  4K7J A;  3VBR A;  3H7Y A;  4OCT A;  1EUT A;  2VTF A;  2YPJ A;  2VOW A;  4MGQ A;  2Z42 A;  3ACF A;  3KQR A;  1CES A;  3SLI A;  2BGO A;  3ILR A;  4XZU G;  5GLU A;  2IFW A;  4Q27 A;  3JXS A;  5BNO B;  5JZG C;  1H8T B;  3H8O A;  4DUV A;  5JIU A;  3ZXJ A;  4KG0 A;  3N7J A;  4NE9 A;  2WJS A;  1XNT A;  3AMQ A;  3AM2 A;  4W6Y A;  4AVT A;  1HV0 A;  4PQQ A;  4CP0 A;  3BYW A;  2WZR 1;  5IAT A;  2BQP A;  1POV 3;  1CZS A;  5AFB A;  2AGS A;  4OFG A;  3IWZ A;  5LAS A;  3IPV A;  3OG2 A;  1HDK A;  1CIY A;  3WW2 A;  1LHU A;  2YFU A;  1ENQ A;  2PAK A;  3SNM A;  2AEZ A;  4Q1R A;  1YHF A;  4DUW A;  3MFC A;  3K46 A;  4XAB A;  1VRH 3;  1QJU 1;  3SH3 A;  4YG0 A;  3OPT A;  5D8A A;  4L9B A;  5LY1 A;  1W6O B;  1NCQ B;  2BUK A;  3POG A;  3IIA A;  1AR6 3;  5DUV A;  1QXJ A;  4GAZ A;  1HJG A;  2F6B A;  4Q4V 2;  4LXL A;  3LPF A;  5FPL A;  3V64 A;  3PMS A;  1YQ8 A;  2VOK A;  3PUR A;  1MAC A;  4YVS A;  4NHK A;  4HAN A;  1EV1 3;  1SAC A;  3T3Y A;  4Z92 B;  4MHR A;  5C70 A;  2D3R A;  3ZPO A;  3AMP A;  2HH9 A;  2WSU A;  3DUI A;  1Q3E A;  2J1U A;  4HPK A;  4BE3 A;  5AC9 2;  4HG6 B;  1DYK A;  1QJE A;  1RHI 2;  3RZZ A;  1GWL A;  4CPB A;  1E57 A;  3HQX A;  3ZIX A;  1F5F A;  1PHM A;  3ST7 A;  3ACL A;  4QQ2 A;  4Y1U A;  2OPK A;  2ORZ A;  3WD5 A;  4J1W A;  1ZRC A;  1C3H A;  1VAL A;  1WW7 A;  3JD7 3;  2QQV A;  1NE4 A;  4LHK A;  5T3N A;  1WLC A;  4AED A;  5BNP C;  3FWE A;  2MEV 2;  4AAP A;  1H1A A;  1S1A A;  2OS2 A;  2ZAC A;  4OI1 A;  4CP1 A;  1WMD A;  2ZGM A;  4BZ4 A;  5KXE A;  3JB8 A;  1GOF A;  4LEJ A;  5EHD A;  1CON A;  2XLG A;  2RDR A;  4V2V A;  1H0B A;  2OW4 A;  3ZX7 A;  4M4P A;  4AYU A;  2BFU L;  3AFG A;  4XFC A;  4KWL A;  3MHZ A;  3LOI A;  4GZ9 A;  4BK5 A;  4MAD A;  4Y3O A;  4B4Q A;  3KT1 A;  2E31 A;  1EY2 A;  3RWK X;  1W9S A;  4Q8L A;  5FY0 A;  1E5S A;  2X05 A;  3TEW A;  4QHZ A;  5FIX A;  5FMC A;  3FMG A;  3N36 A;  5FBZ A;  3PTR B;  1AXZ A;  2E26 A;  2Q1F A;  2ZBJ A;  1GWM A;  4LKF A;  1NAE A;  2WO1 A;  3ZXL A;  4AW7 A;  1UD1 A;  4SBV A;  1G9F A;  1AR7 2;  1RIN A;  1KFX L;  4LOR A;  1J3P A;  1OF3 A;  2BGC A;  5JOZ A;  1ASJ 2;  3BTY A;  2EID A;  5BY5 A;  4C0H A;  3GNE A;  4P00 B;  3IMM A;  2X8K A;  2D43 A;  1JBC A;  4O7X A;  1H8V A;  3WG1 A;  1OC1 A;  2A7A A;  1DQ0 A;  3WNX A;  4NID A;  3LZZ A;  4HN0 A;  2JDH A;  3RJ2 X;  1PO1 3;  3MUY 1;  1DGW X;  1FOD 2;  2XQX A;  3ZO0 B;  4XUT A;  1G9B A;  2ILM A;  3E5Q A;  3VBO B;  2PLV 1;  3VB9 A;  3MF6 A;  3TWI A;  2VM9 A;  4IEO A;  5FP3 A;  4CXX A;  1T6G C;  2QVS B;  3TNP B;  1PGW 1;  2CWM A;  1DYO A;  4MOA A;  2J1V A;  1BVV A;  5FWJ A;  4ZY9 A;  2WWU A;  1NY7 2;  4Q2F A;  1AYM 1;  3PTY A;  3R05 A;  1OQ1 A;  1MS8 A;  3HAG A;  5A7W B;  5EXO A;  1POV 1;  5F5Q A;  5FCC A;  2XJS A;  3WF3 A;  2B9V A;  3C7E A;  1ONA A;  3Q8C A;  3B7M A;  2FDI A;  2V4V A;  3CL1 A;  4I30 A;  5LA9 A;  2Y6G A;  2K46 A;  1LNS A;  4BXS V;  1FXZ A;  1EV1 1;  2J42 A;  2Z2S B;  1CAU B;  1VBB 1;  2VU9 A;  4RQP B;  4AGG A;  2XR4 A;  4QD2 A;  5FOB B;  4IL7 A;  2D40 A;  3RGB A;  1BZW A;  4RL7 A;  3GDB A;  5FK8 A;  3O0W A;  4HPK B;  1UY0 A;  2W52 A;  2GC1 A;  4L99 A;  5ANN A;  5JDB A;  5A32 A;  1QMJ A;  2CAU A;  2BWA A;  2WZE A;  5GLW A;  5C4W A;  4ZXK A;  3ZYG A;  1YC6 1;  1DLC A;  1IKP A;  2EF6 A;  4AVV A;  3J8F 2;  3K51 A;  4N43 C;  2OUH A;  4XOG A;  4EV0 A;  2LUW A;  1CJD A;  1SLL A;  4GB3 3;  3DEC A;  4LE4 A;  5LA0 A;  3RZM A;  4XW3 A;  1UY2 A;  3VBF C;  4CTE A;  5A1L A;  1AYN 3;  5A7S A;  3WVJ A;  1LEC A;  4IV1 B;  1GR3 A;  2VBD A;  3KHC A;  1AXY A;  1OSG A;  2Q5T A;  4UT5 A;  1GNZ A;  1ZZB A;  1AJO A;  4EN0 A;  5FZF A;  3VD4 A;  5DAV A;  2ZML A;  1N47 A;  2ATF A;  2EIG A;  2I2S A;  4CZS A;  1GOH A;  3FX3 A;  3D0S A;  2W5F A;  4IEZ A;  4YVW C;  4OHW A;  4IV3 A;  5L9V A;  2OUJ A;  5DDJ 1;  3VBU A;  4A7Z A;  5FYT A;  2ZMN A;  3SIT A;  4K3U A;  4LBQ A;  1S0G A;  1H4H A;  5IFT A;  1CJP A;  1MEC 3;  2WDB A;  2VZP A;  2PHL A;  4IEW A;  5FBJ A;  4COY A;  1JN2 P;  1Y9Q A;  4EN8 B;  1W39 A;  3MIB A;  1SLI A;  2QUO A;  2R04 3;  3B02 A;  4Y1Z A;  2QE3 A;  2JKB A;  4PLM A;  3W21 A;  1OLM E;  3E5U A;  4UWD A;  3ZMN A;  1QXR A;  2RM2 1;  3R4D B;  4HSL A;  4A7Y A;  2BDR A;  4XUP A;  1YFW A;  4P9I A;  3I3Q A;  2RS3 2;  4DIQ A;  3BOP A;  1RIT A;  4QQP A;  1JUH A;  1ZRR A;  4X8P A;  2J1T A;  4NRP A;  1IPS A;  3CHX A;  5FZC A;  1RUH 1;  1GOG A;  1NA1 C;  4E4H A;  1Z7S 3;  3FLT A;  1QQP 2;  3C7F A;  1VPH A;  4CDW A;  1W03 A;  2WWJ A;  1OMI A;  2YBS A;  4GH4 C;  3BTZ A;  1HLC A;  3N3H A;  1GQH A;  3GXU A;  3WDX A;  2FDK A;  4COU A;  2YYO A;  1G9D A;  3LKJ A;  1V6I A;  1RED A;  3FJS A;  4XC9 A;  4MYE A;  5FZ6 A;  3D6E A;  5A7N A;  3VUO A;  3O1P A;  3FL7 A;  3VBF A;  4IES A;  1MS3 A;  4JQT A;  1TMF 1;  4CDQ B;  5IVV A;  2B5H A;  3VKN A;  3DV8 A;  5DN2 A;  3N35 A;  4LO8 A;  4Q4Y 2;  2ZX0 A;  2J7M A;  2D44 A;  4S2D A;  2GNB A;  3T1M A;  1TZO A;  2BOJ A;  2GN3 A;  3AZY A;  3DYM A;  1RHI 3;  4JKL A;  4Q4W 2;  3O1R A;  2RVA A;  3PJY A;  3EJK A;  1NT0 A;  2F17 A;  2BFU S;  1ULE A;  4AHX A;  1JZ4 A;  2JDY A;  4Q5O A;  5KBF A;  4QT6 A;  1RUG 3;  3OGV A;  5I91 A;  5L7O A;  3BIE A;  2QDN A;  4YVS C;  2B7Y A;  4RS5 B;  3AMN A;  1R08 1;  5LB6 A;  1HV1 A;  4OHX A;  3RYR A;  2DUP A;  3NVC A;  5HXM A;  4Q4Y 3;  3HN3 A;  1RUI 1;  1DQ5 A;  2D97 A;  4YG6 A;  1DYP A;  3WP3 A;  2VNG A;  4PLN A;  1ULO A;  1YQC A;  2ADD A;  1A6C A;  4Q0P A;  4XQD A;  1RUN A;  5CIR A;  5CFD C;  1REF A;  4PCR A;  2WNE A;  3RS6 A;  3RSJ A;  4YZ3 A;  2DFB A;  2J1E A;  2XB6 C;  3SC7 X;  2IXL A;  3M3I A;  3PIG A;  4XFI A;  1VRH 1;  1NXM A;  1DLL A;  1GZC A;  2WA4 A;  4D0Q A;  5I0D A;  1RVF 3;  1TEI A;  1W28 A;  2RM2 2;  2JB8 A;  4MGK E;  3D3A A;  4CDU A;  5HV0 A;  2D7F A;  4BB3 A;  1GKB A;  4A7K A;  1NA1 A;  4R8H A;  4KWU A;  4IE4 A;  5D2A A;  1JOJ A;  1W6N B;  1CX4 A;  3G6J B;  4FVV A;  4RHV 3;  1WBF A;  2ARX A;  2IXC A;  1OOP B;  4K40 A;  3WIN E;  4CDW C;  2E51 A;  4WVM B;  2X53 S;  2ZOE B;  3ITQ A;  4J25 A;  4YFW A;  2QQL A;  1YQ6 A;  3SKJ E;  1J3Q A;  4NO4 A;  4L97 A;  2EAA A;  5DAX A;  3UGH A;  2VQU A;  3KV9 A;  2BBV A;  2Y38 A;  5BXX A;  1F35 A;  5FZL A;  1RVF 2;  1UOJ A;  1ZA7 A;  2VUD A;  3K4Z A;  4UF0 B;  1P8J A;  3DPR B;  3VKM A;  2W9X A;  1RUF 1;  4FOY A;  4W65 A;  2RS5 2;  4R9A A;  2VW2 A;  4YLZ A;  3UKN A;  2HWC 3;  4LNV A;  1I3H A;  2MHF A;  5AC9 3;  5HXV A;  5FPA A;  4BOW A;  3JBG 3;  1WCU A;  5I0U A;  2XUE A;  1OA3 A;  4CCC A;  5FR3 A;  2A6Z A;  1MS1 A;  5JZG B;  3ROU A;  1UXX X;  5CB7 A;  2IXH A;  3IDE A;  2NLR A;  2VG9 A;  2H0V A; 
#chains in the Genus database with same CATH homology
 5CZK A;  3T0D A;  2CDO A;  3LE0 A;  2VCA A;  1NKG A;  3I3B A;  1BHG A;  3LPG A;  4QDS A;  3I2F A;  1RYY A;  1K12 A;  2E32 A;  2X10 A;  2BER A;  4QDR A;  3SEP A;  2QQI A;  4XUO A;  4AAX A;  3ABZ A;  4ZZ5 A;  4JKK A;  2EIB A;  3LQC A;  3NNG A;  5IJR A;  3GM8 A;  3J7H A;  3FHQ A;  4OMC A;  3SKV A;  2L9L A;  4QAW A;  3WNM A;  3VDB A;  3E1F 1;  2J1R A;  5CYY A;  2VR4 A;  2HYX A;  1K42 A;  1J83 A;  4CU8 A;  4A3Z A;  3NJV A;  1UX7 A;  2WQ8 A;  4ZXE A;  1GMM A;  2VL4 A;  4DUX A;  1SG3 A;  2RV9 A;  2Y6L A;  1JZ5 A;  2JKX A;  3I97 A;  2VZ3 A;  3VD7 A;  1W0N A;  1SDD B;  2V5D A;  2W92 A;  3U37 A;  2VZO A;  5F7U A;  2C26 A;  3C7O A;  4LHS A;  3OGS A;  3C7H A;  3IB3 A;  1JI6 A;  4GWI A;  3T09 A;  2WUH A;  2VMD A;  5JXG A;  3EYP A;  5JXI A;  2J22 A;  3T2O A;  2WBK A;  3LEI A;  4CU9 A;  2JD9 A;  3CIH A;  4E8C A;  5JMO A;  5IYY A;  3HNY M;  3WSO A;  3HNM A;  5JXJ A;  4A41 A;  3I2G A;  2W1Q A;  3PUH A;  2WAA A;  2X09 A;  2WO2 A;  1WCQ A;  1XPW A;  3WF1 A;  4P08 A;  3WEZ A;  4E8D A;  2EIC A;  3IDA A;  3MUZ 1;  5A1A A;  3GGL A;  3OGR A;  5DQ0 A;  3UES A;  4CUA A;  4BDV B;  4XVH A;  1OD3 A;  1O8P A;  2Z4F A;  4AG4 A;  3PUI A;  2W1U A;  4JX0 A;  4OUE A;  1JU4 A;  3NQH A;  1GNY A;  1JYX A;  2VZT A;  2YFZ A;  2WAB A;  1UXZ A;  1JZ2 A;  4ET7 A;  5B4X A;  3WNN A;  3I2J A;  3P6B A;  3WNP A;  2Y6J A;  2BZD A;  2Y8K A;  2C9K A;  4UOJ A;  1UZ0 A;  2XON A;  4JKM A;  2C4X A;  2ORX A;  3EB7 A;  1JU3 A;  2B4K A;  1L7Q A;  4L0P A;  1IQD C;  4PT6 A;  4QX0 A;  2DCK A;  3ACG A;  2VQT A;  2CDP A;  1CZT A;  1EUT A;  2VTF A;  2VZS A;  4MGQ A;  4MGS A;  3ACF A;  3A22 A;  2BGO A;  4XZU G;  2VC9 A;  2W1W A;  3ZM8 A;  5G04 L;  3JXS A;  5LA1 A;  4DUV A;  4ARY A;  1XNT A;  3CZU A;  4PQQ A;  2W1S A;  1W99 A;  3OBA A;  1CZS A;  2VZV A;  3T2P A;  1D7P M;  1PMJ X;  3CDZ B;  4KI5 M;  3BGA A;  4MO3 M;  3OG2 A;  3VDA A;  1CIY A;  2YFU A;  4DUW A;  4GWJ A;  2VCB A;  3K46 A;  2R7E B;  3ETP A;  1JZ3 A;  2KD7 A;  4OMD A;  2VZQ A;  4BJ0 A;  4W4Z A;  4DEQ A;  3LPF A;  1SHW B;  2WAO A;  3A21 A;  2Y6H A;  5C70 A;  1PX4 A;  5DPN A;  3IAQ A;  1TVG A;  5B4N A;  4JHZ A;  2J1U A;  1W9T A;  4HG6 B;  4A6O A;  4IUG A;  2RJ2 A;  2ZXQ A;  1CZV A;  2ORZ A;  2QQJ A;  5IHR A;  2E33 A;  3NJX A;  4CUB A;  3K77 A;  2YC4 A;  3MV0 1;  5G05 L;  2ZEW A;  1OH4 A;  1GOF A;  2QQO A;  4QPW A;  5EJZ B;  3I2K A;  1WKY A;  4M4P A;  4DXT A;  4GZ9 A;  4BK5 A;  3K4A A;  4MAD A;  4A45 A;  2E31 A;  4QX1 A;  3UNP A;  3VDC A;  3MBW A;  1W9S A;  3WF2 A;  2X05 A;  1R64 A;  4D8M A;  3W5M A;  3AC0 A;  2E26 A;  2WZ8 A;  1NAE A;  2WO1 A;  3CKH A;  2XHN A;  4ARX A;  1OF3 A;  1MPX A;  2EID A;  4P00 B;  3HEI A;  2OKX A;  1KEX A;  3HNB M;  4XUQ A;  4LKS A;  3A23 A;  4QX2 A;  5LA2 A;  4XUN A;  1KGY A;  3WQB A;  3OB8 A;  1O59 A;  1JYW A;  2VZ1 A;  2JE8 A;  4CVU A;  4LQR A;  3MUY 1;  2VOT A;  1J84 A;  2XQX A;  4XUT A;  1UWW A;  4CU6 A;  1GQP A;  2VM9 A;  2W95 A;  2VO5 A;  4P02 B;  1DYO A;  4MOA A;  2J1V A;  3VD5 A;  4ZY9 A;  1W8O A;  4W8J A;  4CU7 A;  3WNO A;  1GU3 A;  1W8N A;  3WF3 A;  3WNK A;  2B9V A;  3UET A;  4CUC A;  1GUI A;  3C7E A;  2V4V A;  3BN6 A;  2Y6G A;  4RN5 A;  1LNS A;  2VMF A;  4BXS V;  3ECQ A;  5EIY B;  2ZEY A;  2EIE A;  3VD3 A;  5C71 A;  5IFP A;  4OZO A;  3LEK A;  1JHJ A;  1EUU A;  4UAP A;  3SEE A;  4DXR A;  3GDB A;  1UY0 A;  1OF4 A;  2Y6K A;  2BBA A;  3LEG A;  4TXW A;  3I2I A;  3FN9 A;  2JDA A;  2WZE A;  1JYN A;  2QQM A;  1DLC A;  4M4R A;  2PQS A;  1F4A A;  5LA0 A;  3DEC A;  3K75 B;  4YPJ A;  1UY3 A;  1UY2 A;  1UYZ A;  4LPL A;  3DYO A;  4QB6 A;  3VD4 A;  3T2Q A;  2QQN A;  3THD A;  4W50 A;  1ULP A;  3FHA A;  1GOH A;  5EJ1 B;  4Z2A A;  1TG7 A;  1UYY A;  5JR2 A;  2W5F A;  5J1X A;  4BK4 A;  2VCC A;  3HPN A;  2BGP A;  2WN3 A;  1JZ8 A;  1UYX A;  1H6Y A;  2ZEZ A;  5IFT A;  2QQK A;  1PMH X;  1W9W A;  2WDB A;  1F4H A;  3ACI A;  4QB2 A;  2VZP A;  4QX3 A;  4KMQ A;  1H6X A;  3CQO A;  1I5P A;  5HPO A;  2ZEX A;  4PF1 A;  3T08 A;  3CMG A;  3OEA A;  2WO3 A;  2VZU A;  1CX1 A;  2J1S A;  4P5Y A;  3I3E A;  3C8X A;  2WYS A;  4XUP A;  3A7Q A;  2WN2 A;  2YC2 A;  3DYP A;  3W5N A;  3MO4 A;  1HN1 A;  2J1T A;  4TTG A;  4XUR A;  2VJX A;  1GOG A;  3C7F A;  5JUV A;  5LCW L;  2W87 A;  2W3J A;  4A44 A;  2W47 A;  1NX9 A;  3C7G A;  3GXU A;  1XC6 A;  1JYV A;  1JZ6 A;  2W94 A;  1DP0 A;  3I3D A;  2J1A A;  3WNL A;  3FL7 A;  3HOB A;  3WF0 A;  4DXS A;  3VD9 A;  3P1I A;  1L7R A;  5DN2 A;  1UY1 A;  2J7M A;  2VZR A;  4FI9 A;  3DYM A;  4JKL A;  1PX3 A;  2LS6 A;  4QDQ A;  2RVA A;  1US3 A;  3III A;  1UY4 A;  1JZ4 A;  3K4D A;  3IAP A;  3MV1 1;  2DCJ A;  3OGV A;  4QB1 A;  1K45 A;  2VME A;  2XOM A;  5HXM A;  3HN3 A;  5JXH A;  4UI9 L;  2LW8 A;  2V72 A;  4RYD A;  1ULO A;  4DEV A;  3THC A;  2YG0 A;  3HJR A;  3T0A A;  3ACH A;  3NRU A;  5DMY A;  1US2 A;  2VMC A;  2J1E A;  1O8S A;  1YQ2 A;  4D0Q A;  5I0D A;  3D3A A;  1UMH A;  4A42 A;  2QBX A;  4KWU A;  2ID4 A;  3F2Z A;  1NUK A;  5C7G A;  3I2H A;  2QQL A;  3SKJ E;  3T0B A;  2VQU A;  2W46 A;  4ZZ8 A;  1T2X A;  1K3I A;  4OYU A;  3K4Z A;  1P8J A;  2HLE A;  2W9X A;  4A4A A;  2Y64 A;  1OT5 A;  1UMI A;  1XNA A;  5FUI A;  2YB7 A;  3OEB A;  2DDU A;  2W91 A;  1UXX X;  3WF4 A;  3CZJ A;  1JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...