1XQ4A

Crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein apaG
publication title Crystal Structure of the Putative ApaA Protein from Bordetella pertussis, Northeast Structural Genomics Target BeR40
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 23
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1xq4A00
1XQ4A 1XVSA 1TZAA 5HDWA 2F1EA
chains in the Genus database with same CATH superfamily
1A3LL 1J9SA 2YEVB 3SPGA 3IGKA 1G6RA 1NBCA 4FTVD 25C8L 3L4VA 1R3IL 4K71B 1UEMA 3AREA 3QORD 4E9QA 1TQWA 4I9XA 3QUKA 5BV7H 1EHAA 5E2JA 3MCG1 2X1PA 2Z31D 1HILB 2YQGA 4AIOA 2L7UA 3VFWA 2CD0A 5IMOA 2FEDC 2X05A 2WJ5A 3V0FA 4C4BA 5L6YH 3HG1D 3IJSB 2WUBH 2EEXA 4DWHA 2W9DH 3CSYB 1QAWA 3HLKA 1GTFA 4NBXB 2BSTA 3C9NA 4G1MB 3Q44A 5L2KD 3SKMB 4B27A 4X9IA 1UENA 1WAPA 1RIUL 1ZVSA 2E75C 4GKOA 4WI0B 5TH2A 1QFWH 3SPVB 5D7LE 5HGHA 1N10A 2YRBA 3B2VL 4ZOBA 2Y7NA 3GMMA 4AV4A 4GY4A 4MXQC 2FHBA 2C1PB 5C0AB 3I6SA 3MRHB 3VXMB 3QEGH 1JPGB 5I15H 1KTDB 1QNZH 1DBBH 1KZYA 1TDQA 4FZ8L 4PV8A 5EU6B 2AI0L 3IPBA 1GY1A 2QBWA 3QUYB 5D7JB 3BO8A 3PWPD 3LNHA 1S6NA 3LRLA 3PV6B 4YPJA 2O6FA 1IVLA 1QZNA 3DUHA 2YBGA 4Y4FA 4HJUA 3L5IA 1IAMA 1MN4A 1RZ8A 2BVYA 3EYFA 3NBNA 2WQXA 3MFGB 4LPVA 2EVJA 3MLYH 3H42H 3W2DL 2HXAA 4PY7B 3OSKA 5CXPA 3H9SE 4P48A 3ZZQA 3FTGB 2YEZA 2CPUA 3ETTA 5DEZA 2P44B 3LN9A 5E94A 1A7PH 3ZE2F 2WBWB 1JTTA 3S5LA 3EF7A 1M7IA 1Y07A 1DJSA 1PNDA 2OMTB 3ECBA 1KJ3L 3IJEA 1A4JB 3QSKB 1SEQH 3H56A 5IFJA 3MRNA 3VWKD 1YEFH 1E27B 3HE6A 4KJYA 3SE4C 3CWGA 4GINA 5F8QC 3BSGA 1AXSA 3SE8H 3V4VL 4JM4L 2NY5H 3CIAA 3D39B 4ZD3H 3JV6B 4QUOA 1CFQB 5DK0B 3V6FB 4X4MA 3Q05A 2GIYA 1L3NA 4BWUA 1ZGLP 5DD5H 2EYTB 1J87A 4UDUB 2IH1B 1FNGB 2H1PL 3VXUA 4XX5A 5F3HA 3TF7C 1EGJH 3NFSL 4JE4B 2F7RA 2UXVA 3EH2A 4TSCL 2CKNA 3MGAA 1ADQH 3EO0B 5EFIB 1KLFA 4AQ8A 5L8LB 3IAGC 3KWXA 3FFCE 1RXLA 1NIBA 4IRJA 5JNYB 1IFRA 2VLJB 1VEOA 3OXRA 1WIOA 3R0NA 5CFAA 4KK6D 3O9WC 4DCQA 3QUMH 5DHVA 2XWJB 4XWGH 4O58H 2WVSA 4TV3A 4HJGB 5T5NF 2XN2A 3GZOA 4KZDL 2XXFA 3FN9A 2DOCA 3H0TA 4P3DA 2NCMA 2RB8A 1DQJA 5LDUA 1H8NA 3IGUA 4Z78A 1JD7A 3CZKA 2DEYX 3S37X 2ZUXA 4HKBB 5IVXF 1PKQE 1YMMA 2QFRA 3HBQA 3EGSA 1UWXK 1NFAA 2IH3B 1ZA6B 2BSSB 3B9AA 5E5RB 3Q8EA 4AYDC 4GG8A 2R0WL 3I50H 43C9A 1VPOL 1U2YA 3LQZA 1E90A 2W60B 1R47A 2XVLA 1QO3B 4E5XB 3QUZC 5C0BD 1OAXH 2GT9B 2FGWH 5FK9A 4JNXA 1Q9OA 2CRYA 1FJ1A 3CG8A 4R7DA 2QSQA 1E5UI 5L7XH 3ELQA 4QHUA 4YHPB 3TIDB 1JHTB 1JPTH 1XSKA 2PWDA 3PLYA 2K3TA 2WHVA 4HIHB 3LRKA 5EZOL 3STZB 1JYNA 1T04A 2LAGB 5EEUA 4LOUC 1G6RL 1JZ3A 4P5TA 5KS9F 5IBUG 3QQXA 1DBKL 4XC1H 1Z0NA 3C6SB 4TSBL 2ADGB 3MRGA 3UERA 1MCCA 2G5UA 1WD8A 4G6MH 5FGBA 3VFSB 4LVOC 4Y4HD 3CIQA 3QB7C 5DFAA 2A6DB 4HWUA 3HR5A 1MCPL 3B2UD 5DFWH 5EOTB 1HXYA 3N2JA 4TTGA 4D8PA 4JGUA 4U1JB 4UF7C 3C2SA 3IDMA 4UILH 3OX8B 4UTAH 2DLFL 1XGTB 1PZ5B 5D7IB 1BZ9B 5T3ZL 2AK1H 3U36A 2WXOA 5EZJB 3T4AA 3O8XD 1U8LB 3FFCD 3GB7B 2W0LA 5CGMA 1Q9LA 4AQ1B 4Z7UE 3ML8A 2X4SA 1ZXQA 4XPAH 1SJEA 2ADJB 5E24E 4M9PA 4OZ4A 2Z8SA 5ABZA 2B3IA 1WZLA 2OX5A 3QUMB 3FO9B 4GAYB 3LZPA 2V9QA 2OR9H 2OZNA 4RFEA 2IQ9L 1ZA3A 4R7NA 3O11A 5IUCA 1QW8A 3TV3H 4R4NC 1HU8A 3DYOA 2RCSH 5DEGB 4J6IA 3FT0A 3D33A 3D05A 4KK5D 2UZYB 2YC1B 3ABLB 3FRUB 3HRZC 4KK9C 5JIIA 3QIUA 3VFOB 4I9WD 4HOXA 2YS4A 1RZGB 2L8AA 2JKNA 3HHMA 4X9YA 2E7LC 1G7QA 4F33A 2F5BL 5JHDA 2PYEB 5C0IA 3BUYA 3ELAT 1AYOA 3GI9H 4XHJC 4IOFC 3ZTEA 2ZX9A 2FK9A 3W0WB 4MXWH 3U9UB 4HUVB 5J3HC 4CC0A 4NNYA 4HHGA 1S7SA 5T1KA 4UQBA 2P5EB 1RZPA 4J3OD 1V10A 5AVZB 4HJJL 3VMNA 2D2CC 4MQSB 3TT1H 5DZLA 4EDXB 4RMUA 5LXGH 3FN0H 4PJCB 2BW5A 1RMFH 4JHUA 3MUY1 1UGNA 2DJ4A 5CIPH 3E7JA 1QFWI 1RVFH 4OLEA 5K1VA 2QQLH 5D7HA 5K5YA 1QUPA 5KAQF 2NY3B 4M7LT 1RFDL 4ETQB 4U1LA 4U31A 1CDCA 2G60H 5ESQA 2MQ3A 5E23A 5IW6B 4CKQA 5C2UB 4R90L 4NZTH 3RVXD 2A1WH 5D9SB 3VA6A 4F2MA 1A5FL 3KBFA 4PW9A 4D8OA 1FNEB 3ESOA 4PJFE 4KHXH 2OK0H 5JHBA 2NUPA 1CTMA 3DX0A 4MD0B 1HOCB 1H5BC 1YRKA 3NIFF 2ICWB 2HTLD 5I18L 2R1WA 4CN1A 3MU3A 4F58H 1W8NA 5ALBH 3F7QA 1INDH 4MA8H 1MCRA 4OH2A 4RISH 2GFBA 4PWKA 1KIQA 4BCZA 3AROA 4ZUVA 1IM3B 4O5LH 4U1HA 1N7ML 1E2WA 5GGSB 3CDZB 2WTOA 3DOHA 1LE5A 5IHWA 2OXHA 1HH6B 1AKJB 3RLSA 5JW3H 4LSSL 5EBWA 1IEBB 4TULL 3WHE1 3TOPA 1FZOA 3QI9A 4X8JB 4HD9A 4ISVB 1PS3A 4EI5C 3QNXB 3LXBA 1LLAA 1KZQA 3LS5H 5F1SA 2OJZH 3DX9A 1UM6H 5EUOF 2A9NL 2F9BT 1YEHH 2UZXA 2YK1L 3KCPB 1N19A 4OJFH 5CHNB 4X7FC 2A3TA 4GT7A 1HH9A 1IGFL 3BH9B 3M07A 4YHKL 5DMYA 5DT1H 3NZUA 5IMMA 5F7NC 1NOAA 4GRWH 3K7UA 2BNQE 4R8WL 3HZYA 2BCMA 2O6CA 1E28B 2NOYA 3NCBB 4L5FH 1HC1A 1USZA 1AC6A 2LVEA 4ZMTA 2D0FA 5FXCH 4L8BA 3L17A 4YE4H 1ES0B 4LSPH 2O6DA 4PBVC 1PPIA 1XAKA 5B7EA 2HKAA 1J1XL 5FYKU 1AS7A 4QRQA 5CIPB 4DKAA 4P2RE 1FNAA 1GW6A 1VGEH 4ERSL 1YY8B 4XNBA 7PAZA 4DZ8B 5J13C 4K7PL 3OSVA 1JZ5A 2E56A 5F0PB 5ID1A 1FRGL 2VIRB 2ZX8A 5EU5B 1SXNA 1EFXB 2W88A 4XCNB 3BX7C 1GW0A 4KJQC 5DQJA 1RKRA 3CJJA 3BW9A 5FIEA 3AREC 1NMAL 5FYKD 3QHZH 4NLHA 3TBWA 4KDTA 2X53A 2JB6A 1JSYA 1FP5A 3VQLA 2JJWA 3BAJA 2XC8A 4TNWF 4BV1A 3GGWB 4NKIL 1A3LH 2LU5A 1UH2A 3B8SA 2BP0B 3GXNA 4JKKA 4PJXE 5DMGC 5EWIH 3S35L 3UBGA 3NCJH 4UOW1 1R3IH 1NBVH 1LTXA 1BVKA 1PKOA 1DQVA 3N5AA 1SDAB 5AKTA 1PY9A 2G75B 1KPRB 1KC5L 4PJ6A 1Q0YL 5I66B 2BWIA 2VWEC 3OD3A 4FKKA 4UINL 4XT1C 4JCMA 1PJ9A 5DI8A 3C5ZD 2M1KA 3OZKA 1HHHA 2FWLB 4WWPA 2C9AA 1ZWIA 2CJ3A 5KOVC 4Z7WE 1M3JA 5I8EA 12E8L 1J9TA 3L3JA 1JGLL 2OSXA 2G3XA 2L7EA 4CSPA 1DSYA 1NL0L 2AKRB 3ZR6A 2QFPA 5JQHC 2CIIA 2IWFA 1S9VA 3HS0A 3KPSE 4QRSA 3HAEA 1M1XA 1LK3L 2XI9A 5DA0B 2V37A 1PAMA 4GRWB 4IK7A 4PHZA 2HX9A 3MDJA 5F7WC 5JW4Q 3MRCA 2UY6B 3PFQA 4L37B 4ZFZA 5TGBB 4ONOA 3S36L 2CALA 4MJJA 3FJTA 3VXOA 4BDVA 2Z8RA 3AG2B 4Y4FC 2AI0H 1QZ1A 3MJ6A 2KZKA 3QUZB 1E8ZA 2DYSB 5IESL 4PTUB 4U33A 1U58A 1E5AA 4AUYA 1E43A 4QOKB 4DO6A 1WTLA 4HIJA 1FLTX 1VACA 5HD8D 1IKFH 1E3XA 3QXDA 4AL8L 5AZUA 3V4PA 2VH5H 1CZ8L 1X5GA 1ZE3H 5EOCH 2H6PA 3II2A 4NKOB 2OCCB 1ZLWK 1QFUL 3OM3B 3LNDA 4LVOB 3FTWA 4XI5C 2HLFC 1J8HA 4N2DA 5LCVA 1BPVA 1KCRL 2IDSA 4EAEA 4NRYA 1ZHKB 1TFHA 3LKPB 4X4ZA 1YAIA 5DJYA 2ADIB 4GRLC 5IB4B 1KJ3H 5BVPL 2UWEE 2HRGA 3MJ7A 2W38A 5EIIG 4AQ8C 1ODAA 4Z3EA 3V4VH 3ABMB 1IAOB 4P5MB 5E2VL 4IRJC 1AQDA 2PWHA 4F9LA 4PR5A 1CMOA 2NSQA 4OD2A 4EUPG 1Q90A 1CR9L 5F8RC 3RL1B 4E9RA 4FHBD 5IROA 3T0EE 2JJVA 3N40F 2FBRA 3GXIA 3BLKA 4TN9A 3EYQD 1BMZA 3ZZLA 3QRBA 4B5ZA 5IHZB 4WI3A 4XRCA 4TQIA 5E6SB 3SD5A 4IU3A 3RVWD 4OFPA 4RAVB 2PYFB 3L3OA 5EOQL 2CSPA 1XXFC 4QYAA 3QWQB 3QZPA 4N5EC 4D2NA 1U8QB 5C08B 4FQQA 4LCIH 4OKVA 3HRZB 4KZDH 2C9RA 2DMCA 4W9EC 4TL5A 1XF5A 3U2SB 1WWAX 4QXGL 2NW2A 1SM3L 4Q9QL 2PCYA 3V6OC 3DV6A 1ZANL 3DMMD 4WHYG 1A02N 1IAKA 1PG7W 2EZ0D 2R2EB 3UTTD 5CZVL 4NYLB 1MW2A 3B5TA 4YHNB 4P3WA 2ZOTA 1E0OB 3UPCA 3DBSA 4P05A 3D5OF 2PCFB 1F90L 2XFXB 3SDCA 2D4FA 1BFOB 2GJPA 2R0WH 3HE7A 1LO0L 5GGVY 4DVRH 4UQIM 1NEUA 3ULAB 2WZ6A 2V5MA 4NQCE 4QRPB 4U6XB 3U4AA 1VPOH 4ONHB 2Y7OA 5B4MD 4P5TC 4L4JA 1KBGL 3MOQA 4U6VL 3VFVA 3NP3A 5FGBC 1LJMA 3GXUB 1F0LA 1EFQA 4D9LL 1VA9A 5C09A 4KKRA 3EXLA 2YOCA 3OLIA 3SJVA 1G6RH 1UCBL 4LHUA 4TUOB 1LXMA 3KHQA 3VWJA 5I71C 1DBKH 4YL9A 4BXVA 5D72H 4IQHA 5GJSH 1H5BB 3IXTB 5T1JA 1BF2A 4R6UA 1BF8A 1ZLSL 3SKOB 4HWZB 2XBZA 2XWBB 3TFKD 3FH5A 4HJSA 1DBAL 3FU7A 3RWHA 3V4VB 2VSMB 5PCYA 4ZO7A 2WLNA 3WNOA 4GG6E 1X5JA 3FMGH 3ZW3A 3T0ED 1TZ8A 5TFSH 2VKWA 4K3EH 1U4FA 4HKZB 4WGVB 1IJNA 2IBGA 2AJYH 3QEQB 4ZUUB 1KXTB 4H0LC 4NRXA 2XCMC 1MUJB 1BOGA 2R0KL 3SDAD 1SYVB 2CWRA 4P2QE 3SYQA 1SUHA 4DPRA 3EHBB 1JRHI 1QFWM 2HJLA 2VUOA 2KKQA 4EI5B 1T03L 1XB6A 2NMSA 2WGXA 4FNRA 1KDIA 4HZLA 2HPOA 3JQOB 2DQJH 4Z0XB 3WEXB 5MEOB 4LFHG 2AEPL 1TVBA 4GB9A 3VG9C 1N5AB 1IVTA 1Z6JT 3L2MA 3NFNB 5ENWB 5D1XE 1VZHA 3QIUC 4B7LA 2QHLA 3FDWA 4S0TD 4UNIA 4F7TB 2Y2WA 3NJNA 3L1FA 4U1IA 5HYSA 1EEZB 2R2BB 2YD3A 2H1LM 1PLGL 2NY2D 4N0YH 4J3OG 4NQDA 2CGYA 2EDYA 4PJIE 2QL1A 1A1MB 1NCTA 1KNOB 2YUWA 4OM1L 3TBTA 3V4PL 3BRGC 2YD5A 4U6TA 5AVRB 2DLGA 1IZKA 3KPNA 3BPOC 2MKWA 3QCTL 4UQEA 4IRSD 4NQCD 4JFDD 2RBLA 4H0HB 4JO3L 3F7LA 4S0SD 4MQXD 2DLEA 1AP2B 3HG3A 3RWCB 2F5BH 4Z76A 5LCVL 3BT2H 5HDWA 3S34L 2O72A 3QQ9C 3NJMA 1UTDA 1T5WB 2J73A 1NBZA 4Z5RA 2JQAA 5J13B 4HSCX 2XTLA 1ZT7A 1NIDA 3GIZH 4J23A 4JDVA 1A47A 4DGYL 1HHGA 2J7LA 4AL8C 3CHSA 4KOCA 1G6RB 1WJ3A 3MV8E 5AW9B 1ZLVH 5IOPA 3TT3L 3AREB 4IBLT 4N6QA 2NZ1A 3QUKB 1RFDH 3MRFA 3C12A 4FXGC 5HDQL 2V9UA 3B34A 3HG0A 3VFWB 4PYGA 1CTNA 4Q6KA 5IMOB 3FF8A 1RL1A 1BYOA 1QQDA 1A5FH 3QDAA 2X4NA 1MVYA 3UGEA 4EKJA 4OBRA 2QTVA 5EN2A 3U7AA 1HEHC 4B9KC 5E4AA 5IHLB 2BIIA 4ZX5A 1OIOA 2GW5A 4NQXA 2A6KA 2VABA 5EUKA 3O3AA 1IMHC 2BSTB 3C9NB 2XHNA 5I18H 2NXYC 5D7IF 1PSKL 4JFPA 1TIUA 1ZVSB 1A7BA 4P2QD 3K74B 4HUKB 3UC2A 3IDGA 5TH2B 4WHDA 5HGHB 4FNQA 3OWEA 3GMMB 4M00A 2R0ZL 3GKZA 3VYPA 3SE9L 5IK3A 5D8JH 5D1XD 2Y0SA 4KKPA 4PGZA 2VJ0A 3KLDA 4PV8B 3LZNA 2Y9RT 3CQQA 1J1PL 4JQVA 1X44A 4X80H 3GSWA 3P11H 3BO8B 4N2MA 2OSYA 2PPEA 1ET8A 1YJDL 4R4BA 2B0SL 2EIEA 4HEPA 5CGBA 4JKPL 2X6BA 4WO0A 5L4IA 1JVKA 1UH3A 5D7SL 4Y4FB 1IGFH 4YHKH 5IEKA 5SWZA 2FVNA 1RZ8B 4HCFA 3EYFB 5ESAA 5HHNA 1ZTXL 3DSFL 1U8MA 4R8WH 3FUEA 4XODA 4IIZA 1NCGA 1KENL 2WIIA 2YEZB 1MVUB 3JV0A 5EORH 3RWDA 2BCKB 2R1XA 1INEL 5E94B 3HN3A 5TD4A 3S5LB 3RHWF 4LQFH 4F7CA 5DHXB 1M7IB 1NMBH 1T1XA 2JIXD 3HFFA 4UTBA 3ECBB 1ND0A 1LE9A 2OMYA 3IJEB 3MV8D 5IFJB 4PJCF 3PJLA 2OS7A 1T7XA 3MRNB 3ZTJH 5I0XA 1M7DA 3HE6B 4KJYB 2X9WA 5CLZA 1AXSB 5CJXA 4TNEA 1GC1H 2D7OA 4CNIA 3O6FD 3Q9PA 5BPPA 1R17A 4HIXL 2H2PC 2AABH 3DYMA 4PJAF 4HU8A 1CDIA 3FT1A 3GMPA 3NJIA 2JKIS 2ENPA 2PETA 5CCKL 1N12A 4HLEA 3VXUB 2BWDA 5F3HB 3L2NA 5DZAA 4NKMA 1LEKA 4LDCA 1KLFB 2HVKA 4JFVA 1T7VA 2YFNA 3Q0HA 4IRJB 5HHVL 3OXRB 1FL3A 2DAVA 5I82A 1KB9K 4JFZL 4ODVL 2WD0A 4DCQB 1TF4A 1A4KA 1J18A 5DHVB 4R0LC 4PWGA 1QFHA 3WDIA 1ADWA 2IGFL 5EEVA 1GKEA 3IT8D 2E8YA 3H0TB 4MGXA 4P3DB 1JXFA 1IV8A 1DQJB 5D7EA 2IV9A 1QWHA 4UQ2A 2EVFA 3BQUD 4Z78B 4UINH 1CDYA 1UH4A 4OFYD 2P24A 2CJUL 4J5VA 1GCYA 3FSVA 1YMMB 2IO5A 5FAAA 3EGSB 4TPRH 2ZOKA 4J1UA 5D7KD 1ASOA 3T3MF 3BKML 4GG8B 1DFXA 3ARFD 2OW7A 1NL0H 5AZEL 2A0LD 43C9B 2VKXA 4PSPA 2FSDA 2HT4D 1D9KA 3LQZB 4M6AA 4ZDHA 5DD1H 2P5WE 4Q6YA 2YGVA 3F8UB 1LK3H 4N24A 4I7ZC 4B7IA 5FK9B 1JWMA 1Q9OB 2ADFL 3MJWA 2VNCA 4NQQA 1FJ1B 4NFDA 4R7DB 1OWRM 4QHUB 4G6KL 3BZDA 3NIDB 2JKJA 3WKMH 1T04B 3S36H 4U1GC 4AEIH 2L3BA 4P5TB 3DI2B 3Q8CA 1B2WH 3PQYE 3DHMA 3LN4A 2FDBP 3MRGB 5IESH 1E4XH 3DTDA 4PLJD 4G70B 4YHLH 1L9PA 4XPFL 3GMQA 2EDKA 1AGEA 2DV6A 4FYQA 4AQAA 1XH1A 1CPUA 3HR5B 5T1LD 3W57A 2PWGA 1CZ8H 5F97E 2VRAA 1HXYB 4XP6L 4D8PB 5I71B 3AY4A 3RTQC 3IDMB 2ZKHH 1ZV5A 1E9PA 2Q7YB 2QDVA 4AYID 1IGCH 1QFUH 2YXVA 4N2AA 4JLRA 3U36B 3T4AB 4P46D 3LPPA 3ZY7A 2M2DA 4ZT1A 4L3EA 5FKAA 2J21A 3D06A 1Q9LB 1R19A 2CNYA 5FYLD 4AGOA 2HT3D 4F9LC 2X4SB 1PDKA 4YS4A 4G59C 4TLTA 1SJEB 5IROC 2F19L 3M1CA 2JKWA 1TKWB 2OX5B 1C8PA 1UD3A 3O3DB 3RGHA 2O4EA 3QZBA 2V17L 4RFEB 1J9CT 1NCCL 5E2VH 2NCEA 1ZA3B 3QAZC 2VZ3A 3P9WB 3O11B 4M7ZC 3IRZA 4R7NB 4V1DA 5SX4I 3L3OC 1FFOA 2JWYA 4HH8A 4HPHA 4JQIA 2VOTA 4JK0D 3UO1H 4H8VA 5F9JA 2PXYD 4PJHA 3F64A 4O00A 5K1JA 2V5TA 3QIUB 3X3GL 4IBSA 4WSGA 5DFVC 2HTKC 5EOQH 1NIFA 2P5WD 4NC1C 1G7QB 4F33B 3EYUL 2CU9A 3RDTD 2WINA 5C0IB 5JHDB 1OAKH 3BUYB 4WUUE 1QRND 1W6WA 3H2WA 4XNMA 4XX1G 1PLBA 4W81A 5AVYB 5T1KB 1S7SB 1Z32X 3BPOB 3SDXA 2X1XR 3SDCC 2YIHA 1GRWA 4F7MA 3HE7C 4QXGH 1SM3H 1YJDC 3D12B 4OKDA 4GRWF 2BIMA 1ZEAH 4JPKL 3P0VH 5TE7H 2YD0A 5FB8A 3PQYD 2QQKL 4AM0Q 2GHWB 5DMKA 5HHME 4YSUA 1IC0A 2VSCA 3UJIL 2X2IA 1F90H 3MLTA 4U1LB 2F6AA 5ESQB 4LU5H 1NGPH 1BECA 2J8UA 3GJFH 3MYJA 4GKZA 5HVWA 4F2MB 1II4E 1FNLA 3WBDA 2IDTA 5DJZA 1BFVL 1N4XL 3SDDA 3VWJC 1LEIA 3BUPA 4ODUA 3BEVA 3FTZA 2NUPB 3LRSA 2HB0A 2GTWB 1URIA 4HLJA 3U6RA 4AYEC 3KM1A 4D9LH 4HAGA 2DQUH 4GW4A 2K0RA 3X1GA 3MV9E 3QIBD 5EU7E 1PG7L 2BSDA 1BXUA 3HJ0A 1VERA 2GFBB 5GJTL 5K93A 1KIQB 3THMH 2HG5A 4ZUVB 3MLZH 4U1HB 2IPTL 2JFCA 3NPSC 1NCUA 2NXYB 1EZVX 5KVGE 4U7MA 2NNRA 1LE5B 1DBAH 1I9RH 2CRMA 2OXHB 3QZLA 4QDGA 5EZIL 4WW1A 4P2CG 4K94L 5EBWB 2J25A 1FZOB 3QI9B 1KTLA 2KH2B 4G8GA 5BXFA 5L0QC 4JFTA 2YPLA 1MAMH 3DX9B 1P84K 2R0KH 2PR9A 2UZXB 4LP8A 1J5OL 1CDHA 2XFGB 1HH9B 3FQWA 3HAEH 2BSBA 1QACA 1PY0A 1JN6A 3AWFA 5DA4A 5IMMB 1Z9SA 4DUWA 1T03H 5T5FH 3L3IA 4WUUD 5F71A 4MJ2A 1ID5I 4MAUL 1RK7A 3KYAA 2AAVA 3HZYB 1UYWH 1H3PH 1DO6A 3VXRE 3OKOA 4PJ9D 3ZHFA 3C09C 4XPBL 4MNQE 3WSQL 2SODB 3I6GA 3UEZA 3G6DL 5DQ9A 4PBWD 3ULVL 4HMDA 4ZYKA 2D0HA 5AWNL 2E7CA 1G7IA 3MQIA 2KQNA 3V4PH 2UZIL 1FZKA 2CCWA 3AAZA 3ECQA 1GJIA 2APWA 3UL4A 5ID1B 4Y2OA 1XX9C 5JHLA 3KEHA 5DQJB 1FH5L 1Z9NA 4R84A 4XWOD 1YN6A 3BW9B 1JVOA 4XN1A 5LN8A 4FL4C 3L4CA 1A9EA 4JN2A 3L16A 3RIAK 2IADA 3TBWB 4K23L 2JB6B 4QXWA 1P4UA 4JY5H 2Q9OA 3MV9D 4Y9FA 4X6DE 1GOGA 3WIHA 2IFGA 1UJTA 1HNYA 2XWDA 2WQUA 3QUGA 5I6XC 4LP4A 1XIWD 3N9GH 3TJEL 5I1EL 1BVKB 3N41B 3TT3H 3ZIYA 2F54A 2YAQA 3I3DA 2EIKB 5AENA 5HDQH 5CUSH 1DSFL 4NKQB 3GXFA 4JO1L 4UU9A 1S3KL 2NZ9C 1NFKA 1JBJA 2VDML 4JQIL 2DWXA 1G87A 4UDTA 5DI8B 1HHHB 3FU6A 4OJDH 4R0LB 3MNDA 1ZWIB 4X6CA 3B5HA 1E4XI 1LILA 1TXKA 3CZLA 3L3JB 3MGOA 5I8EB 3GZPA 3WNNA 4HOZA 5L4JA 1RURH 1TQUA 1MCQA 4Z7IA 4IK6A 2BS8A 2W8CA 2CIIB 4FQ2L 1S9VB 2DD8L 3T6VA 3HS0B 4QRSB 1MIMH 3WNIA 4ZODA 4JQVC 3HAEB 1M1XB 2HX8A 5T8IA 5JORA 1B3JA 2OR7A 2IXQA 3QYNA 3AXLA 3MRCB 3SE9H 4UQ9A 2CO7A 1IE4A 4ZFZB 3VXOB 4BDVB 5I8OL 2DB8A 2CCLA 4IGBA 1BVOA 1I1AD 1LO2H 1J1PH 3K2UL 3OMAB 3L4ZA 1CXIA 4Z23A 1BG1A 2XZCL 3WIAA 4JRYA 1LD9A 1BDYA 1U58B 3M46A 4BK8A 4DP0X 1KPUA 3OB0H 4HIJB 3UJTH 1FZMA 3EH5B 1VACB 3FSZA 2IEPA 2NSMA 3QXDB 4A6YH 3V4PB 2EABA 4U1GB 5D7SH 4HJIA 1UD8A 1EZLA 1NPJA 3FPYA 3PE9A 5DJDA 2H6PB 1F4YL 1M42A 1ZTXH 1WF5A 1WYJA 3PP4H 5AVQB 2WXRA 2GITA 3Q2CA 4M3KB 1EEUA 5CKAA 1KENH 5E9DD 1J8HB 2JKLA 1TEYA 3K4DA 1MCIA 3ZQXA 4NRYB 5CJXC 4YDIL 1LP9E 5DJYB 5HHOE 3RVTD 1NDTA 2AJXL 1DN0A 4FULA 1VKXA 2V2WA 4WFHE 3ZGIA 4YPGA 2AXGA 1IZJA 1VAHA 3MJ7B 1MCOH 3LN5A 3FRPA 1T1WA 3RQ3A 3K6FA 1CO1A 5IG7A 1AQDB 4DTGL 2A83A 4PR5B 5D4QA 4HIXH 1DEEA 1IC4L 1MFDL 1NMCC 4G8EA 4OD2B 5H4ZA 3VB8A 5CCKH 4M1DL 4OZHF 3MLSL 1SOKA 2D3VA 3LNEA 2F5AH 3QJRB 1NCOA 5HI3C 4XRCB 1X5KA 3OJVC 4Q9RL 4IU3B 4WCYL 3R7RA 3VI3F 4NZ8A 3QAZB 1SFDA 4M7ZB 2LQRA 5IUSA 3L3OB 4P2OD 4ODVH 2ZP0T 5GGUA 3EJPA 3DIDA 3D8MA 4DP9X 3HZMA 2LT9A 4FQQB 4F80A 4K94C 2IGFH 4OKVB 1FZJA 1KYOK 1ACCA 4YXHH 4JFYA 1XF5B 1CB4A 3VXSE 2NW2B 1A8JH 1MCEA 3DV6B 2O1AA 1D9KC 1IAKB 4TM9A 2CJUH 3NRQA 5K9QG 2X3CA 5F96L 1XF2A 2TRHA 2IAMA 3SDCB 5E03A 3HE7B 2X7LA 4KX7A 5I1KH 5AZEH 4ZMNA 3KR3L 4OZGE 3WTUA 1VFOA 1GYAA 1CL7I 4PJDE 5JHLL 1I85A 3QRGL 1T66C 1VZIA 3Q2VA 5K39A 5BRZE 5CLWA 1ETJA 4ZS6C 3JBG7 1A1OA 3TLRA 4BQ6A 4J8RA 5A40E 3ULVC 4G6KH 3DLQR 1DQTA 1HHJA 3KL5A 3B43A 2FRGP 3K1DA 1OGAA 2IPUG 4YDJA 5C09B 3WIHL 3SJVB 4FS0A 4ZW7A 1KCLA 2XV3A 4LHUB 3BKYH 4KJPD 2JSFA 1A14L 1MAJA 3AY4C 4FQXA 3T9WA 3VWJB 4CKVX 4C83A 4WI9A 4WFHD 4PS7A 4ADJA 1BZOA 4OJYA 2FQGA 3IDYC 3KGRA 1N18A 4JRXD 4M9OA 2A6JA 2HJKA 2Y5EA 3TN0A 4RDQG 2DMGA 1M05A 4WWKA 1NGWA 3ILQD 4G9DA 1I7TA 3FU7B 3HNTL 3RWHB 4X4KA 4JRWA 4XP6H 1AR2A 1HX0A 1V3MA 1WFOA 4LPXA 3KNBA 4FA6A 5MEPA 5G5DB 4BFKA 5KVDE 1KMGA 1U21A 2AQSA 1NWOA 3QQ3A 5ICUA 2VW7A 3NPSB 3RKDC 4NRXB 2WLKA 3NQKA 5H37G 3RB7A 5B1KA 1BOGB 3SQBA 4C58B 3MOAH 5J9PA 4GNKB 4KH2A 4YBQD 4PRNA 4TLSA 2HJLB 2IDFA 1I9IL 3NCCB 5DRNA 4N2FA 5L0QB 4HZLB 4ALAL 4HWEH 1TVBB 2XZQH 3LEVH 5IV2A 3F05A 3NRPA 2GBTA 2V17H 1NLDH 1NUGA 2QGBA 1MJJB 1V7MH 2DWSA 2PTTA 5LLIC 1F2XK 2JCWA 1P1VA 5EO0A 5HVFB 2F7QA 4U1IB 5HYSB 5DVKA 4ONGH 2H4EA 4WKXA 1PNCA 4NQDB 1BVNT 3TBTB 1C5BH 3CAFA 2EUXA 3TO4D 3KPNB 4BFFA 3K8MA 1V05A 3X3GH 1X5LA 3C09B 3V52L 1XZ0A 2CGRH 5I1HL 1AGFA 4PB9L 4OY9A 1XFPA 3G6AA 4MJ4A 2B5IC 3OAZK 1OV8A 5BRZD 4Z76B 1B4JL 5DRZA 3T3PB 1MJ7L 3A4EA 2WBJA 1O0VA 4RH4A 2VXUL 3MXWL 5DS8A 4UTBH 1NBZB 3MJ8A 5AVUB 3V10A 2ZX7A 1ZT7B 3G9VA 4JDVB 1OP4A 4JPKH 2COQA 1HHGB 2YAOA 4W9ZA 2GBUA 2O30A 4N1EA 1AMYA 3SDDC 2YA0A 1MRDH 5FGCE 5IOPB 2B1AL 3CMOL 3MRFB 4FL4B 4NUPA 2RMNA 3ZZSA 3VXNA 4MLIA 3MRBA 3IKKA 3OKEA 4DIXA 2H45A 4POZC 2PP9A 3D3VD 4UWQB 3VQ2C 1QQDB 1SXZA 2X4NB 5I6XB 1CICA 1HSBA 1TTRA 5JHMA 5EN2B 2JE8A 2FD6L 1N3NA 4NQXB 2A6KB 2FT6A 2VABB 5EUKB 3FQTA 3O3AB 4QTIL 2G9KA 4OGAD 1ECYA 4K8RD 1U91A 4JFPB 3X17A 1DCLA 3BVVA 2FQFA 1IGJA 3QDMD 3IDGB 3QEHA 4FTVA 3QXTA 1EA9C 5GJTH 3QORA 3DX8A 3ZKSD 1NCWH 2J1WA 2Z31A 4FFWC 1BGXL 4DKFL 1MY7A 4LK4A 4AGPA 2DQTL 4H25A 5IK3B 1MJ8L 1ET5A 4XMLL 5CEZL 1PY4A 2VSDA 3KL0A 4K3JH 4UNTA 1YSOA 4K94H 2XBDA 4PRPE 3GSWB 3KMDA 1CU4L 1P69B 1CGUA 1OANA 4GAGH 5JZ7C 3PYCA 3NGBC 1PD0A 4R4BB 3HUJE 4C4KO 2H3KA 2FB4H 2C1OA 3JYCA 2NYYD 2X4QA 5GGVL 4IBVA 5EEYA 5IEKB 2WUCL 4LAQL 5SWZB 2ZWZA 5ESAB 2GTZA 2LU3A 4LCWD 3GSUA 5HHNB 4I2XE 4UOQA 1U8MB 2IAND 4XB7A 3X1FA 1CD9B 1H3UA 2WIIB 4KQ4H 4AYGA 4JGMA 3RWDB 3D9AL 3M7FB 2R1XB 3UG4A 1ROCA 1H3VA 1JXJA 4U3SA 1S4IA 4BGDA 3ESVF 4PCSA 4ZQKA 4F7CB 1T1XB 1YHPA 2ODIA 3FF7A 4XPBH 3WSQH 4JUSA 4KI5C 2VMFA 4X8XA 1ND0B 3ULVH 1LE9B 2OMYB 3VVVA 3PWPA 3QZNA 3QFJA 5A1AA 1M7DB 3PXJA 1V3KA 2UZIH 2BNRA 3L7EA 5FFGA 5I30L 5KSBA 1M6UA 4A7TA 4BA8A 4PCYA 4DT2A 4CNIB 2EDWA 1MY5A 1Z5LA 2ZTBA 3GMPB 3B4NA 4UM9B 3JT0A 1FH5H 2ARJQ 4HCRA 4HH9A 3WDHA 1LEKB 3JWNE 4NKMB 1HCVA 1RZ7L 4H20H 2HVKB 2JTYA 4N22A 4MMYA 3FYEB 2BIQA 3QA3A 1EHNA 4K7FB 1FL3B 5LNDA 1R3LA 1NMCB 3ARQA 5I19H 1OAYL 1WAAE 4FC3E 1A4KB 5I1EH 3VWKA 2XYBA 4JG0L 1P4LA 3QH3A 1G6VK 4CSTA 4MAYA 4UQ2B 5E99H 2VDMH 2P24B 4NZRL 4BSJA 1YECL 2AJUL 4IRZH 4M3HA 5KW9L 5AAMA 2ZOKB 1SHMA 4J1UB 4E0RA 3SD2A 4UAOC 4HUMB 5DVMA 4BGLA 4L9DA 4ANVA 1Q9WA 4ALAC 4GYBA 2P43B 3ZIMA 5T1DH 1DVFD 1D9KB 1O9WA 4RBPH 5AFAA 2OQJA 5EIIA 1VSCA 4ZDHB 4N8VA 4IGBC 5T3XE 1KB5H 2KHAA 2ZYSA 4OLVH 1YA5A 4XP5H 5F7HA 3LYRA 1JWMB 2X4PA 3L4WA 4W9FC 2VO8A 3CXFA 3ATDA 3FQXA 3OG4B 1T20A 3ZMRA 5I1JL 7FABL 1GOFA 4R9HA 3K2UH 5GZND 3ZO9A 2R8SL 4B9ZA 3LN4B 6PCYA 2XZCH 4CUCA 1NCJA 2HRPH 1QSFE 3CVHH 4LLYA 4LXFA 4NBYB 5SX5H 1P7QA 2ZXBA 1T21A 3GMQB 1KY7A 3NCWA 3Q8FA 4NWUH 1AGEB 5A6MA 4AQAB 4NNXA 2Q6WA 1A66A 4XMXA 3FS9A 4KZEH 1G7PA 2C4XA 3PHQA 3AW5A 1TTAA 1F4YH 5E1HB 2PTVA 1WGOA 2NY4C 3C6LD 1E9PB 3BOVA 4G7YL 5C0BA 4HX1A 3ULSA 1EZUA 4HEME 3IDYB 4H7VA 4KRPD 4JFUA 1QTYT 4JLRB 4JFFD 4XMWA 1BZ7A 1XGZA 4KTDL 3EJZD 3HVNA 4M93C 2OCJA 4L3EB 5FKAB 3IFOA 5KUMA 4QRRA 3KPQA 3UBXA 5BZDA 2XXGA 4KUZL 4I3RH 4X8GA 2GEQA 4XN7A 1MCBA 1PDKB 4I87A 3U1PA 3HG5A 3BE1H 1WFIA 4NO0D 4FA8A 4O4YH 3HG4A 1IE5A 2EICA 5IKCA 2WYZA 4OLZL 1ZVNA 2DMKA 5GRYA 4UNVA 3VD4A 3KYMA 1DVZA 5DDHA 4DTGH 3CUPA 3NSFA 4V1DB 1OT2A 1F5WA 1FFOB 1EJOH 2I60L 1QLFA 2VDMB 3AFLA 1OTUC 3R06A 4M1DH 4PP1C 1HZHH 1NBQA 2PPDA 3MLSH 4U4BA 2BX5A 5F9JB 4PJHB 4OZIA 3O8XA 2K3HA 4P9ML 4Q9RH 3MRKA 2E7DA 1IUZA 4DETA 3PXLA 2XWXA 2JELH 2F8XC 2IJ0C 5T3XD 1RUPL 1PZ3A 2WINB 4QXVA 4BKTC 4M1CD 2RA1A 4GW1A 4XNMB 1CF8H 2DQCL 1HZLA 1U8JA 3SDXB 1WFNA 2IAMC 3FW6A 3WIIL 4RGNC 5DJ0A 4K3DL 2DTML 3O6KL 3CZFA 3SODB 4F7MB 3ARXA 2G30A 4IBWA 2ZSVA 1DSWA 2YR3A 4XO3A 1I85C 3ARZA 5FB8B 1MHCA 3FQNA 3SQRA 1WK0A 4N8PA 5DMKB 3QWRD 4RQQA 4MA1C 4U49A 1QSFD 2Y4SA 5C0RH 3MXVL 3MLTB 3PG2A 3PGDA 3CXHK 5CZKA 2UYLA 2KL6A 5GGQL 1G9NL 1L9OA 3KR3H 1W2KT 1WA0X 2AXWA 2F58L 2F53E 4M6ML 4GKZB 5MEQA 1F45A 4JPVH 2YBRA 3UZVA 4C56A 4HCRL 1A9VA 1TJIL 5DJZB 1GGTA 1LEIB 3SDDB 4FQXC 4ODUB 4XP9L 4LASL 3BEVB 4KJWC 3KXFD 2KLRA 3LRSB 3QK0A 4CJ0A 3U6RB 1X9QA 3GBNH 2KBGA 4GIAA 4P3CH 1YG9A 4BK5C 5KBDA 4WWKC 4GW4B 3T6WA 5F1IA 3B2MA 4WNSA 1DJXA 4XO8A 4YSCA 3ZHKA 1A14H 1WISA 1GYUA 3NA9L 2ORBH 5EBMA 2HG5B 2E46A 2Z7ZA 2OJ1A 4G9FB 1RPQA 4M6OH 1H9DA 2GJRA 1DDHA 4ODTH 4M43L 2Y7QA 3ARGD 1E6OH 5FHAL 4N2HA 2WNWA 3JVFC 3HNTH 4PD4K 3V0EA 1S5HA 4WW1B 1J7VR 1FVCA 2H5UA 1B4LA 4XCCL 3AMKA 3CQPA 4S1DC 4FGMA 4IKKA 4YDKL 1QLEL 1KTLB 2CHWA 4G8GB 4BZ2H 5BXFB 3TYFA 4F2FA 2YPLB 4NB7A 3UC0L 1RIVL 2YMXH 1IO4C 4HIQA 4KTGA 3ZYZA 1XGRA 2XETA 2WXGA 4N90D 3L5XH 3FQWB 3MUGA 1ZXKA 4TTDC 4QHMA 3FKUS 1SFHA 4Z7UA 3RX5A 1JN6B 4N0CC 2LFGA 3PIQA 3L3IB 3NGBB 3IPFA 4E9YA 3HC3L 2BHFA 3WNPA 5KTEH 3R8BB 2P8MA 4PBDA 1JZ2A 3REVA 3OKOB 3ZHLA 1L9SA 1B4RA 4L1TA 1DQQA 3I6GB 1KCVL 2Z9TA 4L1SA 3UP6A 1P2CA 1UFUA 3O2VH 5DQ9B 2UV3A 4YVUA 2XQYG 4GS7C 1A7OL 4ZYKB 4ODSH 2W07A 2ZX6A 3WGUB 1HI6A 2C9XA 3MA9L 3TURA 1G7IB 4PU2A 2Y6TE 1UWYA 3KE0A 2WBJC 4WJ5A 3RUGE 3ARBA 5C07E 1FZKB 1OM3L 3AAZB 2A9CA 1NAMA 4LCUA 1BD2D 2F53D 3V52H 4ZPTA 4Z7NF 4DQOH 1S3RA 4PB9H 4Y2OB 3QDJE 4XB3A 5KZCD 3OLEA 1B4JH 1K6QL 1YN6B 4ELKA 2VXUH 2G5RA 2DQGH 2WAQA 4MD4A 5ICXA 4KQ0A 5EA0L 4JN2B 1A9EB 2IADB 3ZTDC 1KV3A 4IM8A 3VSTA 3VQMA 1UM5L 2CE6A 5ANMA 4KVNH 1KTBA 2DYPD 1CICC 4JKLA 1KG0A 3A47A 4XNYH 4QCIA 1IGIL 1MIEL 2F54B 5F44A 3WKPA 1IBHA 3DO4A 5CJ5A 3ZYIA 3IETA 4F7PA 2BHUA 5K9QI 4UU9B 4UDTB 3EDDA 3TYGH 1S7XA 3O2WL 3BMWA 4BQ8A 4U6HA 3DXAE 3DWTA 4W4OA 4X6CB 3ZE1E 3QORC 3VM7A 3MGOB 1YVLA 3I74A 1LO3L 3VRLE 3UGXA 3WFDL 3SPIA 2BINA 2C9VA 2Z31C 4PRIB 2ENJA 4GSUA 1WA2X 1JK9A 1B9KA 2AJVL 3UAEA 5AVTB 1SUJA 4HWNA 3MUJA 1SQ2N 5AAWC 1G9EA 4DEPC 5EHFA 4UAOB 4YXKH 2A74A 2IXQB 3AXLB 4DKFH 3QE5A 3UFIA 5ELIA 2DQTH 2H6OA 2CO7B 4BHUA 2FEEI 4U1KA 3UH8A 4XMLH 4IGBB 4K9EL 4FTDA 3C5ZA 3QZMA 2NSXA 2ZWYA 5KVFE 4AW4A 3DJRA 1CU4H 4ZNEA 1YO4A 4LARH 5HDBE 1JD9A 4HOMA 4JRYB 1LD9B 5TQ0H 2GK2A 3EBHA 3LHAA 1KPUB 3U7YL 3VH8G 1FZMB 5C07D 4W6YB 3GI8L 4M5YH 4X9GA 2DMBA 1QPKA 4Y16D 1TTUA 5GGVH 3PAVA 5J57B 1TQCC 4LAQH 2UX6A 2XXCB 4F8NA 3QDJD 2EECA 3U4KA 2NTFA 4PLKD 3T4YA 3ZDYE 5CCGE 3BWUC 3WUZA 1OCRB 2GITB 5HGBB 2Q2LA 3K71A 3NSJA 4LNRA 4ATTA 3CVBA 5DYOA 3T3PF 3NCYS 5F72S 3DOIA 1WPCA 5J0BA 3FBQA 1G7JA 2E9IA 1BBDH 3QJTB 1DN0B 1G9NC 1SMOA 1VKXB 2V2WB 4YPGB 2AXGB 2MQCA 2FR4A 5AYQA 4HJ0D 3ETBJ 3IRCA 1WV7T 4P8QA 1E7UA 3LN5B 1HL4A 3FRPB 1T1WB 4M93B 4NUQA 5I30H 2I9LA 1KFAL 1GIGL 4NQED 3MRDA 3ETBF 5IG7B 1I8UA 2DM7A 4DF9A 4WF7A 2A83B 1I1CA 3QGVA 2M8XA 4E9SA 3CFTA 1DEEB 1AYRA 4G8EB 2I9TA 2ZP9A 1RHHA 2YUZA 3FUFA 2CQVA 2IFFH 3DXAD 3AGVA 2BMKA 3FAXA 3L2LA 3VFUA 2YD7A 3VWKC 1RZ7H 4WV1C 3HHRB 2YA1A 5DSCA 4JJ5A 4MAYC 3AB0C 5ITBH 3NG5A 3G6JE 1JIBA 4PJXA 5CZXD 3ZSTA 2EEAA 5GGUB 4DSYA 5JDJA 4PJ7A 3WFCL 2EILB 3KLHC 4KO7A 1CL7L 4JL2A 3P02A 3HZMB 1J12A 1X5XA 2ZXEB 1DBMH 3PJSA 5AAMC 3AMLA 4QI3A 4L3FA 1FZJB 3MN8A 3BRDA 3CFKA 4TL4A 4JFYB 3UYPA 3PNWA 3N43B 2LR4A 3RX8A 1E9QA 2VYRE 1PJWA 2BIOA 1PVHA 2EH7L 3OMZA 1MNNA 1X9LA 1A65A 1W72A 4NZRH 1YECH 4HCIA 3KL3A 4KK6C 3PUCA 3TWCH 1XL6A 1L7IH 4Z7WA 3BSHA 5I0WA 3L54A 1XF2B 5DD3L 1FDLH 1NAML 2IAMB 4RGNB 5DHDA 4WJKB 2X7LB 2QMKA 1Y7VA 5JW4M 3G08A 1R6VA 3ZE0B 1PEZA 2BXYA 5K39B 4A7VA 1IAIH 3L3HA 5J1SC 4Y19A 1J1OL 2JJUA 3KPTA 4MA1B 4Y2DD 1A1OB 4HS8L 3CFQA 2JCCA 3IGAA 4UUJA 2Y06H 3IB4A 3OHMB 1HHJB 1GHFL 4KNUA 1OGAB 4YDJB 1SXAA 4PAZA 2ZJSH 3DMMA 4JFWA 5C6TH 5FUOH 7FABH 2R23A 1G94A 3JWNG 3BWAA 2DIJA 4UV7H 3UTTA 4WFGE 4KO5A 4FQXB 1JV2A 4G83A 2ETWA 4C83B 4KHTH 4XXDA 3WE6A 3IU3A 2DLHA 3QG7H 4Y89A 1MXGA 2A6JB 1ZV2A 2HJKB 1IBZA 3TN0B 1D7FA 4WWKB 1M05B 1NGWB 3SY0A 4G9DB 1I7TB 5IFHL 3HC4L 3ZTNL 3BFOA 5AKRA 5MEPB 3KNBB 4G7YH 1T0MA 1R24A 3G9AB 5FYKL 3RL2A 4JZOA 4V11A 1BAWA 3FQ4A 3QQ3B 1C16A 5GRUL 3UZEC 4ZFOA 3V7AE 2GY7B 3HFMH 3SQBB 3MUHL 5H2BA 5J9PB 3WEOA 4MMXA 3TASA 4QJ5B 2CAKA 3ABZA 4MX7A 1KB3A 4PRNB 4XO5A 4YHOL 5IGXH 1SYSA 1U95A 2N3JA 5DRNB 1KELH 4P0DA 2UWEA 4BSWA 1FORL 1VFAA 4G6JH 4JBSA 1S7WA 4XAKE 5A2KH 3MUZ1 5IV2B 5IT2L 3WTTA 3O8XC 4OLZH 1S78D 4PB0L 2PTTB 4N2OA 5BZZA 1T1ZA 5EO0B 3A6BL 1U3HA 3T0EA 1JFQL 3H6AA 1H0DA 3S6CA 5IM7A 3BWZA 4D3CL 3JWDL 4KRMB 1V8HA 2Q8AL 2Q86A 4L2YA 3RPIA 3W9DA 1J9RA 1UATA 1XZ0B 4TNVK 1AGFB 5C97A 3WI9A 3G6AB 1RZKH 3ZUNC 3A4FA 1CURA 4GS7B 1PFOA 2JTDA 5FO7A 3H3PL 2QHRL 1U3YA 5IB1A 4K9EC 4LDOB 1XWVA 5DRZB 1CDUA 3O3UN 5E7FA 3NIGE 4H44C 2WBJB 4KK5C 5DS8B 3BP5A 4XZ4A 3WIIH 1NUNB 1V3JA 3MJ8B 4JFQB 5C0ND 4K3DH 2DTMH 3O6KH 5IIEA 1G0DA 5CJ8A 4WFGD 5IQOA 4K07A 4RAHA 2CO4A 3MJ9A 2XY1A 3VXNB 2Q10A 1I8KA 5GGQH 4IRSA 3MRBB 4NQCA 5CCJA 3OAWA 3OKEB 2WO4A 4IBYA 2F58H 4JFDA 3WEMA 3LHPL 1F2QA 5LG1A 3ULVF 4L8CA 5AOLA 4CRPA 1CICB 1HSBB 1PAZA 2X40A 2JI3A 5FYJU 5IVXE 1MI5D 3SGEH 5GS0D 1N3NB 4XP9H 4LASH 5AALA 3FQTB 4AGLA 3CNKA 2K8QA 2WMPA 1F8TH 2X12A 2OJEA 3MODH 1U91B 3RVXC 1YAZA 2RGSA 5D5MA 2VR6A 5E2TH 1IGJB 1NEZG 2CXGA 3QEHB 2VUKA 4FTVB 5DC4B 3LH2L 3NA9H 5C6WH 1O6SA 3LMJL 3QORB 5FYJD 4WWID 4XAKD 3VI4A 3DX8B 2CBOA 1JNNL 2Z31B 4HG4K 3UTOA 4H25B 1W72L 4PJ5E 5LN4A 4D7PA 3D07A 1QD0A 4XAWH 4XCCH 5KS9E 4L4TE 4DEPB 3DGDA 1ORSA 4HIPA 2WBXA 5BMFL 3W9EA 1OB1A 3GSRA 2C1OB 4GW5A 3BVDB 3K91A 4S1RH 1IQWL 1XF3A 2X0UA 1RUKL 4PJHF 4IJ3C 4HSQA 2IH8A 3ATFA 1DFBH 3HPJA 2GTZB 1OCWL 1U41A 3GSUB 4KFZC 1FNSH 2HFGL 3IKCA 3BYYA 1IX2A 4HQQH 5F21B 3BVXA 2OP4L 3ZL2A 3CZSA 2KERA 3ARBC 3D2UD 5D1XA 4U3SB 3WS3A 1TQCB 2MOVA 3EJTA 4ZQKB 4LEOA 3ZN6A 3SDXF 1YPZE 1LM8V 3DJZA 2G3NA 1CGSL 1K4DA 4MVBD 2EIJB 3QJQB 5DZVA 1ZGLA 2XJLA 3ILPA 3PWPB 4MCZA 4EVNA 3QFJB 1UACH 2EP6A 4DEWA 2DICA 2XZZA 1IJ9A 5AL8A 2BNRB 3L7EB 5KSBB 2VDLL 4IBZA 5IW3A 2DBJA 3V0WL 1Z5LB 3HI5L 2Z35A 4YX2L 2J8UF 4YXLH 3MZGB 4ZFOL 2J5LC 1ZSDA 4HH9B 4KXZH 1R4XA 2EIBA 2W0PA 3GMNA 5HDRA 5I75C 3MBEA 5EA0H 4FI6A 4MMYB 5GGRY 3QA3B 3MRIA 5D2NE 2VN4A 2JIXA 1R3LB 5IBLD 5IMLA 3KS0H 2CRIA 5DTFA 4KAQH 1KPVA 3MLUH 3Q5OA 4XMKL 4W4OC 1MIEH 3VWKB 1GGBH 1A4BA 1P4LB 2Q5BA 3QH3B 3SKNA 4HG4J 2DM2A 4MAYB 3AB0B 3S8FB 2FO1A 3O6FA 5IJVA 2ITEA 1F11A 4EIUA 3J27A 5KN5A 1RZFL 1A1NA 4RDQF 3UIYA 4HHAA 1M9WA 4I77L 4WQOA 2G9HA 2JMRA 4HGKC 1F4XH 1GH7A 1BCIA 4E0RB 4ENZA 2I26N 4H88L 2ATKB 1LO3H 2A74C 3E80A 5HGAA 1CDGA 3GIVA 1QLEB 4KMTH 1A6ZA 4PJBE 4LLUA 3QDGD 3QZWG 3TP4A 1Q9WB 2AFNA 3SPJA 2AJVH 3T65A 1I4FA 3MRMA 2OQJB 5EIIB 3V5HA 4KK8D 4N8VB 5FFOA 3FCUB 5FOBA 3C5ZC 1BYNA 4ODHH 2KQMA 5CINL 1HXMA 2JLPA 2FX8H 2X4PB 3CZNA 4OM0L 1P4BH 2Y2YA 3EH3B 1T2QH 2EXYD 3BQUA 1UZGA 3FQXB 5DZ9A 4OFYA 1T20B 4NCDA 3N0PB 3JWDC 4L18A 2WOYA 3MA7A 1HQ4A 1TTBA 3IJ8A 4EBQL 4GKSA 2ZXCA 3MJ9L 1OQXA 3ARTA 3PL6D 1HEJC 4LLYB 1OK0A 2ZIDA 4Y1AE 1P7QB 3U7YH 1T21B 4AGNA 2RHEA 3ARFA 4KQ3L 4NNXB 1DTUA 3GSOA 3GI8H 2Q6WB 4DP2X 5DMIL 2ZG1A 1G7PB 3PHQB 1GZHA 3LNIA 1KGCE 2H6UA 4PJEA 4RVBA 3F83A 5I1AA 2X1OA 2WNKA 5C0BB 3ULSB 4HX1B 4F2EA 1KXHA 3P3SA 1KCUH 3SE4A 1Z9LA 4PRDA 3KM2A 1BZ7B 3AU1A 3PP3H 1RQ5A 3PWJA 4EDWL 5EUOE 3UTQA 5ISZD 5BZDB 3IFOB 4QRRB 3KPQB 3UBXB 4ONFL 1X4XA 3JTBA 1BEXA 2A2QT 3AXIA 1KT2A 1MREL 4ZW8A 4D0CA 1DVYA 1QYGL 3N50A 3A22A 2ZAHA 3I9GH 2YRZA 3U25A 5IKCB 3C5SA 4J3WA 5T1LA 1MFNA 1D7BA 3KYMB 5DDHB 5FS5A 3CUPB 5E08L 2H1XA 4K15A 3B56A 4ZXBD 1QLFB 1AIZA 3R06B 1WEJL 5KJRL 4OZIB 1WHOA 3CK0L 3O8XB 4FP8H 3QPXL 4URTB 3NEXA 5E1AA 2OLDA 3MRKB 3P4OA 2PP7A 1X4ZA 2ZCLL 4N8UA 5LAPA 2NY6D 4GW1B 3N85L 4YDLC 3SGEI 3EYQC 3VYOA 1U8JB 1WFJA 1Z0MA 1DJIA 3D09A 5DJ0B 5IB3A 3H9ZA 4A7UA 3CZFB 5DQDH 2EH7H 2WQWA 4LVEA 2ZSVB 3RVWC 4HFUL 4CDHA 2AV7A 2QTEA 4R97C 4EQ3A 2F15A 3L9YA 3K6SA 1MHCB 3FQNB 4KO6A 3IDNA 4F8TA 1Q38A 4XTRD 2PXYA 4RQQB 1MG2C 4CADA 2JKRM 5DD3H 2XY2A 5L8KB 2C8NA 2IMNA 1MZYA 3PGDB 3UADA 2UYLB 3OWRA 2K7QA 2VO5A 3OAYK 4ZUTA 4JDTL 5MEQB 2DM4A 2XG4A 3DMMC 2P5WA 3WNJA 3DX2A 2YBRB 3UZVB 3RDTA 3L3KA 3Q01A 1X7TA 2EZ0C 1QRNA 1J1OH 2OFQA 1BV8A 4QYOA 4X4XA 2X10A 2EVGA 3L7FA 2ALAA 4HS8H 1ZT1A 4J3UA 5JMOC 1GHFH 3L4TA 3RU8H 2MCPL 1W0VA 2HVJA 2XIDA 4ZOEA 5F1IB 3NCEB 4H26A 5B4MC 2CHNA 1QKZL 4NDMA 5EBMB 3RNQB 3ZT6A 1JFHA 1RUAL 4YDNA 4WU5A 5MHSD 1C1EL 5DVLA 1DDHB 1YYML 4C59B 2Y7QB 5E9NA 2K45A 3L5HA 5E51A 1U8NA 2YD2A 5HDLA 2UVFA 3HC4H 1S5HB 4MMXC 4NPYA 3RB5A 1FVCB 1K2DA 3I3BA 2VQ1A 1WZ1H 3E3QC 4CVUA 3RURA 5FYKH 4YQXL 3JTTA 5LNEA 2DMHA 1WA1X 3TYFB 3FSOA 5IF0A 4HXBL 1EO5A 3G04A 3SCMA 2EEDA 1XGRB 1D2OA 4NXSA 1C5CL 3NOIA 4LLMA 1XTLA 3TFKC 1E4HA 4MZRA 3QIBA 3MUGB 1GA2A 4QHMB 4Z7UB 1LGVA 2DI7A 4YO0A 4YHOH 1R0AH 2J44A 1P7HL 2W95A 3PIQB 3S88H 1QX1A 1RJZA 1U3HC 3T0EC 3DARA 3M1BA 1FORH 1GSKA 3GT6A 2EDBA 1FBIH 2P8MB 5IT2H 5IQLA 4OLUH 2QSVA 1OARH 4PB0H 5DYFA 2JB5H 3PY9A 2ZQKA 3KPMA 3REVB 4UIKL 4IJ3B 3MUUA 3V0HA 5DJ2A 1QP1A 5DLMH 1DQQB 1E5CA 3A6BH 1P2CB 1PIFA 4XN2A 3CFCL 1JFQH 3N43F 2PW2A 4NN6C 2W07B 3WXWL 4OF6A 1HI6B 1ZIAA 1E4WL 1UC6A 5DGRA 1I8MA 1AY1L 3SOBL 3I6KA 2LE9A 3JWDH 4WJ5B 3S3DB 3ARBB 3QAQA 3PHSA 4GLRH 4YC2C 5TK2A 4QY8A 1GYCA 1NAMB 4H2CA 4LCUB 4DOHB 4ZPTB 5D70H 5AW5B 2XTSA 4G43A 1URZA 3J8F7 2BRQA 2NY2C 2QHRH 1QBML 3EZJB 3G5XA 4L8DA 2OYLA 3ZPDA 1TJMA 2R29A 3O0RL 1U4EA 4FYSA 5CO1A 4G2AA 5LGYA 4ELKB 2ZXQA 5FGRA 4IIQC 4MD4B 5ICXB 1UOKA 2WTPA 1ITBB 4PJ9A 4IRSC 3BYTA 5C1MB 1VHPA 1KTKE 5ITFA 4KX9A 2VDRH 5ANMB 3ROLA 1A22B 4X42A 3UAAA 5LBVA 4A7GA 4NUJA 3V7AG 1KG0B 2J5LB 5ANHA 4QCIB 8FABA 5I75B 2ATAA 1F41A 1PGRB 3IETB 3MO1A 3QHFH 4F7PB 1JF6A 2DQEL 2FH6A 2YD1A 1U0QA 4TS6A 2ZT9C 3LHPH 3MOBH 4X6DF 3CHXA 4APXA 1S7XB 4LE8A 4ES8A 4F57L 4HSAC 4Z7QF 3AM8A 2FEEL 3CN3A 4U6HB 1OSEA 3ARDD 2ZWSA 3VXME 3D50A 1YMHB 2CBMA 3K2IA 1X6NA 2IQAA 5F9OL 5M94B 5LGHH 3RTLA 2O5YL 4YZFE 5EU6E 5FYLL 2I5YL 1OGPA 1OHQA 1JK9B 4ELMF 4PI0A 3MV9A 3TJHD 1XIWA 3LH2H 4DQOL 3BH8A 3FFDA 3QISA 2A74B 4TRPL 1PLCA 1F3DJ 4OIAA 4L4VE 1JGVH 5LVEA 4LQ1A 1W72H 3NJXA 4JVWA 4U1KB 1HTYA 1AZBA 3V79C 1ICTA 2RACA 3C5ZB 4A66A 35C8H 5KYXA 3EFDH 4QEGA 1FCCA 3ZDXB 3QJOA 1YNTA 4PSRA 3MRLA 3K2KA 4BFOA 2ZXGA 4B9PA 4YHZL 4Y9EA 3GMOB 4GQPH 5D1XC 2MOQA 4XB8A 2VAJA 1QSED 2AVFA 3PV7A 4MCNA 1T5XA 1L0YA 2NTFB 5T5NG 3T4YB 2X89D 5BUPA 5I28A 4FD0A 4LIQL 2CBQA 2Z91A 3K71B 3JUYA 4LNRB 3D39E 3FU5A 5I5IA 3LVTA 2XN1A 1LK2A 1OAUH 5DYOB 5FF6A 2NQDA 3L4YA 4G8AC 1I1AA 1G7JB 5TQ2L 4UT7H 1CGSH 3WY1A 3FQ2A 3A6OA 5F7KC 2BM3A 2PKDA 2VLJE 2FR4B 3BWSA 4ZOAA 2D2OA 3WFBL 3W5NA 3ZHDA 1ET7A 3UBHA 2YSSA 1IEHA 2I9LB 3MBEC 3EO9H 3A23A 3FO2A 3MRDB 4UB0L 1W0YT 1VADA 1LP9F 4K7PX 2GUYA 4WFEE 1MZZA 5AW7B 3V0WH 2WNGA 4TUKL 3TO2A 2I9TB 4ZW6A 1RHHB 4HPOL 4YX2H 2ZOLA 1TO5A 1D6VH 2BMKB 4AM0A 3EJUA 5E9DA 5CN3A 3VFUB 5C7XL 3FPXA 3GHEL 3GRBA 4N8CL 4TNFA 1N67A 4MYWB 1OZTG 1E4JA 3BEWA 2EQDA 3IU4L 4P59H 4JJ5B 2WLHA 5D7JD 5DSCB 2V2TB 2EIMB 3O6FC 4PJXB 1J48A 4PJ7B 1M71A 3S35X 3EO1A 4XNUL 3V0VA 4WW2A 3PJSB 2OMVA 3CFKB 4L4VD 3UYPB 3PNWB 1E9QB 4P2YA 3CPUA 2YN5A 3AU0A 5FA3A 4LNVA 1W72B 4IMKA 4OCRL 2H32A 4I77H 4QHLA 4YDLB 4O02A 5LDSA 3HR6A 4Z7WB 3VFGH 5T1MA 5KVEH 2RQEA 1L0PA 3BQUC 4P2OA 3G08B 4R97B 3TA3D 3QQDA 4KNTA 2R29L 2N4IA 2WM0A 1JCKA 4GJTB 5CINH 2K7PA 3C60D 1AQ8A 3L3HB 1O7VA 4Y19B 4M6NH 2IALA 1EJ8A 2E27H 2JCCB 3IGAB 4P9HL 2WXKA 1RULL 4UUJB 3Q13A 4UM8A 1UJ3C 4Y2LA 4OZGF 3U1SL 3ARFC 3B83A 1RJCA 2A0LC 3BFQG 4PJDF 3DMMB 4MNGA 5D7IE 2HT4C 3S36X 1SVCP 4FMFA 15C8L 1J8RA 2R23B 4JG9A 3UTTB 3BWAB 2CK2A 1JV2B 1GZHC 3P9MA 3CBJB 2Q7NA 4MBOA 4XXDB 1IBFA 3WE6B 5IQMA 2QSCL 1F3RB 3HC0A 3R4DA 4FQCH 3IU3B 4X0KA 1WIUA 4KPHL 3MROA 4BFRA 4RMWA 4NM4H 3BD3A 4BFIA 2KPNA 1J5DA 1LEGA 4I8DA 3APCA 4UQDA 5CEYA 4H1LG 3SY0B 1DJGA 3P9LA 4WFED 3DROA 4PW4A 3ESNA 3B7SA 1TYJA 2VDLB 4ZAKD 3STLA 4JFHD 5A7BA 2NTSP 1T0MB 1KGIA 1R24B 5TE4H 3RL2B 4EMZA 4JZOB 4BEIA 4U2ZA 3EDJA 2X87A 1C16B 4P07A 1FL6A 3NCMA 4IS6A 4R5VA 4ZFOB 5EIQA 4WKZA 2C1PA 4BFBD 5I26A 3EYVB 4OLXH 2I85A 5H2BB 4MMXB 3D6GA 1PZBA 4TSAL 4MX7B 2VMEA 4ONFH 5FA4A 4KKLD 5KAQG 5DZNA 1SYSB 1U95B 1PCXA 1TQVA 2UWEB 4G3YH 1VFAB 4BSWB 5KVGL 2BJML 1S7WB 5J6GA 2RJMA 3TH2T 4JRXA 4ZTOH 1FYTA 1M57B 1I8LA 2PYEE 3ETSA 1T1ZB 1JXKA 3L9BA 3W0WE 3D34A 3QXVA 2HT3C 1U3HB 3T0EB 1C8QA 1WCQA 3H3BC 4NSKA 1H0DB 1WRFA 2AQ3A 4TOYL 1WEJH 2XU9A 1OK8A 2CUAA 3EH4B 4J2QA 4OB5L 5IM7B 9PCYA 3CK0H 4PJCE 5L4FA 1I1YA 4BQCA 5A2LH 3C2AL 3QPXH 1HXKA 1N26A 2DKMA 2J20A 1FE8H 2Q86B 3RPIB 3W9DB 2GTQA 4UQ3A 4R7LA 1NGQL 3TL5A 3ABGA 2ZCLH 4NN6B 4TQEL 3NTCH 3LS4L 5FO7B 2CHDA 4PJAE 1CQKA 1A4JA 5IB1B 3N85H 2DKUA 2PXYC 3BZFA 5I2IA 4YC2B 4ZSOA 3BP5B 4S10A 2J1KA 5IIEB 3SGJA 2VLKD 3ZTCC 4HFUH 1VB9A 2NY2B 1MFBL 5DEFB 3WD5L 1E50A 3U6XS 1ZVHA 1Q4NX 3RDTC 2NNFA 2IH1A 5DC0A 4IIQB 5E7BA 5CGTA 4AITA 5CR8A 8PAZA 3TO4A 4BQBA 2APBA 2VDPL 5AZ2H 5K9OA 1I8KB 4GI6A 4IRSB 4NQCB 4JFDB 2AXJA 4JDTH 4TNWK 3ESUF 4L8CB 2AMGA 3PREA 4XVJL 3BP6B 4HAFA 4AE0A 2AZUA 1EERB 1BAGA 3NSCA 5BRZA 3ZXAC 4NQUA 5EN3A 4W70A 5MEND 1OLLA 4P04A 4RCAA 1S9YA 2Z34A 3W3BA 4JO5A 1YEEH 1CLOH 4OCSL 3T3ME 1CGVA 3WO4C 1K72A 3HA0A 5JHAA 1SDYA 2OJEB 3QFGA 3D25B 4GXVH 1OOAA 1G0YR 3KPRE 1MFEL 3P3YA 1HKLL 2Y7SA 4KX8A 3TC9A 1O6SB 1JHLL 1ZVYA 4B9GA 1CK0H 1RUAH 3KS0J 2NQ3A 3VI4B 2VDOL 1C1EH 2CPCA 3QJHA 5GGTH 2VTFA 4X6BA 3SCMC 3D3VA 4OCYL 4O02L 3FZUD 3W0WD 3QIBC 1UD5A 3FOLA 2WCGA 4KNSA 4NN5C 1ORSB 3WXVL 3MX0A 4POUB 4YQXH 1YNKL 5E8DL 3VNZA 5ICZA 1OB1B 3GSRB 1CFTA 4HXBH 4P99A 5L8JB 1I3GH 4S2SA 4GW5B 4BSVA 2FJGA 1U6AH 4HIHA 3STZA 4BFNA 1XF3B 5IHUH 3HPJB 3P30L 3QDMA 3U7WL 3FQRA 3S5ZA 4P57A 2Z4QA 4AMKL 4PREA 3U79A 3HUJF 5DRWA 3IKCB 1OW0A 2IOOA 2VDKH 2WVUA 4MBRA 4S1SL 1A3QA 5GISL 1EMTH 5D1XB 4QNPE 4M29A 2A6DA 4I1NB 3WS3B 4ZX6A 3VX0A 1CXFA 1T1YA 5JIQA 3F7PC 4OU3A 1K4DB 4JKWA 3CFCH 1ZGLB 1OF2A 3CDYA 3ILPB 4MCZB 4DW2L 4EVNB 5DD6A 2FEDD 1E4WH 3JUZA 3CDGA 4GQ9L 1AY1H 3SOBH 5CBAA 3CLWA 4WWOA 2A9AA 2WV3A 4FXKA 4CU6A 1YC8A 4P9HC 4PJ9C 2IBZY 3UTSD 1I8IA 3MNMA 5F3BA 3CVIL 4XE0A 4RMQA 4LCWA 4QPEA 4Z3FA 3FAWA 2Z35B 4BUHA 2PO6D 1HHIA 5F7UA 1QBMH 2IANA 5CEXA 5EBGA 4WY7L 1ZSDB 1ZRUA 3GMNB 5B7FA 1AKJD 3GTVA 3FO9A 3MBEB 2E76C 4J12A 4OVUA 3MBXH 3MRIB 4ZZFA 5JLZA 2JIXB 4ZX4A 3VH8A 1AR1D 3KPRD 5IMLB 1L6PA 2V8MA 5DTFB 1KPVB 1BIHA 5GGRA 3AM8C 3IS1X 4NXKA 4TVSa 2VQ4A 1MQKL 4KO9A 4XWOC 1LO5A 1UUNA 4P23D 1RH8A 1IT9L 4PJGF 4X9FA 3SKNB 3KYKL 3D7PA 4NQVA 3O6FB 1QI4A 5IJVB 3IMBA 3NT0A 1F11B 1WAAF 1QBAA 4GRWE 5D96C 1A1NB 5KN5B 4HHAB 4F57H 3DIVA 2G9HB 4M7JH 1XIWC 2C9PA 4D9RE 4O2EA 2OAAA 5AW3B 4L5FE 1TU2B 3O4LE 5HGAB 3GIVB 1MPAL 1A6ZB 4LLUB 2I5YH 5FYLH 5IQNA 3T65B 3O81A 1I4FB 3FCBA 3MRMB 4LEXH 3V5HB 1LYQA 4CILA 5FOBB 2H3XC 3FL7A 4QOKE 1J5IA 1HXMB 2AQNA 5HY9A 2FX9L 3KPPA 3UROR 2WLMA 2HUHA 4TRPH 1S7RA 5IVOA 5DO8A 3PJNA 3X1NA 4PV9A 3X12A 1SOSA 1NC2D 2CUHA 2X5PA 2QQNL 3BQUB 2D7TL 2F7IA 1BP3B 3MLRH 3MA7B 1T6VN 1HQ4B 3X2QB 2MTPA 5I0DA 4GKSB 4N85A 1BOYA 3B6SA 4F8PA 4TYUA 1SXSA 4FERA 2PLTA 4XNXL 1UJ3B 4UQCA 2WLYA 3ARFB 4S11A 3ZKMD 3GSOB 2C5DC 2XPYA 3U46A 1DVFA 2ERJC 1MCDA 4NZFA 3PF2A 1NOFA 2CLRA 2F2HA 3MV11 2Z3FA 1I1AC 4OLWH 1J05A 2MNUA 4PJEB 3WFDH 5I1AB 5JXAH 4MSWA 1XSJA 4OCWH 2ZAIA 4LRNH 3PDDA 4PRDB 5FW7A 3AU1B 1TENA 3PWJB 1INQA 1BAFL 3UTQB 1AOZA 2IIJA 5GZNA 5TQ2H 1N0LA 4JUTA 4GMTL 1KT2B 2QADD 4D0CB 1WT5A 2YGOA 3QRFM 2BSEA 4PYHA 1DVQA 4YHML 4HLZH 3W11D 1AHWA 3C5SB 3E1ZA 3L6FB 4PWJA 4ZO6A 4F5CA 3OF6D 5T1LB 4UB0H 1NJ9A 3SY6A 4O9HH 5KVDL 5C08E 4LL4A 4TUKH 3TCTA 3GSNA 3RVTC 2G4GA 2Z1PA 4LKXA 2EDLA 3FCSA 5ID0A 3FT9A 4K8RL 5E2WH 4JFFA 4KOBA 2E9JA 3I9PA 4WW2C 3O4LD 1GVIA 5SWQA 3HJEA 4RRPG 5E1AB 5F7BA 1EWHA 3IU4H 2QLYA 2GSMB 2P48B 3JVGA 3P4OB 3LSOA 3PXHA 4JN1L 3MV7E 1ACYH 1EDYA 4NO0A 3UYRH 2EC9U 3DIFA 5DUPL 5SWSD 4QRPE 3I6LE 1AXTL 4FQJH 3KPOA 1BQ5A 5AL0A 5IB3B 1KCBA 4DZ8A 5EF2A 2MRYA 1VCAA 5I1CH 1TETL 2AV7B 4P2OC 1JTOA 4TQHA 3K6SB 3IDNB 2B9BA 2PXYB 3OV6A 2NDGA 3APFA 1D3CA 4CADB 1RPUA 3SGDI 4K3GA 1MW3A 3ZDXF 4J3BA 4YIQA 4ZUTB 4NT6A 1DJWA 2XG4B 2P5WB 4EZKA 3X3FL 3RDTB 1QBLH 1QRNB 3J7HA 2W92A 5EIVA 4QYOB 4R26H 4X4XB 3VRJA 3L7FB 2A9ML 1GZPA 4EF3A 1ZT1B 4Q0XH 3EJQA 3F58H 3K6OA 4FI7A 3S8GB 2VM9A 1M2VA 1W0VB 1YEJL 2HVJB 3RJDA 1TZOA 1KEML 4JB9H 2YEQA 1NDGA 3QEQE 3O9WA 4H26B 2EXSA 4NDMB 3QWRA 1ZS8A 3EBGA 3DSNA 3WMPA 3LKNA 1QSFA 4JGNA 2QSCH 1UHVA 4I18A 4WU5B 2WLIA 1ZK5A 4KPHH 3WO4B 3ZDZB 3MLWH 4JRLA 3LH8A 1FUNA 6CGTA 4BFJA 1U8NB 1LWHA 3F84A 4NPYB 3WKYA 1A6TA 1K2DB 2VQ1B 4KJPC 1U8IA 4WHCA 3NFPA 3JTTB 2JF1A 5C0JA 3KXFA 3UPRA 4JW3A 2GBVA 5IF0B 1Q0EA 3WV0A 1A25A 2AQRA 2Z7YA 3G04B 3HMXH 4ODBD 5BUGA 4XP1H 3SCMB 1HVXA 4IOSD 4OCXL 3U4BL 4LLMB 2HRLA 4JHZA 3ZR5A 3ILQC 3WTVA 4UV4L 2BLFA 3QIBB 4YO0B 4NN5B 1CFVL 3MV7D 4JMNA 4DAGH 3ESMA 5JIPA 1UWEH 1RJZB 1I82A 2QSTA 2Z8VC 3M1BB 1EHLL 3I6LD 2RH0A 4Y5YA 2ARJA 3O6ML 3T08A 4HDIA 4PJ7F 4PRBA 1O7DE 4YEFA 3O2DH 3KPMB 1J0HA 1D2PA 3OZ9H 4YBLC 2UVEA 1Y0LA 2Z64C 4DESA 2CA4A 4YBQC 5DJ2B 1GR7A 3H9YA 4HA1A 5JO5A 4AZUA 5JUEL 2PW2B 2XA8L 3PRZA 3ZU8A 4NS0A 3ZKND 1I8MB 5HYIA 2WK2A 4OF3A 3I6KB 4PVMA 4F5CE 4W9IC 1MDAA 1TNMA 1FG2A 3C2AH 3GHBL 3RHWK 3T2NL 1UWGL 4QY8B 1UURA 2PPFA 4CVWA 3SGJC 1NGQH 3MLVH 2VN6A 1P53A 5ECGA 4G43B 2F68X 4WK0B 4WHTA 1W91A 4ESKA 4KXCA 4PS3A 2WZAA 3ZL4H 2P8PA 3G5XB 4L8DB 4LOFA 3H7BA 4OF5A 3NSYA 3IMVA 5DK3A 3KLKA 5JR1L 2K4AA 4W93A 3ZLQC 3TO4C 2FX7H 4GQRA 3VQ1C 5DZJA 3Q06A 4AG4L 4PJ9B 3KH3A 4JHBA 2XKUA 1JERA 1QABA 2D0GA 3VI3E 2JCCF 5ITFB 1AE6L 3ROLB 4Z0BL 1YY9D 5BOPA 3QEQD 3JT2A 3SO5A 4NUJB 3QR2A 2FHCA 2VWEE 4YGAB 3ZRCC 2E6QA 2DWDA 8FABB 2J4WH 1E30A 3EHBD 3MO1B 3QG6A 4N6RA 1JL8A 1BD2A 3GSNL 2VN7A 2YA2A 1GY2A 4XVJH 3OKYA 4BZ1A 3CLFL 3S7GA 4APXB 1DE4A 3A21A 5CP7A 3IYLW 3WY2A 3D48R 1SOQA 2IQAB 1NCBL 4GMSH 3RP1A 2NNXA 4OCSH 4NQTA 5EZLA 4TQ8A 3VVWA 2WYHA 2E7LA 5D96B 3MV9B 3V2AR 5J8OA 3VD2A 1MFEH 4FG0A 1PG7X 1XIWB 2FE0A 1NLBL 1JZGA 4KRLB 1N68A 1JHLH 1SN5A 3BH8B 3DJTA 3FFDB 1A3RH 4Z18A 5KYWA 3U48A 1FGNH 3X11B 2VDOH 4C8XA 2PCFA 2E47A 4N9OB 1G1CA 4XPGH 2NDFA 2YN3A 3L9EA 4AW7A 4K8RC 4HBQA 2H32H 1A2YA 3R4RA 1DQML 4XNZC 5KYXB 2E4FA 2H41A 1JGUH 2CM5A 5E5MA 1YNTB 1BQLH 5HVHC 1YNKH 3MRLB 3CN0A 5E8DH 4RAUA 4HKJA 1OW0C 1D5BA 1SJXA 2VERN 3DECA 4Y8AA 3N42B 1OM9A 4GFTB 2D73A 2NY1D 5EV7A 4B9YA 2QVIA 2ZCKL 1DBJL 1NFDA 2F1AA 1DVTA 4YSOA 1T5XB 3BGFC 3SPHA 2JH2A 1UKQA 2QZ5A 3HMWL 4FHJA 3P4NA 1DQDH 2AJZB 2Z91B 1UG9A 1I1FA 2IOIA 1HSAA 4ELDA 3WS6A 1LK2B 4X4ME 2ERJB 3MLXL 5FF6B 1XCQA 4FXKC 4X5RA 2AAAA 4BCXA 1I1AB 3VXUE 4DP1X 2YRLA 3FNKA 3K46A 2D31A 4KITB 3UO8B 2H47C 3BN9D 4WFFE 1MRFL 2CM6A 2VXSH 4DW2H 3E8UL 4NN7C 2PW1A 2HKHL 3QS2A 3SIKA 4CW1A 5BO1L 1AI1L 1IGYA 3O4OC 4LSRL 3W82A 2E9WA 2JV6A 3LCYA 2YSSB 3F7KA 4WI4A 3FO2B 3V0GA 5C0CD 1VADB 2VDPB 2X2YA 3GEWB 5HXMA 3ABKB 3OKNA 4APQD 3TO2B 3KJ6H 4R2GD 5AUMA 4EI5A 2GKIA 2ZOLB 4WY7H 5I6MA 4FLOA 3KAAA 4AM0B 5E9DB 1EO8L 2Z1KA 5D1QD 3ULUH 3WLWD 4B60A 3BEWB 3GS4A 1HWWA 1YMME 1KGXA 4AMXA 1UUSA 3MR9A 4F7TA 4ZMWA 2Z0UA 1CD8A 1JZIA 1M71B 4WZ9A 2XN0A 3EO1B 3SBWA 3V0VB 4MB1A 4WW2B 5D5MF 2OMVB 5DHMC 3RIFF 2WKOA 1U8PA 3TBVA 1VLXA 3KYKH 4NQEA 3T2PA 2BVPA 2VDOB 4CVXA 4HFWA 5FA3B 5KBNC 5F0LB 2H32B 1UA3A 1GPOH 4FQIL 5ALCL 4QHLB 1T80A 3NIDE 4O02B 1EVTC 3MNWA 2DQDL 5HHQA 1WZAA 1PLAA 4WUKH 1X5YA 1MPAH 3FQ1A 1JXGA 2FNWA 4A68A 5HVGB 5IQ9A 5T1MB 1SN2A 1WZMA 4DGIL 2RALA 5BUAA 4P2OB 2BIHA 2VISA 3QQDB 1JPSL 4PRAA 3HE6D 2R56H 2X6AA 4BFGA 3BKJH 4Z8FH 5AW2B 3TF4A 2FX9H 1P0SE 2IALB 1NANH 1JK8A 5EBLA 3APNA 4UM8B 1PCSA 3RWFA 3RWJA 2X6UA 2D7TH 4MNGB 5C8JA 1DVFC 4IKLA 1XGPA 1N6VA 4Y5XA 4EXPX 3HNSL 1A6WH 1EEQA 3P9MB 4NZUL 2V9RA 4PQXA 2W0KA 3HC0B 2EYSA 4DKEL 4X0KB 1V3LA 3LIZA 3PWVA 2DH3A 3EJYD 3MROB 5FHBL 1R3HA 4OIFA 1WO2A 2XBTA 4BFIB 1LEGB 4BZ1L 5GS2H 5F88A 1A7NL 5CEYB 1QOKA 3P9LB 3TBBA 3DROB 5H35A 4OR1A 3K81A 1E6JL 1LMKA 5D2LA 4PS4L 2R59A 3STLB 5GZNC 5JW4N 4FFVD 1AO7A 1IRAY 4Y2DA 1WT5C 2Z0BA 3US1A 4RMSA 5I8CA 1GZQA 3CHPA 3QCVH 5CU5A 3O45A 1FL6B 4IS6B 4IMLA 3K6IA 4WKZB 1AHWC 3SGKA 4O51A 4N5ED 3WTSA 1BAFH 1YMMD 2JQZA 1PZSA 3GINA 1UOLA 4I3GA 3VXTA 2GSGA 3H85A 5MERA 1KEGL 1AC0A 2XQBL 5FA4B 5F7FA 1MAKA 3KYOA 1GYVA 2B2XL 3ATAA 3HZKB 3L1EA 3RG1C 1IGMH 2FJSA 1ZCRA 4WI6A 4R5TA 5J6GB 2YLKA 4HWBA 4JRXB 1FYTB 2P42B 3DDGA 4KY1L 3EJZC 3Q9QA 3E38A 5JHDE 4EIZC 2O26U 1YLBB 1T7YA 1P4IL 3DOSA 5G55A 2D03H 3JVGC 2QMJA 5IBTH 4BWTA 1D7DA 4LRIA 4JPSA 3DC0A 4AK1A 4NSKB 1QNIA 2MTAA 2Y23A 3EJSA 1YC7A 1YEKL 2TAAA 1SF5A 1RIHL 3EDEA 4NUGL 5DR5L 3SKUD 5LHDA 4FQ1L 1I1YB 1MVUA 4N1CA 4YBLB 2BCKA 4B50A 4UQ3B 2OA9A 1FI8C 2VZVA 4ZBJA 1QUNA 4LSQL 1JI2A 4WU7A 2B3RA 4KY2A 4FJYA 2YPVA 4PHXA 4DUXA 4LL9A 1D5ZA 3EIFA 3FTYA 5DUPH 1IBGH 4BE6A 1WDAA 5B7MA 2YJLA 3BZFB 5I2IB 4ZSOB 2PP8A 2CK0H 2IMMA 2VXTL 3N3EA 1UD6A 3RFZC 3MHZA 4RWHA 3D0AA 2XDHA 4B5EA 2R0LL 3A0OA 1TETH 4GRLA 3MCLL 1PX4A 2WQRA 4M1CC 3NIGF 2J12B 1H9VA 1W8OA 3ARYA 3COOA 3TO4B 5K9OB 4OW6A 4I3SL 2AF2A 4X6EA 1R75A 3Q43A 2WWMD 4GUCA 3MNZA 1XGYH 3X3FH 2GJ6A 3V9CA 5BRZB 1KY6A 5D7LD 4XPHL 4QHPA 3L5WA 3H9HA 4LSVL 5FW8A 4CU7A 1S9YB 4I18C 1PMYA 2XTJC 3DTUB 5IVZA 1MCLA 3KCWA 2ESVA 5CNHA 3Q6GH 2YGPA 1YEJH 2HFFA 3L1GA 2YUXA 1KEMH 5F7DA 4X0NA 2H9GA 2E0PA 4OD1L 3AQZA 2NQCA 1TZGH 4Q8BA 2GAZA 5B1BB 1NEPA 3QJHB 3WN5A 4JR9L 4YGVA 6TAAA 4A2LA 4X6BB 3H1ZA 1THCA 3V6OA 3FCTA 5CJOH 3D3VB 1HKFA 2VCOA 2NRDA 2YKLH 4JG1L 5LGJA 4AV5A 3FOLB 1MI5A 3MX0B 4JM2F 2O5ZH 1P5UC 1TTGA 1L9RA 4GEJA 5ICZB 1W9XA 2FT7A 3H9SD 3B7RL 1CFTB 3WAJA 1BQHA 3QO0A 4S2SB 4Y5YC 1X4YA 2FJGB 4BSVB 1TUPA 4OCXH 1L7TL 2V3DA 4XNZB 8CGTA 1CYGA 1P9MA 2Q76A 4LESA 4RMBA 4UV4H 1DANT 1L9QA 2X4UA 3LQAL 3QDMB 1CFVH 3FT3A 3LH9A 1AGCA 3FQRB 4P4KD 4P57B 5HVHB 2Z4QB 4PREB 4UT9H 3UDWC 2ZOWA 1EHLH 1TYEB 2PABA 5DRWB 4GIOA 2ZWNA 5E6YA 1GL4B 4NUMA 1E5ZA 1RAMA 1FPTL 2E86A 5KVFL 3S98A 5IMKA 1T1YB 3KJ4C 1RUQH 3BGFB 2IDUA 5BOJA 1OF2B 2XA8H 3LIZL 2Q7YA 1EQWA 4NHCL 5DD6B 1NAKL 4NGHL 3CDGB 2G4EA 3Q6FA 5IQ7L 5CBAB 3U6XA 3T2NH 4FXKB 5KG9B 4OIIL 5JPNA 3D51A 5B8CA 1YPZF 3WU1A 1I8IB 5GRVK 5F3BB 2VZTA 4LCWB 5IJBC 1HHIB 1FO0A 4NN7B 5CEXB