1XQ9A

Structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
b'MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoglycerate mutase
publication title Structure of Phosphoglycerate Mutase from Plasmodium falciparum at 2.6 Resolution
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 75
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1xq9A00
2P6OA 3D8HA 2EOAA 1E58A 3NFYA 2A9JA 3ZHCA 1DKNA 2HHJA 2RFLA 3R7AA 1FBTA 1SKAA 2WNHA 1BQ4A 3HJGA 4JODA 1BIFA 2P30A 3QPVA 2I1VB 3MBKA 3K4PA 2AXNA 5HTKA 1DKPA 2YN0A 2ENUA 1RIIA 1YJXA 2P2YA 3E9EA 1XQ9A 3DB1A 2P9YA 2P77A 3IT1A 4FDUA 3FJYA 1C80A 2P78A 1K6MA 4AROA 5CU7A 2YN2A 4GPIB 1C7ZA 1V7QA 5AJZA 1RPTA 1QWOA 2GFIA 3NTLA 2OWDA 4QIHA 5HR5A 1H2FA 4D4KA 1DKQA 3LG2A 3QPWA 4IJ5A 4E3WA 1DKMA 3FDZA 4PZ9A 1T8PA 3LL4A 2WNIA 5AK0A 1DKOA 1IHPA 3E9DA 3IT0A 3GP3A 5PGMA 1SKBA 4IJ6A 3MXOA 2H0QA 1FZTA 3FDZB 2P6MA 3GW8A 2DWOA 3F2IA 4ARSA 3E9CA 5CDHA 3IT2A 2OWEA 1DKLA 3C7TA 3EZNA 4D4MA 5AJYA 2IKQA 2A6PA 4TSRA 2ENWA 1BQ3A 4EMBA 4D4JA 3OI7A 3IT3A 3K4QA 1QFXA 1RPAA 1V37A 2F90A 3EOZA 4ARUA 2P9ZA 3DCYA 1NT4A 3LNTA 4HBZA 1ND5A 5AJXA 1SK8A 2HPAA 4ARVA 2EKZA 4JOBA 5AJVB 1H2EA 1TIPA 1QHFA 1UJBA 2HIAA 2H52A 3KKKA 3QPUA 3O0TA 2P75A 3D6AA 1UJCA 4EO9A 2P2ZA 1C81A 2P79A 5CX4A 4ODIA 5AJWA 2WU0A 2EKBA 2DWPA 4PZAA 2PA0A 4D4LA 1YFKA 3F3KA 3PGMA 4GPZA 4JOCA 4MA4A 4FDTA 1SK9A 1E59A 1ND6A 2H4ZA 2BIFA 2P9FA 3BIFA 4PGMA 1CVIA 1EBBA 2H4XA 2QNIA 3D4IA 3GP5A
chains in the Genus database with same CATH superfamily
4MV6A 3L06A 2IW1A 5JTUA 4BNTA 2ZXEA 2IBTA 1DKUA 3HDTA 3RBVA 2YOGA 3E3AA 3JVUA 1MUUA 2AJ8A 2P4SA 3T4PA 4WKCA 4IMIB 4HGPA 4WWHA 1A5SB 3H6GA 4M9RA 1V48A 4NFSA 3RF6A 4HCJA 3WRWA 3FHLA 3UUGA 2RJOA 1XZCA 4QUDA 5EKTA 2JGDB 3LPNA 5HFNA 4WADA 4C08A 3HV2A 2OCLA 1AV7A 1IN4A 1DC4A 2R66A 3JWPA 4RHUA 2E21A 1MB2A 4XVHA 1UPTA 2D1QA 3U81A 2WF8A 2VP3A 1NUSA 4X71A 4HD8A 3CRMA 2GO7A 1E8DA 4NPAA 5PNTA 3IBFA 4FNMA 4BLTA 4AMZA 1B15A 3ZCPA 4XRGA 1TJPB 1PYOA 4A36A 1RP7A 4ARCA 1IYZA 2J3QA 1OWLA 1HDGO 1GT91 3TW4A 2C0CA 4EG1A 1T5DX 4AY6A 1ODTC 1GR1A 2VT3A 2UZ4A 2P1DA 4TV8B 1PJ2A 1SCJA 2PANA 1JVBA 1GPAA 1KBQA 1FMTA 2IV2X 4ZI7B 2VRCD 5ED0A 3HDVA 3KHUA 1JQJC 2V3WA 1CIJA 1RP1A 3B5IA 1ISJA 3KT6A 5FNVA 3SEQA 4F2PA 1GN9A 2WSIA 4H7DA 4HKTA 1Y1TA 4OXIA 4KWHA 1MABB 4MV0A 4B7CA 2IGBA 4DNFA 5BORA 2PZGA 1DAIA 5EQDA 1NC3A 2PZLA 1JA1A 1ZI6A 3CIOA 3TLZA 4Q5IA 4EGJA 1RLMA 5DTRA 2Q1SA 1SN7A 4MPRA 5IW8A 5BOVA 2OPHA 4CTOA 3QJ5A 1H8HD 4GYKA 3HJFA 3SSMA 3KPWA 3OECA 1PS0A 4KQMA 5J3JA 3KHSA 3WGMA 4G37A 5JRDS 2F90A 3ZCRA 2IH5A 3HB4X 3SAJA 4I4IA 3F46A 3HNPA 1R6BX 2W2PA 2BM9A 1D7OA 3QKRB 3OLXA 3HCRA 1MC4A 3PNOA 3QE2A 3JS5A 2QU7A 3L8YA 1TEHA 4EZBA 3VR4H 4LRQA 4FD3A 4MWBA 2EAUA 3F96A 2BEUB 4PPQA 4U7HA 1RWOA 1YS7A 3HA2A 4BRZA 1H9BA 2JGKA 4KRYA 7REQA 4BVKA 4IHKA 4JLDA 1UDXA 2HBYA 4PLFA 3B9RA 3JWJA 1JMYA 3DCJA 2B0JA 4JLBA 1VMIA 1WU8A 1NVGA 1YQGA 2CSUA 2WAXA 3C70A 4H1HA 1XF9A 3GN1A 1IAVA 3ORSA 2RI6A 3GFSA 3IEKA 3PSHA 2ZAOA 4R2IA 4WX2B 3FWKA 4JUCA 1GUFA 4GO1A 4EUHA 2O0MA 2HF9A 2B94A 1P8JA 1ZIPA 2XUKA 2FMKA 2PX6A 3OCYA 3GAAA 3R5JA 1PW7A 1EG2A 4BJ6A 1RBYA 1H3FA 1K9SA 2BI8A 4BU1A 4EHNA 1SKMA 4KIFA 2OOKA 5IP5A 4R81A 1NR1A 5KUTA 1UIMA 4RZIA 4F3KA 3KFVA 2GN0A 3AB7A 3BDVA 1FYWA 5AW5A 3ONDA 1UR5A 2J9ZB 2HK6A 3QPVA 3H8JA 2Z8XA 2RJNA 2XDWA 2X86A 5HTKA 3PQ4A 1M2KA 4GIBA 4NOMA 1DAGA 3IEIA 1BGXT 1SCBA 1S2OA 1YWGO 1Z26A 4NS4A 3RNOA 1SXJE 1TUBA 3F0TA 3T4XA 4FW8A 4V2IA 4AJIA 5J2TB 3FY4A 1TECE 2HA2A 1SVOA 5DYWA 1BFKA 4AQYB 3QXCA 2QA5A 5JATA 2P9JA 1NSFA 3KSRA 3L79A 2IDMA 2FN4A 5EP4A 4YUAA 2PX8A 1E5QA 1YU9A 5K4AA 3IMFA 3AM4A 4BFLA 1NT2A 1SXPA 3ONVA 3UWPA 5ICMA 1R88A 1PP4A 4NBTA 3A05A 4RK6A 1MIHA 4EQ6B 2HA7A 2PS9A 3ZYCA 5JSUA 4I66A 4X97A 1SUWA 3EXG1 3UVEA 4TV9A 1QP8A 1U28A 4OYRA 4X91A 5TB5A 4EY5A 2P2SA 5IT5A 5HMMA 1Z3IX 4GWGA 3P4UA 4H35A 1MH9A 1ZNYA 2QT0A 4C4AA 2ZCJA 1P3Y1 1QIHA 1ZUNB 1IHPA 4P7BA 4NCJA 3KYDB 4RACA 3EA5A 5DX1A 3KKLA 2BLLA 1D9XA 2A14A 3I5XA 4NBNA 2EYQA 1R5BA 3TRKA 3PB3A 1L5KA 3MQ2A 3C1UA 3NZEA 3WMXA 4DAEA 1K6EA 3SM9A 5JXHA 4P5PA 2OENG 1UXOA 3SZUA 4WTOA 5DBOA 3S99A 1MXHA 3U44B 4PLPA 3VZSA 1OX4B 4OUKX 3OEWA 1Z5UA 5AICA 2JGIA 3BFKA 3DWIA 4FEAA 3SHTA 3BC1A 2MCFA 2IYEA 4G9BA 3RKUA 3TK1A 3GAMA 2IU4A 4KLRA 5JYBA 1TM2A 4ZV9A 3P2YA 1T2DA 3JQBC 3ASUA 2NXCA 3H5VA 1II8A 4EZIA 1VPVA 2E49A 3O9MA 4FDVA 4WZBE 3S2IA 4L8YA 4X45A 5FULA 2O7RA 2XVMA 1ZISA 2Q3DA 3FFXA 5FA8A 3LDHA 2XNKA 4X93A 4EJSC 2JFYA 3AT1A 2Z57A 4KN6A 1ZOPA 3A4VA 3LTNC 3DMTA 2WHYA 1WXFA 4G1EB 4WZAE 2RG7A 4F60A 2HN9A 1QG4A 2JL1A 2NTEA 2PU7A 4NCNA 5REQB 4XD7A 3PWSA 3T4UA 2CK3D 2ZAYA 4I1IA 3UMMA 5AIBA 5CFQA 4HGZA 2A9RA 2A5DA 5FLEX 3TAXA 5IABA 3K9HA 1I5OA 5JC1A 4LSZA 2DPXA 1W5SA 3GQBA 5AKZA 5TSDA 1KC3A 1TJ3A 2JBAA 4KPEC 1WXQA 3CX8A 1QV9A 4X85A 2JAPA 2VH2A 4UPVA 5HYVA 5KYXA 1VIMA 3FYUC 1OVGA 2R5WA 2YHIB 1RE1A 1HYBA 1KMCA 2HCTA 4DCSA 4N18A 4YMGA 4JI8B 4LXHA 6LDHA 3F6RA 4F3YA 3N8DA 5KYWB 3G2IA 4WN9A 2HPZA 4DYDA 1CY1A 2ALJA 5JNRA 1T4GA 1JJ7A 3BWXA 3GG2A 3HKDB 4ISCA 4C0HA 4B9AA 4LV5B 1C9YA 3ABRB 5AVUA 3FUUA 3UWMA 2ZYGA 5IXYA 2W6JA 3KJFA 2NU9B 1P1FA 2W6MA 1JHDA 1M1YE 1PWZA 4BQNA 4CKCA 2EGUA 5BUCA 5JNUA 1D1PA 1B6RA 3P0EA 4C22A 1W36C 1HI9A 2HXGA 2GPAA 2FZVA 1NUAA 2B8TA 2PKEA 3B1JA 3OFNA 4MS3A 3HVRA 1E7SA 1MC5A 2PGJA 5K6TA 2B1GA 3WYBA 2CSXA 1EGMB 1YZVA 3AR9A 4PBTA 4EF6A 2LD4A 1XHEA 1J0CA 5I7FA 2AR7A 1W76A 4JP3A 5TT0A 1J8MF 3TH5A 3ZU3A 4YV7A 5E6RA 2H1LA 3ITEA 2NZ8A 2CMFA 1T0BA 1IZ7A 1IONA 3S68A 4HQFA 4EPTA 2JI7A 1DJMA 5HIAA 3ACBA 1KHHA 1KOFA 4MI1A 3WB9A 3ZK7A 1H4TA 1PQYA 1DUSA 2H4YA 4HZGA 1XZNA 3MAJA 3AIMA 3IQIX 4GLBA 4B3XA 1Q84A 1BCSB 1UM9A 1HYQA 1S4MA 3I3SR 5CK5A 1AGXA 1O6GA 2V6GA 4RZSA 2XOKD 1Y9DA 3R3WA 1MDBA 1E2GA 2GSDA 3TXAA 3ZY3A 1F06A 5HP4A 2FPWA 2R4UA 3OEED 4HMQA 4IQGA 2NO0A 1LH0A 3I6YA 4MA5A 4TXMA 5L3VA 2J6HA 5DB4A 2RCYA 4DG8A 1JFTA 1BJRE 3MERA 1OXTA 4V0LA 4Z51A 3AVWA 1AT1A 2G06A 1LWNA 2GF0A 2GR9A 4YRPA 5HF5A 5I7SA 4F3TA 1AQUA 1O9BA 2QJRA 3HRIA 5CT8A 3OCUA 3VGJA 1EFRD 2C8LA 2SBTA 1JEQA 1YSCA 3QLUC 4GX5A 5A71A 2X9GA 3KPUA 1G3RA 1G20A 2YJ5A 4TVOA 4NU8X 1VTKA 3H5LA 4KR6A 3H4IA 4XQEA 2Q2NA 3RVSA 3HXPA 5LNK1 5TQ0A 4DCTA 5CLQA 1GZDA 3B13B 1WAMA 1QQ6A 3ZHBA 1EUCA 4MW6A 1IEWA 4LJ8A 2WYOA 4CR8A 2WTBA 1NMXA 1IZ8A 2F3SA 2P65A 2EFJA 3OY7A 4KFUA 4XWYA 4EKGA 2Q2VA 5B2FA 1CQZA 3DFFA 3L43A 4RMJA 2JS7A 4ND4A 5COQA 4AS3A 5BUQA 2NO9A 4UMEA 1F0PA 2BGJA 3GRCA 1V11B 1YVEI 2FE1A 2HY7A 4BN4A 5C8YF 1JFSA 1V9CA 2QRKA 3E03A 5DOZA 1DDOA 4TRJA 2ZJZA 5FUWA 3IIEA 2ZRMA 2F1OA 3G5LA 3KZOA 5KKNB 3GEIA 5I9MA 4HLDA 1T4BA 4QREA 4RZ2A 2QMEA 4NU5A 2E7ZA 4TVSA 1G64A 4XX0A 3ROKA 4DXHA 3HACA 5CX4A 5KYGA 3O4VA 1TVKB 1JU9A 2VF7A 1PZFA 3AP3A 3B1XA 3GRZA 4JMLA 3SF8B 5DP2A 1Y3AA 4DLSA 4NG5A 3DMRA 2WFLB 4UHHA 4E3ZA 3A6HA 2GPNA 4FYHA 4MA4A 4QTXA 4CM8A 3GFOA 3DWFA 3HR7A 5J59A 4CM8B 4RH0A 3GJXC 4CODB 4M0PA 2ZS7A 3O7MA 3NGMA 2Q07A 4G89A 2WWTA 4DMCA 5IJXA 2VDVE 2PU5A 2DT5A 3VH3A 5AM2A 5KNCA 3HNOA 3BRCA 5JD3A 4JX8A 1Z73A 3ABIA 3WGHA 5K4HA 3OQMA 1GG8A 3NEYA 1XJ5A 4XEHA 3WSTA 4H7IA 3NGXA 1AQNA 5FLKA 4QYXA 2R85A 1H42A 1X0XA 3J81A 1OKKA 4MEBA 5EZ5A 1KQGA 3EEYA 2QN3A 4IOMA 3NU1A 4L1KA 1E1DA 2HNBA 3G1UA 3GYGA 3M6AA 1PV4A 3L0SA 2YUTA 3L8GA 2GO1A 3O8QB 1EX7A 4UQOA 4CM6A 4LHXA 1JHVA 3DDSA 4FGKA 1B8PA 3EAGA 4B9EA 2L42A 3BZUA 2EJCA 4JROA 1KSFX 3UWSA 5BR4A 3OTOB 1Y1LA 2IDZA 4DREA 2IITA 1CRQA 3IAM6 4N6GA 1OXVA 3IE2A 4FHGA 4NCAA 1LRKA 1NNEA 5J4LA 3H0CA 2EHDA 1JFRA 1MV8A 4JITA 2EFDB 5CT4A 4R3WA 1QFZA 2ZYVX 2XR1A 2J9GA 2WYWA 3N1UA 3U16A 2EWVA 1L8LA 1D03A 2O7SA 5JEEA 4XIFA 5A4DA 1YH3A 1PFYA 1UL1X 1RI5A 1XD2A 4HQLA 4EL5A 3S1AA 2VSXA 3NC0C 4AD8A 1NXPA 3E4DA 5EZ6B 2D1RA 1DTEA 2WICA 3FNHA 1F8YA 5KNLA 1ZRMA 3JR3A 2CD9A 3SXUA 3ZBTA 3PEYA 3W1EA 4B76A 4MQEB 4MGYR 4PHHA 4TN5A 4TM8A 2VQFB 3ZWDA 3CH7A 4IO0A 1FUEA 4WRRA 5JAZA 1XCGB 5C5IA 3NPMA 1CQJB 3KE9A 2XRMA 1D6JA 3NNSA 3T7KA 3IAS1 4RNDB 1CJVC 4ZODA 3ZE7A 1WCIA 2V54A 1VRCA 4AURA 3I37X 5EQJB 4YQEA 4EGFA 4M1KA 3ZXSA 1Z15A 3LHKA 4DWJA 2IHKA 2NZJA 3AJRA 5HOEA 2IXGA 1WZNA 4Z86A 3FSGA 5CX1B 2E85A 4J0GA 3LRXA 2PDAA 3W5HA 2EF0A 1R6XA 1ZP6A 4GRIA 2RD2A 4D4MA 1KZHA 1I7SB 3VPBA 4AYWA 5IKEA 5HVNA 4JYAB 4LRXA 1ZIYA 4F1KA 1BDJA 2RG1A 3AESB 2FRXA 4UNNA 2FR8A 5DGDA 5IM4A 4LDZA 1B7GO 1CERA 2QW8A 5JYDA 4RABA 1XZKA 4KVFA 4X00A 1HNWB 3MFQA 2NW6A 2ZU6A 1EGAA 1X7WB 4P36A 1BHJA 4B7ZA 2CJWA 4GVLA 3YASA 2NSLA 3JASA 3SQNA 3IL2A 4H4DA 4MUHA 2GBLA 4ZT3A 4NOKA 4DDHA 5CA1F 2BKXA 1GKLA 2PSHA 3NORA 3GUCA 3TTWA 1SRQA 2NSYA 3RIHA 4R2HA 3ZV3A 5BNIA 4LFAB 2XRFA 2XAAA 1JI0A 4QG7A 2ZBRA 1EM6A 2RJ3A 4DM4A 1E0SA 2F4NA 3S0JA 3BHJA 2FZLA 4GMFA 1I9GA 5EPOA 4OQNA 2H6EA 1N57A 3ON5A 4RF3A 2ZT8A 1ZIDA 5FFFA 3AUYA 1C3OA 5KNBD 4EABA 4OHFA 4KP7A 3UPUA 2MHCA 1I3OA 4B8WA 1GZVA 5I9NA 1DV2A 3I04A 4KBFA 1KRXA 4LQDA 5CNJA 2X3UA 2V5VA 3M4NA 2Z4RA 1L4EA 4JXKA 2GSWA 3TSCA 4LRTB 2A59A 4EP1A 2C96A 1R6VA 2XSZA 3BSSA 2QE7A 2MYPA 3LDFA 3LY7A 3QUQA 4JI5B 1PWEA 3NDPA 4HPJB 3NP9A 2A67A 3F5MA 3FKSA 1E94E 4B3GA 4HATA 1HC7A 1KI6A 2VAPA 4FGSA 1W47A 1E2IA 5EPUA 4H3VA 3JYNA 2XXJA 3T3IA 3WRVA 2OE2A 2WG2A 3NHKA 3C7DB 4D5GA 4NBUA 2QRUA 3K73O 3L3BA 3VC1A 3HGQA 4R51A 1C9JA 1MBZA 3EXEA 3W0LB 4G0WA 3DAFA 1HK7A 2BKLA 2P40A 3EAFA 3V48A 5C4MA 1ICEA 3IXQA 2NGRA 3QH4A 3JYPA 4QDKA 4D9EA 5C3MA 1RI1A 2J7KA 3UIEA 2DJIA 3D0RA 3RADC 3HBLA 3GH3A 2BEKA 4JLWA 1GTVA 4HNTA 1NF8A 4H1UA 4YDQA 3M82A 3D6FA 3DM5A 2J6BA 1CFZA 2FFJA 1TZMA 1FYXA 1P62B 2QUBA 3AERA 4TMWA 4D8TA 2N9UA 3QF7A 4KDEA 1CUFA 5CYGA 2A9PA 4MW4A 3RAGA 1WF3A 5ALWA 4WGGA 3OFVA 3PPIA 2J0UB 1A8SA 3HCPA 3RK4A 4B6GA 4RTQA 5JY1A 3D0OA 2YMQA 2ZVDA 3FETA 3M6UA 3FWNA 3I05A 4MKZA 1ELOA 3IFSA 4IAOA 3AR5A 3V4RA 5GVRA 3KL4A 2QG9A 2C1ZA 2H4WA 2WOOA 4RPHA 4UM7A 5K0TA 4JYBA 2PEYA 4NS1A 1XKXA 4KO3S 5TMDA 1V3QE 3OJCA 1CBUA 1XRPA 2B69A 2WJAA 2MT9A 1YONA 4G4IA 5DBIA 3EISA 3E15A 3HCCA 1KAMA 2OD7A 3G8AA 3ZQUA 2WF6A 4KXFB 3GEDA 2DULA 4LCJA 2YY7A 2YQ5A 3O3MB 4OHCA 2FEXA 3SLRA 1MZPA 1VSQA 2Q9CA 5AXAA 3B48A 3ROTA 1RZUA 4P4UA 2VK2A 2CJFA 2VQDA 3BBLA 2X2OA 4WOJA 3VTKA 3WKBA 4C2BA 4V3CA 4EPXA 2P9ZA 5AIAA 2HYDA 4N4AA 4WFKA 1OVMA 2ZPTX 1YZ3A 3OIFA 3OZDA 4RC9A 3WRXA 2JLUA 2HYIC 4KMRA 3ANSA 3ORFA 4U39A 3THXB 4LSMA 2M9MA 5MN5A 2HCRA 3LY5A 1IK6A 1KS9A 1RYBA 1JKJA 2FKAA 3UENA 3T38A 3EIWA 1Z47A 3ZWCA 4C4TA 3AVUA 4OIMA 5IBRA 4CKYA 4W5NA 5LC1A 3E7WA 2H7YA 4K9PA 2XBMA 1S0UA 4I55F 1NYQA 1EP9A 1OBHA 1NPTO 2XF8A 2Z8ZA 3FOZA 1SVIA 4MQMA 4KE9A 4EB6B 3F74A 2BTQA 2ZM6B 4MMYB 1X1RA 3T5GA 2HK9A 3RYFB 2PL5A 2GQ0A 4EX6A 2PRZA 4C3VA 2OUIA 1USWA 4N7RA 8MHTA 2AZMA 1TMGE 2YHSA 4IWNA 1TCCA 4FC6A 2ZIGA 3SJUA 4RTPA 1OXSC 3B6JA 3CISA 3NTUA 4D3DA 1GEEA 2IS2A 3HB5X 3VU9B 2YQZA 4GRDA 1QH0A 2AI3A 2C00A 4RVCA 5CNMA 5EYPB 1E2DA 3UHOA 1AO0A 2ZDQA 5K3CA 2NUAB 1NC1A 1VIYA 5BQOA 1YQ9A 2VRBA 3STTA 4UCWA 3VYSB 1VYVA 1VMEA 1Q3TA 2VPQA 1YBHA 2G8LA 1WQ4A 2I2WA 2IYNA 1WOMA 3GIDA 3L92A 4FYYA 1EVLA 1XQYA 2Y1WA 2YYZA 1XXHE 3BK7A 4RADA 3RM3A 2CBZA 4YP7A 1U80A 2QP3A 4GYWA 4PO9A 3DVQX 2Q4BA 1V39A 5F98A 3I9MA 4B81A 2N1MA 3EVAA 1G42A 4B84A 2RHCA 5EXXA 4ZYUA 3SYRA 3WGKA 2NXJA 4MS4A 1VZ3A 2DFTA 4BNUA 4ZHQA 1TO2E 2XUAA 4FU0A 3U3XA 3G3EA 2XLBA 2XWBF 4EG6A 1SG9A 5EWJA 4L3OA 1EG7A 4IY1A 2E5FA 4A16A 3ONFA 3F47A 2P7HA 1H5NA 2XQIA 4HEA6 2IHUA 3ICQB 1WA5A 4MV4A 4UNSA 1IIBA 1Y6QA 4V1CB 1LTKA 5TV2A 4BO0A 1VECA 1KP3A 3CSSA 2PYIA 5IJAA 2ZITA 3OZGA 1PLKA 2AG8A 1FDTA 1QQTA 1CULC 4L02A 5BSKA 5IHXA 1UFRA 2IZ6A 2OGSA 1CUGA 4ZQIA 3EFOA 3ZR4B 4E88A 2X8AA 1T8PA 3IQGX 4FYMA 3T7DA 1WL8A 4NP6A 3MINB 3R77A 4U3JA 3AUTA 1WVGA 3VSCA 2R6GA 1LA2A 4JLPA 4LJ7A 1QMPA 4QHSA 3M0EA 3UH1A 4BMOB 4KC0A 2W6QA 1V1JA 1TADA 3HA3A 1TJ5A 1UWCA 1KQNA 3AVYA 4WKPA 1G21A 1NVUQ 2F00A 3M89A 3R7LA 5MHTA 1VIDA 2X2PA 4NJMB 3CPHA 4IX1A 2I4TA 3MRTA 3Q6IA 3HXQA 4X1IA 2LNDA 4IFTA 4ZK6A 1CV2A 3PR2B 1DMRA 1V9SA 4RK4A 3E84A 1RR6A 3N0XA 2WG1A 3FMPB 3OOYA 4Q3AA 2XKAA 4FZRA 2P3QA 4HSGA 5AJYA 3S28A 2Y1FA 1ZLYA 2EKDA 3WGUA 3ISVA 4EDHA 2CV0A 1E63A 2X0RA 4PTYA 2AC4A 1T8UA 5IK2A 1PFGA 4C7JA 1C1YA 5BYAA 3DMHA 4FBLA 5ESDA 1FNBA 1E96A 4FYIA 1XMSA 1MMFB 4YMIA 2RAUA 1ONOA 4GR9A 3ITDA 2VA9A 3NVDA 4LX8A 4PYRA 3EXIA 2EKZA 1PJ3A 2EU8A 4ND8B 1R6DA 1B2RA 4J43A 4ICIA 5JDIC 4HP8A 1PX0A 1GAEO 1KIMA 1P4GA 4LF4B 1L4KA 4OBXA 2FEMA 2R8ZA 1O95D 5EINA 3LLMA 4IXWA 1VCHA 1DG9A 3JQ8B 5FBRB 3Q8LA 1YT5A 2HLDD 1FFBA 1ODKA 3K0EA 3PA6A 5GM1A 4PQYA 5EJEA 1DARA 1VG8A 2VAWA 3F7OA 4JT2A 4ZQHA 5E7JA 4CCSA 1YRHA 3I72A 2IPNA 4PLVA 3VR2D 4EENA 3KIPA 3RFFA 3FPCA 3GEGA 3NKLA 4INOA 3WGIA 3C7CB 3R6WA 1QKKA 4Y9TA 1TA4A 3LUBA 4IW3B 1QO9A 2CHVA 3FFTA 4DA9A 2PA3A 3KB2A 4G6ZA 4EA8A 5K8LA 1J99A 1KNXA 4RV4A 1FUIA 1VSTA 4NFLA 3G0GA 3MBOA 4O4LA 1Z5NA 4CEJA 1D2EA 1AB6A 3N28A 3U4GA 2A9JA 1D1TA 3ZE6A 4YFYA 4GYYA 4M0FA 3RVLA 3FWZA 3OZUA 1AZTA 5JAIA 3LYLA 4TN1A 3COJA 3AF6A 3K0CC 1KJJA 2K7FA 3LE8A 3K05A 1F2UA 4PIVA 2LRHA 1AA6A 3EG9A 3VI4B 1GQRA 4FI3C 5F12A 4BVFA 5AW3A 2QQEA 4E5VA 4EGSA 4OKNA 5CT6A 4CXMA 1M3SA 2EJTA 1Y9AA 4HFMA 1YGPA 3DR3A 2FEWB 3G1TA 2OVFA 1YQUA 2RKOA 2YWEA 2HRZA 2KW5A 4G63A 1ZVQA 4OFBA 4G84A 1IPHA 1JYSA 2QGZA 3IOCA 1VP9A 1ZH8A 5B6IA 1VOTA 2HW8A 2ZRKA 3MD9A 1RJWA 2UV8A 4JBHA 1YGYA 4YRFA 1FVXA 4YACA 3VHRA 1AS0A 1JUDA 2H65A 4ZICA 5C8YB 4TKZA 2KS6A 1XZLA 4MYSA 2GWRA 1WUHS 2I66A 4CEHA 4GZMA 2QY9A 4X62B 1D2NA 1SQFA 1Z33A 2CNOA 3FDZA 3G6WA 2VXOA 3OCJA 4JBWA 5SZIA 1HDXA 2ON6A 1GLGA 2WSMA 3CZAA 3I30X 3KAQA 4N0MA 4WKGA 1JDPA 5ICFA 1XBTA 1EKXA 3BUSA 4QFCA 5L40A 4IGKA 5J2UF 1Q7CA 4QM7A 4M0UA 4BO8A 5ENDA 1KYWA 2A5GA 3PFKA 3L93A 4YRBA 1Z22A 1R74A 1CFJA 3JQBA 4DCPA 2V5UA 2BFFB 3CR8A 2A9QA 1X1SA 4I5FA 2DWOA 4IOJA 3RT9A 5EP2A 2A4MA 4Q9AA 5FTNA 4EJSA 2OLJA 3M9LA 4G0MA 1O89A 4P0PB 2HBRA 3ZQKA 1C30A 1U2TA 3MWJA 4MVJD 2A1UB 4JV5B 2QNRA 3OMWA 4DLAA 2FG7C 3DVSX 5IEJA 5JNLA 2PJUA 1G1MA 1QHSA 2DERA 1AX9A 2HMWA 1J0XO 2P9QA 2VWQA 1JP7A 4MW1A 2AH5A 1QH8A 2C7VA 2FWPA 1QE3A 1PL6A 3PS9A 1PR3A 4HWKA 4J94A 5EWMB 3G8DA 2NVWA 3CUUA 2AG5A 3F6EX 4BXOB 1L3BA 1XLTC 3A4LA 3DDNA 4EK9A 2Z5GA 1XD9A 2VAXA 4CCYB 4ZZ0A 3GUVA 3K2IA 2XMZA 1RT9A 3G82C 3O2QB 4JI3B 4Q7LA 1N2EA 4WJLA 2LGJA 2D8AA 5JS2A 1SVMA 1QTNA 2WHQA 5HIKA 1Z0AA 4HK4A 3OPYI 4Y6RA 3J81k 5HXAA 1IBRA 2X8LA 4EB8A 3FYUA 1NLMA 3DTVA 4JFAA 3X1KA 3ZZ1A 3FYTA 1QRRA 3D6AA 1JNXX 3O1HB 2W5UA 5LXTF 2RE8A 1XP5A 4Y0AA 4J2HA 2YV2A 2GPJA 4MMXB 1C81A 1CPYA 4C6TA 2XTJA 1V7CA 2X19A 3ZY2A 1J33A 4KDRA 4Q47A 1UAGA 3H5AA 4RZQA 4IDQA 3U4HA 1YRLA 2RAPA 4HNGA 1NXSA 2CL7X 2CMDA 2CB0A 1U9YA 4JI6B 3SC3A 1B8NA 1Y1SA 2XW6A 2VJMB 4KDCA 2UUBB 4H31A 3EAQA 1E7RA 1YQXA 1G7CA 2OHOA 1T35A 2G4CA 4KSBA 1KH2A 4EHIA 5ITVA 5A9TA 1C3JA 2QD4A 4D1YA 1A96A 4NCKA 3M1AA 4AYXA 4EDFA 4HL6A 4B3BA 5JZOA 2XTZA 1P2DA 2BMAA 2CLMB 3AH8A 4OU4A 1QP7A 1G5RA 3JQFC 3R3SA 3HYNA 4A1OA 3RS3A 4EW6A 4J91A 3TQHA 4MHOA 4QU0A 4YN3A 3KUDA 3WYAA 2OPBA 3OSUA 3V6MA 4OJMX 5LMUB 4K0KB 3QW2A 1PK7A 2QTCA 2ZBGA 3G5AA 3E81A 1I6WA 4X1KB 4UTOA 2BEWA 2HF2A 1XDUA 2O5RA 1NBMD 1E9CA 5C9ZA 1A4IA 5M5BA 2Q8QA 4B85A 4PHTA 4IHJF 1TCVA 3KQOA 3AJAA 2JFHA 3TM4A 2B4KA 3KZNA 5HCNA 4PYMA 4POOA 2CKDA 1G3MA 3EDRA 3WGLA 1JG7A 2ZRDA 1RYEA 2BMFA 2IIQA 3PL1A 3ZH9B 2JIRA 3IXMA 1L7XA 3KLPX 4FT2A 3VYUB 1CZUA 5IDXA 1PVVA 3R44A 5I7EA 5CA1B 2R8PA 3AHJA 4COKA 2JIZA 1HA3A 2G9VA 1RTTA 2V98A 1AG9A 3FN4A 3NDBB 3C8MA 2V7UA 3VHLB 5BNWA 1MFPA 4AG6A 4HY3A 3F7MA 4FW9A 1PSDA 4V24A 2Z0MA 3RTGA 1V3TA 3UB3A 1E20A 3QVTA 5EIFA 5EWLB 3LUJA 5I5EA 1XMVA 4FX2A 5AJTA 3UMCA 3QLVA 5JANA 3F8SA 4OPMA 1MOPA 2PN1A 1LNZA 2FZ5A 3NTQA 3ROMA 4KE7A 2ZR8A 1JVSA 5SYAA 4N48A 1SU7A 1MIOB 3A31A 1DT5A 1XCBA 3DEFA 3K9FC 2ID8A 3IIJA 1BCRA 2YWXA 3LVRE 2VUHB 3TL3A 3UTCA 1RRMA 2V9CA 3MILA 4WXEA 3GZ4A 3M1IA 4ARSA 5ITZA 1UBCA 1DFIA 4HH0A 4UHCA 4XWOA 4ZRDA 3N5KA 2ADMA 2XCUA 1KH3A 2GKOA 2O7QA 3G2PA 2E48A 2QSZA 3FJOA 3DNFA 3AI2A 1UEIA 2A9FA 3HP4A 1XL0A 1H0SA 4YT5A 1Q7GA 5SY9A 4TT8A 1NN1A 5CVVA 4COOA 1WMAA 2I6UA 3EGEA 2RDMA 4W5WA 3GT3A 1T0HB 5H16A 1MRNA 3RVJA 4AF6A 2OEPA 3H2YA 4PHGA 4X3CA 5DTEA 3DF9A 1N3BA 5DLPA 3V7WA 1USVA 2VSOA 3OPVA 4FZVA 2J67A 2AG0A 1BW9B 2FSUA 1M2OB 3VO2A 3R9XB 3AV3A 3IVRA 5T3UA 4UUBA 4ZOCA 5IAAA 1W94A 3GY0A 4BPBA 2ET6A 2IIBA 5JIBA 3FWPA 4G5HA 1WXIA 4MUGA 4MUYA 4JB3A 2P2LA 1EUYA 2A8YA 5HQ3A 1XDWA 4NI5A 1MEEA 1DX4A 4WCDA 5FPTA 4O4JA 5FOVA 5K3DA 3M5DA 4E5DA 2O8BB 3R3JA 3KVNA 5AJWA 1B76A 1VG0B 3BA1A 2BDTA 3HUDA 3P9ZA 4AECA 4Q9JA 1PFQA 2RGBA 3OOWA 4H77A 4RSGA 4LF8B 1JHYA 3NCTA 4FD2A 4G56A 1JIIA 1N0UA 2GHRA 3H2HA 1T5BA 1ZGGA 2JGAA 3ZXUB 1UBNA 2BGGA 4C2TA 3L6DA 1JKXA 1Z4MA 3B89A 2JD0A 3FZEA 1DNPA 4J0HA 3NKVA 4JVNA 3PUWA 4JZYA 4KQKA 5HF9A 4PQFA 3OTQA 3SHFA 3SZRA 1F6WA 1I7DA 4M9UA 2G17A 2EOAA 1N9GA 3SOZA 2A86A 1GU0A 2JBHA 4J1NA 3SIWA 3GCGA 1NMQA 5DBFA 4KXYA 3W8NA 3WJ7A 1GPWB 1W85B 2ODQA 1DO8A 3DE3X 3H9EO 4UULA 3T9FA 5JVDA 4DFDA 1CYDA 3R8FA 2MINB 3QOYA 2IOYA 1NMZA 1RHUA 5CVDA 4NATA 4ZTUB 1K6XA 2PZEA 4FE7A 3VR4D 1FRZA 2WM8A 4GLLA 1HE8B 1IM2A 1J5PA 1T3HA 2N47A 4HI0E 1Q95A 4KLCA 4PWZA 4Y6GB 3OTIA 1NRWA 2C8JA 4JJFA 4HEQA 3VPCA 4DLTA 4UDOA 1WMFA 1CUYA 4ARIA 3KEFA 3TEMA 2H4FA 4KBYA 3V9PA 2HC9A 5L3QB 5MFPA 1T91A 3ZNOA 3OWOA 2ZI7A 3NHAA 1CUBA 3NHUA 4I9HA 3K35A 2IYTA 1MOSA 4EHBA 4Q0MA 1H2YA 4XGIA 1W88A 2PVSA 4AJKA 1H85A 1QIMA 3KZMA 3LXRA 4AUKA 5FPSA 3REFA 1VL0A 3QUAA 4EAQA 3K70B 1K6IA 3IAEA 4DCOA 2GAJA 4I55B 4PV7A 2I7XA 1ZOOA 1UXKA 4L74A 4UCXA 3GCDA 3H19A 5KOJA 2XGOA 4OBEA 4R1SA 5B6JA 3GBPA 2VC2B 5A4IS 3SKXA 3X1YA 1Z74A 5EA2A 5FO1A 2XA2A 4DUYB 3TX2A 3A4MA 2IP2A 2MJLA 4L5YA 1U2GC 2PUAA 1OFTA 4LJ5A 4WPGA 5FUYA 4D9IA 4XM1A 4EW2A 4P5DA 1TZJA 1RWWA 2WTEA 4KR0A 1X7ZB 3LQFA 4ADSG 1AKNA 3HDGA 4B7XA 4YAKA 1QQAA 4GGPA 1JTVA 3B53X 2FWMX 3NETA 3B2EA 4RV9A 4W8OA 3OJEA 4E14A 2Y0EA 3AFHA 4URXR 5IWCA 2Z9CA 4AJNA 1DIRA 3AW9A 2I9KA 3QBJA 5A2GA 1U2ZA 3H4VA 1JQLB 3EIXA 3G13A 1ZK1A 4Q7EA 4GOKA 4H27A 3VOAA 3B3AA 1G38A 5EIHA 5JQGF 4L85A 3ZDDA 1NT4A 1MR3F 2FY8A 4MAMA 4G9GA 1IN7A 3O7WA 4K6OA 5AHOA 3FYDA 4KEAA 1ADFA 1DXOA 4FCTA 1LBQA 4OXYA 4WW0A 1PQWA 4ARVA 2QSYA 2VSYA 3AYZB 1HQDA 4C88A 1JF8A 1WPXA 4YCLA 1JSZA 2XE7A 5I4IA 1SXJB 1VBKA 3W7AA 3KQLA 2XMRA 5I7OA 5IAEA 5ALXA 2QPAA 3DL0A 4IG4A 3SLKA 3L4BC 1WUYA 2VOEA 5ED4A 3X1DA 5ALQA 4YRLA 2AE2A 3KVVA 4NF2A 3JZIA 3LT2A 1GFIA 1E5XA 1M6HA 3QVWA 1A5AB 2I4NA 1EB9A 2P67A 4CKEB 4X1OA 1U8CB 4WBNF 1DWOA 1OBCA 4ZAYA 3NIWA 2WHPA 1LKZA 5BUSA 4EHFA 5BP7A 4HAUA 3FVQA 3C15C 3AC0A 3RSOA 5BV2P 4AJ1A 2FW7A 1XFDA 3O2NA 4G41A 3HJAA 3C8HA 5EKDA 3UB4A 2XHEA 4DLRA 3TKAA 1YQQA 4RMGA 2DHRA 1HNNA 2ZB3A 3LUGA 1Y9JA 4OLJA 1BYIA 2XYGA 4GC5A 3QBEA 3PPXA 1QYIA 4B33A 3VVMA 1IL0A 3HXMA 2YBDA 2I99A 4MR9B 4UQLA 1VKJA 3ZDZB 4LN1A 2WU1A 4XWWA 4OLBA 2Y1OA 1Z36A 1GRVA 4DJAA 3VHXA 4EIWA 4WLOA 3TGWA 1EGHA 1Z4PX 1CE8B 1I4OA 1W0CA 3AWDA 3KFXA 3IDQA 1TEVA 4G23A 4NYIQ 3GRFA 3C5EA 1FU7A 2A3RA 3P9XA 5KDLA 1JEEA 2BFEB 3NGLA 3RFCA 2I8LA 3LCCA 1RWPA 2ZE7A 5IKOA 3UMGA 5F3WB 3ZDBA 2QW0X 5JXWA 1NVBA 1VLLA 2Q2WA 1SHZA 2QD3A 2XUJA 4B2PA 1L5MA 1FJGB 4PIMA 1KARA 2W48A 1CHNA 4OAQA 5ESWA 3V3TA 4WZBB 3H3JA 4FYWA 1ZCJA 2VHYA 5E6RB 3S7TA 3STHA 3P9YA 3H1FA 4RVFA 3EARA 4D4IA 2Z1MA 5ES4B 1UDRA 4KYVA 1PKXA 4HGNA 2Q9BA 2GESA 2ZPUA 4WZAB 1QP0A 2H3HA 2J3JA 4ATNA 7MHTA 3FGPA 5I51A 2NACA 2CJYA 5GJCA 5KHAA 4TKMA 1H65A 3W04A 1PK8A 2YFKA 1LLFA 1MENA 1Q1EA 3L9XA 3T1YB 2PBZA 3DLHA 3GCWA 1K08A 4I5DA 1FFHA 4IIJF 3WHIA 2W2KA 2F3TA 3DR5A 3C6MA 4FSHA 3C39A 1EDBA 4OHRA 5FADA 3OA0A 4F93B 1I3KA 3EYAA 1EX1A 3MMXA 4TYNA 2IXTA 2E1PA 1O9HA 2G3YA 2J5RA 1ZVMA 5HQTA 1AK2A 2BKEA 1A72A 4OQYA 2M6KA 4MVJI 2WF5A 3UHJA 5EUQB 3JQRA 3L49A 1OD6A 1QPBA 1TFUA 3PWTA 3E9CA 2WIFA 4LF7B 4BKOA 4BDSA 4L73A 1ZMOA 1UP6A 2GZ3A 1CVLA 2R9VA 4IILA 2DOKA 4IUDS 3CZ4A 1KYTA 5L6MB 2OBFA 4XJVA 3SPXA 1JGTA 3CPEA 5FBZA 5D3QA 1XTVA 2OCPA 1ZINA 4B3FX 3P9PA 5AVOA 3OFKA 3HCDA 4KG7A 5DRYA 1PJAA 2ZYAA 2C54A 1IZYA 1BVYF 1ZJ6A 3QSGA 2NWQA 3PEEA 4Q15A 1BKSB 4QTUB 4ZN6A 3OMXA 3LNTA 1P9OA 2ZR0A 3U3KA 4C4YA 1M1YB 3MLBA 1A2QA 3O94A 1KGSA 3EC2A 5LP6F 1O1YA 1L5QA 1WDLA 4U9IS 3KNZA 2QKYA 2R5NA 4G5RA 1BVUA 4HYYA 1Z6PA 2GOYA 1N5DA 1KORA 1JDVA 2WFAA 4HRYA 5MDHA 3JWGA 3IR7A 1R15A 3FNFA 4WH0A 2FWNA 4S0XA 2BEJA 421PA 1UFVA 1U0SY 2FSVA 1C4XA 2HKIA 2PKCA 2VYCA 2YN4A 3QG5A 4HXFB 2EQBA 4J1QA 4LMRA 4U6QA 1T26A 4EEXA 3AP2A 2XV1A 1O6BA 2PFSA 4BATA 2CVFA 3HU2A 1S9HA 4D4LA 5LYYA 5T4FA 4BTEA 3RAFC 2R11A 3RHFA 1YQEA 3KSBC 2XXAA 3EUWA 1JBKA 3WO0A 3RG8A 1JKMA 3TQFA 2C92A 3K7EA 2GUGA 3CKKA 4JAVC 1DPGA 2QX4A 4UTXA 1Q74A 3CH5A 3PDJA 1Y6JA 5J2UB 1J09A 2OO3A 4IYRA 5LB4A 1FB5A 1XQ1A 1U0EA 3CCFA 3O8OB 4WOCA 4XD7D 3TSWA 2GTPA 2XMDA 4I1YA 3GMSA 2ZG6A 3AXSA 3GL9A 4HO1X 4I50A 4O29A 1X7GA 2D2EA 4UVEA 5FXMA 1M72A 5IZCA 3LQYA 1L8AA 1O94C 1SD5A 1YQTA 2GEFA 2HZ7A 3MIZA 4IMPA 1B3RA 1J06A 2QZSA 4QUHA 1AO3A 1ECFA 1V26A 2PCJA 2RAVA 4QFDA 2KBFA 1VKOA 1LSUA 4NEQA 3LDAA 5ELLA 5BW4A 2VWPA 3D59A 2P9YA 2VFAA 3BQMB 4Z3OA 4Q4HA 4IZ6A 4BJ3A 1JLKA 3RFXA 1E9AA 4RF2A 5E4YA 1LQTA 3A70A 3ROZA 4JFRA 2LKCA 3VZQA 5FWXB 1M2VB 4JT9A 1VL1A 3OIUA 4QUEA 3SBDA 5FPPA 3SNHA 3RAEC 1J7KA 3GPDG 5K0SA 1YQDA 1KKUA 2BKVA 4JJEA 3FCSB 2W6JD 3TJMA 2AMVA 2GCPA 3WJ1A 1AGYA 5LXTB 1K0FA 2E6KA 5K45A 2FGJA 1DFGA 1GUAA 2K4MA 5CGZA 3ZDRA 2Q27A 5GIPE 3JU3A 2ANBA 1ZL2A 2H1IA 3OFND 1NMSA 3BE4A 2PRYA 2PX5A 4MNTA 5H1YA 2IZ5A 4FOPA 2DFNA 4GBMA 4DIKA 2WNSA 3PNPA 1PO7A 5PGMA 4AK9A 4RPLA 3AHIA 2OA0A 2J7PD 2JPDA 5EHQA 1P8AA 4GI5A 1Z6GA 1D6MA 2DM6A 2EFCB 3AEKA 3QVOA 1ST3A 3BQNB 3VPFA 4MQBA 4DSZA 3UH0A 1UQUA 4R8VA 4RZ3A 2GMWA 1RWQA 5AT1A 1UKZA 5C52B 4I1OA 1XDBA 1DKRA 1FDVA 2CEKA 3X1ZA 4A4DA 4X8OA 1S2LA 3F3SA 4LQLA 1WBJB 2F1KA 3N2GB 4JEMA 4OHKA 1SCIA 1JFLA 2B9VA 4NDAA 4BV2A 3NBMA 4DMLA 3ADOA 5JH7F 1B6GA 3BEOA 3ETJA 3QU2A 4JH0A 4DADA 2P0AA 4PZZA 3PUIA 1PTKA 4JJ4A 1YNSA 2GTIA 5AP9A 1KIFA 2GCIA 4QPNA 2EFGA 1S2NA 2JNWA 4IHJB 3TIFA 1P77A 2P5TB 2P0YA 4CFSA 2KSQA 2GZSA 3QLEA 3T94A 2X0DA 3HXKA 2O8DA 1VSVA 1TC2A 2HMUA 3KQYA 4AI6A 2P2GA 3TLYA 2IU0A 2DPYA 3QMWA 2H4JA 3SKVA 3GCXA 1MVOA 5KDDA 5C1OA 3V7FA 3GJ6A 4F4FA 1N34B 1R6AA 2PT9A 5IT0A 5HS4A 1BO6A 1L7QA 1NBWB 2PUGA 3U26A 5BSRA 1SHLA 4YJDA 3ZS8A 4AMUA 1L5FA 5ARBA 4CMKA 4YMTA 3K0CA 1GITA 1R00A 3BIOA 3AF2A 1JAHA 4G36A 4ID9A 4YNBA 1PDOA 5ICEA 4YS6A 4GEGA 5T4BA 4AQDA 3EGWA 4Z99A 3A1TA 2WJZB 1IH8A 1OBFO 1TYEB 1RRKA 2WHRA 4KTVE 1XMPA 1LC3A 4LY0A 2XCTB 4AKGA 2FPPA 2ZRAA 3DBIA 4ZOLF 1PNOA 1VB3A 4ZC1A 2DPGA 2D1YA 1M8PA 4JKYA 1E0DA 1U6KA 3L1HA 4PNHA 5DISB 3T1HB 5KTSA 2C82A 1DC3A 1V1MB 2YVQA 5FBLB 1KDTA 3AHCA 4Q1CA 4QGGA 4TQUS 3ZIDA 1R0LA 1SOMA 1CZHA 3IVMA 3WA7A 1QIDA 1D09A 4JP5A 4HVCA 4RTJA 2KYRA 2H48A 4Q6BA 4EPWA 6REQA 2JK0A 4MHSA 2OQRA 4L5CA 1YUBA 3K6SB 2Q49A 1T10A 3X1XA 3Q6MA 3EGDA 3GFBA 1N2BA 4UTZA 3BICA 3U3RA 4JR1A 5KNCD 3ZDEA 1NQUA 2BMWA 1E0KA 2YRWA 1RBMA 5DI3B 4AROA 1RAGA 1ONSA 4Q4DA 3TL6A 4LI0A 3ZXIA 3LUFA 5F3DA 2G80A 1U0JA 4ER5A 1Y4ZA 1Z5VA 3TZKA 4RDIA 1WEHA 5H82A 5EJ6A 4HZUA 4OHMA 4IIEA 4JJ6A 1OKKD 4LZZA 5CDUA 3F73A 2X58A 2OXTA 2OFOA 3UWKA 3ADBA 1ZGAA 1XT6A 2WD9A 5H4GA 2Z2JA 2CZGA 3EE6A 3EVFA 1NRJB 3SX4A 1WTAA 1E3WB 2A84A 3C6KA 1HTTA 2XJ4A 3DV2A 1T29A 4M1WA 3WLQA 4CTKA 2PL1A 2VBIA 2XD9A 3NWBA 3E0QA 3ZUGA 1X92A 1QPGA 2PMBA 2I8CA 1CVRA 4HS9A 4QDXA 2W98A 3RYHA 2AEFA 5HX7A 1OZAA 2DLDA 1Y8AA 2WC1A 4Q39A 3ZLUA 1J2TA 1JLHA 1BN6A 1EE1A 4IOLA 5A3SA 3WX0A 1U3FA 4U7GA 4D6XA 2JLXA 4KFTA 3IP3A 1EJ6A 1U7PA 4DOMA 8LDHA 2F4VB 3C6XA 4CTMA 4EHJA 5JSFA 4BLVA 3G0OA 2C3YA 3H0KA 1O2DA 1YI8A 3EXG2 2QM7A 3HWSA 3H7AA 4AG3A 2O8EB 3FD8A 1AS2A 3RABA 2OL4A 4KPFC 5BVHB 2OMEA 5IJWA 2YTZA 2QL5A 2Z3VA 2W2MA 1D2MA 1H66A 3E3LA 4QPCA 2ZEJA 2H06A 3TSAA 4Z4QA 3WKAA 3R9WA 4XCXA 1BHQ1 5F5LA 4KUGA 3JARA 4RTSA 5AJXA 2R47A 2EATA 4Z0HO 1KAHA 2J45A 4QGFA 4XM0A 1KA9H 3DV0A 4W1RA 3EZLA 2P1RA 3TLMA 3EA4A 4D57A 2GEUA 3QXSA 1L1FA 1VE1A 2W2VA 3JALA 1A9XB 2ZIEA 2FH5B 1AQJA 4WN3A 4HAWA 4JJZA 3RS4A 2ZWVA 1TU4A 2H5IA 2IGTA 4G0YA 1SHKA 2V7XA 2VHJA 3T9DA 2O8FB 1OH5A 3O74A 3URMA 2PGAA 3K9GA 1YBMA 3PFNA 3WK8A 2JLVA 3IDAA 4WK2B 2EBUA 5IDVA 4NH0A 5I4CA 3ABOB 4QUAA 1XUOA 3I01M 1OCEA 1Z38A 1ZW1A 3KOYA 3S2YA 2EKBA 4XFDA 2L82A 5KQLA 1PG5A 3QTBA 4B7UA 3HA7A 3QFCA 1IXZA 4J4BA 3C45A 3BOSA 3VC2A 2H2WA 1K4MA 2WK1A 2WUVA 3TXXA 4B2LA 3I6MA 1ORTA 2HFJA 2HEGA 2NZVG 3GRVA 3AUKA 3OHSX 4ZVTA 4B43A 3WLTA 4RDHA 4MW7A 3U2QA 3OPQA 4HUJA 3H1BA 3IXLA 3N6VA 2O19A 2PGOA 4W7SA 3L6OO 1PZHA 2R6FA 3WDLA 2CLDX 4S2EA 1E1RA 3GGCA 1YZHA 5LOVF 2CLHB 2QIPA 1N6OA 3K16A 3DKKA 4I14A 2X6TA 2ZSKA 2B6HA 1C1DA 2O8CA 3A3YA 1WE2A 3PJGA 5UKDA 1Z5WA 1H93A 1DZ3A 3H9QA 5DNUA 4IV0A 2A5YB 2XUFA 4UNQA 4MRRA 1QBKC 2WE7A 3NHJA 1S3IA 4DT1B 3UQZA 1AKMA 3SBEA 4EECA 3EZ6A 1ZS9A 2VSNA 3G2MA 5IPFA 5B12A 1RADA 5JQGB 3Q8MA 1AN9A 3INRA 1Z0JA 2XSZD 1C80A 1ICIA 1Z8NA 1XQWA 2QE7D 1ILWA 4U6SA 3CE6A 1UMBA 1IG3A 3BWMA 3FUXA 3C3CA 4D43A 3PCXA 1L5YA 3MLAA 3HY6A 4L72A 5B3JA 1L5SA 2ID9A 4UHDA 5HHTA 2OWDA 2HADA 1NI4A 3FKSD 3MIIA 3PRKE 5I9TA 2I67A 5ULLA 5CLFA 2H85A 4JLVA 5AKIA 2OXIA 2JFGA 1RACA 4YAJA 1ZVVA 1A82A 1OC4A 5THQA 2RHHA 1AB5A 5EIOA 1CJTC 4JC8A 3E7XA 3GLIA 3MBIA 3SJ7A 3IQEA 2ZJFA 2VK4A 2VA8A 5DX0A 1AKRA 2NSDA 3E7PA 5LZ7A 4IWYA 1J7JA 1MTOA 1TU3A 2CYCA 2ZFUA 5JD4A 1SD2A 4TTIA 4CMHA 1WXDA 3A04A 1G6KA 2DR3A 3MWEB 5EJ8A 4WBNB 2HJHA 5G0SA 3PX3A 4RMHA 2FV8A 2F3UA 1NBME 3QVLA 3IAFA 4M54A 2Q6OA 4NE7A 4ZVLA 4K7JA 4ALLA 5KSZA 2JD1A 2OKGA 1DZIA 5FO0A 4CKBB 1ZK4A 1SUPA 4YJ3A 3VQTA 5HGJA 2IE8A 3STUA 1YF3A 2R7AA 1YTUA 3I52A 1V96A 2ZB2A 1O5OA 2FZ4A 4EWLA 2ZBUA 4MLCA 4FCVA 3FHTA 3ESQA 3RV4A 3ETEA 2A6PA 3B1VA 2YXLA 3M83A 3MJDA 3T9CA 4EMBA 1MJGM 4Q7QA 2PLWA 4YRSA 3COVA 3OOSA 4EFDA 2YVUA 4HQKA 3O83A 1Q0HA 1XXHB 2ZYIA 1XVUA 5M34A 1IN1A 4G0PA 2Q8NA 1U2EA 2AJLI 3T12A 4B4DA 3L8MA 1L2TA 2XTAA 1JHRA 2CVZA 3CT4A 2PLFA 2E4VA 1EK6A 1G55A 2AFIA 4KX3A 1QH9A 2C4MA 4MB0A 4MW0A 3RO7A 3BXZA 3AJDA 3LCUA 2TMKA 2ZWPA 3A4YA 2GYYA 1QHNA 3KTDA 3JPYA 5AD1A 2ZRFA 2Z09A 2ZI4A 2EZ9A 3QVVA 3V8BA 4YJHA 4WL0A 3TW8A 3QP9A 4RW0A 1UC5B 4S05A 3N87A 1A2KC 2FN3A 2J3DA 1V7PC 2PKQO 3BG5A 3X2FA 5LZ4A 2X76A 3QXXA 3LUHA 4FDMA 2IVFA 2QL9A 1LPPA 2F9FA 3MJ4A 2MSWA 3WZLA 4D8VA 4KXXA 1YZTA 3P9RA 4RD0A 4ENVA 3GJZA 4F4DA 1FC0A 1NJFA 2XUPA 5DNVA 5H80A 3HM9A 2Y1GA 1F20A 5U4QA 3WLEA 4PZDA 3O3OB 5KYUB 3HA5A 3U3DA 1BRMA 2PZJA 1TFRA 2FSGA 5JCOA 1XTTA 2O1SA 2AUTA 1PWHA 2ZQZA 1XELA 3ER9A 1LJ8A 3QHQA 3BRWA 1QO7A 2IEDA 3DBVO 3IOYA 1Z28A 2DGDA 4LC0A 3V4ZA 5EHNA 4BLOA 4FM9A 3CF4G 4MLPA 4TTTS 1RU3A 1UQTA 1WHTA 4FEEA 5T64A 1GU7A 4KXNA 1H9CA 1X1BA 1XA4A 1QGED 2A5LA 2A9KA 1H6BA 2EX1A 3V42A 3AOGA 1PQ4A 4P34A 4UE3S 4KLAA 1U94A 1I1QB 1Y34E 3CSUA 1E6WA 4E1BA 4ZZ1A 3ADPA 3QPBA 1OA0A 1ZSYA 2AFHA 4BV9A 1FLNA 4BX3A 3DTNA 5I01A 2GF2A 4OI2A 4F9GA 4G1UC 5FOTA 1WCYA 1XTPA 3I2JA 4ZOQI 2PLRA 1ZQ1A 1X70A 2VQEB 3N0WA 1T6YA 2XUIA 1M2HA 3UICA 3VPGA 5LP6B 4WK0B 1CG6A 1FVHA 1XU4A 2QXYA 4NEHB 1XB2A 5TARA 4B46A 3P9QA 1DIBA 4A27A 2NU8B 2QAGC 5HNKA 1G0OA 3HYSA 1RHJA 2O1EA 1Y82A 1R8SA 1SOUA 3N6XA 4PLWA 4WFIA 4YJFA 3W2FA 4LJRA 1JIVA 5HZHA 2Y92A 4LAFA 3GLGA 3KU1A 4DR3B 1VRWA 2J4FA 3UT5B 4HX5A 3E3OA 4J1SA 1ML3A 2Q5LA 3CB4A 4YMVA 4JI4B 1I51A 1GTRA 3NEPX 2V8BA 4EEKA 1YR8A 2OBYA 4RA9B 4F4JA 4IRXA 2O2CA 2UYHA 2W6CX 1K63A 1FSZA 1R4MB 1RQLA 3G8YA 3PGVA 2IPXA 3CWQA 3R7WA 4F12A 1O8CA 1Z4OA 4HB4A 4MVJP 1O96B 1EVEA 5FYQA 2J33A 4OX9Y 5L7TA 1U81A 4AICA 4KHPB 4EBFA 2VHTA 4HXYA 4LNHA 3T6KA 3ZX4A 4KUHA 3KKMA 3JVEA 4CVNA 4E5PA 3JAKA 5B7GA 8GPBA 2NUPA 2IKQA 5D5QA 5CAEB 4DUZB 5I4BA 2O2IA 2FMXA 3L4BA 3H83A 3I9FA 5P21A 3S8YA 5BSTA 3NJRA 1RKXA 4L6CA 2ZT5A 5TIIA 1DDGA 4XQCA 3CF0A 4UZEA 4DS3A 5KQMA 2ZROA 1CR2A 3FPBA 1BZYA 4OKIA 1XDZA 4LZLA 1YOVA 1FDOA 2JDIA 1SZCA 1YDEA 1RXEA 4LTNA 3WYEA 1ZI8A 3DC2A 3AEQB 3I1IA 4IDFA 3SDZA 5AOCA 3EVCA 2P4QA 1JWBB 1US8B 2WJPA 3DBOB 1IHXA 3C8UA 3UFXB 4MKXA 5DTMA 2WDPA 4YYEA 1QHYA 1AK1A 2VHZA 4H1WA 1YDMA 1I6LA 5KINB 1D1SA 4IZOA 4E0BA 3THYB 2HJSA 4FZ3A 3TTSA 2XRZA 3HI4A 5IK2D 1FYDA 1XTJA 3AMVA 3W2TA 3COYA 4ALIA 5JNSA 1ISMA 3OIYA 4PZAA 3AQ4A 3AM5A 4QBKA 3ICWA 4ZALA 3FTQA 2BJWA 2QYSA 3NDJA 5SYNA 4YECA 1OE0A 3MAGA 4JK3A 3OICA 4XDHA 4LMBA 4Y2VA 3BEDA 3UV3A 3M33A 3LDGA 3PIIA 5ECGC 4J0JA 3ZEIA 3KCQA 3KUXA 2Y1DA 2VDUE 3HBMA 3VAZA 4TKVA 3DBLA 3WGVA 2F43B 4JA2A 2PMEA 3AJ9A 3DD5A 5GONF 3QF4B 4ARZB 3RTEA 1F8GA 2QUZA 2QWXA 3PNKA 4CKWB 1CUEA 1PK9A 1YR3A 4BNFA 3RWOA 3PUKA 2HDWA 2HDHA 2DQZA 2QI9F 2J5KA 3JQ7A 3TAUA 2GBIA 2OV6A 1JPUA 3ND6A 3QEMB 2HCBA 1ZD3A 1OFUX 1W93A 5JUWA 1WB5A 2R84A 4PGHA 3FPEA 3S2FA 3F49S 1K5PA 3KDAA 5JH7B 3OESA 4HDSA 4JGGA 3HJNA 3QWHA 3ZY4A 1FRNA 4E09A 1PV1A 2R1ZA 1W7AA 1SWWA 2I6QA 3I5UA 4MDYA 1JKIA 2YBEA 4ON9A 1CD5A 3EXFA 3P2JA 2HU5A 2NYAA 3GVPA 3I4LA 4I6EA 2WJVA 3WHLA 4D4KA 2C5LA 3KEQA 4OM8A 5DCUA 5E3HA 5HE9A 2O4CA 4DJTA 4E3WA 5COBA 1THMA 3MT7A 2JJ1A 3E53A 1LBEA 4NK4A 4YUWA 3ZNQA 3TIVA 4FGLA 4YRDA 5JRZA 3DE0X 2D0DA 4G0QA 4K1LA 3S27A 1XZAA 3KKNA 1IJBA 2XWJI 4M88A 1TYBE 5EL0A 4XJXA 3A28A 3X43A 4B09A 1WY5A 2OSVA 2YWGA 1IY8A 1KEPA 1OAKA 1P17A 4BB5A 3VX3A 3BDIA 5IUKC 1GT6A 3JQ9A 4B3CA 3QEBZ 1BS9A 5ECYA 2X2EA 1QNLA 2X6QA 2ECFA 3HADA 1ZIOA 4KPYA 1VJRA 4PTLA 5MGNA 1I3CA 2R97A 3DUFB 3CW8X 2GRAA 2W90A 1M2NA 1X7DA 4WY8A 3DBHB 1NWCA 5AVYA 1CQWA 1DOZA 5EUCA 1MG5A 2PQ0A 4G4JA 2ENWA 4EF5A 5JAHA 2VUSA 1J25A 1YVDA 3EYWA 5JC8A 3JZMA 4Q24A 2GF9A 5D5HA 4C03A 4P35A 2DWCA 1ZRHA 1E3LA 4BAUA 3EBLA 3BD6A 3C6QA 4F8EA 3QEJA 4FUQA 1RCUA 1A1VA 2FFQA 3EN0A 3GZNB 5EE1A 4B8YA 3GD7A 4LJAA 2JGJA 2Q46A 5J1SB 2BYTA 4XIYA 5LZ9A 3GNSA 1Y1QA 2OC4A 1JB9A 2XUHA 3LAWA 4YPFA 2UVPA 3ABQB 4C0SA 4EY6A 4FEYA 5AESA 2YZ7A 3CCCA 4XUCA 1ULSA 5FL7A 1K6JA 1JSXA 4CMJA 4CQMB 1NF2A 2F3RA 4NZNA 3T7EA 1GQ2A 2ANCA 3O4GA 1TVCA 4QRHA 2PWYA 3AU8A 5LIPA 2WYHA 2QRMA 4DSAA 3QLJA 1EESA 3DD1A 1SU8A 2FVYA 1UC9A 3LBYA 4NQRA 3E5RA 5GIOE 1JDZA 4G8BA 2FSFA 2IXAA 4MVCA 4DR2B 1BH2A 1P1IA 1EFPB 1WCV1 2HSZA 3KOWA 2D06A 4HPWA 4KLNA 4UFNA 2PR7A 5AVQA 2W42A 5DCYA 3UKJA 1K3TA 2ZCVA 2J9FA 4IH1A 1TAUA 4WDRA 5H3CA 2W70A 3R6DA 2JFPA 4FONA 1EK2A 2R1TB 4GZ6A 5AR1A 3FDIA 2PBLA 1C1XA 5AVSA 1J00A 1M74A 4MUKA 1KI8A 4IMRA 1SY7A 4RHCA 1N1GA 2CDBA 3DTVD 4RQUA 1TM4E 1T8WA 1L6RA 3BJRA 3K92A 3LVFO 5CA0A 3T0GA 2H1VA 2LE0A 2IA5A 4B6EA 1JLRA 3I58A 4MH0R 4MO2A 3WP0A 2NN3C 3WNBA 5AW6A 1G5QA 3FVWA 3NIGB 4AY2A 3SHVA 1UF9A 2G7ZA 1T9ZA 1X7XA 5D2CA 2H16A 3LFTA 4BFXA 4YT2A 5KNDH 1FIUA 5ALNA 2WSSA 2VLIA 2O8VA 3CEJA 3LKBA 4YV0A 2CVOA 1E1CB 3KTAA 3DCIA 3BWEA 3GRRA 1SKUA 5JR3A 2Y1CA 2GVZC 3PNQA 1NIJA 1W36D 2XQVA 4O08A 1IBLB 3OCWA 4EHLA 1SZJG 4DA8A 3ADKA 3GROA 4FFBB 3I61A 1OBOA 3F71A 2RHDA 3AIOA 4PO8A 5LA6F 2F8SA 5IYZB 2CDCA 3PE4A 3RHSA 4C4ZA 3PPYA 1XZGA 3O8LA 4HDAA 4IJWA 3RJMA 3EZGA 3TQCA 3S5JA 4D4HA 1RWVA 2WT9A 3OQIB 3G68A 2ZXUA 1IE3A 1RJDA 1VA4A 2Q0QA 4URUR 5DM60 2QBYA 4CQLA 2B8NA 2J4DA 1POXA 4J4HA 1YACA 4FSXA 3WK6A 5FV4A 2XDQA 5JSZA 4MPJA 3QE3A 1TK9A 3HKCA 1ATIA 1Z08A 1LI4A 2WAMA 5K0NA 5TGDA 1C9EA 3BTUA 3PHIA 1TKRA 5IKPA 1WDWB 1X14A 2EVWX 3A6JA 5C35A 4KUEA 1DDIA 3QWBA 3AY3A 3VAAA 3X1MA 3C1TA 1Y89A 4KQCA 1A4RA 1YJCA 5BYKA 1BEEA 1SKBA 4LJSA 1DQSA 3FMIA 4BMYA 6Q21A 2O2ZA 2WWRA 3BKWA 3T1NA 1V6AA 1NLYA 2JKYA 2PMDA 4GOOD 2PH1A 3GUHA 2JIZD 3KLNA 3NUZA 1P1KA 4FGJA 4NENB 1IQ0A 5JXJA 3LHSA 5AOVA 1UFQA 4WFJA 3NXKA 5P8WA 4C20A 1XEXB 3G2QA 4HLUC 1O57A 4I1SA 1U7OA 3CPSA 3ENWA 1N1EA 1L5HB 1Z5ZA 2QMQA 3HJUA 1FZQA 2DPLA 1E2JA 3UT0A 4CF7A 3PYMA 3ZHYA 5LOVB 1S01A 3PC3A 4UEOA 3C3PA 2GD6A 4BNGA 7ADHA 2AL7A 2AOUB 2ACVA 1VCIA 3DNPA 5ES3A 3FI9A 4P3OA 1R37A 3KSAC 4HNAB 1E66A 2XEDA 3TVDA 2ZBEA 3RBZA 1XA3A 4C5CA 3I6BA 2QN6A 4MRVA 3KU4A 1Y8QB 4ZYWA 1CUWA 1KPGA 1P1JA 1SRRA 3FFBA 2QZPA 2MYUA 3O0TA 1J2RA 4YPOA 1COWA 5T67A 1ISFA 2AEMA 2I6SA 3F9IA 3DHVA 5ARDA 1RXWA 3I9NA 3KHTA 1TC1A 3L46A 1FQOA 2HCJB 2Y1EA 1SVUA 2B36A 4KLZA 5T7BA 3HP1A 4DQDA 2Q5HA 2GPTA 3LY9A 3ZDXB 2OLEA 3DFIA 3IVCA 1LDGA 2Y76A 2A7QA 2AQKA 1ISHA 4D56A 5B57C 4LZWA 2XRYA 3ENVA 3L0IB 4YAOA 5LDGA 2V65A 5GGYA 3BMQB 2DFKB 4KPUB 5JZSA 2CHGA 1ONNA 4YAUA 1AUXA 1EA5A 1RXYA 2Q3FA 1O9GA 1NG1A 3TMYA 1KDOA 2C4TA 2IL1A 1CNMA 1H0HA 2ZRNA 1DEHA 1GG2A 2QRGA 4KZKA 4DLNA 2PL9A 3BSYA 4ZVQA 2PLNA 2GAFA 1N5MA 4OMUA 1LCIA 4ER3A 1FP4B 1D07A 1KY4A 2B2XA 1MVNA 1SHUX 3E9QA 3NJ4A 4N40A 3WIOA 2IWHA 2ZTSA 2OQVA 4C7OA 1DO0A 3A0UA 2RGYA 1LPOA 2XMGA 3DLCA 4ARAA 4DKXA 4KGDA 1JR6A 1G20E 3PCTA 2AD1A 3M9XA 2VR1A 1ZK2A 5L95A 4FR2A 3TTTA 3PYLA 4JU9A 2QJWA 1K3UB 5EFZA 1DBWA 2YV4A 3RVDA 1P3DA 5B2EA 4Q3NA 4RWZA 3LT1A 3VKGA 3CEHA 2BGUA 4RPCA 4MW2A 5LWQA 4G07A 2HBQA 4MOWA 4U0KA 5JCJA 1RCFA 1CR4A 4E31A 5TVKA 2XCLA 2YZNA 4LE1A 5BW6B 2F17A 4O4IA 3NHWA 3OCXA 3OT5A 4DTCA 1TIBA 1K06A 4MQFB 3BK2A 5EVCA 1PN3A 2QENA 1RPTA 3KQQA 3T9EA 3J80A 4RQAA 4N8SA 1JFVA 3W1VA 1V71A 4GBED 3I83A 5SICE 1Y6ZA 4OP2A 4KK4A 1C3LA 2I2AA 3U3ZA 3KYJB 1D7AA 2EF1A 5KQSA 3K0FB 5I45A 2VTVA 1JE1A 2UAGA 3CKYA 3LC1O 5D3KA 3GA5A 4HDKA 4V0KA 1NVWQ 4XGKA 3D0QA 3KUUA 4LGVA 2BMEA 3AL2A 3DGFC 1XDDA 3R4VA 1HDRA 3QIAA 1U9IC 3EDOA 1RCTE 3USCS 3IE1A 1NFRA 1SZPA 3TW0A 4C6RA 3K0AA 4FZJA 3RV3A 5E2BA 1HYHA 2FQ1A 5EHXA 1T8RA 2WV9A 3R8CA 1ZXBA 2R8EA 1QCYA 3TZ6A 5HKKA 2IXDA 2K87A 3AHHA 3CPJB 4H7KA 4XWGA 3M4JA 4DMMA 4YXFA 2G9NA 3QX3A 4KQHA 2ZANA 4H6XA 1OHHA 1FXWA 3CVVA 3PSAA 4L8GA 4TSRA 3U4QB 3OFJA 1Q77A 1SHTX 1SIBE 1I2BA 3DOEA 4JBIA 4UC0A 1Y0BA 4OQFA 5BSUA 2ZIVB 3QKSB 4YDHB 4R8LA 4YP5A 4BX8A 4CNQA 4EZEA 3PLAE 5ILQA 1QVAA 4K03A 2GAAA 1RJFA 4Y8VA 5IVKA 1U2RA 2HPAA 4YVFA 1XTRA 5FYDA 3DDCA 3RSZA 3TIXB 3CO0S 4OGLA 3B3JA 4FQ7A 4CW7A 1F60A 2KE5A 3G0IA 4KO8A 4F84A 5LCXA 2XOXA 1R3UA 1QR2A 5K3FB 5CB6A 3I76A 4TYMA 1BC5A 5FDFA 1E61A 1EVKA 2UUOA 3K8ZA 5AW4A 4N7BA 2J3EA 2WTNA 1OFVA 3KQMA 3WWCA 1Z18A 2VKTA 4P7JA 4LWQA 5BV7A 5CFNA 1GIAA 1QOQB 1CQIB 5F2EA 2JCBA 2C2YA 2IYVA 3SOPA 3BTOA 3C5VA 3F3KA 3L7CA 4X1YA 4AMGA 3EPRA 1J5EB 4KKXB 4F06A 4M8KA 4FOSA 3CY6A 4O3FA 4ID3A 3UUFA 3U80A 1P0MA 3GZJA 1ANKA 4UVGA 3MELA 3ODGA 2I76A 3AVQA 4JKOA 3F1KA 1L4BA 4PAGA 5E1DA 1FSPA 3L7KA 4ACBA 1C7RA 1GTSA 4HR7A 1AMOA 1R16A 3ILXA 2QTBA 4S2UA 2AN9A 1SIUA 3KV3O 3K0KA 4KMSA 4OYYA 3VTFA 4D0RA 1ZM9A 2HGSA 1AZLA 2EL9A 1GA1A 2C31A 1LTQA 2JZNA 3A9TA 1TD9A 2H8GA 3PPVA 2PIDA 1DG3A 4H7JA 4LGYA 3R74A 4XWKA 4CEIA 4FHZA 1L5LA 2BFCB 5JARA 3MTQA 4MRAA 3U9SA 5CB4F 1OJ7A 2IBSA 4EY3A 1V5WA 3VOTA 4CE6A 3I0MA 4BO9A 1NI3A 3TJRA 3ZCXA 1RMQA 2IPAB 2RSLA 2HQOA 3SD7A 2BGTA 3ISJA 1GZSA 2IQ5A 3QK7A 1DAOA 4NQZA 1B1CA 3KEOA 3L5KA 3W6OA 4FBMA 3AVXA 3G1WA 1ZBQA 3E1GA 3OCVA 2BWJA 2B6NA 2VTBB 3EXHC 2NZXA 1DQPA 2DCUA 1PR9A 2CKMA 2PAFA 1P3JA 1KWGA 1GCUA 3WV5A 2I3GA 2ONZA 1QQBA 2JH3A 2GETA 2XNSA 4P31A 4R4JA 4UJ3A 5AJZA 1JLSA 1KJ9A 3HWX1 1LF0A 2UDPA 3AF1A 4LFCB 4P33A 2WM3A 1IWBB 3K9NA 4QOIA 4ZT2A 3Q3GE 3GARA 4DWOA 3GP8A 1Q7BA 3OZIA 2VPWA 4M49A 2DRIA 1ZD8A 4QHTA 2MSNA 3L8DA 1L4NA 2PTHA 2W2NA 1XAJA 3ST7A 5CR9A 1WW2A 2CL0X 4HWOA 1KVTA 1HE1C 1OV6A 2FPIA 4YONB 5G3YA 3SS7X 1CY4A 5CG2A 3ZDAA 4LY9A 3LUAA 2XECA 4TKLA 4UD2A 3VC7A 1RWBA 2K2QB 4B3DA 3ZHUA 2BKUA 3WY9A 1NW6A 4M98A 1ES9A 2NXEA 4NZOA 5F77A 5EJAA 3B8EA 3HXOA 2B1IA 3GGJA 5BQPA 1N2ZA 1NULA 2JGNA 4H6WA 1COZA 4PZ0A 1O6FA 3QE9Y 3GJ4A 1TUGA 2OZLB 4EMTA 3GVIA 2WYIA 5TRTA 5H59A 5HCIA 3IQHX 3QWFA 2VYVA 5EGNA 3OUUA 4QOSA 1K7YA 1RI3A 2QRHA 2VDQB 2WSYB 3RKRA 1WRBA 4UVIA 3T9AA 4EHKA 3BH7A 2FW6A 4X7PA 4ARBA 2RGXA 4LW8A 10MHA 3MUNA 5IVDA 4IGFA 3WFJA 1VKHA 1DBRA 3W1WA 1WMBA 3QM1A 4OHBA 3KKQA 1CUVA 1XQVA 2QX8A 4MI3A 1XHFA 1LJLA 2CCJA 2VATA 3IKVA 4QVGA 4FFLA 1XG5A 3WLAA 1V8PA 4MRMB 5TQ2B 3ROFA 3N2NA 5JYEA 4OJYA 3PNMA 4PC3A 1W2GA 4KYIB 1W87A 3LIPA 4PSKA 4EO4A 1KI3A 3I9V1 2P4UA 4BN5A 1EUDA 2P75A 1D04A 3FUVA 1N6HA 1Z83A 3NCHA 3RIGA 1D9ZA 4WIAA 1L4UA 4E4YA 4MSUA 1E2QA 2R6JA 1BMQA 1YS4A 5AVTA 3V7UA 2RK3A 2DFPA 1IQPA 3CKLA 3OEHA 1DX6A 4OOEA 2FP4A 1DEKA 4P08A 5AKXA 3JQAB 3EF1A 4NZZA 3K70C 1BX0A 2IODA 2WI8A 1XCOA 1U3CA 3FOBA 4KXMA 4QJIA 1WTCA 2TMYA 4OEHA 1ZN8A 4V02A 4O2RA 3DE1X 4IMJB 1A8QA 4M46A 2BTOA 5IH7A 4FCCA 1JG6A 3ZHRA 3PNLA 2OP0A 1L7PA 2WUWE 3EF3A 2GN2A 5DYGA 2VPTA 3P45A 5EQTA 3PHJA 2XT9A 2JJ2A 2GEJA 4NULA 2CVQA 2JFBA 5IVPA 2WQ6A 2R79A 2DY1A 2X7HA 1JQBA 3QEKA 4KVGA 4O2AF 1OAOC 1IMJA 1X38A 3JQCA 1DC6A 1RXSA 3KZKA 3OU6A 2DECA 2G0NA 1NM5C 2PY6A 3B70A 1BIFA 3FX2A 1UBEA 4M1TA 4GMDA 4IDBA 3A2MA 3WMWA 2QAGA 2QLFA 3P0HA 2PUBA 3U39A 3ESZA 1IOLA 3NNDA 2Q1YA 5M2QA 3FTDA 3I09A 4LNAA 4BAZA 1KMQA 3F98A 3TCNA 1UOPA 3HKDA 3L7DA 3WK7A 2AQHA 1UP7A 1QO0D 1G9XA 3EVNA 1JFFA 3GRYA 3OZWA 4MUMA 2IYFA 4OK6A 4WZBA 4OCZA 5CPBA 4DLLA 4H3SA 5A9SA 4S1PA 4AF7A 1H4SA 4RHYA 2IPOA 1J90A 1UK7A 3EOBI 1M10A 4A2PA 3L0YA 5JMTA 3H87A 4BMVA 4ESEA 2HWKA 4ZZIA 2QRVB 1P18A 1N2CA 6CHYA 2BM0A 5DN9A 5KQRA 2DR0A 1HGXA 2IYSA 3QNUA 1J07A 1F3OA 1N3IA 1L7RA 2E4UA 1R6UA 3FLBA 1KSHA 3GBVA 4LJ4A 4NZ9A 4OQMA 1JDNA 3NHYA 1F8FA 1Z34A 4GX2A 3S2GA 4LA4A 3DGEC 1Q20A 3VKWA 4MQ6A 3AFNA 4ER7A 1VKZA 5TC4A 2YCBA 1Y9EA 3TTVA 3LQ4A 4KN8A 2WU3A 4CF5A 2DG2A 2GXAA 4YUYA 1BCSA 1C0IA 1H22A 1N6PA 3T0FA 5FBKA 1LWOA 2QI9C 1SBQA 3EVEA 3AUUA 3CRNA 3GJ7A 3K0HA 4PVCA 3ZWBA 4EGCB 3U7HB 3PX7A 1L0BA 4J0IA 5ALZA 3AR2A 2SCUA 5F5NA 1XNHA 4D3FA 1I13A 3KDSE 5IANA 3SQMA 4QU8A 4KQ9A 3DKPA 1BMTA 3KR9A 3HQ4O 4QOHA 1TM5E 2E4WA 3HJTA 2XQKA 1T25A 3B78A 4EW1A 3PF8A 1FP6A 3JVVA 2ZAMA 5H70A 2CXXA 1FYEA 1O0CA 4MYHA 5C81A 1BMDA 1XR3A 3LECA 3KETA 1J21A 4H0CA 4XFKA 1Q7TA 2G5TA 2C97A 1ONPA 3D8BA 3KHKA 2W2LA 4Q02A 1QH1B 2X23A 3LWBA 1GRCA 1FXSA 1Z2CA 3Q9NA 5JZ9A 3FKJA 5AOBA 3S81A 2Y71A 1O0SA 5DGTA 3RE1A 4B82A 2QG4A 1RSZA 2YRXA 3SNKA 3IMEA 2HNKA 4IIVA 4ITUA 1S4QA 4WE3A 2R8XA 3IALA 5LA6B 3D2BA 1I3NA 3PUXA 1T5LA 1XMJA 2M2IA 2EDCA 1SOVA 1VKNA 1WNFA 1X19A 3OZFA 3BD9A 1JDBC 4I2NA 4AKSA 2QYHA 5LLTA 1T1SA 3NRCA 1C9KA 1UDWA 1NMEA 2ECOA 5IVIA 1YBAA 3P2OA 1JR3E 3GF4A 5DYYA 1DAHA 3RF7A 3ZKWA 5E9WA 4I7EA 1SXQA 3QFFA 2UZIR 1IEXA 1P1BA 2NVUB 2CF5A 1EFTA 2CLEB 3SR4A 5KWVA 1HPLA 3OE4A 4K46A 1I32A 1WSAA 1SURA 5ADHA 2H29A 1EHIA 4QUJA 1VLQA 3AKCA 3D4LA 3V4OA 3W6PA 2W4MA 3EGXA 3OCZA 4P84A 4ZAVA 3RFUA 4AX8A 2JGMA 1NLFA 4I4NA 2NZ2A 2PSFA 2XZLA 1G21E 3IC5A 1XZMA 4R1TA 4YI5A 1XAHA 2V59A 3GLUA 4A26A 3AF5A 4RWEA 1H8HA 1QG2A 5TMPA 3EQ2A 3VJLA 1X8XA 1FY2A 2FCAA 1CP3A 2HHCA 2AI2A 4O25A 4P3NA 3UJ8A 3GLFA 2VAVA 4X92A 4GLOA 4J6EA 1X1DA 1GQFA 4MR8B 3AFIA 4QUGA 1YNOA 1G6OA 2NAFA 3ZY6A 4HNQA 4K3VA 2AHOA 1XO1A 2CJXA 1X80B 2Y2VA 3E4CA 2ZLBA 3E9EA 2NUBA 2R6AA 4IDAA 1OLSB 4MCAA 1IWOA 1YZGA 3ZH2A 3VR5H 2AOVA 4IIXA 5C1IA 5BSGA 3GVHA 4TXJA 4YJKA 4AJOA 5I3ZA 4MCIA 1CJMA 3E2IA 1OU0A 3ABSB 1OXBB 1P2VA 3D3KA 4MGEA 1UWKA 2HH9A 1K6MA 4HB3A 4J8PA 3UWOA 5M29A 2OQIA 3O3CA 2QTVA 3NYIA 4O5AA 4EEZA 1XRLA 3AFGA 2BONA 4F7DA 1WZEA 5THKA 1DKQA 1N92A 1SCAA 1WXGA 2XY4A 3D64A 4PC2A 4TRNA 2AS0A 2PNFA 3CZCA 4INZA 3ISTA 1LPBB 2PRJA 4URFA 4B1FA 1OILA 5B4VA 1DPFA 2M1ZA 3O8NA 2LR0A 2ZWAA 1KNQA 2VNSA 4L78A 4PRYA 2YS6A 3I5MA 1BS2A 4MV1A 2CDRA 3GLKA 3LYUA 3WLJA 5K6RA 1PT5A 3FZYA 4C14A 4MPDA 5K0JA 4FHDA 1EQ2A 4DEYA 2P5YA 3UO8B 3MA0A 4MR7B 4WXPA 4MCHA 1OH6A 2PKWA 2ZRJA 4MX8A 2Q1UA 3UATA 2HWWA 3NUQA 4GI1A 1C7FA 2P9HA 2ZJBA 1KOJA 3BGDA 3R5SA 5IC5A 4GDFA 1HEYA 3FNGA 3TI9A 1N0VC 1UBTS 3FUTA 5MGBA 4HDQB 1CUSA 2IZ1A 4X20B 2GVNA 1TAHA 2OHIA 3JQPA 4XYGA 3DMGA 3OC6A 4UVHA 1V6CA 2RGDA 3PFGA 1D2RA 1HMPA 3BKXA 5JFGA 1YB1A 3TOCA 3S29A 3VKFA 3DZ8A 1I4TD 5KSYA 3KBOA 1RAIA 1QLJA 3ZNNA 5BR1A 2C4UA 2OB2A 2OHJA 4RE6A 2W6OA 1HLGA 3KJXA 3N8NA 2WINI 1GM5A 1Z68A 3BMOB 3WLHA 1WP4A 4HDMB 4DTIA 5F4BA 3AESA 2YS7A 4AO7A 4CL8A 2R68A 3RVQA 3OOEA 4W82A 1OZHA 2DQYA 3ORYA 4K05A 4ZU3A 4QQRA 1UEJA 3U9TA 2NU6B 3KUKA 4X8LA 2ASVA 4QQKA 2ZJ5A 3FAZA 5ADWA 2WJHA 2ZQYA 2OAGA 4JXXA 3PFFA 4GLFA 1DAEA 2ORIA 2C2ZA 5CIQA 3NAQA 3C2QA 3D43A 4LC9A 3FNRA 4DRXA 4GPTA 2B4RO 3B82A 3V7YA 2OO5C 1Q0PA 2AK2A 5D3MB 3VNSA 4E2XA 1ZD5A 1QZTA 3MJCA 4TWZA 3O75A 4W9RA 5BR7A 2C20A 2N75A 3O21A 2DHQA 1G5PA 4DBVO 3QVGB 3UUWA 4C5BA 5FEUA 4A03A 3IUQA 3KT0A 4O1HA 1U8UA 2VZ0A 4R0NA 2P6OA 2GJ4A 4AKHA 1Q0LA 1RWNA 1YL5A 4KO2S 4GVXA 3WTBA 5KSPA 1KOLA 4PYKA 4RJ2A 4ETWA 4LKRA 2MYTA 1A69A 2PHZA 3HWWA 4YJGB 3FTNA 3TKLA 1A76A 3ZE9A 1U98A 1SVSA 3WNQA 4MYUA 3HV0A 1UJ6A 2LPMA 2PS1A 3ZXXA 3JATA 3ZCQA 5KAPA 3F4BA 1K0UA 3IIKA 4DVJA 3P4YA 4IYJA 4BQEA 2QN8A 4K26A 5U1PA 2FW0A 3H1EA 4YHBA 4B48A 3CUTA 5KYNA 5IKMA 2V4UA 1CRZA 3KZCA 3R5TA 1JAXA 1QCCA 1Z7EA 2NYUA 1QBGA 2P90A 3D8RA 3SFZA 2QZJA 4DPLA 2AOXA 1P0QA 5B1EA 2A0FA 3CX4A 3SC2B 3ZD9A 2YN2A 3N2IA 2ZP1A 2G88A 3CX7A 3IO3A 2IOHA 3O92A 1LI5A 5TPWB 4EI2A 1SB8A 3IJEB 3I04M 1E1RD 2FZGA 2I33A 1GNRA 5ALIA 1Q0QA 5AKJA 1IUKA 3JSXA 3M6XA 1Y4AE 5IFLA 3FIUA 4ZI2A 1YS1X 4A6PA 2GPYA 5IKXA 3I9KA 3LKZA 4HLUA 4Q21A 9ATCA 1ZHHA 3KOUA 5LBUA 3D1VA 4Z4CA 1DE0A 1KEUA 2A3NA 4UVDA 1FDIA 1ULBA 3R6LA 2D6FA 3T06B 2HI0A 4HH1A 1RLIA 4CT5A 3H65A 2JAHA 2WKPA 2VNHA 2JC3A 3W06A 4IJ6A 4DR6B 5FBVB 6YASA 1IQRA 1WSDA 3NAMA 3VOSA 1R7RA 4HAZA 2QD2A 1WOYA 4P9NA 2ODTX 3G85A 2DBRA 1SCUA 1U8XX 2HREA 2ZIZA 5CDHA 2A94A 1NYRA 1YDFA 2IYRA 1N9ZA 2ONKA 4V0SA 1X15A 1DAMA 4OFZA 1NTOA 2R6CA 4JI0B 3GUYA 4PANA 1CJBA 4I5EA 5ALPA 2P7IA 3LCRA 6GPBA 2JHFA 4RPKA 3RT1A 5ILOA 1ORDA 4Q4AB