1XQ9A

Structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Phosphoglycerate Mutase from Plasmodium falciparum at 2.6 Resolution
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords phosphoglycerate mutase
total genus 75
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1xq9A00
2P6OA 2P77A 2P2YA 1BQ3A 2ENWA 5AJZA 2HPAA 1C80A 4MA4A 2P2ZA 3C7TA 1QFXA 3FJYA 3IT0A 3D4IA 1RPAA 4EO9A 3GP5A 1DKQA 1UJBA 1DKLA 1ND5A 2HHJA 2OWEA 4ARSA 4AROA 3D8HA 3IT2A 1V37A 3F2IA 3LL4A 2AXNA 5AJXA 3E9DA 4JODA 1DKMA 3KKKA 1BIFA 4E3WA 4TSRA 1ND6A 4EMBA 2DWPA 5CX4A 3NTLA 3PGMA 1H2FA 1SKBA 3MBKA 4FDTA 2RFLA 1T8PA 3EOZA 5HTKA 2YN2A 1DKPA 1H2EA 2EKZA 3D6AA 4ARUA 3EZNA 5AJWA 2P79A 1RPTA 1C81A 4PZAA 5CU7A 4JOCA 2P78A 1SKAA 3OI7A 4QIHA 3IT1A 1YJXA 3QPVA 2H0QA 1SK9A 1XQ9A 3LG2A 1BQ4A 4PZ9A 4PGMA 2DWOA 3FDZB 2P9FA 3LNTA 1DKNA 5PGMA 1QHFA 3MXOA 5AJYA 3ZHCA 4ARVA 2WNIA 4D4KA 4IJ6A 1DKOA 1EBBA 3DCYA 1V7QA 2A9JA 5CDHA 3BIFA 2HIAA 2PA0A 4D4JA 1SK8A 2WU0A 3DB1A 4D4LA 1QWOA 2F90A 4ODIA 3FDZA 1FBTA 1NT4A 5HR5A 2GFIA 1UJCA 2P9ZA 2P9YA 1FZTA 4JOBA 2YN0A 3NFYA 4D4MA 5AJVB 2OWDA 2IKQA 5AK0A 3IT3A 3E9CA 2WNHA 3K4PA 4FDUA 2BIFA 2QNIA 1E59A 4GPIB 1YFKA 2A6PA 2I1VB 2EKBA 1CVIA 3QPWA 2H4XA 1IHPA 3R7AA 3GW8A 2P6MA 1K6MA 2ENUA 3F3KA 2H4ZA 1E58A 1C7ZA 3E9EA 4HBZA 2P30A 3K4QA 4IJ5A 2EOAA 3O0TA 2H52A 1RIIA 1TIPA 3HJGA 2P75A 3QPUA 4GPZA 3GP3A
chains in the Genus database with same CATH superfamily
4HLCA 3TQSA 1U2GA 3UBMA 4UEKA 2QTCA 3WBFA 3RVLA 1Q6YA 3NUQA 3QHPA 2HMSA 1ZRSA 2IY8A 4TYMA 6REQB 2A9FA 5JAOA 4JJ8A 4A2QA 1LRJA 2AK2A 2W93A 4FIDA 1F0PA 1FFDA 4OUKX 1IJEA 1PJBA 4IHQA 3UTDA 2IF2A 5A1JA 5AUPB 2I7XA 3WHLA 1I7SB 4YPVA 1JBKA 2AQ8A 4IAOA 3FJYA 2BAGA 3N5CA 2QI9C 4QAJA 5DF1A 5J4YA 1NSYA 5CA0F 4LVUA 4R5MA 3KWJA 1FDUA 4FYXA 4YV1A 1GGHA 4NDZA 4IH9A 1CUUA 4HPJB 4MVWA 2ACKA 3VVCA 5BXYA 2IYOA 5CLGA 3S44A 4EKNB 2QHXA 3V7WA 3VZBA 1O03A 1R0WA 8ATCA 2ST1A 3VYWA 2A5JA 1YRAA 1Y5RA 4CF4A 2J46A 4JNKA 3V3TA 1BCSB 2QLFA 3ORQA 4RA6A 3TQHA 2O2GA 3M2PA 5ALSA 4HFNA 1L5NA 4D44A 5EZ5A 2ZJ5A 3SD7A 2W2OA 1IAVA 3MZ0A 4K1XA 4PY2A 5HQ3A 4X41A 4P2BA 1AQUA 2BL4A 5I9IA 3DGEC 2WOOA 1E6UA 1HF3A 1U8TA 1X92A 2OBNA 3DM5A 3GN2A 4OXIA 4XEHA 2C1EA 2DFNA 4DCSA 1RPJA 2V65A 3JD0A 3QW2A 1GOTA 5K3FB 1G3QA 4IDGA 1LVGA 1A7JA 2EJCA 3GEMA 3I04M 3NOVA 2XQFA 3C39A 3ZXYA 5HCUA 4YCSA 5BR4A 5F9FA 4MV8A 4EZEA 3AUTA 2EIXA 1QUEA 2QT1A 3G6WA 4KWCA 4IRMA 1EMDA 1ZK4A 4OPMA 5I8PA 1Q0ZA 3OVMA 4MUGA 3OOEA 1KR5A 3G7SA 3RQIA 3GOHA 5CIWA 4WSOA 1OHHA 2C3YA 5AJYA 3U49A 4QDZA 3GRRA 1NATA 3O03A 3C8HA 1SUWA 2R00A 3D02A 3N2NA 4JOSA 2R47A 3PSHA 4B9AA 3IHTA 1L4GA 1Z62A 2Y1WA 3GBVA 1E1QA 3AW8A 3Q3CA 4NYIQ 4F4IA 2QRVA 4HGNA 1QFSA 1F0NA 2E6UX 4WNYA 3RM3A 4FXPA 2V0CA 3IXLA 4Y2UA 3CZ4A 4QREA 5F3DA 1XTJA 1PQ4A 3N7TA 4IDNA 1NVGA 3W77A 1ANKA 4G9EA 1DC8A 1T6BY 4G89A 3QU5A 5CD1A 3RIHA 3F74A 1NPYA 2I6XA 4QXAA 4NEQA 4DLVA 3ER8A 3L8HA 2PVSA 2WU1A 2ZQYA 3JQEA 2FR1A 2PYZA 5TV2A 4BJ6A 2IP2A 5SICE 2W42A 5HHTA 4AQDA 2VDJA 4E5KA 2E5WA 3NRBA 1PDWA 1ZFNA 5CEEA 4O4IF 2Z9DA 3C97A 2AOTB 1V3UA 5T41A 2JAWA 1M0SA 3GRKA 3RVMA 3U09A 1UJ2A 1QYVA 4FW9A 3CLRC 4FDVA 1WVIA 3UXMA 1PR6A 1KOLA 4D3SA 5I48A 4KCGA 2Z8YM 3IQIX 2AI1A 3QIAA 3TW8B 2YH2A 1Q57A 5E2BA 4YC7A 4BYMA 4EJFA 3ED1A 1Y8RA 2YXDA 2QRMA 3QSGA 3U3XA 4PC2A 5CB4F 2UV8A 1J8QA 2PD6A 1GZ4A 1HQCA 1U3VA 3AY3A 4NJEB 4RX1A 1E5TA 3PDWA 2OQ2A 3CB4A 5FPYA 3IXMA 1A95A 1G21E 5JPIA 1LQUA 1PGQA 3EFOA 1I7DA 2QP9X 3HBAA 4JUAA 1YCHA 5TARA 1FNDA 2VQ6A 2WIGA 4Y1FA 1IY8A 1E6MA 3IIMA 4FDMA 1XDSA 1RQLA 1M7GA 1YQEA 5DZSA 1QIMA 2YUIA 4WN3A 1KZYC 5EJ6A 2I29A 4X65B 2I3BA 3EMBA 5K20A 3EY4A 4RVFA 4RTSA 1A9OA 1XRJA 1JHZA 2B8EA 3T8YA 3NASA 1WW3A 1XCJA 2R62A 2NZ8A 1M34A 3DEAA 1V45E 1Q7GA 3AHDA 1N6OA 5HIAA 3ITDA 4NCXA 3OCUA 1NE7A 4UDOA 3VNRA 3VO1A 4YP1A 2XA1A 4W9NA 4WBXC 1FP6A 2F4NA 5F64A 1UADA 2VVTA 4AO8A 5A4KA 5EHZA 3D81A 1F38A 3NTXA 1KDZA 2F3QA 5KCZA 2R8BA 3RV3A 4FSDA 3E48A 5CDGA 4GOJA 2QJRA 3EVNA 4LKOA 2VRWA 2YHIB 4AJIA 5F7ZA 4R05A 1CIJA 1MPXA 4RTQA 3I8XA 1J2UA 3EXEB 3GOQA 4Q19A 1BE0A 2J3IA 4FBMA 1B8VA 4LUCA 3VNVA 2FTKE 3OE1A 1OLUB 1UC8A 1MENA 1NF3A 3VBCA 3D59A 3IMFA 1VRVA 1A96A 821PA 4JQOA 2G0NA 2J3EA 3H04A 4G36A 3AFHA 3IPRA 1A76A 3RTCA 5ARCA 1SIWA 2NU6B 3F4KA 1GZDA 2VPIA 4PXSA 3V6LA 1N2XA 2DJ5A 1K7EB 2XHEA 2Q5EA 3RUDA 4AZ3B 3G0HA 4GMXA 1HI9A 3G9UA 4WXYB 5GV7A 1X9IA 1F3LA 1IHYA 2GBLC 3OKFA 4R1MA 1GSHA 4HDKB 1P5RA 4A8PA 2ZJZA 1MAHA 1N2OA 2I6GA 3SKVA 1RXVA 1P1RA 3KTAA 4ZV9A 4ZYYA 1HUQA 3O4JA 5DLEA 2KI5A 2QL9A 4IIVA 1SKYB 4GZMA 3ZLBA 5CITA 3ZDBA 1KJNA 2XMZA 3RC7A 1CB7A 5SZKB 4YCNA 3IAUA 2ZRMA 1XDWA 3NWPA 3UWOA 1VGVA 2B1QA 5CFOA 1ESEA 3JQPA 1E8NA 1JJIA 1KPGA 2CNKA 3O3CA 3V34A 3HXTA 4GEGA 1X19A 1XNGA 1LH0A 1WJGA 3AWDA 2OFXA 1GLGA 2I3DA 2QNIA 1P1BA 1CEEA 4F38A 3L4BC 3P5SA 1UK8A 1C3VA 3RRXA 4HXFB 1HL7A 2RAFA 3JS5A 4QOIA 4P4LA 4JSYA 4PWZA 1Z63A 5DT9A 2FW1A 1IZ0A 1OV6A 1PZFA 3CH4B 3KXKA 5DYYA 3VC7A 2A9OA 1XVVA 2R7LA 3HHEA 3HVUA 5J63A 4Z51A 3HLKA 1T0PA 5F2OA 3TSOA 2O05A 5BYJA 5I9NA 2RHDA 4A8HA 1PZNA 2CLKB 3LC1O 2EFEB 3QYAA 5I4BA 2EOAA 4DILA 2WT4A 4ZPXA 1S3IA 1MX1A 4QLAA 3H11B 2O1XA 3ZY6A 1JIVA 4MWTA 4UDYX 1Z2EA 5IABA 1U9IA 2ETXA 4Y9DA 2H06A 1N32B 2CVQA 3F96A 3V1TC 4M0DA 1UFQA 2FH5B 2WFLB 3A31A 4WOCA 1HEIA 3CW8X 4KB5A 3DW1X 2OORC 1LQTA 1HYEA 2MSKA 1N8KA 1J56A 1VCNA 3AO0B 2A3NA 1TO6A 1RS0A 3RTAA 2OG1A 1PBTA 3GUZA 2JVKA 1EZ4A 3SAJA 2O3JA 4U5QA 3V80A 2HDWA 1YR2A 4I5GA 2RH8A 5AM0A 3RTBA 3K6SA 2WWWA 4EO9A 2AI3A 1MB0A 3AOGA 4XFJA 4YMIA 2D06A 4LBWA 1YTLA 1BDIA 4PFKA 2ZTMA 3V42A 4F9FA 4WV3A 1EUZA 3Q1LA 2FWMX 4HSEA 2L19A 4WGGA 3HEMA 5HBRA 3OU2A 4R1OA 3SR4A 2OBYA 3QFRA 3EMVA 5DBIA 1QH8B 1VYTA 4HUJA 4NABA 2ZUEA 4XXHA 3I52A 3N2KA 2XODA 4FDTA 3O47A 4UHKA 5EZYB 5CLFA 1N7GA 4M83A 3OFSA 1GV0A 4JUDX 2IXBA 4UD2A 4G4SP 4H4EA 4KOEC 2L0XA 3WJ1A 3UQZA 1ZICA 2P62A 3REOA 3IBYA 1YS2X 1SBHA 2GZ3A 1S7GA 2DCMA 3A6FA 4OY3A 4LMBA 4CODB 2E5FA 4OXNA 1TJPB 5K51A 1X15A 2XYRA 4QYSA 1JI3A 5GQSA 5CFMA 2LDBA 2PEZA 4CMAA 2GJSA 1EH5A 2X2FA 1ZI8A 1Z2CA 4PYRA 3S8MA 2XZOA 2AZ4A 2ZWAA 2XMRA 1I5RA 3QXJA 3LPLA 2QY9A 4ARVA 2OBLA 3G1TA 4RMGA 3FMIA 2PZAA 4MW0A 2BI4A 5FADA 2JH3A 3OQ1A 4H1HA 1N6LA 1TO2E 4MV5A 4RK6A 3U1VA 4J9UE 1AURA 1PDVA 4NENA 1SK8A 2O59A 5FWYB 4P4SA 5BMVF 3AXTA 4TV8F 4EHIA 4MTLA 5JZSA 1ZRHA 2VK4A 3A1NA 1J2TA 3C4JA 1SPBS 4NYMQ 4F4DA 3G88A 1GN9A 1LF0A 3F78A 5JZVA 1DJQA 2CHQA 2JK1A 2EXXA 3PRKE 5AK0A 1GKUB 2BBSA 4MUMA 1Z68A 1ZSYA 2B4AA 3PTZA 3K5PA 3LT1A 3EGIA 3RODA 5EJAA 1IULA 3UW3A 5FFMA 1RYNA 3STWA 5J4HA 1OVGA 4D8TA 2FAXA 4ENUA 1WMAA 1EP3B 4OH1A 5DXFA 2EKBA 4C2UA 1NP6A 4NARA 2UKDA 4B47A 4EITA 3TG8A 5AW4A 1N8TA 1YAHA 2GAIA 2Q3EA 2WUWE 1ZD3A 2AA3A 5MHTA 3F7NA 1SKQA 3T5AA 1K0FA 4EEKA 1S1MA 1S02A 2BZ1A 2BY4A 2P4SA 3JVVA 4C0HA 2XUAA 3U9LA 5LBTA 1E8MA 3FYSA 1X74A 2QXUA 3LDFA 1PDOA 3CNHA 3NEPX 1RJDA 4C3ZA 5C1IA 3ZZTA 4YMHA 2QQGA 1U7TA 4RZHA 4WLUA 1TCVA 2B8NA 1ZGHA 3M4ZA 4WK4B 5FOXA 3R5JA 2IEZA 1GZVA 1GGJA 3HHPA 2ZVDA 3NIBA 2Q07A 1R4ZA 2QVZX 4K46A 2HJSA 4R40A 5FTMA 1ILEA 5D8DA 3U3RA 2IITA 2ZRCA 4J16C 4DXDA 4C01A 1PS8A 1A9SA 3AB8A 5AW0A 1PCXA 4L73A 4BNHA 4DR7B 1L7QA 4F6RB 3D43A 1QF7A 2BI7A 2CMKA 5AKXA 4M8LA 4XD7D 3MVEA 4V0KA 1E3QA 3E5HA 4YJHA 2O3SA 1JQEA 2VA8A 3NLLA 2N46A 5F3RA 1K8YB 3BZBA 3EARA 1IUPA 1CUWA 1W4BA 2ONKA 3IPCA 1XDZA 3N9IA 3OD1A 1LRLA 1JB9A 2CFOA 3QUAA 4PLCA 4LQDA 2F64A 5FPPA 5IDQA 5E8JA 1Y37A 3CCFA 1LJLA 3A3PA 3LA6A 4Q03A 4UQOA 5JSYA 3AETB 3OPYB 5KYVA 4EI2A 2GPYA 1HRDA 3EA0A 3BZUA 1E9RA 4NBUA 3CRVA 2EG5A 1DC4A 1IDN1 1T5SA 4WKOA 4QU9A 4D74A 3GG2A 5BSKA 4E13A 2GEKA 2UDPA 1JDPA 3O84A 4H4DA 5JD4A 1EA7A 1ZW6A 4MQEB 1CZNA 1CDOA 5LOVB 1BXGB 2Q6LA 2QQ5A 4MXDA 2HQOA 4GLFA 2MYNA 4KRFA 4KVAA 4F9EA 2EDCA 1VSTA 2EX0A 4JLMA 4L72A 2JI7A 2GEJA 1ONBA 1QZ3A 2P9FA 1QCDA 1V8OA 4JY7A 1L4KA 4KWEA 3LS2A 2AD1A 5C3UA 3UMRA 4C0XA 4DVJA 2ZETA 2IOFA 3T3OA 4DNPA 1G19A 3ZIAD 2BELA 3SYTA 3UT0A 3KPVA 1DKUA 2PX0A 3GUHA 1DJPA 3HB4X 3JQ9A 3D6NB 2XZDA 2VDMB 2P65A 3TW0A 4TL9A 3OT4A 4UTXA 4E4YA 1GZ3A 2QM3A 3K9NA 3T52A 1IY9A 1XZ8A 1DQNA 4Z9XA 1V7ZA 5JS2A 2IHYA 1AXEA 1F2DA 3TNYA 4QBGB 4IHJA 3I83A 1OW3B 4LWPA 3LPCA 2WF7A 3TJZA 3Q7RA 1QGDA 5F7XA 1GWNA 2D59A 4G26A 5KOYA 2F1JA 5AJVB 4CKXA 3QJGA 1T9HA 4G5SA 3G9QA 4LECA 4NS4A 3LUDA 2G8LA 2R2GA 3RGGA 4OQFA 5IC5A 1XP5A 5I5EA 1RWPA 2IA5A 4V03A 5L95A 3WB0A 1D5WA 2BI8A 1TLFA 2H4WA 3T4XA 3KKNA 5M5BA 2YQZA 4M46A 1PR4A 3OJCA 3I32A 3TAHA 3MTQA 3ELWA 1CVLA 4UBIA 4X20B 2ZZMA 621PA 1JL3A 1JB1A 2QRLA 2ZBPA 3TNLA 4CF7A 3SIRA 1R6VA 2F43B 4DR6B 3QWBA 1BGXT 3USES 3I5XA 3B82A 5JS7A 4I1RA 4DMRA 5KUTA 4JP5A 5JNTA 1NUHA 3OWXA 3W78A 4TLCA 2FQQA 5EE9A 4A5OA 1G21B 4O8CA 4MW7A 4CV0A 2XKAA 3V46A 2GYVA 1P4AA 3KAPA 2K2WA 2SKDA 3KTDA 1UK9A 2EX4A 2FUKA 4X1KA 4I9HA 4DDUA 4UAGA 3THYB 3HCBA 1ESDA 3DKKA 5EIBC 5CCBA 2LP4Y 2NACA 1TW3A 2HEGA 5KNBH 2PQ0A 3WFIA 1EFVB 3DZFA 5DNUA 4GM4A 1N0IA 3TVDA 3A1EA 3ZDCA 4MIOA 1CEXA 3GRYA 2WKRA 3LC0A 2DRIA 1ECCA 3OZEA 4B81A 2FGJA 1Q3HA 2EFGA 2OHFA 1ADFA 4JS0A 5CYOA 2C1ZA 3V4VB 3UJ8A 4PRKA 4EHNA 1YASA 5IF9A 1EFPA 1GKLA 2B21A 2OV8A 2QUIA 4BUCA 4P33A 2CSXA 2G76A 5CEJA 5LUAA 3GAAA 4OA8A 1T2UA 2YWDA 2BP7A 4MMYB 5JYDA 2WJYA 1CDEA 4N40A 1K3UB 4O59O 3D6HA 1Z28A 2WIAA 3NTLA 4XGQA 2PX4A 5ALYA 3BDAA 3OT1A 1ADJA 4LJ8A 5JMPA 4MA5A 1HMYA 2J5XA 4QQNA 5D6OA 3WQRA 5A3QA 3H1TA 1E63A 3ER6A 4JHLA 5CVUA 3N39C 5CYFA 3FOZA 2H3HA 2CXTA 5F5LA 5AW9A 4HWSA 1D2HA 1E2FA 1C7FA 2Y0DA 5C8XA 3CVOA 3S2FA 3D4OA 4CLDA 5KU1A 3BD6A 3MHTA 4TV9B 1YZYA 3BTUA 1LSUA 1OXVA 4PZUA 4L9AA 3RU3A 3U4DA 1QKKA 4EPVA 4NFLA 3LPNA 4WI1A 4Q1CA 3BMNB 1X7GA 3LLCA 4NMLA 3K6SB 1V41E 2H92A 3ZHYA 1ZOOA 1DKNA 2J32A 3F46A 2ZDGA 1PL6A 1E94E 1KP2A 3HY3A 4PO1A 5H9WA 1FVFA 2H1OA 3JSAA 4HDRA 4ZCPA 3K15A 4D9GA 3N2YA 3N58A 4MAMA 1CQZA 3TXAA 1CYDA 5JZ9A 3FHOA 2ZYAA 4KR3A 4JI4B 1WLSA 2XEXA 3DFUA 5KTSA 2VJDA 4EG5A 1K6IA 2PD3A 4JA0A 5H83A 1PVDA 2ZJYA 1XG5A 5CB6A 2I3GA 3A7EA 3MD0A 1LXCA 3RAGA 4CR6A 1SXIA 4CT5A 4BNXA 5IXJA 2D8MA 2OECA 1DZ3A 3C15C 3RRJA 4ZEMA 2BTEA 4JBGA 4X84A 1OWLA 1UJ6A 1JHPA 1VBFA 1XQWA 4WKCA 4ZXFA 4HYQA 3HRHA 2YWFA 4S3MA 1C3OA 3OY2A 5KOJA 3C4QA 2ODPA 1IRIA 5DM4A 2WNHA 1UWCA 5DYTA 1QRUA 3U2QA 3UY4A 4HH1A 5JNLA 1YZVA 1XLTA 4IWYA 1H0RA 2NM0A 4UU8A 3PNPA 3WGJA 3AVOA 4B4DA 3GPIA 3PQ7A 4D4IA 4DBZA 3U56A 1QONA 2OBFA 4X00A 2AS0A 3GBSA 5LN1A 1GJRA 5LA6B 1ZH8A 2SECE 3SSAA 4A16A 5CDSA 1FRZA 3A25A 5KBYA 3ZGLA 3N0RA 5FWYA 4FTWA 2OBXA 3COPA 4QFCA 1WBJB 3IS3A 2CNOA 2HD4A 5IH3A 1SO8A 2GWRA 3EC7A 5FBVB 5M34A 2X9GA 4K86A 2DHQA 2GVDC 3JAWA 5J5CA 2JJ2A 5FAKA 1RWNA 3URKA 1HFKA 5JH7F 1Q2XA 2ADFA 2GYYA 2YIJA 3KR9A 1CQIB 1H6CA 1XX6A 4Q3KA 2WY2D 3ZC3A 1G20E 1KNXA 3G89A 4C5CA 1IU9A 2A78A 1KI2A 1ZUIA 2OOSA 3DDNA 3OP4A 4DE5A 5F2NA 3U6KA 1YI0A 4AJLA 3OJOA 2CK3A 1JXQA 4UVIA 2B5OA 4JR0A 3UKOA 3WGZA 1JQAA 1U04A 4DIUA 5L4NA 2WTBA 1B15A 1QMPA 4ZK2A 1E79D 4AVYA 1G8AA 3ML1A 1W4CA 2PVCA 3L8CA 3PC7A 4HLDA 1E1NA 5BV1A 5KYGA 4U2EA 3OO1A 5TGDA 1W59A 3E5RA 3CS3A 4ZV7A 3LQ2A 5AK5A 1D09A 1NW7A 1G0OA 1NNUA 3DP9A 5DFAA 2GEVA 5H7XA 5B7QA 4AMZA 4UBMA 2ZVJA 3KYDB 3RRBA 3CWQA 5JNRA 2BH9A 1MB9A 2CLIB 2J3HA 4QC2A 1P7CA 2Y1FA 3LYUA 2Q1WA 1BVUA 3ZBUA 1V1JA 1HQYE 2JGJA 4C20A 2VJAA 3PF8A 4CM8A 2ZI7A 3K1ZA 4EP1A 3OOJA 4J07A 1TRKA 1UP6A 4IJMA 1CNMA 1JAXA 4MW5A 3Q2KA 3U0VA 5EKXA 1ZGCA 3ZUGA 4IMRA 3GGCA 2C7GA 4K6KA 4P34A 4QEZA 1SVWA 4WCFA 2G80A 1AKWA 1ZK0A 4NVRA 2I4IA 3HJRA 4I9NA 4C22A 1NMEA 4WY2A 5K0TA 3ZLJA 1I9CA 3C3XA 5DNAA 4CM3A 3Q41A 3O1LA 5C3MA 1ZK1A 4JJAA 3VFDA 3CGWA 4M0CA 2AWOA 4HN2A 5HIJA 1AZLA 1HXHA 2P3QA 3KJEA 4HYEA 2C5LA 3D8TA 5I7FA 3GB9A 1O6ZA 1Q1NA 4X85A 1KY3A 2F48A 3U9TA 2O52A 4XTRA 3LVBA 1YJBA 2GWHA 2ZIUB 4HH3C 4WEOA 1N34B 1WO8A 4EO7A 4CI9A 5I01A 2FPGB 4UBJA 1LI4A 2ID7A 3JYHA 3QXXA 4Y1RA 4Z1MA 5JVDB 1QHFA 2WSMA 1FFXB 1IH8A 5SV2A 1LX6A 4BEBA 5DX8A 6AT1A 5TQ0B 2YYAA 2ZXUA 2P6NA 2K5UA 2IYZA 4COKA 1EUCA 3W8RA 1VFNA 2WTNA 1VKOA 3WLRA 3ZWPA 1QH1A 3LUKA 1S8FA 1MCZA 1BMFA 1XELA 2BUBA 2PLFA 3PCTA 3M34A 4TYQA 3RKRA 3TD6A 5HRUA 5BY2A 5E6SA 2ARKA 3GLHB 5HOQA 3LZ6A 4WZZA 4BRZA 2YOFA 4HXGA 1DX9A 4MVJD 2V03A 4QATA 5K8LA 1B73A 1T0UA 1T3TA 3C3JA 2WB4A 4MQEA 2IX9A 1DO0A 2QDKA 3V4FA 5DISB 3TLBA 5BQ3A 1HLGA 1SBNE 2YJ6A 3QX8A 5BT8A 2ZREA 4WMLA 3FYCA 1NFRA 3I39X 4ZJUA 4YJ3B 1XFDA 4CUJA 5T3YA 1SM4A 2WRZA 5A1TA 1RLMA 5IMBA 1Q0QA 4BWFB 4GW3A 2FX5A 4A0HA 4ZODA 1W47A 2CJYA 2FG6C 2X5XA 3TZ6A 3DLBA 4K81B 2YFHA 2CLEB 4MV1A 1E7RA 1RI2A 3I42A 3QBTA 4JJ7A 5J2TF 4JKIA 2A5LA 4C7OB 1GA1A 1J1ZA 2C5HA 4PONA 5ABPA 5ALMA 4F3TA 1MC5A 2CSUA 5JJBA 3KSMA 1L4MA 3Q1KA 3LGSA 3EBPA 4JYMA 1T29A 1Z6TA 2O8EA 1CJCA 2QSUA 4X5OA 3OSZA 2QGFA 1J0XO 4IZHA 1GTSA 1A5ZA 3OQVA 5AKIA 5IDWA 1F12A 1QAQA 3H86A 1YJAA 3OUZA 4NONA 5EESA 3FB4A 4MCAA 4R54A 3T3HA 4E5UA 2UYCA 1JR6A 2GK4A 5K4AA 4N5LA 5AUNB 5BUZA 2J9YB 3E1GA 4RFSA 5CFNA 1R10A 1W2HA 3DEYX 1KQ3A 1KJIA 4NCIA 5DLQC 4W5TA 1ORDA 2GT1A 4INAA 3IBSA 2LBPA 1AMNA 3CA8A 3EH2A 2JC3A 2XTNA 1WHTA 4DGQA 3RFTA 4Q7QA 5HGXA 4IF6A 5BURA 1KEZA 3KOOA 2J41A 3VOAA 1T1JA 5HKBA 5A0FA 3T9BA 2ZU0C 4HDNB 1L1RA 8ADHA 4JODA 1TLLA 1GZUA 1CERA 5DW0A 3WXMA 1OLXA 4DTIA 1HMPA 4NHOA 3UAOA 2GCEA 2AE1A 2F3PA 5AVSA 3QLJA 5KVCA 1Y7PA 2Q1TA 2UZ3A 1SVIA 4B6SA 3VNUA 2ZUWA 1B43A 1IXZA 2PMWB 2YWGA 4LI0A 2GQ0A 2JCGA 5LD2B 1JIQA 1I2CA 1KZGB 1L2TA 4H0NA 4CCYA 1DKPA 1L5KA 4AIIA 2G9RA 3MS2A 2O2XA 3BFXA 3EASA 3STHA 1LVUA 1PO7A 1T9KA 4G63A 3V9AA 3B3FA 5IXYA 4MO2A 5E6UB 4V0QA 4LBYA 1SXJC 3BXEA 2INGX 4BFXA 1T2FA 2EEZA 2XCIA 3ZU4A 2WQ6A 4IR7A 4EY3A 1G66A 1P72A 5BSEA 4Q16A 3WTBA 3MB5A 3V97A 4D6PA 3LK6A 3JR7A 3M6XA 5BUCA 2IH5A 2ZPAA 1YZQA 3BD7A 3FVTA 4PX9A 3A2NA 1WDLA 1FJ2A 2I2BA 2PUWA 3E7FA 1PEKE 3F6YA 4M2LA 4PX3A 2WHEA 5IWAB 1ZESA 2WKWA 3I2GA 4GGPA 3E9RA 3AZQA 3QOWA 1STOA 1VXRA 3KC2A 4J1NA 3ORRA 4G5QA 5J40A 4FNOA 5J43A 1OPXA 4QBFA 5BWMA 4KX5A 1PYDA 3K0CC 1ZDMA 3U4HA 2FDCA 5E1BA 3CUSA 2OUIA 2EL9A 1HT2E 1X94A 1CQJB 2FMIA 2YQ4A 1W6RA 3BXXA 3KALA 4ZAGA 2WJHA 4HX2A 5K09A 3GT7A 1WZEA 4YT2A 2IQ5A 3WK5A 4DEVA 1GKYA 1KEVA 2P2NA 1EI9A 4YIKA 4C4AA 1L7AA 2QAIA 3DNFA 5HQTA 2BIFA 3ELDA 4NBSA 1E59A 3U7RA 5KQGA 1SIOA 2GHQA 1E3WB 4TPKA 5J47A 5IRCD 1C9KA 1LBEA 2V6JA 4ZVNA 1ISHA 4F45A 4F60A 5A4IS 1UAAA 4WN9B 2QR5A 1T25A 1AV6A 1IWBB 1T5IA 4TV9F 4RPJA 1XJWA 5EJGA 5FQNA 4DNQA 4JBNA 1DRKA 1PGJA 2I4TA 4CU5A 2COUA 3HZZA 4Z9AA 3B70A 4GMKA 3UK0A 3RADC 3NONA 3Q8MA 2B1RA 1K97A 4GXTA 2IRWA 4KO1S 1L5FA 1LFDB 2WD8A 4KIUA 3R9KA 2IYUA 3GZNA 5M7EA 3W6UA 4W1QA 3JVIA 4O63O 4B6RA 1TIPA 4BQIA 3UJBA 1N1GA 3R0VA 3S2UA 1OX6A 3RT9A 4C6HA 5KOJB 2QIPA 2ZTSA 3OE5A 4XQGA 2I54A 4Q9JA 4U0KA 5EEHA 5ADUS 1SHJA 2XCUA 3X1ZA 3FSGD 1C3OB 3OG9A 3UWPA 2R79A 4IZ6A 2Y66A 3B2QA 3B6MA 2BFOA 2G08A 2PKYX 4RY9A 4F12A 2CMFA 1GEEA 4URUR 2QUBA 1DI0A 3ID6C 2BR4A 2MYTA 2WUEA 3NX4A 2ZB4A 4K87A 5EZSA 4DJEC 2PZMA 3T1TA 1JHVA 3U16A 2WVJA 3GLGE 2FPUA 4S1TA 2BKAA 5KTMA 4G01B 1QQTA 1YS6A 1U0FA 2COKA 1Q17A 4HQRA 4IDAA 4LJ9A 1IC6A 4OI4A 5DTRA 3RFCA 5FL7A 2I87A 5KDLA 1L5OA 3F2IA 3UFXA 4BMNA 4PYQA 3CUEF 3JQGA 3DXYA 4FFBA 1G16A 3L0ZA 3AR3A 4CCSA 2VZ8A 2PZFA 5D2CA 5CCEA 1OB5A 4HNTA 1ZIYA 4W8OA 2JF0A 4DQLA 4S2UA 1E5XA 3EDCA 4BLVA 5P21A 5FOQA 3PQ6A 4PM4A 2A67A 3ZE7A 5JSUA 3UAZA 3K0BA 2YN2A 3NH9A 1LS1A 1P0QA 1RKXA 2FR0A 4GP7A 2GEBA 3EZNA 3WZLA 5T6MA 3D64A 4R3WA 4CG1A 4MO9A 3SHTA 2FFAA 1L7RA 1XMSA 3I73A 5HE9A 3L0OA 4LDNA 3CLTD 1P60A 1HY3A 2UUCB 1XDBA 4O4JB 4JBLA 3IALA 4JFRA 5J1SB 3GEGA 4ZQFA 1JT2A 1MABA 5T4HA 2YNMA 4OHUA 2POQX 3BMCA 3GEIA 2PYIA 1NQXA 3GQVA 3MRVA 1F0KA 4MQMA 5D7NA 4CQLB 2AI2A 2YXNA 3D7SA 5ICSA 1DZIA 1OAOC 2C54A 5G4KB 2CKDA 3LHFA 4M76B 2AEMA 4RGYA 4ND7A 3U62A 3WP1B 3WYBA 5CBKA 1EJ6A 5LZ9A 4OKNA 2YV5A 1BE1A 1OFVA 3DEHA 2A1TR 4TQAA 4LXIA 1GTZA 4MR8B 4P35A 2GZMA 1DG3A 3F5SA 2GX6A 3R5XA 3GFFA 3K0SA 3UVEA 3FDFA 3JQ8A 1XMQB 2W90A 2H1VA 1PUJA 2J45A 1M8FA 4H08A 5L3QB 2GN6A 5A06A 1ECGA 2B9EA 1N3YA 4ROTA 3G2KA 4KQCA 4NV3A 3TIFA 1DDIA 4LXHA 3FVRA 3U3KA 1C3JA 1VCIA 2V8BA 1ORTA 1ZX1A 3EN0A 1PWZA 2IT1A 2GBCA 4IZOA 2X77A 1W88A 4JBXA 1NT2A 4MLPA 2YW9A 4OMUA 4J1QA 1DC5A 2J9FB 3H9EO 3NV7A 4BX2A 4HRXA 3QXHA 2RGXA 4XLLA 1Z26A 5B12A 2N1MA 1CB0A 4JP8A 2GM9A 3RC9A 3WYNA 2DBQA 5FYDA 1RXSA 1VM6A 1KJZA 1MO6A 2CMGA 5E7QA 3RSGA 4TYPA 4AKIA 4QVKA 3RABA 2J6BA 2O8CB 3Q72A 3LX8A 4XIFA 1K9SA 2FQYA 2FPPB 3FUXA 1EIZA 5ITVA 2PUEA 4Y1GA 5TMBA 1JLLB 1JFLA 4P38A 4JU8A 4C0QC 4OHZA 3ETLA 3E7PA 8OHMA 1FMTA 2A1TS 2X4DA 3AP2A 4PLVA 4QGHA 3UB3A 4F96A 1V0JA 5C80A 4QOJA 1FYDA 1MVOA 3UCFA 4RA9B 2XDYA 2GBFA 3GLVA 3B8EA 4KJXA 3R0ZA 1RQ7A 4XPZA 2ZR9A 4LV5B 3A05A 3MF4A 1GIAA 3QU9A 4FONA 1YQDA 1YWGO 4Q4CA 4IQGA 5C52B 1OT3A 1JRLA 2ZT8A 1VP3A 5EZYA 5H82A 5J2TA 1KMNA 5B36A 2PQMA 2QNBA 1IBRA 3CW9A 3K0AA 4XPIA 4IYRA 2PNFA 3DGFC 4CBVA 5JXWA 1XRPA 2H9IA 3BD9A 3WJ2A 5K9ZA 3ICQB 4YCAA 5IBQA 3MGBA 3UYLA 1T8RA 4LF5B 1Y9JA 3PWKA 1TKCA 2YWRA 4Q02A 2BM1A 4X54A 3X1MA 1CUFA 1KFCB 3OTGA 2XX3A 4K7JA 4ZI7A 4KV9A 1KARA 3HFGA 2C8VA 2ILVA 1JHUA 1MFPA 1VYVA 1QIDA 3KKEA 4P0PB 1ZUWA 3DC7A 5BVHA 2PKEA 4CKEB 2EZTA 1Z16A 3O7MA 2ZYSA 5IKOA 3AJ8A 3B6JA 4B3HA 4U7DA 4UZSA 4PAGA 3PWZA 9LDTA 2AV6A 2BFBA 2LGJA 2B8JA 1B14A 4PCLA 3TAUA 2JG3A 4ZIRA 2CDBA 4G6ZA 3DF7A 2IYVA 1N3BA 2RDMA 3BFVA 4ZHSA 5FOVA 1JVBA 4FPXA 1Y4UA 1RBQA 2IYPA 1OFTA 2WE8A 1KFBB 5D5QA 2P6RA 5L7YA 1Q1QA 4X1YB 3TFWA 3M81A 1E64A 4CDGA 1C1XA 1RZRD 3TW8A 4Z49A 4A5SA 2VPTA 1SA0B 3IUYA 4ARZB 2V98A 3OZSA 5AT1A 1XTTA 1Y8CA 5FWAA 3F4BA 1RFLA 2I8LA 3UATA 3JU3A 4OHKA 5K6AA 2H2FA 4UHCA 4OG2A 2JGMA 1E5QA 4WX2B 3V3KA 3NO4A 4BVBA 2J0UB 2QG9A 1J4AA 1XA3A 2CXNA 4DJAA 3VYUB 5AVUA 2ZW9A 3BGSA 4NMMA 2WTUA 1R9NA 3H6KA 3HXQA 1QTNA 4ZU3A 1G4UR 2F9FA 1O95C 4M1KA 3H1AA 4F4FA 1NKVA 2E1PA 3A9TA 1IEWA 2GUGA 5AJHA 3ZHRA 3VM6A 1PR5A 4LOHA 3PNKA 5ER9A 5HR5A 3DLAA 3THWA 4G25A 2QMQA 1M2NA 4E4RA 1BH6A 4FYWA 3EWSA 2P40A 5ADVA 1G3UA 3WGYA 5DI9A 4DA6A 3LIPA 2NV0A 5IDYA 2IEAA 3K0HA 4LRXA 3WMEA 3GHYA 3IE2A 3PQ3A 1MJHA 1S7CA 5JNWA 3EIEA 3R0QA 1PLLA 2IXGA 4PZLA 1AQLA 4YACA 1JVNA 1UQRA 1E7WA 3Q7IA 4CE6A 3F7MA 4DMFA 5ERYA 3HCOA 2WJPA 3K5IA 5SYMA 2H11A 2YYZA 2ZRQA 3KYCB 4V3CA 4WUTA 1CZHA 2APJA 3V2UA 4AMBA 1XMPA 5BOSB 1X86B 4WBSA 1ZBDA 4QFMA 1AKUA 1KAOA 5J58A 1OFIA 4BU1A 2JLWA 2XDWA 1CJMA 4ZOEA 1JPUA 4UHHA 3W3AD 5K2MA 4LHEA 1T6ZA 1V4BA 5C31A 4LK3A 1Z8NA 2AC7A 2WJAA 1BHSA 1JBEA 1XZDA 5K8JB 1JKIA 3NTQA 4MHTA 3QKIA 4BZWA 3HN6A 3WGMA 2OD7A 4X92A 3FFAA 5BRJA 4O5AA 3C85A 3HUFA 3WQBA 1OOEA 2WHYA 4CHTA 1SXHA 4WE3A 2BFFB 2XITA 2ZK7A 4UU7A 2FRXA 5ELMA 3NBFA 3WWEA 4EGAA 3KLBA 1WU7A 1DRWA 1MBZA 4HMQA 1DX6A 4B4UA 3GUUA 4YMGA 3QBEA 2EP7A 4H7FA 4NCKA 4UULA 1PHRA 1AO3A 2MSWA 5FFFA 4XYLA 1XTPA 4EHHA 4K3VA 1O94D 4EYKA 1E3LA 3RC1A 1ZHFA 2VSXA 3OIDA 4LGYA 3F9RA 3HKDB 1KH3A 5FYQA 1XTUA 5KJEA 4UTVA 4EM6A 1JKJB 3EE6A 3IE0A 4ZOQI 5IT9A 1PAUA 1E1CA 2CLCX 1BIFA 1VPLA 4BB9A 4D41A 1E6EA 5L9AA 1OXSC 1OMOA 1R15A 2EW8A 4PVCA 2C8JA 2FZKA 1NQAO 2XTAA 3MT0A 5FX2A 1P29A 2HA0A 3P2KA 1A77A 2HLNA 4YRGA 5JHHB 4RHFA 5CVDA 5AD1A 1AKVA 4UM9B 1IY0A 2VK8A 3TLMA 4RDIA 3ZE8A 4D3DA 3RVPA 4B44A 5IVKA 3BICA 2PKQP 2PV7A 2Y0CA 4RUKA 4DQUA 3VSAA 3VR6A 4BN4A 2O3UA 4K2AA 1JFVA 1MEJA 1N9GA 1O9BA 3AHGA 4NDNE 3ZK7A 4DV7B 3L06A 2EZUA 1BKSB 2NZWA 4G0QA 4JR1A 1XAHA 1RI4A 5LPNA 3LYHA 2KX7A 2ID4A 2A9QA 3INYA 1QH8A 4P7BA 1ITZA 4XSGA 5WRFA 3ZYCA 4ILEA 1JAYA 1FRQA 1GN8A 3DKVA 3H11A 4UUBA 3TMKA 1HWYA 3IVRA 1ACLA 1GL7A 1SQ6A 3AU8A 1KYTA 1CUVA 2GD6A 4FEAA 2Y1EA 3NBUA 1X7YA 3A1DA 1M2OB 1G60A 1X8LA 2RHJA 4XVHA 2AMYA 5FV7A 1A8UA 1M0EA 3MQFA 1S9HA 2XCQA 2Z56A 1ZBQA 4BVKA 2J85A 2OEPA 2BKLA 4FN5A 4ALIA 4KQ1A 1BWPA 1XYGA 1PNVA 3VU0A 2VP0A 3PT9A 3GFQA 3BOSA 4WERA 1FZTA 4KODA 2YWXA 1V5FA 4JYPA 3ZWKA 1PYOA 3EAGA 4CQLA 4Z4CA 3RDPA 4X7PA 3RARA 3SF8A 5F5XA 1EVYA 1MU0A 1BWQA 1GHTA 1M1YA 4L2IA 4I3HA 1KEKA 1ZUNA 3PCRB 1O8CA 3G2LA 4ZHQA 2R25B 4Q4AA 2GCNA 1GUAA 2YFYA 3OFJA 2Y0EA 3E4DA 2FR8C 5DHPA 3DHWC 3K96A 4ICIA 1PT5A 2ZUVA 2AN3A 1C50A 1SOWA 4MKHA 1DXQA 4R8LA 4BNYA 4HMOA 4EKEA 3NKFA 5J2UB 2M6LA 1V1MA 1MTOA 2FQ1A 4D02A 3KKMA 5F5NA 1JFTA 2F7SA 4TGLA 5LZ7A 2I5PO 2WAMA 2V45A 3GRZA 4HDOB 4CKYA 3SWWA 3GJ0A 1U0GA 1AS3A 1AB5A 1WV0A 4HYYA 3X2FA 3AFOA 3AP1A 2VCEA 3CVJA 3U6BA 1DQSA 2BEVB 1UKVY 3VOSA 4A73A 3IULA 4HSGA 3KAQA 1PZGA 1MQSA 4KO3S 4MINA 5GWXA 1OI4A 1U9YA 2EBWA 2FE1A 4ONEA 4IH1A 4S24A 1QH0A 2EYUA 3FJOA 3GJ3A 1QPBA 4KLNA 4XE5A 3IJRA 3DXFA 2XMBA 4G5YA 1PX2A 1KDYA 4I3GA 5B5SA 5AKEA 3ZCQA 2J9GA 2C84A 1YOBA 3DPUA 3U4QB 2WMOB 2C7PA 2DHDA 4TYYA 4PSCA 4OSOA 4O6VA 1U3FA 4ND2A 3ZIAA 1ULTA 5EI5A 4OUDA 5SY9A 3NWJA 1ADYA 5DM70 1BW9A 4GC9A 3H99A 2E9SA 3FYDA 3P9KA 2QRUA 4Z8YA 2Q7XA 3ZZUA 1GNRA 1RJ9B 2NAFA 4MW1A 2PG3A 2WJJA 4EVRA 4DUYB 4ENTA 4QRIA 4V2UA 4I6GA 5G1PA 2H6EA 1ZJ6A 4G1EB 4E6EA 5EWMB 1Y33E 1ENYA 1W9MA 4PLTA 1VSQA 3KKKA 4UBKA 1TX4B 2QVGA 4LDJA 4I1UA 5KEIA 1RDFA 1XLUA 4QHYA 4IDDA 4B8YA 1RQXA 3UB2A 1LLFA 1F51E 2LR0A 3KRTA 1AHNA 1UBCA 2GTIA 4HS4A 1WZIA 2IWRA 5DN6D 2OM2A 4JBYA 1SCBA 3FROA 4HH0A 3TSAA 5IZ4A 1TTHA 4R8KA 5BNZA 1FJGB 1F48A 1M73E 4NY1A 4HAUA 1EJBA 4H1UA 13PKA 4RYLA 3A1CA 5LMNB 5BWOA 1E4OA 4MMZB 2RH5A 4HDCA 1EXNA 1R0BA 3TRFA 4XQCA 4KUHA 4TQUS 2QTHA 3F6CA 5DULA 4OGLA 1O5IA 1NVUQ 4R1NA 3IA7A 3IHLA 4U9IS 1BDMA 2E18A 4HWTA 4BNVA 1NYRA 4HGPA 4RZXA 3BTVA 5C8DA 3N7UA 1ZISA 1E1MA 1Y63A 3FPCA 3IH5A 3JYOA 3MBOA 3O93A 4KPGA 2W2XA 5KSPA 1RXWA 1C3XA 2FFRA 1EVQA 5DMXA 4POAA 1R4NB 2GLXA 2GSWA 4KGVA 5T6BA 3B9QA 4Q7KA 2NZUG 2XF8A 4WZAB 2C77A 2HX1A 1R0KA 2E3JA 5CGQB 5FUXA 2YASA 1YC5A 4BTEA 1U2SA 3R0XA 1E1LA 1E4YA 4OHMA 1JHRA 4ZIRB 4PLFA 4YJ2F 3D7MA 4BV2A 5CJPA 1E69A 1RQ2A 4M1ZA 4KACA 3QJ5A 2J4FA 2RBGA 4UREA 3OH8A 2FVXA 3VSDA 3PLNA 4ND8A 4K6CA 1RP1A 4X1IB 1QX3A 3C7KA 2X8BA 4A2WA 4UATA 1GCIA 1TFUA 3PQ5A 3QHQA 3WGVA 4PNEA 5J23A 2B3DA 4IW3B 5IVHA 2DBYA 1KVTA 4MQ6A 1OC4A 2ZWPA 1RVV1 1NBMD 3ZDEA 5GONB 4OQXA 1WPGA 3ZU6A 4OX9Y 1SQGA 2OCBA 1LDEA 3A6EA 3TW4A 2VOEA 3ANSA 3N2GA 3UCEA 4A0FA 2HO4A 1OILA 3BS4A 2IOYA 1QGAA 2X6TA 5IEBA 1BC5A 4DHWA 4E94A 3W90A 2E4YA 3EQ9A 3T61A 4OHCA 5DRTA 2W8BA 4JL5A 4RKYA 2VH2A 1QE3A 3VGJA 3R9XB 1QBKC 1DPGA 5C8VA 1PGPA 1L4UA 1W44A 3CU5A 4EHFA 1BAPA 5IW8A 3N6VA 2XPCA 2NUPB 2WD7B 3HM2A 1MT0A 1U4NA 1WY7A 1NJSA 3VR0A 3PZRA 2YUTA 1EWVA 1Y4AE 2BLLA 3U39A 4NU8X 1VHDA 1IPEA 2XZLA 4XEUA 5DHSA 3T3GA 3UGKA 1M2HA 3INNA 3TBHA 4OI1A 1T6NA 4RGQA 4Q4HB 5DBFA 4GLBA 4HWKA 4ECAA 1WUKS 2VWPA 3L7NA 1FE8A 4WBNB 3KEFA 3HP4A 3JQFA 1GG9A 1YB2A 2XQVA 5KYUB 1E9DA 4DCJA 4QU5A 1RPAA 4ZYZA 1J2RA 3CONA 3OQIA 1I13A 2G88A 3L7JA 4PGHA 1MV8A 3W7BA 3AP3A 4BFSA 2C83A 4LBVA 4WJLA 2V7EA 3A9SA 4RV9A 1IN1A 1FYXA 4KQFA 1F7VA 2WWFA 5GIOE 2J8ZA 4MI1A 2GCOB 4JEHA 2WM8A 4RF5A 3MTDA 3DKPA 3H5LA 1S1CA 4GR4A 3RS9A 3PI6A 5IKEA 5EIBD 3T1NA 5E0OA 1EUDA 3GZJA 1GPLA 2ZYIA 1A97A 2JFUA 4OD0A 1OTHA 4NYJR 1IXYA 3LCRA 4UTRA 4R71A 3U48A 2DLCX 5D01A 1VJTA 2A9PA 1KTIA 4EA8A 1NPTO 2AHOA 2NQ2C 4PZAA 1G4HA 2DE0X 2O19A 3CEJA 2J33A 3G1UA 5F3WB 4LDAA 2CLDX 3P52A 4A8JC 1Y5NA 5HM6A 1J39A 2HK8A 2K7ZA 4OMFG 5A2QA 5KWSA 2BW0A 3R4CA 1KZ4A 3C43A 1UF9A 5AHOA 2IELA 3D5TA 4MUBA 1KBOA 4NWIA 1M5RA 2QE6A 1Q1AA 1XEWY 1L3CA 1GPMA 1VI2A 1DCFA 2AF4C 3HJTA 3PC2A 4HDRB 1X38A 4U2GA 3ZQ6A 4ENVA 1IBMB 3FR7A 9LDBA 2P9EA 4EGSA 2CHUA 1HLPA 1T9CA 2V9ZA 4Z7JA 5KX5A 3GLFE 1J0BA 1PJAA 1JW9B 2VPYA 3AY6A 2RI1A 3DAFA 2FSVA 3IAFA 4G65A 3PNVA 3O9MA 2ZUCA 1I4WA 3GARA 4ZZ2A 2C58A 4QICA 3TRHA 2ZU6A 4YUAA 2V3VA 3QWAA 3RF7A 4ASUD 4DL9A 3FLAA 4AYXA 2E4WA 3WBJA 2IH4A 3DHNA 4HV4A 1JAHA 3T54A 1CQPA 3PEVA 2Y67A 2VDWA 1W36D 4MQ5A 2ZEJA 5ERGB 1WXFA 4F86A 5A6VA 4PZZA 4R9NA 2WG1A 1R3DA 3VPCA 2D74A 4AY4A 4XAQA 3KB6A 4D6XA 1XJCA 1YU6A 1MZVA 1JYEA 3O1IC 2BMWA 1O6FA 5D3MA 3QX3A 1X80A 2IBSA 3PPYA 3LYAA 3GZTB 2FWIA 2X76A 4OXKA 5BRNA 5FH9A 2OESA 1FUIA 5U9CA 5EJ7A 4WH0A 1M34E 4YAJA 3AESB 4D0GA 1KETA 1RRFA 4E03A 2AFHB 1ISFA 1SRRA 4PYIA 3W9YA 5FA5A 3R7AA 3WGLA 1M2OA 3C1UA 1KGSA 1K6MA 4R8RA 3ZLTA 1P2UA 2JARA 2A92A 5CA1B 4QRDA 1RC8A 1OLSA 3FMGA 5EJFA 1E0JA 1NUSA 1QIEA 2UZIR 1TIKA 2O3QA 5JZOA 2WJGA 2YHIA 1Q74A 2N3ZA 2Q28A 3L0CA 4N7RA 1CUJA 5BT9A 1K9VF 3RYCB 3ADDA 4P81A 2NT4A 3LBNA 3R0JA 3U81A 5KHLB 1NI4B 121PA 4MAAA 1YL7A 3AKYA 4JKYA 2P8SA 3ETGA 4PNPA 3AVUA 4GQAA 3I01M 3C3CA 3UUGA 3QVGB 1BS2A 3OPQA 4EPWA 1OSNA 3BA6A 4LJ6A 4KMRA 5LKAA 5CIQA 1GTRA 5EXEA 4TTPA 2NWQA 3ZHQA 1B8PA 2ZRKA 4Q4DA 1YMUA 4WDRA 2NVWA 3L0SA 1TRHA 1V5EA 3WHIA 4BNLA 1X7DA 1UAGA 1HDRA 1I4OA 3DEJA 4HEJA 4ME6A 2ZSDA 1UJBA 1ZIDA 4IIBA 1JDZA 1TVKA 1GRNA 4DC1A 4WJKB 4YREA 4MQ4A 3JAWB 1YDMA 1P2TA 1KYQA 4EPRA 3OHPA 4HTFB 4XASA 3WGTA 6YASA 1QC5B 2RARA 1TB4A 2WIBA 5L7TA 1KMHA 1FZQA 4D6YA 3BXFA 1GGMA 2HIMA 4JK3A 3Q9SA 4MPTA 3HKEA 1UZNA 4OO3A 3L92A 1ZVMA 5DCUA 4AQYB 2QX4A 1T8PA 2NP7A 3IDQA 4K6FA 3WKEA 4EUNA 3R23A 4TS1A 3F98A 5K4GA 1QDLB 3OCYA 4NH4A 3H5VA 5DXAA 2Z98A 3GQBA 3W8FA 3WAKA 3ZKWB 5GINE 1F1JA 1NVVR 4J0DA 2ZJ2A 2VHZA 5IYZF 1G2QA 3KFLA 3NIDB 2PKXA 3MMXA 2WR8A 5HA5A 5H8WA 2IL1A 5DGDA 1XL1A 2VDQB 3B60A 1K0UA 1U81A 5F12A 1JXOA 1BKDR 4DMHA 1L4EA 1J0DA 1DEXA 1H1LB 3COWA 3JATB 1L6IA 4HK4A 4S0XA 2ZUDA 2EKLA 3MWDA 3PIIA 1H3NA 1DFHA 1RLUA 1UMCA 4KPFC 5D5PA 2C2XA 2XHZA 4FBLA 3S5UA 3OPVA 5PGMA 1KMMA 2X5JO 3CRW1 3WK6A 1Y9DA 3H9QA 4WKGA 4XWAA 4J2OA 5DTJA 1EBBA 4GZ5A 2GTPA 2V6GA 3A26A 3ZWAA 3IUPA 4AY6A 3IC5A 1MXHA 5AWFC 1D2EA 4ER5A 4RBNA 1LDGA 1KBZA 2FSFA 4K05A 3UC5A 1O08A 3EEFA 2R9VA 2OSBA 3Q5GA 4FDAA 3RPEA 2GJ4A 2LDXA 1OROA 2R6JA 1IN6A 4QUGA 3F9IA 4OEHA 4QGAA 2R4QA 4ESVA 1T2CA 1P4RA 3FF1A 4HS9A 3G6KA 5FLKA 4CM7A 2VQDA 3NVKI 3WMXA 1WUTA 5K0EA 2HBZA 1OH5A 1RYFA 4E70A 3PFIA 4KWIA 4CM8B 4PWYA 2X0EA 3OKAA 1UIMA 4B5LA 1SU7A 2NNLD 3D3NA 1Z29A 3LA8A 1NF2A 1O6CA 4EOGA 2XUIA 5AM4A 5LC1A 4AP5A 5F4BA 3FOFC 2ZSAA 1N5RA 3CJRA 5DHAA 3S27A 3I45A 1KHHA 5EVJA 1H5NA 1U0HC 3WYAA 4DIOA 4WZAA 1XALA 3A4YA 1JHQA 4NF2A 1HQDA 1LPSA 2ZFUA 3RVKA 2HF9A 4R1QA 3SEQA 4L85A 4UTPA 5G02A 2VUUA 3C6ZA 1AVTA 1PT9A 1K8QA 1ZJJA 4M8KA 5D00A 4QE3A 4E4TA 3TS1A 3A8TA 1QQ7A 1LK0A 3E84A 4ERXA 5FOUA 2EC5A 4MTCA 1Q0PA 2AYXA 5GGXA 4KLZA 5AHRA 4YUXA 3FRJA 1I9GA 2PGJA 2QX7A 4YRPA 4YMLA 1SUSA 1ZWLA 3CKYA 3MCWA 3GYBA 2HPHA 1Y8QB 1ZN8A 2FPIA 3F1LA 4J03A 5IFKA 5IG2A 1G5TA 3TLJA 5KNDH 1E99A 3OJFA 3NG1A 4FYHA 2RHCA 5E9AA 2REQA 5HIIA 1K6EA 2GPTA 5L3RA 4EUEA 2IPOA 2XYHA 3MFQA 4BIIA 2XEDA 3WWCA 2W2KB 3AGPA 1YS9A 3G2PA 4U7FA 4ZCMA 4HB0A 3OF3A 2VEOA 1GITA 1DCTA 1O96A 1B74A 3L7AA 4MICA 4TUYF 1W85B 1H05A 3QEMA 3IQZA 3QI7A 3DL2A 4F5EA 1A2QA 4Q34A 4B7ZA 2JGKA 2QD1A 2BSQA 5D7BA 2NXEA 2JJ1D 1ZMRA 5JY6A 3FKSD 4F2HA 5ECGC 1TZCA 2XGMA 4BNJA 5KJ6A 5HFNA 3C3DA 3Q88A 5HF8A 1R0SA 4OU4A 3ME5A 2X4GA 3THSA 3VKHA 2Z5FA 1KU6A 1FSSA 1WHTB 2DYKA 3MK31 5CH8A 5A4AA 3J80A 1G5IA 4OHYA 1W88B 1UBSB 1Z3CA 3H8VA 4JMLA 4ZZ0A 1ZD2P 1X7WA 4GPBA 1KS2A 1E2BA 5LNK6 2ZBQA 4AZWA 3AEQA 3R1IA 2JGRA 2NZJA 2J30A 1ZI9A 2WYIA 5E7JA 4EG6A 2J3LA 3W5CA 4XKJA 4DXAA 2ZBGA 4AYWA 1C0LA 4RD3A 5LQAA 2GB4A 3QTBA 2BE7A 3IVXA 4GXQA 4W9NC 4YRAA 4GSLA 4DY4A 1O94C 4IP0A 1LBSA 2ZSIA 1J8FA 2WU0A 3GRFA 1D03A 4E33A 1ZS9A 2OCXA 2KS6A 2YQ5A 2IX3A 5LDGA 2WA1A 4OXXA 4FJ2A 4BKMA 4GUDA 3SBXA 3R74A 2GFIA 4UJ5A 1UJCA 3NPAA 1P45A 3VUEA 4COOA 2XCSB 3K9LA 5DNWA 1Z39A 4N1AA 1V16B 7REQB 2H31A 2ZB8A 1UM9A 3NTOA 2J9RA 3L7CA 1UXHA 1TPZA 1Q21A 3AEZA 1W1IA 3BILA 3IKVA 3BF7A 3H18A 4G8CA 3PPWA 4I46A 1QF6A 1YQXA 1N2ZA 1YE5A 5TJHA 2A6PA 5TQVA 4GRIA 1NP3A 3OEED 1PYGA 1P77A 1FRFS 3MSCA 4W63A 1B00A 1DQRA 2W4IA 3RIEA 4KRYA 1ULZA 3MRTA 1TEXA 4HNUA 3BIXA 4HR7A 2QP3A 1OQAA 1YIAA 3D1JA 3G8CA 3Q7SA 2ISQA 3QOYA 4XD2A 4HZUA 2BKEA 2P6MA 2R6FA 2FNAA 3N2IA 1GGFA 4AUNA 4P83A 4EI8A 2H51A 3OLZA 4MWOA 2GBLA 3VNQA 3ZHUA 5GM1A 2O8FB 1SVMA 2IEGA 4RMHA 5K45A 5JJCA 5T64A 1WE2A 3Q7EA 5HTOA 1GU7A 2F3RA 4DYHA 1D1TA 2XNDD 3C6BA 4E7PA 5LLSA 5FBHA 2V0NA 5BNIA 3V1UA 1U9ZA 1ZOLA 4AN0A 1GRQA 4PO8A 4DDHA 1WB4A 2AZDA 2QGNA 4M36A 2P75A 1U5AA 2IPXA 2XWPA 3NT4A 4Z4GA 4ZKEA 2B34A 2HKIA 2QU7A 2RB4A 3P4UA 4NNJA 1W0KA 5G1NA 2V4UA 1GSAA 3GA0A 4F4HA 4GM1A 2B83A 2PRKA 4FQ8A 3LE8A 1OWPA 4MP6A 1YDEA 3ABIA 5IVPA 3PBKA 1XZFA 2AZTA 3FPLA 3HI6A 4P0QB 3EPLA 4G2NA 1YACA 4XWWA 3L5OA 4LJ4A 2FY8A 2XOKD 5F98A 4WXEA 1M1NA 1UMDA 4QLBA 3P0IA 4H60A 2ZANA 3EK2A 4I3FA 4ARZA 1IYZA 2PXAA 2PLAA 3UA3A 1P8AA 1EGMB 5I7RA 2K6GA 4ON9A 1WB6A 1MEOA 3GFVA 4NCNA 4ID9A 4MV0A 5HX7A 4ATNA 4IFIA 3QUQA 1XDGA 2D2FA 1DAGA 3JQQA 4WOPA 1GQFA 1QPZA 1NVFA 3QV1A 4X3OA 4KUEA 3CF0A 4FE4A 4TKVB 4WL0A 2BGKA 3L2OB 4WVLA 2NP6A 2ZI4A 2HWWA 5FOWA 5BN5A 1WZCA 4TLEA 2K87A 3CPJB 4NQRA 2R5WA 4GI5A 5TIIA 1OV4A 1YJ5A 2R4UA 2UYGA 3E9MA 1C1DB 1WMBA 1JQKA 1WXXA 3RYTC 4ZVKA 4BFWA 5ISMA 3DDHA 1NZDA 2BMEA 3D8SA 5KNBA 1LJUA 1W5AA 1ILWA 1Y3HA 3GEPA 3BRQA 1Z8FA 3I1YA 4NG4A 4O2LA 1DAEA 5DM1A 4JQZA 3STUA 4JDPA 2C03A 2R7AA 1L5WA 1Q11A 1U94A 5TQ2A 3DUFB 1V25A 4PF1A 4F2WA 4MR8A 4FEGA 2BGIA 2WHQA 4GYYA 4QVGA 3TZQA 1JXAA 3M1LA 2ZBDA 4N4AA 3WC4A 2XDQB 1D2RA 2BFNA 2RJOA 3LXRA 3LWDA 3TBFA 2ZBVA 4AZ0A 1P0PA 3RS2A 1ZOPA 1Z0DA 3KPJA 5BQXA 3DYVA 1V7QA 2Q21A 4N01A 1JGTA 2WUGA 4MRNA 2A9KA 4BEVA 5IXSA 1HTBA 1XF9A 3ZU2A 5HJ7A 1HH4A 3KJFA 3SQXA 1H0KA 2J67A 2Q9UA 4LV6A 4F7WA 5EFZA 4F71A 4MH0R 4IX1A 4K9QA 3HYTA 4FKBA 2XSZD 1L4BA 1AN9A 2JFBA 3IMKA 4RVUA 2XVXA 2JGDB 2WZCA 4KK3A 4RL6A 3K6KA 2ZJAA 1XBTA 3ZU5A 1UANA 1REQA 3NFYA 1J8DA 1C1YA 2VSOA 3JATA 1AHPA 4J3FA 3H0KA 3O4VA 1EFKA 2FZEA 4CDMA 1FDRA 4D98A 4IM7A 2QVBA 3BX1A 4P3PA 3LUBA 1TZ2A 1KU0A 1ZW1A 4GF5A 1HTWA 3PIRA 5A9SA 3PNMA 1FP1D 5TF4A 2W6OA 3P4YA 3W3AH 1AM4D 4CNQA 4TM7A 3H2JA 1ATIA 1M66A 3IDFA 3PENA 1E3MA 3K6JA 5C53B 4NPHA 4IUYA 4OTZA 3GLQA 4D9FA 1UFVA 1NPDA 5H81A 4XI9A 1HKHA 1Z82A 2Y93A 4CIYA 5IAOA 2AWNA 1BZYA 2B1IA 1S6YA 5HK9A 3H2SA 2P30A 2PBRA 3L18A 3NEAA 1UKCA 1SBTA 4BMOB 1CLUA 4XX0B 3WLTA 2C2KA 1P44A 3NAQA 1RYYA 5C35A 2VZ9A 1N0HA 3PYXA 1OI2A 2AOVA 1Y5LA 2CVZA 4O2AF 3CGGA 2BGRA 3EUWA 2OYRA 5BW6B 3FTNA 5C1OA 5H4GA 1RTKA 1VLHA 3S7ZA 3H2GA 3HYRA 4J0QA 4RVCA 2HMUA 1T4MA 2OZVA 3B5JA 3E1KA 5AJUA 1W76A 1P9LA 4FFRA 4QBTA 4B0OA 3Q15C 3OCJA 3N2ZB 4BEWA 2FUEA 2RAVA 3GI1A 4MSUA 2GHRA 2VWQA 2ZRAA 4HI0E 4CIXA 1SWWA 1SOAA 1ML3A 3U13A 1QLJA 1DE0A 7GPBA 1F60A 3MJEA 5IAKA 1AXGA 1QB7A 4QUDA 3LL4A 5HXAA 3T3NA 5E6RB 2X7HA 4WFKA 1DKMA 1HETA 2VF8A 2YMPA 3C24A 4IHJB 4KDFA 3G9XA 1KHTA 4RKWA 3B53X 3S81A 4CF5A 1U5CA 2CXSA 2JBWA 3KXDA 4JLUA 4IGAA 1E4EA 4XIYA 5EKUA 5AJTA 1FL9A 4AJNA 2C9OA 1NQWA 2I4LA 4AJHA 4B40A 1YQQA 3RASA 3FNBA 5IHPA 5C8ZA 4IOJA 2X4IA 4E2YA 1TVCA 3EZ2A 5FUBA 4AS3A 4FWTA 5DBGA 3V4RA 4PPGA 3LTNC 3N2LA 1D04A 2XE4A 2Q5OA 4L02A 2XGJA 4PHFA 4QM7A 2CJPA 4GX5A 4ZQIA 1D2AA 5JR3A 5M2QA 1TZMA 5JAHA 1AUQA 4DQVA 1XQ6A 2R7NA 1QYCA 3SJUA 4R1UA 1HE1C 2JGLA 3V4SA 3JY6A 1DT3A 1UEJA 2CFSA 2HHAA 2JNWA 3AUYA 1VP9A 2CL6X 5THQA 1O96B 2WPDA 2ZBEA 1CW2B 2HT6A 3HR4A 4LDPA 4QBHA 2H1SA 4JD5A 4MKGA 4PC6A 3QE9Y 3L7OA 5KTYA 2WT8A 1BN7A 2HWUA 3R40A 4MQUA 4M86A 3SXUB 2Q29A 2W00A 3V4ZA 2JI9A 1FB5A 2QW1A 2Z08A 3W5UA 4CKWB 2A9RA 2WUVA 4WAUA 3D2CA 5DNVA 2PGNA 3CLVA 5IJAA 3I2KA 2HREA 4ANFA 5C4MA 4KITB 2RC5A 5K3FA 4DDTA 3DDZX 5KTTA 1Z73A 3COSA 4WCVA 4EHBA 2Y05A 1HDYA 2GA8A 3B1ZA 2EARA 2WW8A 1QG0A 4DRYA 5JYEA 4MDFA 4Q37A 1AA6A 3TG2A 1JDTA 1V96A 2AJBA 4F92B 5FR2A 2FPRA 5EGSA 3G02A 3L77A 4KSYA 4US1R 1AIPA 1OYWA 1UXGA 4Q47A 2QRZA 3BEOA 3QYFA 3UICA 3N8IA 3E35A 2L69A 3GAMA 3A70A 3KG2A 5DHRA 1EBFA 3JQ6A 2CVFA 2KBEA 3U7QB 5KDDA 2R3SA 4EY5A 1VIDA 1KI9A 2Y6UA 3ZDYB 1UC9A 3ABZA 3P9ZA 4XUEA 1BW9B 4G5HA 3IURA 3O94A 2QA5A 4IIHA 3R5TA 1J7KA 1GL3A 5F33A 1ZCJA 4JITA 2F6RA 1YVPA 1W2GA 4YDHB 2A7QA 4TZ6A 1BVYF 1FFEA 4MS3B 2O54A 5IX8A 2Z2KA 2CL7X 2BDEA 2EP8A 3JWPA 4K9NA 5HFJA 4UNSA 5K6AC 3ZGZA 3SZUA 2VDPB 4QUKA 2WF5A 1K5HA 2ERXA 2JCBA 1IOVA 5KYYA 4J0FA 4FQ7A 3H1BA 5GONF 2WU4A 3QEBZ 3MQ2A 2DHEA 2CUKA 2DEUA 5CLJA 4DAOA 3CZCA 3LLSA 1SIBE 1ZZEA 2NO7A 5AXCA 3EYAA 4HFMA 2G40A 5FUQA 5JWOA 3GFOA 4ZVUA 2GSDA 3P2MA 1YD7A 3X2EA 1E6CA 1TK9A 2WQZA 1LNZA 3JV7A 3KJZA 3PYLA 5F21A 3SDZA 4ZOBA 5C81A 1B2LA 3SXJA 3E82A 3G2IA 4RVOA 1U2QA 4KYTA 2E4ZA 4ZAZA 4MJXA 4C1BA 1RAFA 1C0IA 2CKMA 1W4ZA 3LKDA 4B09A 4YV2A 5LXTB 4B3SB 2OWEA 4MR9B 5TQ0A 4UPEA 5DM0A 4GU5A 2OVFA 4XB6B 2XWJI 2V8OA 1FOEB 1YB7A 4NJEA 3KSBC 2ZB7A 5I45A 3QA3E 2WMDA 1LV8A 4Q7JB 1QZTA 4DPKA 4O2AB 4ZDWA 2ZWVA 1KF0A 3JAKB 5CVEA 1PS0A 3OQJA 2GETA 3QEJA 4URXR 2JANA 1GQQA 3NGMA 3GT4A 4LVCA 5TT0A 1JA0A 4YAFA 3EBLA 3GA5A 5I51A 4EVQA 3AI3A 1NBME 5C34B 1T0IA 3DPSA 3BHJA 4P93A 4CCAA 4EFKA 1HDZA 5F9HA 2OXRA 1CEYA 5ICMA 1JECA 1X0VA 1QAOA 2XGSA 3DBHA 4IDHA 1VPDA 5FUWA 1J99A 2C9DA 2DERA 1NU6A 1O4WA 3OCVA 3QF7A 3QMPA 2QY6A 3DVLA 1XDUA 2XT6A 1CDZA 1JKJA 3DEFA 5I9SA 3BH6A 2WHXA 4IMJB 4L0QA 2ZI5A 4LF7B 2DWOA 4DARA 3QLUC 4DQ0A 1KEEB 3HVRA 1EXMA 2PS0A 3UHFA 4BJ5A 1C30A 4Q12A 4CFZA 3HSKA 3BVPA 3SQWA 2VDNB 3G3EA 1ODFA 2GZ2A 5DN9A 1CUDA 3LW7A 3OZBA 1OZAA 4B3TB 3VC1A 5GV8A 3ESDA 1I0ZA 2VUIB 4W7IA 3W6OA 1U2GC 1JEOA 1SR8A 3IOCA 4UU1A 1GSIA 4AZSA 4BQOA 3FZEA 1VPVA 1BNCA 1T2DA 3CVWA 5LQKA 1P1KA 1BTOA 1Z5NA 3DHYA 3DVAB 4JI5B 221PA 4JOBA 5ARDA 2IYQA 3CPSA 2YJ5A 2C2OA 2XXJA 3MOSA 3O21A 1QKJA 1VIVA 3A9CA 2YJTD 4Q4AB 5TB5A 4EW2A 2NZVG 3RUPA 5CLLA 1G5HA 2PH1A 2H65A 2JCYA 4JH0A 1U4SA 4EIWA 1W29A 3D0RA 4PSKA 4V1CB 5JBIA 1Q92A 2HGSA 4OXRA 2QTVA 2FKNA 4K6HA 1C9NA 4FKZA 4IKEA 2V3CC 2R1VA 1QTIA 1FFBA 1W0CA 4RKRA 5G0WA 1O5OA 5H3LA 4AZ0B 5IM4A 3QPCA 3T94A 2IHKA 3H8WA 1CP2A 1MKYA 1Q83A 3GCDA 2BISA 2IEIA 3MILA 3QNWA 4RXTA 4Z9FA 3OQIB 1VHTA 1YO6A 2MYUA 3FMVA 1R50A 2D6FA 1KWKA 5CVVA 1P62B 4PNZA 5AW5A 1SOUA 1G6Q1 5DGIA 1HZJA 4F56A 3ETDA 4YRMA 4MQLA 4MVJP 4FUQA 2XADA 1RR6A 1GR1A 5HZMA 3ZJVA 1CCWA 1LWNA 2HPVA 3NVDA 1OXBB 3OUTA 1QORA 3G0DA 5E9JA 2ODTX 2PMBA 4UUAA 1QRSA 1EK5A 2X4LA 4KBFA 5BSTA 5DCYA 4LPSA 4FUTA 1RQNA 4MMXB 1A9QA 2CYAA 3BJIC 4YHBA 4DNXA 2HRZA 1JDVA 2JVJA 2PRJA 2VSNA 3PGXA 5LKRA 5IT0A 3VQTA 2XAUA 1QSGA 2P2ZA 3ELUA 3MWKA 4MYTA 4RCZA 2C7VA 3FCXA 3NBAA 4HWOA 3PPVA 1UDAA 4YALA 1J0AA 2ZTVA 1R0LA 3WK8A 4P1ZA 2Y8EA 3FLMA 2EVWX 2ZI3A 3PRYA 3IT2A 5YASA 1K88A 4TN5A 5EYPA 5KJCA 4YIHA 3AT1A 3IPAA 4CIDA 5LQNA 1XTSA 1N5DA 5EQDA 3ANMA 3U3ZA 1S01A 1F06A 5HZKA 1JR3A 3AC0A 3LY5A 4LSGA 2WA2A 1G9XA 5INTA 3MBKA 4I5FA 2EFDB 4B3IA 3M4YA 3UAVA 1CHNA 4OB6A 2A33A 2Z8ZA 4XX0A 4DFDA 4YRKA 5FWNA 1LEHA 4UW9A 3TMYA 4CM5A 5IU6A 5JSQA 4C4RA 3I2HA 3TPCA 2PYDA 4N76A 2XKJE 1NN5A 4TS4A 4TMWA 1N3LA 4KE6A 3JPYA 2E87A 4TTRA 4KXXA 4KVFA 3MRSA 3JVDA 3UG7A 4HATA 1ZGZA 3O91A 3KEGA 1H0HA 4TWRA 1GPH1 1HA3A 1VJCA 2V7PA 4J43A 2ZJFA 1N7IA 3ANLA 4AX8A 1BA3A 1CSEE 3TTWA 1G38A 3IPYA 4BX3A 2HRBA 4P7FA 4RCVA 5HDQA 5HIMA 2WNIA 4GOOD 4DVGA 2E2WA 3IODA 5FBWB 5IBRA 1L3IA 4PANA 3SYLA 2KHZA 2XVAA 3U3JA 2QVXX 3QHAA 1DIRA 4TLMB 5EL0A 3IUBA 4E2ZA 1IK6A 4LCEA 4GSYA 5KSOA 2ZIXB 2GPJA 4AJOA 2WJWA 2UYQA 3JRNA 3W4IA 4II7A 5DXJA 3FCAA 1M8GA 1R4MA 3W2GA 4UUPA 1XR3A 2BGGA 2GUWA 3GVHA 1TA4A 4W4TA 4LZAA 2PLWA 1PJTA 3D54D 3DYBA 1T3SA 1K2VN 3AR7A 3EXIB 1OFUA 1JTFA 4ZYXA 4C7OA 1K75A 3HKBA 5B30A 4KMMA 3T3MB 3PWTA 4EFLA 4FLFA 2YN4A 2FETA 1VFPA 1IQ0A 2ZDQA 3AONB 2BSAA 3RYIA 1FC0A 1BSVA 2CD9A 2PKCA 2IUTA 2YZNA 1LLUA 4G5RA 1ZJ4A 3QGMA 1E89A 2QQFA 4UEOA 1P9NA 2DMRA 3SXUA 2PWAA 1E2LA 3LQ4A 3VTKA 4AX4A 4XUDA 2XVYA 2PAAA 3ND5A 1F6WA 2JFNA 1FA9A 4FW8A 4KNYA 1F2VA 2D1TA 2H2GA 1VDZA 5L3ZA 4L5BA 4RYDA 1E8DA 2PS3A 2LD4A 3SX2A 3AM4A 3Q3VA 3Q7QA 4CEIB 3WNDA 2CXXA 1YNSA 2LIPA 2PRZA 1UBOS 5KSYA 5FO0A 3BRWD 4WADA 5BPHA 4A27A 1ISPA 4ZGGA 2NO6A 4IMIB 4MDYA 3IERA 4WACA 1UP4A 1Z4LA 5AI5A 4B85A 2UU9B 1E2IA 3O75A 5HMMA 2JIZA 3L8DA 3NHSA 3GLUA 4G0ZA 5CBPB 3K05A 1Z6GA 4YVFA 2XCTB 3F8WA 4X6UA 3CPHA 1KSJA 3AIOA 4UUOA 2EWMA 3N7AA 2ECQA 1I3KA 2YBDA 4R9RA 3A32A 5FJJA 1PWEA 1NW3A 1YT5A 2OCAA 2FF5A 3S2EA 5KX5F 1WMEA 3ZX4A 1P7YA 2MSNA 3L8GA 5DIZA 2X0KA 5ALWA 3UMCA 3ZS8A 4I55B 4QO7A 3DE4X 1D8TA 3AKEA 3IEIA 2EATA 1DCMA 4G67A 4X45A 5AQEA 2O7RA 2WZDA 5KINB 3SR0A 1Y3DE 2NTYC 2ESRA 2HSZA 3D5EA 4Q3EA 1NMSA 3JQAB 3RFVA 4F9TA 2JH9A 3WMFA 5JJIA 3FFXA 3MBIA 3WKBA 2UYHA 4ZCIA 2IPMA 4BN5A 4E08A 2E4XA 3TLYA 4FSXA 4BWYA 1N0WA 2HJ9A 2QR2A 1PNTA 1RE1A 4YK7A 1HSZA 3HC7A 2WM2A 5CURA 1W52X 2FMKA 5KHAA 3WHPA 1X39A 2I1WA 4KWTA 1E9EA 2PAFA 1H3EA 1AS0A 1Z4NA 2HF2A 4L07A 3KV1A 3F97A 1IZ9A 4QQFA 4UHEA 4NRDA 3UOWA 2PX6A 4CIWA 3L04A 2XNCA 3VJLA 2UVPA 3HK2A 2JFPA 9ABPA 3WV4A 1JDBC 1Q2UA 1Y8ZA 2QMOA 1OH6A 3QLTA 3SC2B 4QVIA 2CHGA 4NESA 5LOVF 1AK1A 4TXLA 1BD3A 3KWFA 3OZIA 4EYSA 3I9FA 4F85A 1TM4E 1E96A 2O2IA 2YWHA 4RQTA 2UZ4A 5EIXA 1Q0SA 2I9KA 2RI6A 3IB6A 5GPBA 5ED0A 1XJQA 2XUZA 4W1RA 4Y9TA 3HXPA 2P3LA 1XJ5A 3FPFA 2JKZA 4CFYA 2GASA 3ON5A 4IUCS 5JH7A 1MUUA 3AJDA 1QIJA 2OO5C 3DBRA 3IKTA 4J90A 3B2NA 4IGKA 4JI3B 4H6PA 1FP2A 1TYDE 5CT4A 4ENSA 3JZAA 1FUEA 1JJ7A 3L9XA 3EF1A 1QJCA 4PZEA 1J9GA 3KU1A 2GD0A 5H70A 1K7YA 2R84A 2JW5A 5DYGA 2XWBF 1BN6A 1M2GA 4EYEA 3PC3A 1RPZA 1S8NA 4GYWA 3KYJB 4D56A 3U4GA 3UMYA 2WFZA 1PJRA 1SHLA 2C7OA 5ALKA 1CY8A 1E2EA 3E9YA 3FHCB 3QUCA 5IN4A 4HJRA 2WSYB 5KO2A 4KBGA 5IYZB 1VG8A 4QDOA 1HDXA 4JN6B 3ROEA 3H2BA 4ND6A 4DA9A 1Y6GA 3PLRA 1SVSA 5FNVA 1G21A 3DE0X 3F67A 2W98A 3T7TA 1VDMA 2II6A 2XQGA 1Y0BA 1NZJA 1YR8A 3KHTA 2FSVC 4BE9A 1NVBA 5DHTA 4I2NA 1CG6A 3BMXA 3QUSA 2XGGA 1Z7BA 1SG6A 1Q44A 1T4BA 3RBAA 2QN3A 1YZKA 4MYCA 5JIBA 5EA2A 4X8LA 2OGTA 2V7TA 4I9UA 6Q21A 3T0GA 4MWZA 4NE9A 3T7RA 1RBMA 3TSWA 3DUWA 4HOYA 4M8IA 3AKZA 1KEEA 1QFXA 5LA6F 1C30B 1Z25A 3H65A 3CX3A 1QP8A 1KOJA 1MRSA 4A6EA 4HQFA 3R5SA 4QD3A 3ND8A 2J0UA 2P3SA 3DF9A 4LHVA 4IJVA 3GRVA 1YQGA 3OAAD 4BGEA 5AJXA 4LRSB 1WVGA 3AR8A 4QM6A 4ES6A 2HJHA 3V7FA 3KB8A 3KIPA 1U9IC 1EX1A 3LOPA 4GMHA 1KS9A 5MGNA 2N75A 1KXJA 4ZAVA 1TYBE 4IFBA 1OWOA 1TPYA 2YICA 3A1TA 3IE1A 1ICEA 1NRXA 5K3CA 3TD2A 4BXOB 1EP9A 1NRIA 2VNIA 4MDEA 5CMLA 3LLVA 2E5LB 3UFXB 1YCDA 2NV2B 2Q3BA 2Y4NA 1CIPA 3DTVB 3PDCA 3WIVA 3PUIA 1WW8A 4A26A 1J7JA 3IMCA 1B23P 1BMDA 1HE3A 3NB0A 2V4MA 2B5WA 5ADWA 3U7GA 5AHKA 3L07A 2ZROA 3M1YA 3AF2A 2DQYA 2EGGA 1BRTA 3O9VA 3T7AA 4EGQA 1XHEA 4R31A 2E6KA 2FPKA 2WYOA 1GTMA 2CV0A 4I2VA 2JAPA 1D6MA 4E30A 1CZUA 5L53A 1ONSA 1PGOA 1PJ2A 5FCDA 4C76A 1DOAA 4IZIA 3ILSA 4ZZIA 4MRMA 1PK8A 3OJEA 3P5BA 4QYIA 2Y1KA 2VH5R 3SC4A 5IC4A 5AOBA 1YZGA 2RHWA 3LYLA 1IRXA 3D3WB 4HZUB 5LZ5A 2DFLA 2D5AA 2J4DA 4ASUA 1AY0A 4M1TA 3AEUB 3H19A 4TKUA 1Z15A 4TTJA 3CT6A 3KVOA 2QZ4A 4H35A 4Z4IA 5B64A 1JG4A 1HQKA 2ORVA 5LYJF 2JHGA 2Z5LA 4QTUB 4FFBB 1E2QA 2EBUA 4XWGA 4I5DA 4P98A 3C3BA 4B84A 5EIEA 1T9AA 2DQKA 4OHWA 1DUVG 1YZTA 2BV3A 2GGSA 2OK8A 3NZEA 5GY7A 1LPAB 1EX9A 3ECCA 3KDPA 3O3OB 1GPKA 3QU7A 5D84A 4BZZA 4BVAA 3D3EA 4YASA 2GKSA 1JMKC 5G2OA 4E7OA 1G55A 4NOMA 1L1EA 1LLDA 1XMIA 1GNPA 3LCVB 5JYBA 4KQMA 1HFJA 4P92A 5ALNA 2IYFA 5T57A 1M1XB 3VPXA 1R6DA 3EFBA 4DLLA 3FHJA 3A9VA 3OIWA 4UEWA 1U31A 2Q3MA 2XUOA 4KTTE 5G4KA 1E7MA 2O8BB 5DLPA 1N6IA 2OHXA 3HJFA 5HZHA 4YJHB 3A2MA 3A0UA 1MAVA 5EUQB 1Q0TA 3CR7A 4DANA 5CX1B 1O3YA 3HJGA 3PQ8A 1I10A 2NVUA 2BMVA 3ZBQA 3PHJA 1S2LA 1X1QA 1VLQA 4J0JA 2KQUA 1GY8A 2VXYA 3D4NA 4PIPA 5EE0A 5A6SB 3G0CA 2FUNB 5EPUA 2C2BA 1OFUX 4HT3B 2X3YA 3SS7X 3AUJB 1CJKC 1JMVA 2C2GA 3VVLA 1USUA 1YKFA 4HX5A 5CM2Z 1NC3A 3B7WA 2Q3JA 5ECYA 3W4KA 1FFYA 4HZGA 2QBYB 3NHWA 5ULLA 1GAXA 1R37A 2EFHB 3FNGA 4LRWA 2ETVA 4XSVA 4KFTA 1QCCA 3H1PA 1G63A 1SCAA 3U17A 4UFPA 2BUAA 3J81A 5DDIP 2J09A 1JQBA 2QLJA 4LYAA 4UQLA 1XXHA 1W4LA 2O7VA 4KDEA 4Z2YA 4YCCA 5J59A 1QTQA 1ZQ1A 3OM0A 2HA6A 4Y6QA 3S2ZA 2XT0A 2IIPA 1OC2A 1DELA 3PJFA 1MF7A 2I8AA 1DXHA 4PRZA 5C7YA 3AG6A 4P3KA 1FVHA 1CX9B 3HACA 3DLHA 4AJKA 1K7CA 5BW4A 4P3NA 2IUFA 1ORRA 5I7UA 1WXGA 3GGJA 3JZDA 3DMYA 1T8WA 2DPXA 5K3BA 2P7IA 3VV2A 1ZQ9A 2HZBA 3MOIA 5I7WA 1X8JA 1JZQA 4NAUA 4HDMA 2YW2A 1CWUA 5DV9A 1HDCA 2D0DA 4LSWA 3FF4A 3PP8A 4D8UA 2Q99A 3TH5A 4DZZA 1SHTX 5AO9A 5LU8A 1KPIA 5HCNA 3A1SA 3OAAA 4A8JB 3EIXA 4C5BA 4KV7A 3K9GA 5EJIA 5LIPA 5DW3A 1TK2A 1CHDA 4L3WA 4RWEA 5JAPA 2ECOA 2FEXA 2QL7A 3QEMB 3PI7A 1U8FO 1UKAA 2VJBA 5FA8A 4Z0HO 2GA9A 1UK7A 2WINI 4DSTA 2RHLA 5CT5A 1T9ZA 3ZNPA 3U40A 5ICEA 1YA6A 4LF6B 4L9RA 2CZCA 4TTSA 1O97D 3CY6A 2JGNA 4PGFA 4BO5A 4HNVA 4MWBA 5E8RA 4O4LB 4BDSA 5SY4A 3TXXA 1B6RA 3VZSA 3EGXA 2HCFA 3PEEA 3LVRE 3QVJA 2BBTA 3QTTA 2OLKA 1P2BA 1S4QA 4U7GA 1HV8A 4DKXA 1URPA 4B46A 1N2IA 3D4LA 3UHAA 3ZWDA 5KPJA 2VP6A 4WK0B 1H4VB 3FMPB 2QD3A 2GD1O 4LJYA 1T91A 4FJ1A 5HIKA 2O7QA 2NXJA 4OFWA 1HGXA 2IV2X 3Q5EA 1KJQA 4IHJF 1FFXA 1N0VC 2C4HA 1PFKA 3LQQA 1K06A 1N4AA 3I6IA 2DC1A 2ZRLA 3LLMA 5FTJA 3TUJC 5JECA 1A98A 5EE5B 1KVUA 1QDEA 1SUBA 1TJ4A 3NYIA 3U7EB 3RTGA 1E9BA 3WYEA 3AM5A 1Z4QA 2REBA 1R18A 2JFWA 3H97A 3QH4A 3TM5A 5F2EA 1X14A 2OMEA 3D6JA 4R3NA 2EKPA 5CT6A 1UM8A 5JPCA 5C51B 1O54A 2O2SA 3DXZA 5AOAA 3UNXA 4B7XA 5CYPA 1Z7EA 3FTCA 4X20A 1ESCA 1YI8A 4RHYA 5AM2A 5LP6F 5AXDA 2YXBA 4GMGA 2AMVA 4Y30A 2QLLA 3HUEA 3S8YA 2JLBA 2WF6A 4YMTA 2IZ1A 4B7UA 1V5WA 3IP5A 3OTHA 3C3AA 3D8NA 4FT2A 3F7TA 2FN8A 2CCGA 2LKCA 3H5NA 1SUCA 3QJYA 4MRRA 3NM5A 2OGSA 4KUGA 1TM2A 2KPOA 3CLKA 1RZVA 1H2BA 1JPJA 1XD2A 4RU1A 3WLOA 4D0SA 1L7EA 1G6KA 2VBIA 3LC2O 2I3AA