1XQ9A

Structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
241
Chain Sequence
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Phosphoglycerate Mutase from Plasmodium falciparum at 2.6 Resolution
rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords phosphoglycerate mutase
total genus 75
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1xq9A00
3HJGA 5AJWA 3IT3A 4AROA 3EZNA 1UJBA 2WNIA 4ARVA 3FJYA 3D4IA 1DKOA 5CX4A 3ZHCA 2OWEA 3GP3A 1ND6A 1SK9A 1V7QA 3EOZA 1QHFA 1C7ZA 1E58A 4ODIA 1V37A 4IJ6A 4D4MA 1EBBA 4QIHA 3K4QA 5AJZA 3E9EA 5CDHA 1RPTA 1E59A 2P75A 2ENUA 3PGMA 3D8HA 3O0TA 1BIFA 3DCYA 1SKAA 3NTLA 3GP5A 1RPAA 4FDUA 2DWPA 2HHJA 1SK8A 2A6PA 1DKLA 2DWOA 3R7AA 4E3WA 3F2IA 4ARSA 2IKQA 3QPVA 1ND5A 1TIPA 2P2YA 3QPWA 5HTKA 5AJXA 1CVIA 3NFYA 4ARUA 1C80A 1SKBA 1RIIA 3E9DA 4JOBA 2EKBA 4EO9A 3FDZB 2H0QA 3E9CA 4PZ9A 2P6MA 2A9JA 1BQ3A 2RFLA 4TSRA 2P30A 2H52A 3QPUA 4EMBA 2I1VB 1DKNA 4GPZA 5CU7A 2P9YA 1BQ4A 1UJCA 1YJXA 4FDTA 2GFIA 2QNIA 3KKKA 1IHPA 2HPAA 4JOCA 4PGMA 2OWDA 5AJVB 1H2EA 3LG2A 1K6MA 3LL4A 1FBTA 2WU0A 5AK0A 3IT1A 1T8PA 4D4JA 3F3KA 2H4XA 3K4PA 2ENWA 3BIFA 4PZAA 3GW8A 1NT4A 2P6OA 2P9ZA 2YN0A 5PGMA 4MA4A 4D4KA 3IT2A 4IJ5A 1XQ9A 1QWOA 2H4ZA 2PA0A 4JODA 2EOAA 1FZTA 1H2FA 4HBZA 2P78A 2HIAA 3C7TA 3OI7A 3IT0A 2F90A 2P79A 3DB1A 2P9FA 2BIFA 2EKZA 1QFXA 2P2ZA 1DKMA 3LNTA 3MXOA 5HR5A 4GPIB 1C81A 2AXNA 4D4LA 3MBKA 2WNHA 1DKPA 1DKQA 2P77A 3FDZA 3D6AA 2YN2A 1YFKA 5AJYA
chains in the Genus database with same CATH superfamily
1CJMA 3L6OO 4JIGA 4LRSB 2R5WA 4R2WA 3T5DA 2QJFA 2I7DA 1HOXA 1UPFA 2C4MA 2IXBA 3E3AA 2B2NA 4M55A 4WDRA 5IF9A 2RHJA 4ZHQA 1FDRA 4WLNA 1ZOSA 1BMFD 2O7VA 3HXKA 2IF0A 2AEFA 3BKWA 1KEZA 4HY3A 4IICA 1PV1A 2Z2JA 2ZIWB 2ZWPA 3ROFA 5IFLA 4EX6A 5IBCA 1T1RA 1X1TA 1UEXC 4DG9A 3H4MA 1YR9A 2JFFA 1N1MA 4WCDA 3TQRA 3LTEA 3BF8A 3TQCA 4OBBA 4RIGA 4HVCA 1ZJYA 2EG9A 3ZVKA 1ICIA 4X6UA 1NQOA 4YMSA 3IURA 1EH5A 2C58A 1V3VA 3QE3A 4F6LA 3AFHA 3D8HA 3LUAA 4JVMA 4XD2A 3CZAA 4E2XA 5AI9A 3H6HA 3J80A 2QJOA 1I13A 4XJVA 3KAJA 5CCEA 1MXHA 3N2GA 3A1TA 3PC7A 2HW8A 3WTCA 1RC1A 1W4ZA 1SC1A 4DCUA 3RVJA 4B8YA 4O08A 5ESRA 4N0DA 4LE0A 1JDBB 4ZYWA 1KMNA 1QBGA 2FETA 1D4FA 1GDDA 3DXYA 5EMNA 2E3JA 2Q4BA 4YGXB 1W0KD 3FF4A 1LVUA 3Q40A 4L6IA 1V3UA 1UZAA 4CEIB 1JIKA 1Q1QA 4HX9A 4ZWNA 1N8NA 1K06A 2PD6A 1GRNA 2JK0A 4J7UA 3BMNB 4RD0A 4Y6PA 1IL0A 2WT9A 2QTRA 2GMWA 3HBNA 5JNWA 5CIWA 1NVVR 4XA8A 1N34B 3FTEA 3K0HA 5JYBA 1G2PA 4OYYA 5I9NA 3OG9A 1XZFA 3W2FA 2YRWA 4CBVA 4E09A 2AMFA 4DT1B 5CG2A 1THTA 3H8SA 1BQ3A 3JYPA 2QMYA 3G0GA 5DOZA 3FPHA 1ZDMA 3QIVA 4JB8A 4A8JB 2GCNA 2OLJA 3DEFA 5K20A 4GRAA 1QIGA 1OPRA 1T5HX 4WFJA 3WZ2A 2MSLA 5CDUA 2PX0A 2HBQA 1GZVA 4QOGA 3BIXA 4NH4A 2UUPA 4Z49A 4E2ZA 2PR7A 1OYYA 3DE6X 4PYQA 4RJKA 1PDVA 3D1JA 4EKIA 1RHUA 3NORA 4ZQHA 1G38A 1R8QA 4AN1A 2PQ6A 1AQYA 3UHOA 2FU5C 3KOMA 1L5YA 1ISRA 3REOA 1C1XA 3TQIA 2W6QA 3R5TA 1FP1D 3L0CA 3TZHA 4ESHA 5JZVA 1S4QA 1BDHA 2L19A 3RYIB 2PZMA 3EEIA 3SVZA 2F9FA 1MW8X 3F49S 3HP7A 4LZLA 4TMKA 1C7QA 4NABA 3WLIA 4GI2A 1RXUA 3DLCA 4RHXA 4WT7A 4DTCA 3GFGA 3IP7A 5JAQA 4KMMA 4M1KA 3R4CA 3GJZA 2GUGA 3PUWA 1AUVA 4BFSA 3RYFA 2P78A 2H07A 4RY9A 4TN5A 4DMUB 4K0KB 3E4CA 2P65A 4MV7A 3RSQA 4D8YA 1UANA 4GX0A 3IERA 2GF2A 2SNIE 4PYMA 5TQ2A 3CF2A 4D3YA 4EG8A 2I8LA 5KNCD 2R6JA 5C53B 4ZO9A 3BCUA 1YZYA 2RAPA 1O89A 2JI4A 2B1QA 2EL7A 2E4ZA 4Y1RB 3ZY2A 4M3NA 3WQRA 4YAUA 1I4EB 1WPRA 1W5TA 1E32A 4KN8A 1Q77A 4X1IA 1B3BA 4MVJM 3R9KA 4MWGA 2ZJ4A 1O9HA 3WYBA 4WINA 4CM4B 4B9AA 5ELXA 1GAQA 1YBHA 1QF7A 1JWAB 3HP1A 1LDYA 2R47A 5TVGA 2FF5A 4L3OA 2AG5A 4RCZA 3LKDA 2YMMA 5A0FA 1CYDA 1EK5A 1W19A 3OCCA 1QHFA 4CMCA 3CPEA 3W9UA 4TRJA 1V5WA 1E79A 3PGJA 4ZKDA 4J75A 1BX1A 3G7UA 4FJ1A 4L2IB 5ADWA 1SA0A 4JP1A 2IY9A 4N3GA 3EEOA 3AG5A 3FZNA 2YWXA 2O5RA 3L1VA 2K2QB 4M22A 2OCGA 4O4LA 3QOYA 3VH3A 4U7TB 3ZVNA 1OYOA 2ENUA 4PEVA 2BEKA 3H5TA 2X42A 4FBGA 1Z06A 4I1OA 4NG5A 4MKXA 3BDAA 1NQVA 4PYJA 1AUOA 5CH3A 1BAPA 2M1XA 3DCJA 4CUZA 3K0SA 1VFPA 3HLTA 1VPDA 3G1TA 4QJIA 4DY6A 4WOPA 1GAEO 4Y6QA 3SLRA 4OL0A 4Q02A 1LNSA 3JRWA 4N0MA 4YRPA 1CJSA 3HYNA 4ZYLA 1AF7A 1W44A 2ZXUA 3OFNA 1TM3E 2H2FA 2HPZA 2UZAA 1QYXA 4ZGGA 1N7IA 1ZLXA 2XW6A 4LKOA 1M6VA 1S1MA 4GGMX 2W6JD 3DZBA 3UEOA 5FP0A 3TFQA 5IYZA 5IT4A 3OLZA 3PJFA 3J81A 1OZHA 1V2GA 3N87A 3D6JA 5AOVA 2YZKA 2COKA 1KY4A 5FBRB 2FX5A 1M1NB 2QN8A 3P5BA 3PTZA 2ADFA 5J2UB 1R16A 4QAQA 4F92B 1Q1NA 1HZZA 1HMPA 4DCJA 1XXHE 4H16A 4ZI7A 2AF4C 4YCCA 2HPHA 2X2PA 1YJXA 5DHTA 4KLCA 2BHLA 4HAVA 4JOSA 4CKWA 4AL4A 4DARA 2FSIA 5I7SA 1BVYF 1G5IA 1IHPA 2A7QA 1YR8A 3MLEA 4ALKA 4XI9A 1JH8A 2Z9BA 1C3LA 2LIPA 1HURA 4W8OA 4ZQIA 4ZT6A 3W5JA 3ZLTA 1KRWA 5EE1A 3IVCA 1PJSA 3F78A 4P80A 1Y81A 2H7XA 1XO1A 3K7EA 3IO3A 5JRZA 5JO0A 3D7KA 2ZIEA 5EWMB 1K88A 3HCEA 3SIPA 1WZNA 1TXGA 1GPUA 2Q49A 3GRUA 1U02A 3OLYA 3PRHA 3R5FA 4I55B 2GTIA 2RCYA 4HAZA 1LF5A 2ASVA 2G07A 1VMIA 5CB4B 3ICWA 5EJFA 5DNUA 1UP6A 2D2XA 4XZ3A 3B60A 3U4GA 3QHPA 3ZI4A 4BC1A 5C8XA 3Q8MA 3EN0A 3QZUA 3MOIA 2EL9A 4H7KA 1J4AA 1PS8A 2BFFB 4B3SB 1XNHA 1AS0A 4EF5A 4URFA 2W93A 3OMXA 3S8MA 4R1TA 1T13A 1QB8A 2NU7B 3E1SA 3GJ4A 2CZQA 4HDMA 4J8PA 4KVFA 1T9ZA 3ZN2A 3EPRA 1GGNA 3KYDB 4ND1A 4WJZA 1R9GA 4PYKA 1JHVA 4G0OA 2ZZKA 3JWEA 3LOQA 5FUYA 5L3VA 4C4RA 4YRCA 3PD0A 4BLPA 1GVNB 1HQDA 4AIIA 4EKGA 5K3DA 3QU7A 1JFTA 4LV6A 3I2KA 5ERGB 3G5AA 2QP4A 1YB6A 4I14A 4FP9A 4KACA 3FPAA 3RSCA 1VMAA 5EP3A 2WDZA 4OYLA 1UPCA 2JEZA 3ZCXA 2IWRA 2W2LA 3U7QA 5CFRA 4FXOA 1FP4B 5IMSA 2JJQA 3SX0A 3KETA 1V8PA 5J1SB 1CR0A 4DA4A 3MA0A 4MGYR 3RK1A 1NN0A 3QELA 1RWQA 3VZDA 1MB2A 2NXNA 2ZJAA 3MCVA 4URWR 5IH7A 1AM4D 5D6OA 5EA2A 4IFBA 4WMLA 5TIIA 4MWBA 4F04A 7ABPA 1VPVA 2O2XA 2AG8A 4P98A 3FNHA 4PTZA 2XB2A 2HA2A 3K4HA 4BL5A 3E7DA 2CLLB 1N75A 4DWVA 5G40A 1NATA 1Y98A 3HN7A 3AEUB 3ELYA 4F3NA 4TS3A 4D0GA 2JH9A 2DFNA 3ZG6A 3D5QA 2XUJA 5EP1A 2OXIA 2VEOA 3KB2A 2HX1A 2OTCA 4IQ8A 5EPEA 2IYRA 4WESB 2Z2YA 5LZ7A 2FLVA 4JFAA 3V9PA 4EUFA 4D44A 1DX6A 1KRXA 1TJNA 3QNUA 1QIHA 1KXZA 1QYDA 1PWXA 1SY7A 4GNKA 4OAPA 4V1CI 1I5EA 1IWPB 4LC0A 3BMCA 1I5RA 3O83A 4M8IA 4ER3A 2XGMA 3PG5A 5BWOA 3D8BA 2D1SA 1Q3TA 2BTQA 2ODNA 3OF2A 4PZ9A 4RFSA 4D1YA 4EVRA 5IRCD 8ABPA 1CUDA 1GRVA 2DPGA 2YYSA 5LLSA 1R18A 1TT5A 1UFVA 2PWBA 3DMYA 1Y37A 4B48A 5H4GA 3EEQA 4YV2A 2HLDA 3VOBA 5JSZB 1EESA 1DIBA 2B78A 4HLCA 4IM7A 1PSZA 1TECE 2IW1A 1PNVA 3NEYA 2WWFA 4CTJA 2HU5A 4PSVA 2WHYA 2O20A 4HNGA 4O4HF 2VHUA 3NV9A 4CI0B 2EKQA 2AEMA 3NDIA 2NT3A 3OKFA 2ZI7A 5BQOA 3E2IA 2Q9BA 4WKCA 1FB5A 2ZG6A 2BM9A 1EVZA 3R5HA 1UXJA 1KMQA 1U2DA 3ENQA 3L7AA 4RVDA 3TDKA 4RDCA 3UGJA 3Q7EA 3GY0A 4RD1A 4WBXC 4XEHA 4NARA 1XTJA 2B21A 1A5TA 1XA0A 2CFIA 1P6QA 1CQWA 1R0KA 4B3HA 1Z6YA 1LLQA 3FYTA 4G0XA 1M2GA 4MVJI 2MJLA 1I5OA 1E64A 2EXXA 3E8SA 3G9UA 4UUAA 1SN7A 1JRLA 3ETLA 4MUBA 4BUJA 1P18A 5BYAA 5AKHA 3PFCA 5KBYA 4RHYA 3G2PA 4ZAGA 1VMEA 1YUNA 3RYCA 1L1RA 2HT1A 3LIIA 5I6DA 4MVJP 4X3PA 5FA5A 3SQWA 4GD3Q 4FN4A 5C5IA 2EEZA 2BE7A 3GJ0A 1YA6A 1XF1A 3KXIA 2ID8A 3UOAB 2EKZA 2W8BA 4LJKA 1DAIA 1K97A 2IDJA 2QE7A 1DJMA 4FZ5A 1W47A 1FFBA 4JI3B 1E0DA 1RJ9B 2GPTA 2PKEA 3GLHE 3C2QA 3GXBA 3KZKA 4NFYA 2LW7A 1K8ZB 2NUPB 5BOSA 3LAWA 4NSNA 5EJ7A 3GLQA 3G8BA 4R9SA 4U9IS 5ALJA 4AAYA 1H9CA 4IDDA 2I1LA 1CRLA 3DTVD 2FNAA 4H3KB 3TBHA 1U9CA 2GLUA 1EE9A 4IHJB 3Q2IA 2PNJA 3FWZA 4I1SA 4Y1GA 2QEQA 1CUUA 2ZWAA 4UEOA 5E2BA 1OH7A 2O8FB 1SZCA 5JXIA 1LDEA 3CJQA 4QOIA 5EIOA 3TOCA 1N4DA 3NIBA 4IKPA 1U99A 1P2FA 3MCTA 1BMDA 1G21A 1F4VA 4GQBA 4LY0A 1XMJA 1O6ZA 4JBGA 4XFJA 3HR8A 5C5DA 3PS9A 3D0KA 4Q37A 5J59A 4AMZA 5C80A 5JCOC 1CY2A 2OBMA 5HE9A 2IZOA 2W6ZA 1FJXA 2PL5A 3P96A 2Q2WA 4OLJA 4TWIA 4JR2A 2PPVA 3AT1A 3UIEA 4CKEA 2IUUA 1YIDA 1XTZA 4A8JA 3C3PA 4WLVA 1CQIB 1XCJA 2J4CA 4NKRA 4NPHA 5B30A 4B6RA 2XT0A 4Y2XA 2VJQA 2BBSA 2PYDA 4GE3A 3OTGA 2EGUA 5AWFC 2FMUA 4EPTA 2BI8A 1EFTA 1SG9A 2WG2A 3KZMA 4TL7A 1PZEA 4ZAWA 5FD8A 4ATNA 1KSGA 2GLXA 2XXJA 4OSOA 3GZNB 2I3DA 2FI1A 2ZJ2A 4B4OA 3T38A 2ZUBA 2GZ3A 2OK8A 2JI9A 4D45A 5IU6A 4BAUA 4RMGA 3RS7A 4LYFA 1ZK3A 1ZU4A 2DT8A 2J5XA 4FFOA 1PFUA 4QTUB 4U6SA 4MDFA 3OU6A 1G20A 3TVYA 2F3SA 4H77A 5CFZA 3LP5A 3PEFA 4PHFA 5DM70 1GRQA 2YZGA 2B8WA 4DQXA 3QPUA 3ZJVA 2HQSA 1GQOA 3DFMA 3FNQA 4PLVA 4Q6BA 5CPBA 5CT4A 3WGKA 1C8LA 1D6MA 1L4MA 2YCLA 3BB3A 3M6FA 4G5XA 2GH1A 5FOQA 3IPYA 2PD3A 3IVXA 1VPWA 1PNRA 5CGZA 3ZWWA 3WGNA 4D3XA 1NP7A 1Y3CE 2ECQA 3UB3A 3T99A 1BS9A 4A8PA 2CJWA 3O94A 4OUDB 4ENSA 4GR5A 3H9QA 2NU8A 3OZUA 2V3WA 3FGZA 2XYHA 2HO5A 1UIMA 4EZIA 3T5PA 3N05A 1RWNA 3FZYA 2IU4A 3OQHA 4LV8B 4RTRA 3GDWA 4AY2A 4MTLA 5IVHA 1HI9A 1P3Y1 1Y8QB 3OZDA 2YJ6A 3LDAA 1A97A 1PQYA 2QRLA 3ED1A 1UPUA 2WJGA 3TOZA 5COQA 2GTHA 4QJ3A 3N7TA 4P7FA 2X40A 3CJTA 3NEPX 4B4UA 4HPWA 1FC0A 1UBNA 3LSTA 4PQRA 2RGBA 4JP8A 3WLPA 3C5CA 1J2RA 3UAOA 4CR7A 4NZZA 3BTOA 4CCAA 1XNQB 4PS1A 2E1PA 3BCHA 3HCRA 4L3WA 2VJOA 5AVKA 3ZCQA 4BKOA 5K3EA 2X86A 3AUAA 1CCWA 1U5CA 3CVOA 2IZZA 4TMTA 3H9CA 3GV0A 3KB8A 1JSLA 1Q16A 5DI3A 2RHBA 1C9MA 1G9SA 5E6RB 1XCOA 3ZJ5A 1GN9A 1QDLB 3LPAA 4O5AA 2RGWA 3JYQA 2HHLA 2AE2A 5EOVA 3RSFA 2XPCA 2ZRCA 1MEJA 2Y9PB 3LNCA 3QE2A 4B6EA 3DQPA 5JSZA 5KTOA 1SXQA 3PYXA 2GKOA 5IAOA 4B3FX 2CNWD 3AETB 4CDGA 1X8XA 4FDVA 4M1ZA 4NBSA 3V97A 5KOHA 4KE6A 5DKFA 3TXXA 2BBWA 5SYNA 4MINA 1QVAA 5ER9A 2ACEA 4R41A 1OH5A 1N2SA 1SK9A 1TAGA 1VGQA 3AUSA 3RODA 1VA5A 3P9IA 2E21A 2HLPA 4BFCA 4C9BA 2R1ZA 2G8LA 1KO1A 4Q3CA 2DB3A 4DDMA 3QLTA 2YZ7A 4A6XA 4MZXA 2JATA 1EIZA 6ADHA 4UPVA 1QV9A 3TPCA 1RRCA 3KLNA 3LQFA 2J3KA 3ZWYA 1SB8A 5JDIC 1IQPA 1W6UA 4YRJA 2NLOA 4MUGA 2DLCX 3UGQA 3T3PB 4EA7A 2YXNA 3HU1A 3RUHA 4ZTBA 2BKEA 3TZQA 3WJAA 2WE8A 4JJFA 2C4HA 2P35A 2LWIA 1JE1A 1Z28A 4CM8A 2KBFA 4UVEA 4CIDA 2G9RA 2IIVA 4B1FA 4B4KA 1L4BA 4V1CB 3I4FA 1QZZA 4GRDA 3PVZA 1Y7PA 3UWMA 2WF5A 3DTNA 3OZFA 4AULA 3EVCA 1YR3A 2PLAA 3QPWA 3EMKA 3IIJA 1AY0A 1NQUA 4NU0A 1D2EA 2P69A 2E2WA 5EGNA 2PNFA 3LY8A 4OSEA 1GUZA 2ZETA 3ZTTA 1RRKA 5T5QA 2CUNA 2C59A 3ICOA 2WHQA 3PNPA 4BBAA 1G2QA 1QPGA 2D2VA 2E4YA 3BHJA 3H84A 3QVJA 5DOVA 1RACA 2OA0A 2WSBA 4JIMA 3SX4A 1AUXA 1ZOIA 4FB4A 3MJHA 4TMYA 4EUSA 1FJHA 4LHZA 2YY7A 4Q4HB 2FR1A 3C6MA 4GU5A 2G88A 3H5RA 4J16A 5HBRA 4AICA 1QCZA 1GNPA 2EHDA 3KTFA 3ZHRA 2VF4X 2GAFA 2NO0A 1T6NA 5EZYA 3ZZ0A 1ZJJA 4ECAA 3MERA 4PLYA 4H2DA 3AINA 4HLQB 2GT1A 2W4MA 4JI2B 3RFCA 1T1SA 3FOAA 1EXNA 3VR0A 1G4AE 3E48A 1V6AA 3KAQA 1QQTA 4LJRA 4E12A 4REMA 3WK6A 4B6QA 1R66A 3HBAA 1MNQA 1TO6A 4OXNA 5AXDA 3RT1A 4D7AA 1KKLA 1NDQA 4AN0A 2I7CA 4TVKA 3KZ1E 4D57A 3D6NB 1OC4A 5DRYA 2PEYA 5HZHA 1PI3A 2ODEA 3F3MA 4A91A 4TROA 4J3NA 3FHCB 3NAMA 1RADA 3GN1A 3BD8A 1L9KA 3CVYA 4M8KA 2C8LA 1I33A 1I6MA 1YS2X 2WWRA 4NNPA 1Q7BA 3L8YA 4DA7A 3EMBA 3I9V6 1G1AA 4GOJA 1V45E 4JSYA 4AJLA 3MRTA 1ZA2A 1BE0A 2CDRA 2JDID 2JJ8A 2JGDB 3K0AB 2W2KB 1CY7A 3PXEA 1G8AA 1U9IA 2JGAA 3ILSA 4J2TA 4MR7B 4TXJA 4MNTA 1YGPA 5FV4A 1ONNA 1N0UA 1O96B 1JDUA 2C9MA 2BGGA 2AJCA 4F4CA 3WLLA 2WTUA 1Q1ZA 3EC1A 3SHWA 1FP4A 4WZAA 1TPYA 3ZUGA 5MGBA 4M1YA 1E2QA 1KTVA 2VDWB 2GD2A 3WGQA 4A8TA 4BN5A 1LSJA 1NASA 3IAS1 4XQEA 4QECA 3UW3A 4IV5A 3OM9A 5IEBA 3U17A 3D8RA 3CZRA 4DIOA 1NR7A 3OURA 2JANA 4OGLA 4P32A 5DE3A 5L3SA 1ZAYA 2R25B 1GWNA 2XMPA 4X1KA 3LDFA 1KZ4A 4Q4AA 4ZANA 2I7TA 2WHPA 1YFJA 2WPDA 3CWQA 3R5SA 3NO4A 3VPSA 4DV3B 1N36B 2VNJA 2XCIA 4X60A 1BCSA 2CSXA 4M0PA 1L5HB 1PTKA 2WKSA 4O63O 4BQSA 3KHSA 4V03A 1V9SA 4G36A 4XYMA 4XOUA 1X0XA 1NMZA 5KJEA 4HEHA 3T9BA 2OWEA 1DAPA 3FMOB 3HO1A 4BLOA 1UWKA 3NPMA 3ZLVA 3NBZC 4ZVKA 1U9ZA 1E66A 4CKBA 4W63A 2XQKA 4FYHA 1O0CA 3BGIA 2XOEA 1FUEA 1NZFA 1SQSA 3S0JA 1M2VB 3GUVA 3R23A 4JL6A 3K0EA 4H1UA 4S0XA 3OZ7A 5B3JA 1GADO 2WQ7A 1TQDA 4Z7NB 3E8XA 2PLFA 1V95A 2XR1A 3HHPA 4IINA 4FYKA 4PSKA 4JP2A 4WNIA 2E5WA 2PY6A 2CD7A 3VU8A 4E5DA 1LK7A 1V47A 3R3WA 1M8PA 3M1YA 4D96A 1IEWA 3BG5A 1DPGA 3VHXA 3FUWA 3H5OA 3HADA 4NNOA 4QXAA 1E0AA 4UVDA 3BHIA 1YZHA 1EFDN 2AWNA 2H16A 4CN9A 3U39A 2RG1A 4R2LA 3O8QB 1DLIA 1KJZA 2BHTA 3GWGA 3SHQA 4CJXA 1H22A 2Q9AA 3I01A 4QNRA 1NF3A 3LT0A 4BKQA 1QG2A 1VIAA 3D5EA 2FMFA 2DY0A 3KZXA 4M0MA 5KYYB 1BN7A 3HI4A 4GKAA 1CEYA 2GPJA 4J94A 1AV7A 4R8RA 1YQUA 2QLLA 2QN7A 3GCWA 1Z29A 4RVNA 4ZCPA 1O0BA 1YQQA 2B7CA 2ZE8A 3NAQA 2ZUDA 3NHRA 2IS2A 3V8MA 3GLIB 1SQGA 2N9UA 4P92A 4RYLA 4D3DA 1XALA 1YI8A 1IBMB 3OIDA 4DJ5X 3SXPA 3QEJA 3TW8B 1MB3A 3LPCA 3DZCA 3IL2A 1NLYA 3N6XA 3STXA 3WLTA 3COJA 1FK8A 4XW2A 2C2ZA 3N2IA 4DLKA 5CFNA 3B1WA 4IV0A 4XQGA 3USES 2DM6A 2R2GA 3QQ5A 4XX1A 1P60A 1D2MA 1JX6A 1MJ5A 2HJRA 2X4LA 2I66A 3ONDA 5C34B 3RRZA 4Q05A 3T5TA 1E6WA 3I9KA 3UJDA 3WRVA 3PXAA 1U0EA 1U2DC 4YY3B 4KQ9A 2D5IA 3QI2A 5F52A 5AW3A 4IGFA 3E05A 1RW4A 1P1CA 3UXEA 2PMDA 3LRTA 1HFWA 2JLBA 1HQCA 2PU5A 3F47A 3P71T 1GGVA 3PTLA 1SUWA 5AM3A 3BWBA 4UM9B 4GP7A 4R9RA 5EMJA 3VNSA 4GSLA 4UUMA 1IY9A 2OPHA 1U04A 3TIVA 3PQCA 4C05A 1XQ9A 4YJFA 3KEGA 5KMGB 1E61A 5LA6F 4OOFA 4M0KA 3AOEC 3SEZA 1QRRA 2CXQA 4MA5A 4DPMA 3WA7A 3AHJA 4Z4GA 4DGSA 2JGJA 4LXGA 4L2IA 5DTMA 1MG0A 2B7BA 2C5BA 4U2GA 2C3OA 5LBUA 2VT6A 4FFNA 2XA2A 4P93A 1NBIA 3GLVA 1MX3A 3T7EA 1KIFA 3ASVA 4ZZ1A 1GNVA 4MLZA 1R37A 1FNSA 3QFRA 1T6BY 2DQKA 2OZVA 4P8RA 4B87A 5ED4A 2JLUA 3EW7A 4P4NA 3HS3A 5MN6A 4TMVA 3UMJA 3VVMA 4BE9A 4F72A 3BD9A 5CXSA 1ZH0A 4KLRA 4MEJA 2PIDA 4RESA 4I0WB 3FOEC 1ODJA 2HJGA 1MAHA 3JD4A 1KDVA 1ZHOA 1NV8A 4IZ6A 4IF6A 4Z51A 1ETHA 1Z3CA 2HWXA 5A05A 3ZY6A 4XLLA 4ADSG 4Z3KA 1GM5A 4ZTUB 1DT3A 2BFBB 2G9QA 2NV2B 4DQLA 1ID1A 1TTQB 2Q4OA 3NEAA 2VAVA 1BN6A 3FCAA 3SSMA 2NGRA 1IWOA 3THSA 1DBQA 1XZDA 2XZPA 4KDEA 5M29A 3GDFA 1OHHA 4NBTA 4UNQA 1JJVA 4B7XA 2CV1A 1TCAA 4KUHA 5ALUA 1XK7A 4TVOA 4ND5A 1KYXA 2QTNA 4RACA 1YMQA 3L7LA 2XRFA 3R6DA 2EJCA 4RNCA 4PGAA 3SN6A 3PGA1 3QUCA 4N48A 4FU0A 2Q46A 2OFXA 2YHIA 3SMVA 1XDGA 5BNWA 3F6YA 3CW2A 3FHTA 5MFZA 3U3ZA 1CE8B 2BUCA 1WU8A 1MABA 3KYIB 4BBJA 3UANA 1CK4A 2VKQA 4DSNA 1BU8A 3CF4A 2HTFA 4AFNA 4RX1A 5K0TA 3D31A 1H4QA 1EG2A 3VNBA 2BKUA 5HRCA 1RWOA 3GVHA 3TR6A 1TPZA 1PJ2A 1W5EA 2QX4A 4ZVRA 4RTJA 2FDCA 4UFPA 4QDJA 2PMWB 5EPUA 1A8SA 4TMZA 1JAYA 3GFQA 5L3ZA 3AEQB 5LMUB 4GOMD 2BGIA 4LDAA 4WWHA 4H7FA 5EP4A 3V1YA 4O4IA 2FSGA 3JVVA 2VDPB 1GZ7A 2VC2B 3CZPA 3PA6A 4Q03A 3CPHA 3FTCA 4B4WA 1ZJZA 4LOJA 4MHOA 4G23A 1W2GA 4PC6A 3KPVA 1GG5A 4FFLA 4O8ZA 2R84A 1GA6A 2O8BB 2C2GA 4M0CA 4QDUA 5A3VA 2XUDA 3V80A 5IFKA 3FAKA 1FFYA 1Z5ZA 4GYWA 1HOTA 4QQNA 3RIYA 4ZXPA 2O2HA 1YZUA 4HBGA 3I2YX 1H2EA 5CK4A 5KNDH 2IH2A 3PK0A 3UV3A 2JFHA 5EC8A 4YDSA 2EP8A 1F9EA 2GEVA 4NDAA 1GTRA 1UM9A 1A5SB 2G76A 2XGJA 1Z4NA 4LYYA 1DNPA 4BNNA 2KI5A 5ICMA 2HK9A 3EBPA 3AKDA 4PCLA 2ZBQA 4KWCA 4XQCA 4A8JC 4YP7A 3M6LA 3P4UA 4R2HA 5P8WA 1ML3A 1P3JA 3A4IA 1PVOA 3BILA 2VLIA 3N2GB 3U3OA 3ICQB 3UATA 3PC2A 4B35A 2YN0A 3DPIA 2OBBA 1UBOS 3CG4A 4KR9A 2C3UA 1OT5A 1QWOA 2P8SA 4K0RA 4K9QA 4G01B 1O08A 3NRBA 4CFSA 1R8XA 2IYQA 2V6MA 2I03A 1N2CE 1USIA 3MJSA 2PGOA 4MUXA 2NO6A 4ZC1A 4EUEA 3CNNA 1VGVA 2ZJZA 2J8ZA 4DJAA 5KJ1A 5FI1B 1E6MA 4L27A 3P9YA 1A2BA 2JZCA 3EG9A 3LVRE 2GVNA 4I81A 4X84A 2PT7A 2HF2A 1X8LA 3HWWA 2YDYA 1TD1A 3HA3A 3CB2A 4LNUA 1YOVB 2ZYDA 2PZLA 1DG1G 2HQ1A 1ZR2A 4QNNA 5LA6B 2ZRQA 5MF6A 4S05A 1SD5A 3LCVB 3OMLA 5AXBA 4BOYA 2VH5R 4Q1EA 2HEGA 3PRJA 4CMKA 3L0SA 2YINC 1SC3A 3CUSA 2XV1A 1E7SA 4BRZA 5LDDC 4TXHA 2QLMA 1Y8RA 3GP3A 4N3BA 1PG5A 2LDXA 1C3VA 4F2HA 4LK2A 3OPQA 1EWQA 4FT2A 4HZUB 4OI1A 1F2DA 3T41A 3WJ2A 3GXOA 4WK6A 1V16A 2JAWA 2ZJFA 3L8MA 2GD0A 1MOSA 1XU9A 4ZO6A 1GZ3A 2ZTLA 4TRRA 3FMIA 5FO1A 2V7QD 3ETCA 3WGJA 5JMTA 2V1UA 3C3WA 2E4AA 1Q3KA 4K7JA 1WY7A 4WN9B 4GI1A 4ALMA 1F8GA 3BKXA 4G4SO 1GPKA 3RHSA 7YASA 1JDNA 4QWWA 4F4UA 4OHOA 4KH0A 5A2QA 5FLXA 1PFQA 1VBNA 3DKKA 5I7AA 5A3QA 4TZ6A 5L4LA 1W94A 1IN6A 1U1IA 2W2QA 3UT6A 1EJBA 4K8OA 3UJ3X 5H8WA 3GN2A 2B20A 2OHIA 3I8XA 2AN3A 3GAFA 1A9RA 1Q91A 4EW1A 1GHTA 4HNHA 4PG8A 4MKGA 3A4YA 3HRIA 4KJXA 1XDWA 2NMVA 1Z39A 4GO1A 4MAAA 4R31A 5EKUA 2ZJYA 5BNTA 1IXYA 3B1FA 3LY5A 1IHUA 3S29A 5CT6A 1NN1A 4Y9RA 3WB1A 1QHXA 5F3RA 2Z8YM 1RWXA 4IY1A 2O57A 2ZIGA 1M5TA 4KQMA 3BEOA 4X20B 1SKMA 3AFNA 1YJQA 1K1EA 5LUAA 3AGPA 4Q4JB 3W5SA 3D6VA 3RYCB 1YR7A 5BUSA 3GAAA 4BO0A 4CQNA 2NQ8A 5FWAA 1VIVA 5ABPA 2H51A 3ODPA 4J29A 1GILA 1LUAA 4AO8A 5LWHA 1E6EA 4EWLA 2XY4A 5FR2A 1OHHD 4RKWA 5CCXA 4ZJPA 3KR1A 4RYDA 4PYLA 5KAMA 1JUDA 1NNSA 3IKVA 2JL1A 3DHVA 2HIGA 2VYVA 1NW5A 3PFIA 4ZO8A 5DP2A 5H3HA 1JXAA 2C96A 2N1MA 2FEPA 2JCBA 3EF3A 1ZPDA 3FPJA 1WXQA 4R0VA 4QDKA 3TW4A 4NCBA 1B0AA 3L7JA 4AY5A 1U7ZA 2A2ZA 4PQEA 3IUJA 2GA8A 2XF2A 3ZE0B 1NT4A 2QPAA 2H1FA 3M3PA 4HDAA 3B1ZA 2VHZA 1A76A 4YT2A 1A9YA 1GL6A 5I8ZA 5T7BA 1LSOA 1IBCA 2GRJA 3LK7A 2YY6A 3UF0A 3IDFA 3R0ZA 2CC2A 4JZKA 1OYVA 2BF7A 1NQWA 1MQAA 2TMDA 1R6AA 4MQLA 3Q0TA 4C30A 1NUSA 4LTMA 1XEWX 2ZM5A 4BVEA 2H1RA 1R6UA 5GONB 1G21E 5E7MA 4EJSC 3JQ9C 3NIGB 1XF9A 4NZMA 4BX2A 1Y1SA 1ZVMA 1GUDA 1WIWA 4LE1A 2K4MA 2HJWA 2QTTA 2A5DA 1SXJA 5HG0A 1GZDA 2J46A 4HUTA 3DDWA 3ACDA 3Q41A 3FWKA 4IVNA 4RA6A 1LTHR 3DLIA 1Q1EA 1T1IA 4B4VA 1VDMA 2GN8A 3QVXA 2MYNA 5EESA 3EK2A 1CJKC 4G1BA 2XA1A 4NDZA 4LVOA 2ZSJA 1M73E 1VM6A 2X5KO 3W77A 4TWAA 1MVNA 2FY8A 3F46A 3VZSA 2C5SA 4P3PA 1ZJ6A 3TSZA 5CFLA 3WB9A 2CJWB 1Y3DE 1DUSA 1P0IA 2VPXA 3FUUA 1V5EA 3MQ2A 3QVOA 3R3VA 1E59A 1T8YA 4JS0A 4MIEA 4H3VA 1I1OA 3NHBA 2P0YA 1M10A 3RVDA 1HT0A 1XTKA 2XMZA 3MTIA 2H7YA 3IMFA 3LZDA 5LIRA 4KXQA 1FRNA 2QPOA 1B16A 3K0AA 4RUKA 3R7WB 3WBBA 2A4MA 4EG7A 1NQXA 4JX8A 3WLOA 1CR2A 1XYYA 3LRPA 3V8RA 2C4WA 4IJKA 2W58A 4ZO4A 4PZEA 2J6HA 5JJIA 2FFAA 5E7QA 3K30A 4KODA 1Y1PA 5CLQA 4QLOA 1T2UA 2AL7A 2NSHA 4C4YA 4Q7QA 4PPNA 4KIGA 4HRXA 1CXZA 3QU2A 1U1GA 2D4AA 4EG5A 1OFUX 5K51A 4F12A 4WVFA 4YC7A 3TL3A 4X7RA 1KH2A 2VDMB 5T67A 1LKZA 3A58B 3BK2A 3IUMA 5CJJA 2MYUA 2YNMA 3AF2A 1DAOA 1JNXX 2A30A 3CMCO 3TH5A 1JQJC 4EKYA 1D2NA 3G13A 4MW1A 1B0ZA 3DW3X 2QTWB 3TIGA 2VTBB 1N57A 2C7PA 1AA9A 2XX3A 4IMRA 5TQJA 1QTRA 3LVFO 4YJFB 2BEWB 3VSEA 2VJKA 1GRRA 1YZNA 2XCQA 1Q15A 1CUEA 1XI2A 1C0PA 1P5ZB 1X74A 3WLJA 4DUZB 1YR6A 1N2CA 1W4CA 1KK1A 1X15A 2YJZA 4FDLA 4DJDC 4JOCA 4V39A 5DBGA 4LZOA 4N5NA 1THGA 1E1LA 2QR2A 2B35A 2ZEJA 1XZCA 3SYKA 1ZEJA 2DR2A 4CEHA 4ZVSA 1JQKA 3PQFA 2QM8A 1V16B 3GUCA 3FOFC 2FPMA 3OBBA 4C0XA 5EIEA 3GLGA 2R6AA 3AM1A 5DTRA 1JEEA 1OUMA 2ZBRA 2ZU0C 3I3OA 2O3TA 2B82A 3OT1B 4FHGA 2GPNA 2RJOA 3EDMA 4PPQA 5CJ2A 3ZHZA 4D43A 3H11A 2GX6A 3E1KA 3GD7A 2GZ1A 1Q57A 3RJ9A 3RVMA 4A82A 2GUWA 4NOLA 1WZIA 3GQBB 2VXCA 3E18A 3KQMA 3O84A 4H7HA 3GC6A 5ITZA 1XQWA 2PG3A 2ZRIA 4XGNA 2F4VB 5A03A 4H6XA 2BN4A 1UBCA 1IBKB 4PY2A 3LBHA 2E85A 2CHQA 5FA6A 4HXFB 4DDVA 1U2GA 5JXHA 4PC3A 1N2GA 1XJ0A 4HDRB 1JNYA 3L07A 4MVCA 4A36A 2F3RA 1RVV1 3ER8A 2O8DA 1JKIA 1P0PA 2Z3VA 3BWDD 3DTVB 1KI8A 1JFLA 1SU8A 4MYCA 2Z8YA 3LXUX 3TIIA 5EJAA 4FFSA 3NYIA 3QOXA 4NNJA 3I5XA 4R2MA 2ZREA 2QLNA 3DFFA 1AVTA 3FBWA 1Y9DA 3DVAB 3EDOA 4EHIA 1XQXA 5IF3A 1BX3A 1OLOA 2QD4A 4K6KA 2PUJA 3QTLA 4Y2RA 5JD3A 1IZ9A 3SS7X 4ZI2A 5KJ6A 2V5AA 2VNHA 3OLXA 5IARA 5FI5A 3IFSA 3VU3A 3CSDA 1JALA 1H6CA 5FOTA 1EU1A 2Y1KA 1EGVB 2ZBFA 4RGYA 4COOA 1X7ZA 2A9VA 2J31A 1E2PA 4MPTA 4OQNA 2IXFA 5GY7A 5BN5A 3V4PB 5GMOA 5JDCC 1V7QA 1SEPA 2MU1A 1W9MA 5EXTA 2PJUA 2ZIXB 3JQBA 2C03A 2AMJA 2HN9A 3L8DA 4KITB 1AMNA 3IKMB 4J03A 3DHNA 4IJ6A 2FJUA 4O1HA 1G66A 1TFRA 3QBEA 3K2EA 2GEJA 5FBHA 5K4AA 4ZEMA 5F73A 5A71A 1BXRA 1T26A 3OICA 3UH1A 2UYCA 2LCIA 5BN1A 2WHXA 3D0RA 4HMQA 3ZR4B 3C8ZA 2QR3A 1BS1A 4HYYA 1YH3A 2QVBA 3UJAA 4FDUA 3GJ7A 3WB2A 4EELA 5IZ4A 3GBSA 4GEGA 4HO1X 2MINB 4UZEA 4ZCLA 3EBOA 4HQFA 3RRMA 3WO1A 4B44A 4E3WA 2W9XA 3QVTA 2CLCX 4L5IA 1Q7TA 5DX1A 1IONA 4IDQA 1ZIYA 3SZUA 1QPZA 2XYVA 1Z18A 3V2HA 1KEUA 3ORSA 3C3YA 1WP4A 3VVLA 5KSWB 1G5RA 1NJ6A 1T2VA 3SMQA 5AI8A 3NR2A 5A5FA 2I2BA 4BNKA 4K28A 2HUPA 1A2QA 4E70A 3JQBC 1UBMS 2OLKA 3LPMA 4D8WA 1JLMA 1SUSA 3OCXA 3OJEA 3OPYI 1XQ6A 2QX7A 3PNBA 2VPYA 4X9XA 4XR4A 1GL7A 3BXHA 2FFHA 3L0PA 1SOVA 1CD5A 2PTGA 5I7EA 1ZWLA 1BCRB 1MTZA 2XUHA 1OXUA 1ZD5A 3NHUA 1G3RA 1U3CA 2X8AA 3DUWA 1BVRA 2WF6A 4P0TA 4XYBA 5J2TF 1YQXA 1J0AA 2OMKA 1QFYA 1XCLA 5KSPA 4QVGA 3BGDA 2OECA 4X24A 5EL0A 1S96A 5KSOA 1Z0JA 3OEHA 3R7SA 3NXSA 3LG2A 2YJ4A 1ZN9A 2QI9F 2ZBUA 3A10A 3K9WA 4ZN6A 5BMOA 1NI4B 4MQEB 5KS2A 2WFMA 5FWDA 1SFRA 4L8VA 1PVVA 1RZ3A 1D0IA 3H1TA 1QGAA 3OOEA 5AK0A 4F5ZA 1AN0A 2EJVA 1GNRA 4OGWA 1SD2A 3KG2A 4YJHB 1VKZA 2Z6VA 3ITEA 2AQIA 1OI4A 5FUXA 1Z2AA 1ODIA 2JHCA 3FMFA 2XRYA 3EVEA 4FE7A 4DCGA 4BNUA 1DZ3A 3FE2A 3LMKA 5IXJA 3PWSA 3O8OB 4LF5B 1LS6A 3GLSA 4HEA6 3ERCA 3WSTA 5D3ZA 2WUGA 3EGXA 4BFZA 3WYNA 3OAAA 1RZRA 3GFSA 4OB7A 1BQEA 3FMPB 2MSEB 2ZAIA 4XQ0A 4BJHB 3KZVA 1QRDA 2I4NA 4XM0A 1ILEA 3M34A 1YJ5A 2H63A 2PMEA 1WZUA 3ROPA 1DO0A 3ZDZB 3T1YB 1NNEA 2IQ5A 2C2XA 3D3WA 5AVYA 3TUIC 1H85A 5CT8A 3H4IA 1KEVA 1P1BA 3IE0A 4DEXA 4OG2A 1KWGA 4G0YA 1GU7A 4XPZA 3EGOA 4F8JA 2QJRA 1EVQA 2ZJ7A 3B36A 1GSHA 3D4OA 3BFXA 1R6VA 4PC1A 1JSCA 1KP3A 2BFOA 5L51A 3W04A 3RKSA 3VNVA 2O0HA 4QBIA 1B6SA 1HLPA 2HRCA 1V5GA 1YQGA 2NU8B 1ZS9A 1GZSA 4KFCA 2JLSA 4NCXA 2OZLA 3RO7A 2XYGA 4KXWA 4I1IA 2Z2KA 2B3DA 2P75A 4DQVA 2Y68A 4ZJUA 3HO8A 1Y8QA 4DLAA 1TEVA 5I7WA 3TDMA 2ZKLA 5CJPA 3G2JA 1SU7A 3ZDQA 3CN9A 2F3TA 1LPBB 5JASA 2PUAA 3RHFA 4P5EA 3S3TA 2FUNB 3W5AA 3J7AC 3BA6A 4UMDA 1EE1A 3QLVC 1MJGA 4Q3LA 3ZWOA 1N6PA 1N3LA 1L8QA 3KFXA 3N7UA 2IDKA 4AUNA 2C4TA 4JLSA 4G2NA 1YZKA 1PZHA 1U3UA 2YASA 1X86B 3EXHC 3MRVA 4RPGA 3Q7IA 3TLYA 1TC1A 1WB5A 2W22A 4LI0A 3DAPA 3VR3A 4BMCA 1FXWF 2J4FA 3KPUA 4QPPA 1JIJA 2PLRA 3RBAA 5BSEA 3Q6IA 4TQUS 5E6RA 4KKXB 1UC8A 2XD9A 4CMEA 1NJGA 3ZV3A 1Q7EA 2IHNA 4PO8A 2VRNA 4EG4A 4ZU3A 3QEOA 2CVFA 2BTEA 3EF1A 4P4SA 3I52A 4QFCA 4GI3A 1CR1A 3I2JA 3MPOA 3BJEA 1YRYE 1J9GA 4N5HX 4OMFG 1U90A 5EY5B 1TZJA 1XD9A 3AOGA 2FPWA 2QQ0A 1Q74A 1ZNXA 2X0RA 3FVVA 3BZUA 4RGVA 1UJNA 1CUCA 1QHNA 3NIDB 3VH2A 4UCWA 2C1XA 4EJSA 4JUBA 2O2DA 5LQUA 1IZYA 4X7MA 3H1BA 3RBXA 2W6MA 1LLUA 4OHWA 3IO5A 1IBLB 3NP9A 3KWMA 2XBMA 1P73A 2WM2A 3O4RA 4MJXA 3HGQA 1NC3A 1PEYA 4YO8A 3DEAA 4YMIA 5FNZA 3FD8A 5H1YA 1HX7A 3PA8A 4IIBA 3SVLA 3NNNA 2FF7A 3C3MA 2XMGA 3GEBA 5EQDA 1A69A 1PIWA 1VA4A 4IP0A 4DLXA 4JXXA 3OWXA 1IOLA 2IYNA 3V2UA 5C8YF 3QG1A 2YVAA 2DH6A 3PUYA 3QG5A 4M9ZA 5CDYA 3AERB 3F7TA 1E7RA 4PAOA 1RFLA 4OHMA 3WC4A 4MRAA 4BLSA 5JJ5A 3DMDA 2V7EA 2ERYA 4TLBA 3OAAD 3I0MA 1I80A 2B4QA 3IRUA 4XR9A 3RS3A 3ZQUA 4D9EA 4D8XA 1AHPA 1ZA1A 3A9SA 1IATA 4Z9BA 4YMHA 4DB2A 1C81A 4PFSA 3I4CA 3MBKA 2OORC 1K66A 1TTPB 3T5GA 2DUNA 4AVYA 2B1GA 2JI6A 4KO2S 4FI3C 5EUCA 4KAAA 1QIMA 4QVKA 3TSOA 1KDYA 3E53A 3FSGA 4MV6A 2XB8A 4PC7A 3X1WA 5ISMA 3JU3A 3IV6A 1BCRA 1J07A 1TW3A 2JAXA 2JFQA 3C74A 2XB9A 5CYOA 5F1PA 3EDQA 4ED9A 3O8QA 4D8UA 4A9AA 5EHZA 3P9SA 4Z53A 2IF2A 3AF0A 3ZDXB 1JR3A 4DR2B 2PMKA 3UMSA 1Y4SA 2ZSIA 3GGGA 1GV1A 1KAHA 1K0UA 2AOWA 4WE3A 5AM0A 4V2UA 4YH1A 3RABA 3V7YA 2ZCJA 3DOEA 5AKLA 3PUJA 5F9HA 4J0QA 5IDXA 4RHEA 1E8DA 3NJ8A 3WK9A 4OD0A 3JPYA 1GUYA 1JP7A 1ZNQO 1UOQA 2YWEA 3BRQA 3CZ9A 4DGQA 2REBA 5LNK1 4FKZA 3WDMA 5KWJA 1EFUA 3MLAA 4JLNA 1EXWA 1QH0A 4OQDA 3JQGB 3U9TA 1OV6A 4JP3A 3DZFA 1L9XA 3PDCA 5HQ3A 1PR5A 2YJTD 1N9GB 4RHUA 3KC2A 5GOZA 5A9TA 3V48A 3PCXA 1HDXA 2BEVB 3JQ8A 3QW2A 3T3IA 1ZHHA 4L8WB 3B6EA 3ND9A 5IG2A 2PQ2A 3P9PA 1TEXA 4AN4A 3KDSE 1A0OA 3ZH2A 2GM9A 4YLGA 4J0JA 1UKBA 2POCA 1NONA 3Q1LA 4IUDS 5L3QB 4RTNA 3NM5A 4EI7A 2PYZA 5IUJC 1SBNE 1G59A 2H7VA 4DWWA 2COUA 3FPSA 4JGIA 4A10A 4A6DA 3DD1A 1SJ9A 1T36A 1Z62A 2AN5A 2J85A 3DMGA 3L6DA 3LA8A 1NFRA 4U5XA 4WW0A 2GYVA 5JCJD 4GMDA 5DFAA 1UDCA 1GNTA 3ND8A 3VR2A 2JZOA 5EIXA 2RHRA 1L6RA 2PV7A 3O2QB 4F1WA 5HPYB 1WQ1R 4WCFA 3MELA 1Z4QA 4FOLA 4GT1A 4O4JF 1D03A 4AMGA 5JANA 1KJQA 1GPLA 7MDHA 5CB6A 1GTJ1 2A1TR 1B15A 5K8IA 3AR9A 4QYSA 3H8JA 3CUVA 1ULHA 3ZC3A 2PT9A 4EY5A 2EX0A 4GMFA 5AH0A 1I36A 4HGYA 2Q45A 2B36A 3AVPA 1IB6A 1I3LA 2Q5JA 1CB7A 2ZBGA 3E84A 4O2BB 1XCMA 4U7HA 5I9TA 3UY4A 1JPJA 1NV9A 4HDRA 4Y6GB 1WUYA 4JAVC 1VB3A 2WTEA 3OPYA 2H65A 3C0KA 1LC3A 1IM8A 1VHJA 1M6EX 4ETNA 4JI4B 3JASB 4C0WA 2A9QA 3QTTA 1EXMA 2ZI4A 4TUYB 5AI5A 1ZQ9A 1QNFA 5CP8A 5FHQA 3HO6A 5CGQB 1GPBA 2UUBB 4WN9A 3AHGA 2A1IA 1MC1A 3C4QA 3D4PA 4FYYA 5B2EA 1A8QA 1RWPA 3TJRA 2K2WA 1QGUA 2WJ6A 1C1HA 2QTVB 3LOUA 5BQ5A 3WB0A 4KNVA 4PLZA 3WLRA 2GTPA 4I4TA 3V1KA 2BMVA 4D6PA 4DSUA 1F2UA 3O3OB 4TV9B 5EPOA 1PJ8A 4D4GA 5EIFA 4FBLA 5HVNA 1U0HC 2HDWA 3QM1A 3PICA 1KNQA 5ALKA 5AHXA 4I9NA 4RGQA 4DLZA 1L3IA 1Z4KA 4BO4A 4W5HA 1J2TA 2NWQA 5B2ZA 4ARZB 2YW2A 4GW3A 4KVAA 3KVOA 4JXKA 4A0SA 4DLTA 5AJYA 1YVUA 2WILA 1GYQA 4JEIA 4V2IA 1JJIA 1Q0HA 3BJZA 1QYWA 3HBMA 4TXMA 4C89A 3R9XB 4MS3B 1DFIA 1W4RA 1XBTA 2ZUWA 1NRXA 3ESZA 3HMKA 1TO2E 4NYMQ 3GJ5A 4DIBA 4ZIRB 4ZYXA 1RBMA 1IJBA 3B3AA 4YYZA 1JSZA 2LCFA 1SVSA 1OC2A 3F8TA 3MCZA 1L5LA 4CM6A 2PWZA 4F3YA 3HJFA 4MWCA 4K9DA 2G17A 3P52A 4RHFA 1D09A 2AH5A 3A3OA 3GQVA 4GBJA 4HGPA 1ZGHA 1ZGAA 1UP7A 1XU4A 4IMPA 4TKVB 4XIIA 2Z3ZA 1P33A 2RKBA 3CW9A 4C14A 1TJYA 3JYLA 4KFTA 2HCRA 4MB6A 3PXGA 1E2BA 2A67A 3VSCA 2FWBA 5IM5A 3NYQA 5FTKA 1U0OC 3WNZA 2XE8A 1LI7A 1WSDA 3VPDA 4YRMA 3VHRA 2V7WA 1JHYA 1QVZA 4I4NA 4P3OA 3EULA 2O0KA 1S0UA 4AWAA 4ZODA 3NCHA 4CR6A 5FX2A 4OHYA 3EOBI 1W581 4IQ4A 5JJCA 2FUG1 3ESXA 3IVGA 2WW8A 5KWSA 2WAXA 1TLLA 3TTXA 5DSTA 4FUTA 4ZMSA 2VG8A 3BWEA 5DI9A 2JA1A 1P4GA 1MQSA 1NUTA 1P5FA 3IEXA 3ZGZA 4FCTA 3W1VA 1O97C 2CXXA 2C2BA 2OK7A 3IP8A 4JU9A 5JNUA 5K45A 1DIGA 1EUDB 1SUPA 2HBYA 3CLUD 4PYNA 2IOFA 4V3BA 5BT9A 3RC7A 3V9AA 4BGEA 4BKUA 2Q0XA 4LY6A 2ONKA 3CISA 3DEJA 4QU0A 2OVFA 5DM4A 1CUXA 3VPHA 3F74A 3WP1B 5C3UA 1ZVVA 3GCZA 5CR9A 1KI9A 3VMMA 4IGIA 4YTEA 2J9RA 3DBHA 2QUJA 4R8MA 4JL8A 3KKOA 4QPNA 1Z88A 2IL1A 3ZD8A 3PJDA 4AO7A 1I4TD 1T0BA 4KJZA 3PFBA 2PZAA 4FYWA 4AD8A 1S2DA 2I6GA 2J3HA 1ZJ5A 1NHWA 3MWGA 3FUCA 4O0LA 3K6KA 4Y2GA 5FUBA 2DFLA 4TS4A 1L4KA 1T1JA 3FM9A 4KXFB 1RE0A 3NVAA 3M3DA 3WGTA 1ZI6A 1JZSA 2FQYA 3HL4A 4LMBA 3MGCA 5ALZA 5HUQA 4RNDB 5D1NA 5BWLA 2X2EA 1JDZA 4KX3A 4HDMB 2NXWA 4QELA 1JMKC 5IJ9B 1EFPA 2ZROA 3KYCB 3SHOA 2J0QA 4TOIA 2ABWA 2H2WA 1GAXA 3O9VA 4W7HA 4Y1EA 4OUDA 4EGCB 1RWMA 3TG2A 2XKKA 2RHTA 4C0SA 3UXMA 3GGPA 3NT5A 3IBSA 3JRNA 1P1RA 4RCYA 1OH8A 3RYHB 5DYIA 2FYTA 3DB2A 2H0RA 4QTZA 4WHMA 4Z1MA 4OXIA 2W37A 1Y80A 5DSZA 1M33A 4D0NA 4JC5A 2WFLA 2O2EA 1X7HA 2WJJA 5GGXA 4KAXA 4LI3X 1KEEA 2GJSA 1YQWA 5CLGA 3Q5GA 4E2WA 1A82A 1SUBA 3W0LB 2NIPA 4DNFA 5K3FB 3EXHB 2YOHA 3OFVA 3Q3EA 4Q18A 1R7RA 1QTQA 3PUKA 4HDKB 1E2NA 3DB1A 4Q34A 3NBKA 3VR4H 4YFYA 5CPFA 3A37A 3DHEA 1GZHB 2JJ1D 3T5MA 4E5NA 1LVGA 2AXNA 1JG6A 5BNFA 1UXOA 4D6YA 3ZDEA 4OGGA 4E46A 2X15A 2VDQB 2BCEA 3EIHA 1EDDA 3RE1A 1I30A 3EVAA 2C4NA 4A7PA 4YP1A 3SNKA 5AKJA 4XLTA 4KIWA 3T8YA 1EFCA 5LMZA 4HPJB 1N8TA 2VPPA 1S3GA 2O8NA 2JK1A 3QOWA 2QORA 1SKQA 3LXRA 1TA4A 4H27A 2Q41A 5D87A 3G2LA 1GPJA 2GERA 1K89A 4I8IA 5KYTA 1OLSA 3M9LA 3IKLA 1XMSA 3ADKA 4EMSA 4M87A 3IBCA 2GBCA 1EX1A 4YV1A 5M7EA 3PP8A 4ESEA 2AZXA 1ZH2A 2AW3A 4UPEA 2D1FA 4JJGA 5DLQC 1U7TA 3LCCA 1XCGB 4HAWA 3VVBA 4AK9A 4JP5A 2CNOA 2X1VA 1VL2A 4QJ4A 1XN1A 4JMPA 3VTFA 3CUWA 2DLDA 3A14A 1H9BA 1IUKA 2Q6LA 3KQNA 1FW8A 1GN8A 1NPTO 3R6WA 2GNAA 1G291 1PT5A 1SK8A 3HA7A 4DDHA 5JFTA 1E9BA 1ONPA 2J9FB 2V7QA 5IAEA 5KX5B 2BV3A 1ZIDA 2IYAA 2PR2A 2PANA 1QGUB 2OV3A 1TIPA 4BVAA 2Q5HA 3BVPA 2FOLA 2V96A 3KB6A 5ALMA 5HCIA 4P5PA 3EQZA 4FHFA 4PTLA 2C4VA 3CVVA 2W2OA 1YS4A 2JHAA 3FVWA 4FW9A 5K8VA 3H13A 1YDEA 4ZT3A 5KINB 1S5PA 3U19A 3S5UA 4ER7A 1KY5A 1ODFA 1NLUA 2OAQ1 1T6YA 4J43A 4QO7A 5HM8A 1YI1A 5E9QA 4R9UC 4Y6RA 1EDEA 1UDXA 4IG9A 3FJOA 4B71A 4C7MA 1IN8A 1PS0A 1H2ZA 3TTWA 3DAGA 4DSOA 4F1KA 1YD7A 1E18A 2PJDA 2PS0A 3GELA 4BP3A 4RF2A 3L2OB 1FS4A 1VLHA 2IPXA 4RQAA 4LZAA 4PLGA 3F8WA 1TQHA 4RTPA 3J7TA 2I6QA 1YTLA 3OETA 3VYRB 5BRAA 3IAHA 4LJYA 4JVOA 3R6TA 1ZY2A 1DCTA 3K0CA 4J4HA 1GTMA 5A62A 2M32A 1ZGGA 4B3BA 2QZPA 2NZWA 2VUHB 1N5DA 3MS4A 2JIZA 1BXRB 1U81A 2AVDA 3U7IA 4UD2A 1GSOA 4L75A 5LZ2A 5ECWA 1M8KA 4AQDA 4HQKA 4JMLA 3RWMB 5FJIA 1Z26A 4LC1A 5A6VA 1IY0A 2W2PA 1P8JA 1RS0A 4LC9A 1I2AA 1XRSB 3Q7QA 1CUYA 4MCIA 1LK0A 4MUJA 3UWDA 4I5FA 5EEHA 1D04A 2ZIXA 1NYRA 3KHKA 4HATA 3P2EA 1EFHA 2ZYGA 4A15A 2E48A 2HR1A 4D92A 1J8DA 3DR3A 5CXUA 2C61A 3PQ3A 1V1MA 3MBOA 2LE0A 2NU7A 4GPIB 1AZTA 4IIJB 4LJ8A 4ZVMA 1XJ5A 2UXCB 3QPDA 2Q6TA 3U44A 5EI5A 1DKQA 2X0KA 4H1TA 3AUJB 5UKDA 3W79A 4LHSA 1NQTA 3MTDA 5DGTA 3WIBA 5KCZA 3H5NA 1NJ8A 5EXEA 4CL0A 5TS2A 4J0IA 4QYIA 3N53A 2P11A 4CG2A 3PKZA 1U2EA 2V3CC 4IF4A 1XU7A 2WQZA 3AP2A 5TMPA 2F43A 4Z4IA 1MV8A 5KNBD 4DRXA 3GFVA 4ANFA 2QVYX 2G9ZA 1Q50A 5KKNB 2IFTA 3JW8A 1V9LA 3ZXIA 4YX9A 1UBKS 3PUZA 2I3AA 1ISIA 4O3FA 1QQBA 2HDNB 4J0CA 2W70A 4AT1A 4LRUA 1KAQA 2AN1A 3V1TC 1RTTA 4YAJA 3VNRA 4LBWA 1EFPB 3LHIA 4IGKA 3ROXA 3OCWA 4AMVA 2VJCA 1QR2A 5JXJA 2ZI5A 1FTYA 4J2HA 3W2EA 3N5CA 1Q19A 2D1YA 1TVCA 2G1KA 2RKWA 1FEZA 3PV0A 2F1JA 3QBVA 4NZOA 4R54A 3RIXA 3T3EA 4CV2A 3OEEA 3NX4A 4EW3A 1FX0A 2DWOA 1Z38A 2R6FA 4LYAA 3NJRA 1DU4A 4F3CA 3ZHXA 3PU6A 2ODQA 3RJZA 1L5QA 3NBQA 1JIIA 1DWOA 4Z0PA 2G1JA 3UOWA 3E2MA 1QQAA 3NWEA 2P4UA 1Z9BA 2FZKA 2G67A 4J07A 2ACWA 3BMCB 4PQGA 1L5SA 5FBZA 3IIEA 3LZ6A 4FT4A 3WV4A 5HIIA 3HCOA 1BE1A 2ZRHA 3DOHA 3ZDFA 2PU7A 4WLFA 1Y3HA 3ZLJA 2O50A 1JEQB 3GFFA 5J2TA 1O94C 2Z98A 5HQJA 3COSA 3QA3E 1HT1E 4OQEA 5FBQB 2BRUA 1ISGA 1YB4A 4DR7B 1WNFA 2P67A 1LW6E 2GM3A 1Y5LA 1X94A 4U8GA 5CU7A 3UWPA 1Z56C 2WYOA 2OAP1 3IIIA 1K5HA 1T3GA 3O8OA 4PN3A 5JQGF 4GPTA 3IDSA 1Z8HA 2BWJA 3K09A 4INJA 3KT8A 3DZDA 1DQZA 4BTLA 1CETA 1SKYE 1VKRA 2HRQA 2M6SA 2TYSB 3VHQA 3ADCA 3HB9A 4IYRA 1EJ6A 1YOVA 3HKCB 1FXUA 3JQCA 4E32A 3NOQA 1L7QA 1A98A 1D1TA 2B92A 4GDMA 4MW5A 2ZSBA 2FWNA 1VYTA 2QVGA 2VVTA 4YAWA 3WP0A 2DECA 1MVLA 2PKRA 5BSFA 5LLTA 2HWUA 4MPPA 3DBIA 1BJRE 4NK4A 2YQ4A 4UHFA 3TLKA 3H7AA 3QUSA 2NVUB 4HNVA 1QCCA 1R12A 1ZEMA 2Q1UA 2QX6A 3PWZA 3E22A 4FMDB 1QHSA 2BTOA 3GJ8A 2ZPAA 3IXMA 1Y4UA 4MLPA 5KSZA 5HFNA 4NONA 5BURA 1NP6A 2Q1YA 4TSFD 1T2NA 2GZSA 3T52A 2BT4A 3ZGOA 1ZH4A 3U7FB 1DTWA 1UJMA 2X3UA 1DKUA 2X1MA 4W7IA 1ESCA 5DW3A 3S1AB 4X66B 1KZGB 1RC0A 3RJMA 4IMIB 1VZ3A 3TEFA 3EUWA 4A2WA 4U7DA 2W8BB 3WGMA 2A9OA 4JA2A 1VE7A 3M9XA 5L7TA 4WCFB 3GRZA 3Q0IA 2QZ9A 3R4VA 3T4UA 3CBQA 1YHZA 3WKBA 5BSHA 1FU8A 2IC5A 2QX9A 5AIBA 3THWB 3MM4A 1G5HA 2AG6A 4Z99A 1CHNA 5H9WA 2P4QA 4BQPA 1S2LA 1VJ1A 2CZCA 3MTGA 3RRJA 5I5EA 1ZN8A 5I7OA 3UPUA 3FGPA 4EPYA 2HMTA 5FORA 3MTBA 1MVOA 4FQ8A 4TQ9A 3WWCA 4WCFC 4ZYUA 3G2HA 5JROA 1EUCB 2G5CA 1CR6A 4PIPA 5IK2A 5L40A 4BP1A 1DJPA 2W11A 4G5HA 4RELA 1XZHA 4L74A 5EP2A 1OFTA 5I9MA 4Z1OA 4F3KA 1YC2A 4D9JA 3RASA 2DJIA 3B89A 3C7KA 3ZJ4A 5DGCA 3OPNA 4DBLE 3JQQA 4EZEA 4YCMA 2G7ZA 3QU4A 3TVTA 3D5TA 4RSGA 3DCYA 3I1IA 3W5BA 1XXHA 3L6EA 4GZ3A 4MIKA 4CODB 5EJ4A 4OP3A 5SYAA 4MPJA 3ZWKA 3AJRA 3GUUA 1B42A 1MQ8B 3D7NA 3RROA 3DLBA 4M6WB 4YV0A 4OB6A 1RT9A 2PH7A 4FC7A 1U7OA 4NOJA 2RD2A 2J9GA 2VUIB 2IEDA 2R0QC 2NO9A 3WMXA 3U4QA 2BMWA 5J43A 1M1YB 5CB8A 4KMSA 2VHQA 2NO7A 2O8DB 3LLUA 4IXTA 3WDSA 3BSSA 4ZRDA 4UVIA 2H3EA 3C5HA 1XRPA 1DAFA 1GG2A 1M5UA 2O4CA 3DTVA 4HFJA 2VHEA 4MRMB 4Q6WA 1RI3A 1XD2A 4GXTA 3NHMA 1W29A 1RWKA 4NZPA 3LC1O 2O8VA 2Y8EA 2D59A 3ICVA 1NR1A 2HA6A 3A27A 2O3UA 4K1XA 1G20B 3DM5A 4RLHA 4NX2A 4TSRA 4TVBA 4O2BF 2C5EA 1E3LA 4J0HA 1CUFA 4QC2A 2C99A 1GPWB 1D1SA 2GCEA 3FFWA 1HDIA 1UPTA 1E2DA 2N42A 2OHFA 4CWAA 2G7MC 3WK8A 3WAJA 2O19A 1X9GA 3WICA 1Z8FA 2WUFA 4IIXA 1EB8A 1FBNA 1HG1A 4BZWA 2EFGA 2FOIA 3BSFA 4FOPA 4GHWA 2FZ4A 2ZIFA 4IH9A 2AA3A 4R1PA 3RT7A 2VIIA 3ON5A 1RE1A 3WLNA 1FL9A 4LW8A 1Q0SA 1L7AA 2REOA 1YE8A 1KU6A 1LRJA 2ZUSA 3MJEA 4OHPA 4DTIA 2CDCA 2QXYA 5IKMA 1E1MA 4MWDA 1E63A 1PR6A 2FX2A 1ZD9A 1T8WA 2ZYTX 2YY5A 3IAS6 5G1NA 1YA8A 3RVPA 4DA0A 3FFAA 4NENA 5LXTB 2XTZA 2A35A 3W1EA 2QUZA 4KOEC 1JH9A 5CYPA 1H6DA 3BT7A 3PWTA 1Z7BA 5JHHB 2BD0A 3IEPA 5NULA 4D4KA 3TQFA 3ZU4A 2FG7C 4L51A 2A57A 4WOJA 2YCBA 2ZRAA 1U8TA 2XNJA 3Q72A 4L5JA 3N6VA 4BO8A 1UMCA 4NAVA 3M5WA 3PC8A 3X44A 2OAEA 4HH3C 5K4HA 2FMIA 3IMGA 4YMGA 2Z1DA 3BL6A 5KPJA 2J0UB 2HYDA 1RLJA 3A26A 1MOQA 3EQ7A 3NHSA 4KI0A 4CR8A 3DXZA 3I5YA 3GJRA 3ZK9A 1TL7C 1J99A 1YS1X 2D1RA 4JYPA 4DR6B 4JB0A 1ISPA 1FDIA 3D02A 3QP9A 4I36A 1SHLA 3HA5A 3NGLA 1S2GA 4YO7A 2P8JA 2ILVA 2YW9A 2X8BA 4NZNA 3BAFA 3BXPA 1I7SB 3G17A 1JDPA 3TF5A 1PL6A 3VGPA 1TVMA 2DHRA 3MBIA 5LQAA 1DBWA 4Y0VA 3QFTA 1JDJA 4O2BA 1C30B 3SX2A 3DDCA 1FPQA 1UAAA 3LXMA 5CD1A 3BICA 2GCOB 1L7PA 1DAHA 2FPRA 4CCWA 2IXGA 1E2EA 1EZZA 4ZVOA 4CIWA 1BH2A 3KAPA 2WV7A 2QRNA 4NCIA 3ISTA 3KNZA 1MO4A 2WD9A 4GYYA 5BMVF 1M75A 1BHO1 5ALNA 5DNEA 3ROZA 1CUGA 2FB9A 2Q0SA 3OE7D 3NNSA 1TAQA 3QHQA 1H3FA 3KOYA 1FDUA 2WSSD 4V1CA 4QOSA 2Y66A 3ZCVA 4X00A 3LY9A 1I94B 1D2RA 3USCS 4HLNA 4MRPA 5ALTA 4EATA 1F0NA 4C6RA 1EX6A 3CX7A 4PCUA 1PS9A 1TU4A 3EXG2 4IW3B 1PFWA 2R5NA 4CL2A 1D1QA 3E7WA 1ZP6A 1HV8A 3VM6A 1MC8A 2EU8A 2IEYA 4N49A 5CB0A 2WICA 1RSZA 3LA6A 3DE2X 3BDIA 3WGYA 4RVHA 3CKLA 2KX7A 4D42A 5H3CA 5DN9A 1M83A 2ZJ8A 2VYCA 4G0ZA 4MMXB 4QLBA 2P2NA 3GOQA 1YVPA 2C5HA 1AXEA 2FEAA 3M82A 2H2AA 3E3LA 4ICIA 4PGHA 3STUA 3EASA 3RFXA 3DWGA 2OGTA 1KFJB 4W6QA 4A2PA 1JW9B 2MT9A 4QHTA 3DOCA 3PITA 4R68A 5AXAA 5T64A 4EW6A 4KPGA 4II3A 4YMWA 5MFPA 4J1TA 2UZ1A 3IUNA 4FGWA 1EDZA 1KP2A 5KNBA 5GJVC 4DMFA 2PS3A 1P39A 4GICA 2OYSA 2I7VA 5DK4A 2YMLA 1WSWA 4IV8A 4MUEA 2GM4A 4UAGA 1MENA 5F9FA 1LQ2A 1THMA 4P4TA 2QNIA 3ONFA 2AC7A 4DOMA 1IHDA 1OFUA 4RL6A 3V8NA 4D82A 4AJPA 1XV5A 5BRJA 4ZT4A 3S7ZA 4FW8A 4P3XA 3WADA 5I8PA 1FTGA 5E0KB 4MHTA 5A02A 1FDWA 4R6XA 4IDNA 4LWQA 1VDZA 1OXXK 2FP4B 1NNI1 1TK9A 2QMEA 2F48A 3FNGA 2CXTA 2BFDA 1CUWA 1FBTA 2F59A 2JZNA 2NYRA 2OV8A 2WF7A 4XLZA 1KMIY 5FOSA 3WNBA 1SUEA 3S4YA 4C4TA 3G0CA 4X5OA 2B8JA 4QKQA 1G64A 2H5IA 2I76A 1ESMA 3P27A 4DSTA 3UV7A 1U7PA 4MQMA 3THOA 4CF4A 3K1AB 2NQTA 1ZSYA 2HU8A 2XZDA 3EYWA 3F6PA 5H70A 5HF6A 4RLSA 2G6TA 3PQDA 5AUOB 5JH7A 1ISSA 1SU4A 4AWXA 3UWSA 2VRCD 2NSYA 3PD7A 2SECE 5SZKB 1AUQA 3LCMA 4BLUA 1GAWA 1OLXA 2XQFA 3RS0A 3HNRA 3O5AA 5D85A 4BLVA 1DAKA 1UC4B 4N8DA 2OCLA 2D13A 1U9JA 3FLBA 3P2KA 3QEAZ 2N1BA 3R5KA 4ABTA 2WG0A 3M6UA 2YXEA 3K09C 3LYLA 4L15A 4JZYA 2WNHA 4LFCB 1UM8A 2BBTA 3VDQA 2HA4A 3K70D 2ISCA 3SYNA 1B76A 1PRYA 4X8HA 3WWZA 3RCBA 5IJZA 4GPEA 3RBVA 2YFQA 2ZYWX 3DOOA 3S2YA 4ZCRA 2CD9A 4QBKA 3E7FA 4HC4A 4FX2A 3N3BC 2JIQA 1GTVA 1QPBA 4IDHA 4IMJB 3STYA 2LP4Y 4X95A 5M34A 1G6HA 2QZ4A 4FIZA 4NDNE 4LHYA 4DUGD 3C7DB 4MJ7A 3C24A 3ZDCA 4JJ8A 1CKEA 1SB9A 5B6IA 1EK6A 2I4TA 1KO8A 1WLSA 3KPYA 1MIOA 4BZQA 2YHBA 3E03A 1WB6A 3VI4B 2ZR7A 1JR3D 4RJLA 1SIBE 3C39A 3IE1A 1F8XA 3G2KA 2ZB4A 4J76A 2YUTA 4B6FA 4I1UA 1SCBA 1VI2A 2PJRA 1K7YA 1DTEA 1XQYA 3AY6A 3EF0A 1PYDA 2JBAA 5TX7A 2G6BA 3PJEA 3S55A 1I4DD 2RONA 2PSEA 5C35A 3ESCA 4N01A 5D00A 1EEXB 2C00A 1GTL1 4ONEA 3WKEA 3DEZA 4HMPA 3T12A 3K5HA 3ISVA 3T7JA 4EBFA 1K63A 5IT9A 5MHTA 3KQVA 2AZTA 4BNJA 4PYOA 1P9OA 3MTQA 1JU9A 2AEEA 2J0SA 4OLBA 1WMAA 3LS2A 4IWNA 5FL7A 4F5YA 2ZULA 2B2CA 2Q50A 1N25A 4LF6B 4JLVA 1AK2A 3G89A 4DV0B 2BLLA 4UMFA 3R0QA 5JTTA 4MXDA 2FGJA 4DHEA 1C80A 3EG5A 2XVYA 2QE7D 5FEMA 1DFGA 1I0ZA 2VOEA 3N70A 3WHKA 4W5RA 1BNCA 1L1EA 4YP9A 2IUEA 2GK7A 1I10A 4QTXA 4D9NA 4HAOA 2V0GA 1GG9A 2GESA 2A9FA 1I7QB 1R4MB 2DCUA 1ZCFA 2H9YA 3DDNA 3HYTA 1GZ4A 4QEZA 4UAUA 5FF9A 1KNXA 1KZ9A 2GCGA 3IOYA 3UC9A 3ESAA 4H7JA 4ND3A 3NC0C 4C22A 1NRIA 1RI5A 2QBYB 1S2NA 1YB1A 2Z95A 2VQ6A 3GLRA 4ND7A 3RUCA 2RG7A 1JE0A 2IE0A 1YRQA 1UQRA 4M21A 2W2NA 2FZ5A 5DCLA 2QRHA 2RMKA 3ROGA 3MYRA 4A27A 4JI6B 2EC5A 1ONSA 4PRLA 1OZ0A 4PANA 3RARA 3GGOA 4U6NA 1F4PA 1KEKA 2DPHA 1LI4A 1WEKA 4RPKA 4BAGA 1B6RA 3TXAA 2G80A 1KZYC 4LXIA 4MVXA 2W4IA 2MTBA 2QT1A 3ZV4A 1PDOA 4P84A 3S1LA 4DMLA 5J58A 4BGDA 3Q8KA 1N5LA 1QFSA 5FWXA 4ACBA 3HCWA 4R1NA 1M1NA 2VHVA 2QG9A 3OZGA 4W1PA 5K5EA 5DGXA 2QDXA 1M54A 1JZTA 1O94A 2AWOA 4TGLA 3WI7A 3S8EA 3ZK7A 1SXPA 2V54A 4LNHA 3T35A 3MUNA 3TLJA 1XEXB 1AKQA 3UB4A 10MHA 3W34A 3UJ7A 1M72A 1QO0D 2KQUA 4UJ5A 3TX6A 2H1SA 3VTZA 1HR0B 3RTDA 1QO0A 4IO0A 4Q39A 4YACA 2WVHA 1HYEA 2P2ZA 1SIWA 1HNNA 2A5GA 2ZJ5A 4FGZA 4HWKA 3HKEB 3GRPA 2QL5A 4OREX 4JYBA 4QA9A 2PSSA 4FTWA 5GZ6A 4AF7A 1H2BA 4GKKB 1ST3A 3GB9A 3K2IA 4UNIA 5CLLA 1U3TA 4EUKA 1RMTA 2ECFA 2HZ7A 4HDNB 4NU6A 1HM5A 2YTZA 4F38A 2PLWA 3SLGA 2GVDC 2HK7A 2ZANA 4L72A 3Q8LA 4HH1A 5JZBA 4LDJA 4WESA 4EEKA 1NG1A 5KYYA 3MOSA 3WK4A 2N0SA 2I2WA 1Z5UA 1FYFA 2I6SA 2XUOA 2W6CX 3TLAA 1B74A 4BDTA 4EPXA 5I3ZA 3PTAA 2YRXA 5EXPA 2FQQA 3PGXA 1EWKA 4F6CA 2F8SA 3K8QA 8ADHA 2RGCA 4UTPA 2G71A 2V7TA 2X7XA 2DFKB 3FPLA 3N2YA 2KE5A 3R9WA 3FUTA 3KCQA 3LVBA 4HH0A 1Z34A 2E9SA 1EGHA 2ZU6A 2PWPA 1FSFA 5E9JA 3ZWXA 1T0PA 3CF6R 3F9IA 3PQ2A 1JI3A 1GKYA 3HNOA 5F78A 3H9UA 2B8TA 3KKPA 2X8LA 2D1QA 5JSUA 5AJTA 2YWRA 2Q1WA 3OIYA 1FE8A 3IILA 4LQCA 4I9HA 5AD1A 3OKPA 3OQMA 5DTQA 2Q3HA 4QOJA 1RCTE 4B76A 1ECBA 5A5EA 4MGKR 3MAGA 5LFAA 1SBZA 2F4NA 2PCJA 3GT3A 1SUAA 2DTEA 2VQ3A 4L02A 2WM3A 4UMVA 1BXZA 2DQYA 4YCSA 1GZ5A 1VP3A 3LECA 5JNLA 1M6VB 3T15A 2EBUA 5FNVA 2VPIA 4U7WA 3U3RA 1P44A 4EO9A 4FS8A 4TLAA 3VBEA 1LSSA 4QREA 3VU9A 3V00A 5HX7A 2ON6A 2BY4A 1LI5A 1Z37A 3K1JA 2CXNA 3THWA 1C8VB 3EVFA 3FBGA 1UR5A 1V5IA 4OVKA 2R62A 5LXTF 5TQ0B 4QDTA 4EY7A 1SXHA 3NNDA 3T6KA 2ZJ6A 1TQ2A 1Y82A 2MSWA 4DG8A 4RDHA 2XUZA 2B6HA 3OIUA 2QX8A 2DKFA 3OCZA 4O4JA 3DEKA 5ICEA 1R5OA 1U11A 4IGEA 5K1ZA 4RHCA 1BROA 2DFPA 3WQSB 4Z9AA 3E27A 2NUAA 3K0CC 4UCFA 3D3EA 1O1YA 2VJDA 3WQBA 3N1UA 3NDJA 1E79D 1QRSA 4RKYA 3G5MA 1VYHA 5A4DA 3CNHA 3DGEC 1CNEA 4WCVA 3W2GA 2BFPA 3ZGLA 3R3XA 3EA4A 4BX3A 1XNGA 2UVPB 3JQEA 1JXMA 2HADA 4IXDA 2CLFB 4JB3A 4RMNA 4JWTA 1P4JA 4J3JA 4XJSA 5FOVA 2Z08A 5EWMA 1U3VA 4DT1A 3A36A 3CH5A 4KHZA 3MNFA 1Z4PX 3LC2O 3T4XA 1PV4A 2C1ZA 4CTKA 5F7ZA 3DPUA 3LGSA 4IEFB 5JWOA 1PR0A 2ZRJA 4ER0A 2A8YA 4ERXA 4QPCA 4RZUA 1GA1A 5TEWA 1WOMA 1RM4A 3JQ9A 2B1JA 4R8KA 1QE0A 3BXEA 1UMBA 3OI7A 4Q15A 1U5BB 3E61A 3NYWA 3IT0A 4ND2A 4NTZA 2I87A 1JBQA 4IX9A 5HF8A 3HUUA 4ZOCA 4AG6A 2R85A 3EH2A 4WK2B 3BPSA 3QEMB 5IDQA 1RC8A 4BNVA 1E62A 2PKWA 3CYFA 4GFDA 3FDZA 4MR9B 2VAXA 4HI0E 2YS7A 4OQ4A 2BM0A 1JEQA 3DBOB 3SJ7A 3F96A 3QMPA 3VKGA 4IDPA 3VJMA 5LP6C 1ORVA 5IDVA 4Y1FA 1ZOPA 3O03A 3PXCX 1CLEA 2XKBA 4LFBB 3V2IA 5FTMA 3UJNA 1XQ1A 1G7SA 3AGQA 3D6TB 2BMAA 3KYJB 4YECA 3NM4A 4R05A 2HBZA 2WSYB 5KWEA 2A9PA 3EDRA 4HB2A 5CNJA 3W8FA 4EOGA 5CA0B 4UTXA 5FPTA 5KHLB 3WK7A 1F0YA 2CXRA 4UTOA 2DOKA 3SJBA 3B5JA 3AESB 3AJAA 4G4GA 5FQOA 1W4AA 4BO7A 5IJ9A 2CBGA 4ARCA 2QT0A 2R1TA 3SDSA 3K4QA 4YPFA 3K9QO 2Y1DA 3PHHA 4UARA 3UZUA 4F3RA 1KPGA 2VP5A 3FVTA 4M1EA 4MDYA 1EWRA 3BQMB 3N2KA 3IJEB 5WRFA 4E07A 3ZBQA 5K9ZA 1EVJA 1GLVA 2BGJA 2R8PA 1GCAA 2X9LA 1RLMA 3QV1A 4OA8A 5JWHA 2EHJA 1SCUB 2WJ3A 3OX3A 4I5IA 3IOMA 3SSNA 4AS2A 4MW0A 2Q21A 4WKOA 4EW2A 2ZZNA 2DHCA 4FMBB 2JLYA 3PX3A 4INPA 1K6EA 1PJ4A 2A0WA 3SBOA 3TOXA 1Y6JA 1EIWA 3E5NA 3GMSA 2VJBA 4WUVA 4HGRA 2Y3IA 4M9CA 4DCVA 1Q3HA 3G5LA 1HEYA 1C3EA 3I6BA 2Y1XA 5BNIA 3OIWA 2V6FA 2JFUA 1OZGA 3QY0A 2XCUA 5I45A 3KZNA 3V46A 3P1JA 3RVNA 1IJKA 2OXFA 1JVSA 2R4TA 2YMQA 5FOUA 3ZWDA 2E37A 3G68A 4YQYA 1MJGM 1ZI9A 5C1BA 4CLOA 2D7DA 4P0PB 1TMKA 1XAGA 2GAAA 2FW6A 2OD7A 4M0EA 3AH8A 4RD4A 2VCEA 1KJ9A 2DKOA 3KKNA 1O2DA 3F7OA 5GONF 5FKJA 1IXZA 3SM3A 2EZ9A 2IU3A 1J0CA 2WLSA 4PHHA 4QGFA 4X1YB 3UTCA 1Q0TA 4HT3B 5GM1A 3P9KA 1XKXA 4GPZA 4MQFB 1GDHA 1ZINA 4PYRA 4FGLA 1ZN7A 4DXDA 4EY8A 3TCXB 1K5GA 1H2HA 1Y9JA 3MHPA 4YCNA 1I9GA 4QYWA 2ORYA 3PT9A 1WCIB 4MB0A 1JSXA 3K05A 5L9AA 4PG6A 1AX9A 2PCLA 4FILA 5JALA 1BEEA 3Q9LA 1TUGA 3DMPA 3T1NA 3HKDA 4BLQA 5EGSA 4CEIA 2Q3CA 1J8QA 2WKPA 4JX9A 4UHBA 4ZAVA 4AJHA 1RXVA 1JHPA 3CIFA 3N3AC 4IIGA 1ENOA 2B37A 1T25A 3OQ1A 1ZMXA 1P9RA 4C4SA 3RANA 2PKYX 4FKBA 2LRHA 4GECA 4D9GA 3IBFA 2B69A 1DV1A 3PDWA 4GR4A 4BFVA 4YT4A 3I2GA 5CM8B 1H8HA 1E7QA 3O2SB 4B74A 5CHEA 3TRFA 2RHHA 3U1BA 1M34E 1IG3A 2JDIA 4HG2A 1GCOA 2I71A 2IEBA 2GEFA 5LQDA 3D59A 2LUOA 3UNXA 3TGWA 1S2IA 2WKRA 3IJRA 2C2WA 5B6JA 4FUQA 4WECA 4Q82A 2FRDA 1DP4A 4L85A 3SXUB 1II8A 4U3JA 3U4AA 1YJAA 4KU4A 2DEUA 2GSDA 1U6KA 2GN0A 3AHDA 4TL6A 1JYSA 3U3XA 1T9GR 3ND5A 5EMHA 3KSUA 1GSAA 1N2JA 1UZNA 2CL0X 2QW0X 3FMVA 4BMDA 3REFA 2BSQA 3G7SA 3H1FA 2MMCA 3OCUA 5I7FA 1VKJA 2V3VA 3ELBA 2W0MA 1G9XA 3IQXA 5GWXA 2HLDD 2GD1O 4RA9A 1PT9A 1S9DA 3L4SO 3VFDA 4F06A 5CB4A 1WLYA 3IH5A 5JY6A 2ANBA 4B7UA 4FR5A 2LCQA 4UUBA 2V74B 2OSBA 4J9VA 1AZSC 5B4VA 4Z7QB 4QDXA 4LRWA 2BMFA 2RHDA 4CYMA 1EQUA 3ZV5A 1PJCA 4IDFA 4LXHA 3VKWA 1XIVA 4J6FA 4O2AF 3BD7A 3DZIA 4L9SA 5EWJA 1J22A 2CDNA 3L0DA 1QAMA 2HRBA 1E1CB 4TV8B 4BB6A 1XAJA 1VCIA 1NPYA 3QUAA 2R96A 2VLBA 1AZLA 4FGKA 5EKTA 4BWYA 5IULC 1LDNA 2BRUC 2CMKA 4M53A 1J5EB 1DWUA 1X39A 3F9CA 2X5OA 4LCBA 3SYMA 4RS3A 3B9BA 4RF5A 3WVNA 2HSZA 2Y6VA 3DE3X 3B7WA 2B83A 5TEVA 2DFVA 1YULA 1Y3IA 5EJMA 3D81A 3I23A 3LHDA 3BL8A 2HWKA 4E5KA 4PAWA 5JVDB 4QICA 4EYSA 4DJTA 2ZR9A 3JAWA 3LQKA 4FC6A 5AKXA 1ID8A 3W5IA 2A5JA 4UEQA 2RI0A 4IEEA 3ORRA 5ESXA 2MSDB 3BXFA 4OJNA 1UJ5A 3JVEA 4AKGA 2OXRA 1NXQA 3HVJA 4DJEC 2QTLA 1W88A 4HB4A 3OEWA 3NQ41 5G4KB 2R87A 5DIFA 3RC3A 1G3UA 1PK7A 4NPAA 3ZCRA 8OHMA 4QE3A 3DF9A 2Q7DA 3UENA 4KXMA 2DX7A 3A9UA 3PNYA 4HYEA 1ZIOA 1Q2UA 2DUJA 4MR9A 1F7UA 1S3IA 4OFXA 5FFMA 1V7CA 3S2IA 3TTVA 5CG1A 3TGLA 2VAMA 4L4SA 4N9WA 3TE6A 4F9TA 1P0MA 5C5CA 3RFVA 4RV9A 4QJ5A 1SOUA 3BGVA 3HM2A 3OEYA