1XQSC

Crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Regulation of Hsp70 Function by HspBP1; Structural Analysis Reveals an Alternate Mechanism for Hsp70 Nucleotide Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HSPBP1 protein
total genus 52
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1xqsC01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1xqsC02
1JCEA 4H0XB 3GDQA 5AQFA 4B9QA 4WQ4C 5BRFA 3A5LC 2ZGYA 3AARA 5BN8A 5TKYA 2W40A 1GLJO 3A5MC 3VEZA 4BC2A 2GUPA 3IUCA 4H5NA 4O5FA 2QM1A 4O8KA 4BRDA 1H1VA 3CJ1A 2GEMA 3CJAA 5BR9A 2A41A 4YDUC 1HJOA 3O1BA 2FF3B 4JHDB 1TUYA 4M7YA 4FWOA 5AQZA 1T44A 4M7XA 3VF6A 3VEYA 1HKCA 3CHWA 4B1YB 1YAGA 4B1XB 2V7YA 2HOEA 2AP1A 1OKJA 4MLEA 5FPMA 4FWQA 3BEXA 2YI1A 3QBWA 1X9JA 4XH1A 3FZKA 2E2OA 4A2AA 2ITMA 4B1ZA 2E1ZA 4ISFA 3LL3A 4BRCA 2CGLA 1NGDA 4CZJA 1NGAA 3O4WA 2P9UA 1T6CA 3FE1A 5AQJA 3SJHA 4RWTA 2Q31A 4PKGA 1XQSC 3A0IX 5E26A 4LC9B 5AQNA 3LDOA 2ASOA 4MLHA 4EHTA 5AQHA 2E2QA 3UKRA 5ADXA 2P9IB 5FPNA 1KAZA 5AQIA 1ATRA 3U9DA 1Y64A 3VERA 3CJBA 2NLXA 5BRDA 1MWMA 3SMPA 3D2FB 1WOQA 4H0TB 4WQ4A 3F9MA 2DPNA 4F9OA 1NLVA 1QHAA 1NGGA 3KVGA 1BDGA 3CQXA 1K8KA 1LCUA 2Q36A 1DGKN 4RCHA 4BRHA 4CBUA 1C0GA 2Q1NA 3DXKB 5EX5A 4H0YB 2IVNA 1YVNA 1V4TA 2V7ZA 4PKHA 2YJEA 5BPLA 2ZF5O 2FSNA 4FWPA 3D2FA 4ISEA 3QMLA 3DJCA 3DWLA 3VGMA 3KZBA 4FWSA 3ENOA 2J4RA 5E84A 3I8BA 4BQZA 3CIPA 4B1WB 5LJVA 1Z6RA 4H0PA 3ZX2A 1HX1A 3BF1A 2QWQA 4E1JA 4KBOA 3C0BA 2QWNA 2GWJA 3VESA 5KPTA 3FGUA 3UKRB 5KQDA 2ASPA 2A3ZA 5KQ8A 3TPQA 4CBXA 3FZLA 1NGBA 3R6MA 4FSVA 4BROA 4IJAA 1WUAA 3O08A 1NWKA 1QQOA 2QWMA 4QS8A 3GE1A 4DHYA 4BG8A 4J8FA 1IG8A 3ZEUA 4H0OA 2ZGZA 2Q97A 2Q0RA 2VYPA 3W3DA 1K8KB 4H5RA 5AZIA 3UKUA 1X3NA 5EOYA 2A40A 2V52B 1U2VA 4BC5A 4BRIA 4FWMA 5AQOA 1YXQA 4BRLA 3HZ6A 1Z05A 3O80A 1ZBSA 4B1UB 3FR0A 4AM6A 1J6ZA 2IVOA 3EO3A 1BWFO 2H3GX 2YHYA 4EHUA 2E1YA 3FZFA 3MN9A 3ATUA 1BA1A 5JLFA 1ZC6A 4M63C 5EXWA 1MWKA 1TYQB 1BOTO 3BF3A 4BRQA 3H6EA 1ZXOA 5ADXH 5FPEA 1T6DA 3AAQA 4CD3A 3M1FA 5I9EB 2I7PA 5KPRA 1TUUA 2E2PA 3MN6A 4Y0WA 2FSJA 3IFRA 3WQTA 1SAZA 3QICA 1P8ZA 4GY2B 2OANA 1GLBG 1ATSA 1QQNA 4FWLA 3HBTA 2EWSA 3VENA 2NRHA 2P9LA 3ULEA 3I33A 3VETA 5AQXA 5AZIB 3UKUB 5AQGA 2QWPA 4BVPA 5BPMA 1ATNA 3CJ9A 3CERA 3U9ZA 3QDKA 1E4GT 2ASMA 4H03B 2D0OA 1HKGA 3DXMA 5F1XA 3LDNA 4L3QA 3JS6A 4K43A 3LDQA 1JCGA 1NGEA 1Q18A 3O1WA 3G25A 2P9SA 3UE5A 2D1KA 2D4WA 5AQLA 3HI0A 2YJFA 3WXKA 1HPMA 2P9LB 1MA9B 1X3MA 3MN7A 3ULEB 3RSEA 4BGBA 4CBWA 4HWIA 5AQVA 3B8AX 3DAWA 3W0LA 3O6WA 3LM9A 3ZETA 3LDLA 5AZJA 3U4LA 4JNEA 3MN5A 3R9PA 4K42A 4BRGA 3FFKB 2YHXA 4BR0A 2HF4A 3H46O 4IXCA 1KAYA 2Q2RA 4FPAA 2A5XA 4RTFD 1GLAG 3EN9A 3GG4A 1NGHA 5KPZA 2GWKA 3CJCA 4BR4A 2CH6A 3RSEB 1QZ5A 2P9NA 2FF6A 4ISGA 3WT0A 4A62A 3WXJA 1GLFO 2E20A 4BRPA 1NGFA 3AAPA 3ZETB 3SMSA 4FWNA 1NGJA 5BPNA 3CJ7A 1GLDG 3DXMB 4CZEA 2P9UB 3H3OB 1BG3A 5BRHA 4A61A 3C7NA 4IZ9A 2P9SB 4BC3A 4EFHA 1RGIA 3FZMA 1S22A 4CJ7A 3GOIA 4H5WA 5JLHA 1NBWA 2P9NB 3SK3A 4K25A 1NMDA 3LM2A 3ZEUB 2CGJA 2NZTA 1JCFA 4IO8A 5AFUH 4FO0A 3BP8A 2YHWA 4CZGA 4WQ5C 3VEXA 3ZX0A 3ENHA 5AQYA 3A5OC 4DQ8A 5AFUA 4Z94A 3P4IA 2GELA 1HLUA 3WUHA 4JD2A 1NM1A 3MMVA 3GBTA 4B1VA 1GLLO 4GNIA 4H5TA 4C23A 2YCHA 3QBXA 3FLCO 4FWKA 5F0XA 2A42A 4HTLA 1BO5O 3MCPA 1YUWA 4BRKA 3DXKA 1LOTB 4BR2A 4A2BA 2FSKA 1G99A 1TYQA 3VEWA 5AQKA 1QZ6A 4DB3A 4BG9A 3ZX3A 1SQKA 3VGKA 4JN4A 2VCPA 1XC3A 4PL7A 2D0PA 1DEJA 1GLEG 4EIAA 2E2NA 4CZKA 1DKGD 4PL8A 4XEIA 2QW9A 3VPZA 4BR9A 2BUPA 4JHDA 3U8XA 3HM8A 3C7NB 4BR7A 5EY4A 3M6GA 4IJNA 1BUPA 4CZFA 5BN9A 1S3XA 2GTDA 2VWBA 2V51B 3WXIA 4BC4A 5CE3A 4CZIA 1IJJA 2F9TA 3FZHA 1BA0A 1V4SA 3MDQA 4FOEA 3L0QA 2AA4A 4BGAA 4CI6A 1D4XA 4I6MB 2HF3A 3D2EB 5JICA 2HMPA 3EKUA 3J8AA 3QFPA 2E88A 4NB4A 5AR0A 3VOVA 5AQMA 4JD2B 4EAHD 3WEEB 3UB5A 3CQYA 5LY3A 2E8AA 3D7EO 3BUZB 4QS9A 2QWRA 2QWOA 3H1VX 4K41A 4WQ5A 4QS7A 2W41A 5BREA 2ZWHA 4FL9A 1SZ2A 3ATVA 1QQMA 1ESVA 5AQUA 2Q0UA 5AQTA 2KHOA 3L6QA 4BRMA 1HUXA 4I6MA 4XH4A 3VF4A 3D2EA 2QWLA 1U2VB 4WYBA 2PBDA 4CZHA 3TU5A 3CI5A 5AQPA 2A6AA 3L4IA 4H5VA 3S41A 2QXLA 4MO5A 3H45C 3VF2A 1NGCA 2IVPA 4BRNA 5LJWA 1RDWX 3JXUA 3IMXA 3VEVA 4BRFA 2FLOA 3HTVA 4BVOA 1NGIA 3HSCA 1CZAN 2UYTA 4JAXA 3MK6A 5AQRA 5AQSA 5F2RA 2F9WA 4XH5A 2BTFA 3AY9A 2P9PB 5ELZA 3WXLA 3LDPA 3QB0A 4CZMA 3CETA 2P9KB 4NO7A 5AQQA 3WQUA 4PKIA 5JMVA 1RFQA 3ID8A 1HKBA 5EVZA 3WEEA 3H3NO 1C0FA 4H0VB 1MDUB 3EL2A 3O8MA 4BREA 3SLCA 3R8EA 4BR5A 3VEOA 1U6ZA 1KAXA 5FPDA 4DCHA 4FWRA 4BRAA 2IIRA 1GLCG 3QFUA 1R59O 2PAVA 4BQLA 2P9KA 2CGKA 4CD1A 3A8YA 3O5BA 1KXPA 4FPBA 3IDHA 4YDUA 2CH5A 3KHYA 3M3ZA 1E4FT 5AQWA 5B8HA 3EZWA 1BU6O 3H1QA 4CZLA 2WUSA 3GL1A 2FXUA 3EKSA 3VGLA 1EQYA 4MO4A 3OHRA 4IWVA 1XUPO 2I7NA 3A5NC 5AZJB 4AM7A 4FOIA 2P9IA 2P9PA
chains in the Genus database with same CATH superfamily
4FJ7A 4B9QA 5AQFA 5BRFA 4KRFA 1GLJO 4AILC 5C24A 2HHTA 3VQQA 3T69A 3K5MA 3NAEA 4PQUA 3DM2A 3AO2A 3PUFA 4NXMK 1H1VA 3CJ1A 2GEMA 5HP1A 4FJ9A 4YDUC 1RDUA 4JHDB 3NF6A 2OZSA 5AQZA 3M5RA 4CK1A 3VF6A 3OYDA 3L2UA 3JYTA 4BDZA 4FYDA 2V7YA 4ELVA 2WFBA 2HBJA 1BCMA 1ZBLA 4FWQA 3BEXA 1HMVA 3QBWA 4FJLA 4IEEA 3LP1A 5GIOA 2HVHA 2X6NA 4ISFA 4CZJA 2CGLA 1NGAA 2G8UA 4PY5A 4X64K 2HHHK 5E26A 4LC9B 5AQNA 3LDOA 1SL1A 4MLHA 1CZ9A 4BEBA 2OPPA 1G15A 4DTMA 1KC8O 3VERA 2YNGA 3KK7A 1KFSA 4CJUA 4KB1A 1JLBA 3SMPA 3V6DA 4H0TB 4M41A 2ZJRL 1NKEA 4F9OA 5KI6A 3K5OA 1Q7YO 1EWQA 3U3YA 4ID1A 3MXMA 3PLAA 2JWKA 3L8BA 4GVEA 4CW7B 4E89A 4C8OA 3VQ8A 3P39A 5KGWA 3SQ2A 1JJ2M 3MX5A 4Y1DA 1YVNA 3CCLN 1V4TA 2V7ZA 4EZ6A 3CMEN 1BCOA 3THXB 3VQ6A 5C10A 4ELUA 4DR1K 4FWPA 5H1SQ 1JL2A 2ZJQL 2O8BB 4FWSA 2J4RA 5E84A 1XMQK 4JYAK 4GKJK 3RMAA 3CIPA 4B1WB 3B6OA 3J81O 1Z6RA 4H0PA 5GAEP 2C1GA 5SZTA 4DTSA 3TARA 4KBOA 3C0BA 3BZKA 2QWNA 3K5LA 3OJUA 2G8KA 5KPTA 4B9UA 2VQFK 1VQ7N 5KQDA 4JK9A 3TPQA 3OYIA 2DTUA 4LF5K 3DRSA 3V9ZA 4BROA 5HRRA 1YF5L 3GE1A 4CJLA 3NGZA 1BIZA 4E7LA 1YITN 2ZGZA 1WSFA 2VYPA 3LP0A 4H5RA 5AZIA 1NJWA 3V9UA 3TAPA 4FWMA 4B9LA 5AQOA 3I56N 4BRLA 1EO1A 1Z05A 3VQCA 2KKZA 4IKFA 3I55N 4CJQA 4U67L 1J6ZA 3EO3A 3TSUA 4EHUA 2E1YA 3KLFA 1REVA 3OYLA 2B5JA 1ZC6A 3SJJA 4YOTA 3SUPA 1KVBA 3CCUN 4CD3A 2NRRA 4I2PA 2I7PA 5KPRA 3LZJA 4N41A 3SQ0A 1P8ZA 3VQBA 3HJFA 4GV9A 4A59A 4OLBA 1KFDA 1W2BM 3KWGA 2NRHA 2UXDK 2ZD1A 3VQ4A 5AQXA 5AZIB 5AQGA 1T03A 2KZZA 1FW6A 5BPMA 4CGDA 3CJ9A 4CFAA 3CERA 3SUQA 5HROA 4DV3K 3DXMA 5F1XA 4FJXA 3LDNA 1BI4B 4JEPA 3VA0A 4FZXC 1VQLN 2X74A 4R5PA 2D1KA 2D4WA 1B9DA 3K9KA 5KRSA 1KSPA 3LP3A 2P9LB 1MA9B 3O9TA 2UUCK 4NCGA 3TAMA 2F4VK 3HT3A 4IOCL 1NJYA 3DAWA 3O6WA 3MECA 1D9FA 2HVIA 3OYEA 2EHGA 1L5UA 4CGFA 3H46O 2Q2RA 3CFPA 3QINA 3KLEA 4LSLA 4DFJA 4Z4GA 3EN9A 3TWHA 5KPZA 4JKCA 3AO4A 1N5YA 4ISGA 2FF6A 3CCJN 4CEEA 3CFOA 2E4LA 4JI8K 4KHYA 2RHKA 3CJ7A 4RW7A 3DXMB 3HK2A 5BRHA 2EX3A 5DMRA 4GW6A 4CFCA 4IZ9A 4FK4A 4LSNA 2IS3A 2OZMA 1RGIA 1N8RO 1U4BA 4AHCA 1EETA 1Q86O 4DSKA 1S22A 4CJ7A 5JLHA 1RDCA 4DSLA 1NBWA 2P9NB 1VQNN 3QLHA 2NZTA 3V9WA 5AFUH 3OA9A 3R3LA 4LF9K 4DU4A 4B9TA 5AFUA 3ZSZA 4Z94A 1KTQA 1WB9A 5GINA 4JD2A 2ZM6K 1QHTA 3TAFA 1BIUA 1QSLA 4IFVA 3T19A 4FM2A 3AA2A 5K14A 1YJNN 4QCLA 4HTLA 1BO5O 1YUWA 1OVYA 1VQ8N 4FCYA 1TYQA 3VEWA 3QERA 5CYQA 1QZ6A 3HXMA 2B4JA 4DB3A 4FZZA 1N32K 1BISA 2Z1GA 2ZE2A 4BG9A 5J2MA 4JN4A 1J53A 4OKKA 4CF9A 4PL7A 2D0PA 3NF8A 3NF7A 3K57A 4WFAL 4RW9A 4JKAA 3VPZA 3HM8A 4KHWA 3LZIA 5EY4A 5BN9A 1HYVA 2NNWA 4CEZA 5CE3A 4CEBA 3OYCA 4B3OA 2XY7A 1VQ5N 1BA0A 4I9LA 3L0QA 3OYKA 2AA4A 2BDPA 4BGAA 4CJVA 4JS4A 1A5VA 3DMJA 1T3VA 1R0AA 1SKSA 4OPHA 2KFZA 2HMPA 5AJ3K 3EKUA 4NB4A 4KTWA 4JD2B 4CCHA 4WQ5A 2VG5A 3WNGA 4EP4A 2Z1HA 3RR7A 1O13A 4QS7A 3ZT2A 1VQPN 5IT9O 1QVGM 4KPYA 5AQTA 4BRMA 2PZSA 3VF4A 4BECA 3LAMA 4WYBA 2PBDA 1S1VA 3BZCA 1VQON 3OY9A 1NK4A 4IBNA 5AQPA 3G6EN 1IV0A 5M1QA 1NNEA 3THWB 1WBDA 2QXLA 2QXFA 3H45C 3VF2A 1NGCA 3O4QA 1S6PA 4BRNA 5LJWA 2OYQA 3VEVA 4BVOA 2FLOA 3HTVA 4BRFA 1NGIA 4HCCA 5AQSA 1IKYA 4DWIA 2F9WA 3AY9A 3CM6A 2P9PB 5KRTA 3QB0A 3CETA 3VQ5A 1DT9A 3G0ZA 4PKIA 5JMVA 1RFQA 3ID8A 4AHSA 5EVZA 3WEEA 3H3NO 4RW4A 1C0FA 4H0VB 4WE1A 1MDUB 1MU2A 3EL2A 3AVNA 1JLGA 3SLCA 3R8EA 4DTOA 2YNIA 1KAXA 3NBPA 4BRAA 1YJWN 4E7KA 4KHSA 2NRZA 2FBXA 3A8YA 5C2FA 1Q8IA 3IDHA 3M3ZA 4B9VA 4DLGA 1M1KO 3WNEA 1BQNA 4KAZA 5CHIA 2F8TA 4DU3A 3THWA 2OTJN 1JXEA 2GBZA 3HVTA 4DR7K 3DLRA 4FJMA 3QO9A 1S1TA 2FXUA 3VGLA 1EXQA 1BHLA 1XUPO 5LL6Z 3L3UA 3C6AA 4FOIA 2P9IA 4CGJA 2P9PA 5FRNA 3PX6A 4H0XB 4IDHA 1RTHA 4OO1J 5D3GA 3VTIA 1L3UA 3AV9A 3MCAB 5TKYA 4BC2A 3IUCA 2A41A 4ILHA 3O4NA 1LAWA 2ETJA 2FF3B 4M7YA 3V1QA 4YORA 4CJWA 5LMNK 4CF2A 1T44A 3TSQA 3O9SA 2BANA 4ILGB 1ZBFA 3LPUA 4NCBA 2HOEA 2IDOA 4LF8K 3RWUA 1RT5A 4FLYA 4O55A 1TK0A 4XJXA 1X9JA 3QIPA 4A57A 2ITMA 4B1ZA 1KLMA 1UA1A 1IKWA 4BRCA 2O8FB 3O4WA 3R1XA 1S9EA 1TGOA 2BH1A 4DG1A 4O4GA 4AHTA 4EHTA 3ULDA 4DKWA 4X65K 3G10A 2QKKA 3AVLA 4CEQA 2E2QA 4DS5A 4DQIA 5ADXA 4W5TA 1KAZA 3U9DA 1ATRA 3CJBA 2NLXA 1L3TA 3PSFA 4OPKA 3IRXA 3DLEA 3F9MA 3DRPA 3ZSRA 3QEIA 1QHAA 4ZTFA 1NGGA 1W9HA 4E3SA 3SBTA 1BDGA 2PYJA 4E19A 4JKEA 1SL0A 2IOCA 4YOUA 1K9MO 4Z4IA 5BR8K 4BRHA 5JS1A 4F2RA 2Q1NA 4FJNA 2D0CA 4PKHA 4DLEA 1T05A 4DTPA 3DJCA 2BE2A 3DWLA 4HUFA 2FC0A 3KZBA 3ENOA 5CZ1A 2O4GA 1YJ9N 3KTQA 1ZBHA 5LJVA 3OBWA 4K8ZA 3ZX2A 3PX0A 2KZMA 2QWQA 4DTXA 3AVBA 4IFYA 3HPOA 3VESA 2G8FA 2ASPA 2VG7A 5DK5A 1WAJA 3FZLA 1TL1A 2GUIA 3R6MA 1C0MA 4N5SA 2JLEA 4IEIA 2VQEK 1QQOA 3E66A 3IKMA 4GVMA 4ILJA 4QS8A 3NHGA 2QA4N 2O8EB 1RTJA 4J8FA 1IG8A 3T1YK 3G71N 2Q0RA 3EEQA 4MDBA 3PV8A 3DLGA 3K5NA 5J2QA 3HZ6A 3V9SA 4B3RK 1JLFA 2HB5A 4B1UB 4CJPA 4JK8A 5FLXO 3FR0A 1VQ9N 3AVKA 4FJHA 3Q7CA 2H3GX 4LF6K 3AVGA 4CJRA 3HL8A 3MN9A 1N36K 2HW3A 1TL3A 4JI6K 1QQCA 4M3WA 5EXWA 1MWKA 2HHVA 1BOTO 3BF3A 4BRQA 4E72A 3OW2M 1SS6A 3AAQA 4AHRA 5I9EB 2YHAA 3KLGA 4I2QA 1XNRK 1TUUA 2E2PA 4Y0WA 2FSJA 3IFRA 1SAZA 2VGMA 1RNHA 1RCHA 4GY2B 2OANA 1GLBG 2W42A 4FWLA 2I5JA 3BY5A 3O3GA 3VENA 2KW4A 1RT6A 5M1FA 1TK5A 1IBKK 3TTCA 3ULEA 4DQSA 2WTUA 5HOOA 3EYZA 3CQ8A 2D0AA 1YTAA 4CEOA 4WFNL 3RMBA 4A5BA 4H03B 1QTMA 4GV6A 4IO9L 4CECA 3HM9A 4L3QA 1BGXT 4E1NA 1XMOK 2FBYA 4M3ZA 5GIPA 3S5TA 3EZ5A 2P9SA 3P38A 3O9UA 3HI0A 2YJFA 3WXKA 4CFDA 3RSEA 4BGBA 1NK0A 4F8RA 4DR4K 3O9RA 1YI2N 5M1NA 3CFRA 4CESA 3ZETA 3LDLA 4IG0A 3U4LA 1QSSA 4JNEA 1OVQA 3AGRA 1W7AA 2Y1JA 3FFKB 2B6AA 4KTZA 3CG7A 2HF4A 1TKZA 2HNDA 3O3HA 3VN5A 2O8BA 3G4SN 4CK3A 1QZ5A 1RBTA 4A62A 2DFHA 3L3VA 3WXJA 5JVGL 2E20A 4DUZK 4JI3K 3SMSA 3QNOA 1GLDG 5C12A 3H3OB 2OPRA 4V19S 4A61A 3KK1A 4CHZA 3KKRA 2P9SB 3FZMA 3GOIA 1LW2A 4H5WA 4BE2A 3TANA 5M1PA 4N76A 3IAYA 4PA1A 3F73A 3AA3A 2CGJA 4IO8A 4DSIA 3DLLL 3BP8A 3RVCA 4WQ5C 3VEXA 2HNYA 2E6LA 3QIOA 4UQGA 4DQ8A 1YT3A 2JWLA 3WUHA 1NM1A 3MMVA 4B1VA 1GLLO 4IFEA 4M3TA 4JI0K 2OCEA 3E9LA 1C0TA 1RDAA 2NRTA 2RF2A 3FLCO 5F0XA 4C8NA 4JKBA 1TVRA 3TAEA 3QEPA 2Q3SA 3VQDA 3EY1A 3CD6N 1LOTB 4K8XA 4ID5A 5T7BA 1G99A 4FM0A 4JI1K 4FW1A 4E1MA 1NK7A 1CZBA 3WXMB 1SQKA 3VGKA 2YNFA 3AVJA 3M8RA 1IH7A 3LDSA 1EP4A 4KHUA 1GLEG 1HNIA 3S3MA 2QI2A 1IO2A 1DKGD 4BR9A 4LFBK 3KLHA 3U8XA 3QEWA 4IJNA 1DTQA 2GTDA 2VWBA 2V51B 3WXIA 4BC4A 4CZIA 1IJJA 3OJSA 1WSJA 3MDQA 3V1OA 2W6LA 4O0JA 4JI7K 4CI6A 1D4XA 3KIOA 4I6MB 1NMNA 1WLJA 2HF3A 4H8KA 3J80O 1LAVA 4R79A 2X6SA 2HHQA 4DQRA 3VOVA 1HPZA 4EAHD 4KKOA 2YKMA 4LY7A 3D7EO 3BUZB 2R7YA 4WCEL 3HRGA 4DSFA 1FXXA 3T3FA 1Q9XA 4KI4A 4CFBA 3B6PA 4JK7A 1ESVA 3P83D 5KGXA 3OYFA 2ATQA 2KHOA 3L6QA 1LWFA 3D2EA 4CJ3A 4Q5VA 1S6QA 4CZHA 1NU0A 1A5XA 3TU5A 3CI5A 1C6VA 3L4IA 4BE0A 3ZSWA 4CJ5A 4MO5A 1WSIA 3BDPA 4FLWA 3CCEN 1RDWX 3F2KA 1RTDA 3ID6A 3HPHA 4W5NA 1CZAN 5F2RA 3OYMA 3KK3A 1OH5A 4XH5A 2BTFA 4JS5A 1Q81O 1NOZA 2HNZA 3WXLA 3D6RA 4CZMA 3QEXA 2PFUA 2UU9K 4MDAA 3ISNC 1KLNA 1HKBA 4CHQA 1FK9A 1XHXA 3J7YP 3ALYA 5HRNA 3DOLA 4AF1A 4W5RA 3OS2A 4CJKA 4IG3A 3VEOA 1U6ZA 5FPDA 2A1SA 4KFBA 4JKGB 2IIRA 1R59O 1XC9A 4BQLA 2CGKA 3O5BA 1ASUA 1ASVA 3AVFA 4YDUA 3DLBA 1NK8A 4IOXA 3NE6A 2Z1JA 2QK9A 1J5EK 3EZWA 1RBUA 3GL1A 1EQYA 4MO4A 4IWVA 3ZYYX 4EZ9A 3HPGA 4BACA 2I7NA 4RW8A 5AZJB 3OYGA 3RTVA 3U3GA 3CF5L 1JCEA 5C15A 2E6MA 4FJKA 3PO4A 4WQ4C 3A5LC 3HOSA 4C1NI 2W40A 4XIUA 4FM1A 2GUPA 2VWKA 3HSTB 4O8KA 2QM1A 4BRDA 4B8AB 3CJAA 3ZSYA 5JENA 1HJOA 1S9GA 3O1BA 1TUYA 1VQMN 1ITGA 3TR8A 3E01A 4M7XA 2XHBA 3ZT0A 3VEYA 5HBMA 5LMUK 4M3XA 1HKCA 1Y97A 1YAGA 4B1XB 4PUOA 4NYNA 4RW6A 2AP1A 5FPMA 1L3VA 4JRQA 5I42A 2HHXA 3PSIA 3LP2A 4XH1A 3FZKA 2G8VA 3AO5A 1GOBA 5FDLA 3LL3A 4LH5A 3QESA 2DFFA 2P9UA 3CC4N 3MX2A 3K9JA 5AQJA 4RWTA 4CEDA 4FW2A 2Q31A 2OTLN 1XQSC 1FKPA 2ASOA 4JI2K 3AA4A 5AQHA 5JS2A 2P9IB 5FPNA 1GOAA 1Y64A 1CXUA 1M90O 2JGUA 1EX4A 5BRDA 3D2FB 4BDPA 5CR4A 1NLVA 1JLQA 1OH6A 4JI4K 3KVGA 3OYJA 3C95A 4G1QA 3CQXA 1K8KA 1LCUA 2Q36A 4RCHA 1I3AA 3DXKB 4QAGA 2O4IA 1K73O 1U47A 2AJQA 2D5RA 3ITHA 4CF1A 1X9MA 2XRIA 1NJXA 1X9SA 4ISEA 4HUEA 1OH8A 4YNQA 1IKVA 2W00A 4FLTA 4M3RA 2KTQA 4FK2A 4BQZA 5FRMA 2FBTA 2QEXN 4CIEA 1NJZA 4DR5K 4AH9A 4O0IA 3IS9A 4AHUA 4E1JA 2GWJA 1XNQK 3FGUA 4KTQA 4Y1CA 3HP9A 3LPTA 4JLHA 4DV2K 4CJTA 5KQ8A 2KLAA 4TSXA 2RN2A 2OPQA 4X62K 3K59A 4X66K 4FSVA 2O8DA 3OYBA 4IJAA 3D0PA 1WUAA 3EE8A 4OGEA 1NWKA 4DTRA 4DHYA 3SAFA 4B3MK 2IC3A 4I7FA 3ZEUA 3L2VA 2Q97A 3W3DA 3UKUA 1X3NA 5EOYA 2V52B 4BRIA 4N47A 5MLCQ 4YFUA 2RPIA 4KV8A 3O80A 1Z26A 3TABA 1ZBSA 5JVHL 2KFNA 1BWFO 1HQEA 4W5QA 3K58A 4QOZB 3ATUA 1BA1A 4HCBA 3DYAA 4M63C 4CE9A 3CC2N 3HO1A 4KHQA 1TYQB 1JLAA 3H6EA 1ZXOA 5ADXH 4OJRA 5FPEA 4C1NK 3KJVA 1VSLA 3M1FA 3MXJA 4O44A 2WBNA 3I0RA 1QVFM 4DR2K 4DR6K 2DY4A 1XI1A 1HR0K 3WQTA 1IBMK 4L8RB 4YOVA 4CJSA 3QICA 5C2DA 2UUAK 1BI4A 1ATSA 1QQNA 5CYMA 3HBTA 2G8WA 1HYZA 2KQ2A 2EWSA 5C42A 4DSEA 1RT1A 3NH0A 3VA3A 4DU1A 4ZHRA 4C8KA 1CXQA 3NF9A 4CGIA 2P9LA 3SQ4A 3T1AA 3KLIA 3UKUB 2X78A 1C1AA 2QWPA 3T7ZA 4O8UA 2FBVA 3ASMA 3QDKA 3U9ZA 2ASMA 2PY5A 3VQ7A 3JS6A 1NK6A 3N4QA 1NGEA 3O1WA 4JI5K 3UE5A 5CY4A 1HNZK 4CHYA 3ZLJA 5J1EA 1HPMA 3K2PA 3EE9A 1X3MA 3ULEB 1RT2A 2HMIA 4HWIA 3JAMO 5AQVA 3E9PA 1VAZA 4KO0A 4MQ3A 1D9DA 5HRPA 4NXNK 5AZJA 5A2QO 2XY5A 3C6TA 3MN5A 2YKNA 3CPEA 3CYGA 1SKRA 4FVUA 4BRGA 3I0SA 1RBVA 2XY6A 1T7PA 4FPAA 1GLAG 1ZYQA 3GG4A 4BR4A 1NKBA 2P5GA 3AVAA 3TTFA 1VSHA 2P9NA 4LH4A 3TI0A 3WT0A 1VSFA 5J2NA 1JL1A 1SL2A 1GLFO 4CGGA 2OA8A 1EKEA 4OVLA 4BRPA 3ZETB 4FWNA 1NGJA 4F4KA 5BPNA 3CXCM 3DI6A 3MAQA 4CZEA 2P9UB 4OPAA 3VQAA 3C7NA 3MWTA 4EFHA 3OBYA 4CHOA 4CVNE 4BWJA 1J9AA 4GV3A 1YTUA 4K25A 1NMDA 1JCFA 3MEGA 4FO0A 1WSGA 4BWMA 3ENHA 4DR3K 3A5OC 3P4IA 2GELA 5M1KA 1HLUA 4DV4K 3GBTA 2UUBK 4PWDA 5C25A 2YCHA 3J7AP 3J7ZO 3RRGA 2A42A 3L2WA 3F9KA 3MCPA 4AHVA 4BRKA 3DXKA 3OS0A 4BR2A 4FVMA 3SV3A 3T1HK 2VGNA 1S1XA 4CIGA 3SAHA 1W0HA 3CMAN 1FKOA 3PX4A 1BQMA 2YX6A 3DOKA 3O3FA 4FLXA 4CIFA 1NK9A 1VSIA 3OS1A 1X9WA 2HHIA 2NRXA 1IBLK 2E2NA 2HBKA 3ZT1A 4KHNA 3VTHA 4PL8A 4XEIA 4IDKA 4JHDA 1JXBA 1IKXA 3CPWM 1BUPA 1VQKN 2W6KA 4A5AA 4UY8O 1V4SA 1VRUA 4CJEA 2XY8A 4JKFA 2OPSA 4B9SA 1BL3A 1TKXA 1VSJA 5I3UA 2NRWA 1N6QA 3QFPA 5AR0A 2E88A 2D0BA 3CQYA 5LY3A 2Z1IA 5CZ2A 3ZCMA 4W5OA 2QWOA 3H1VX 2O8DB 1D8YA 1B92A 4C8LA 1N33K 2W41A 2ZWHA 4DV7K 3A2FA 1SZ2A 1CLQA 1QQMA 3PY8A 4FJGA 5AQUA 2Q0UA 3I8DA 4J2BA 4KH4A 4E7JA 1VQ6N 4XH4A 2HSTA 2QWLA 1D5AA 3C65A 1VSDA 1RT7A 4BE1A 3OVNA 3SNNA 3M8SA 3DRRA 4U7BA 4KI6A 1DLOA 1KQSM 4DF8A 1UA0A 1J5OA 2F8SA 1SV5A 4Z4HA 2UXBK 1WN7A 3P5JA 3L2RA 4NCAA 3NDKA 4CGHA 3LALA 3CYMA 3IMXA 1S72N 1HJRA 2UYTA 4JAXA 3MK6A 5AQRA 3BGRA 4FJJA 4I9QA 3S3OA 2RKIA 1EWRA 5ELZA 5GAHP 1IG9A 4CHNA 2P9KB 4OKJA 4FJ5A 4NO7A 3THYA 4JKHA 3OYAA 3O8MA 3NVMA 4BR5A 3LAKA 4Z4EA 2LSNA 4DFKA 4DCHA 1E3MA 2YNHA 1RDBA 2WC9A 3QFUA 3CCVN 1LWEA 5HLFA 4CD1A 4O5BA 1KXPA 3SQ1A 3HOTA 4H4MA 3CCSN 1QE1A 3AO3A 2CH5A 1E4FT 4CF0A 5B8HA 4ELTA 1UWBA 1BU6O 5KTQA 3N4PA 4LF7K 3UIQA 4GMJB 1UAXA 4CJ4A 4Z4CA 4B3SK 3KD5E 3OHRA 3SI6A 3AVMA 2UXCK 4LD0A 4J2AA 4FJIA 4DTJA 3GDQA 1KVCA 2ZGYA 3AARA 5BN8A 1J54A 2Y1IA 2A1RA 1S5JA 5C0YA 3THYB 3M8PA 3A5MC 1VHXA 1RBSA 3VEZA 3DLKA 4H5NA 4IOAL 1C1CA 3E1YA 3SUOA 3SPZA 4O5FA 1RBRA 4JRPA 5BR9A 2O8FA 5GAGP 1XWLA 4DV6K 4FWOA 4E7IA 2PYLA 4YOXA 3CHWA 4B1YB 4OPJA 4DFMA 3C94A 4KH5A 5E41A 3OYNA 1OKJA 4MLEA 5J2PA 2O8CA 2YI1A 4B3TK 1FJGK 4FLUA 2E2OA 3QETA 3JSMA 4A2AA 4KB0A 2E1ZA 1NGDA 1T6CA 3FE1A 4DV0K 3SJHA 3C6HA 4PKGA 1GOCA 1TKTA 3A0IX 4WFBL 1LW0A 2ZQBA 4OGCA 3UKRA 3OTOK 4KREA 2NUBA 1JLCA 5AQIA 1RDDA 3VQPA 4Q0BA 1MWMA 4DUYK 1WOQA 4GKKK 1KCFA 4WQ4A 2DPNA 3SCXA 4AQYK 4Z0UA 4HVJA 2IGIA 1N34K 2YV0X 4YOYA 1LV5A 4KH6A 1DGKN 4FZYA 2VG6A 4CBUA 3KWIA 1C0GA 5EX5A 4H0YB 2IVNA 2VWJA 3LWMA 2IAJA 1ZBIA 4C8MA 5BPLA 2YJEA 3RR8A 2ZF5O 2FSNA 3D2FA 4E0DA 3QMLA 4FLZA 3NH1A 3VGMA 4M42A 3ZSOA 4CJFA 3I8BA 2O8EA 1C0UA 3M8QA 4DF4A 2DFEA 3ENBA 1U48A 1HX1A 3BF1A 3MXIA 3SBGA 3SUNA 3V1RA 3CCQN 3UKRB 1HNXK 2A3ZA 4CBXA 2QTDA 3O9QA 1NGBA 3E9OA 3L4QA 5IWAK 2G8IA 3O08A 1KD1O 2QWMA 2ZJPL 3C6UA 4BG8A 3KK2A 4H0OA 3RMDA 3CCMN 3DLHA 1K8KB 2HHUA 4CF8A 2A40A 4DV1K 1U2VA 4BC5A 1DTTA 4FXDA 1YXQA 2C1IA 3PIOL 4AM6A 2IVOA 3AVCA 3RRHA 2YHYA 4NLBA 1QSYA 1VK0A 3FZFA 3LANA 2XO7A 3SZ2A 3SYZA 5JLFA 3CM5A 1YVUA 4NYFA 5HRSA 1K8AO 3V81A 2GV9A 1T6DA 3AO1A 4K0KK 1RT3A 2HHWA 3MN6A 2GX9A 1T8EA 4MFBA 4DFPA 3AA5X 1RT4A 4JV5K 4NLCA 3V4IA 1F21A 1Q9YA 4PHTX 4OX9K 3PIPL 3I33A 3VETA 1S1WA 3VMFB 4BVPA 1ATNA 3RMCA 3HYFA 1E4GT 1P90A 1SUQA 2D0OA 1HKGA 3KD1E 1TK8A 1WAFA 3NH2A 3NFAA 1LWCA 4B9MA 4K43A 4HHTA 4F3OA 3LDQA 1JCGA 1Q18A 2E5LK 3G25A 3ZSXA 5AQLA 4B8CA 4CEFA 3MN7A 4CBWA 2WOMA 1I39A 3TTDA 4N56A 5SWMA 1U04A 3HVRA 3SV4A 4E7HA 3B8AX 3MEDA 3ZSQA 3W0LA 3LM9A 2P1JA 1RILA 4JKDA 4DS4A 2QKBA 1ZBUA 3R9PA 5DM6L 2F7TA 4K42A 1WSHA 1YHQN 4M3UA 2YHXA 1VSEA 4BR0A 3AVIA 4IXCA 3TAGA 1HNWK 1KAYA 2A5XA 4RTFD 1NGHA 2GWKA 3CJCA 2CH6A 3RSEB 3L2QA 1ILYA 4CK2A 3TAQA 3NVKA 4FJ8A 4CERA 2YHBA 3S3NA 1NGFA 3AAPA 1YIJN 1O1WA 2P5OA 1K6YA 4DSJA 1TKDA 4DQQA 2O8CB 1NOYA 1BG3A 1I94K 3ZSVA 4BC3A 3ZT3A 2G8HA 1VQ4N 3SK3A 3V9XA 3LM2A 3S9HA 1X1PA 3ZEUB 1KVAA 2YHWA 4CZGA 5GADP 2F96A 1SKWA 3ZX0A 5AQYA 4H4OA 1UOCA 4BDYA 1S1UA 3U6FA 3NCIA 3IG1A 4GNIA 3FFIA 4H5TA 1B9FA 4C23A 3QBXA 4HTUA 4FWKA 4B9NA 3QEVA 4M45A 4LFCK 3AVHA 5EU7A 4A2BA 1TV6A 1A5WA 2FSKA 5AQKA 4WF9L 2RE2A 4CHPA 3QNNA 3ZX3A 3LWLA 2VCPA 1XC3A 4FK0A 1DEJA 4BY9C 4EIAA 4CZKA 4DMNA 3THXA 2QW9A 2BUPA 3C7NB 4BR7A 3M6GA 1TAUA 4Z4FA 4CZFA 5DM7L 1S3XA 3AGKA 3MEEA 3WNHA 3NMUA 5HL7L 2F9TA 3P1GA 3FZHA 3VQEA 4FOEA 1Q82O 1NG9A 4KHPK 3D2EB 5JICA 4OKEA 3J8AA 3D45A 5M1OA 5AQMA 1U49A 3WEEB 3Q7BA 3UB5A 4LFAK 2E8AA 3OYHA 3NGIA 3MWPA 3TSPA 4QS9A 4G9ZA 2HHSA 2QWRA 1WNSA 4K41A 4RG8A 1TAQA 4M3YA 5BREA 4FL9A 3ATVA 1WBBA 3K0SA 4DV5K 1HUXA 1RTIA 4I6MA 1U45A 1U2VB 3HP6A 1VSKA 5FROA 2HBMA 1XHZA 2A6AA 3CCRN 4H5VA 3S41A 1NJIO 4DQPA 2IVPA 1KRPA 4YHHK 2BGGA 3WNFA 3JXUA 3HSCA 1L3SA 4EP5A 4OLAA 1JLEA 1Z25A 4JKGA 2NRVA 4DTNA 1NK5A 3LDPA 4HUGA 3H08A 2P51A 4YOWA 4FLVA 1W97L 5AQQA 3F5TA 2ITGA 1VRTA 3WQUA 4B08A 3NGYA 4J2EA 1C1BA 4BREA 1QS4A 2HBLA 1HYSA 3P31A 1NKCA 4BE7B 3CC7N 1VSMA 1OH7A 4FWRA 3SAGA 1GLCG 1HQUA 2PAVA 3PO5A 2P9KA 4F2SA 4FPBA 3KHYA 3THVA 5TKWA 5AQWA 1HRHA 1JKHA 4DTUA 2WONA 3SPYA 4F3TA 1ASWA 3ZT4A 4ICLA 3H1QA 4CZLA 2WUSA 4LF4K 3EKSA 1HNVA 3VQ9A 4J2DA 1WSEA 3KKSA 4CEAA 3A5NC 4AM7A 4ZTJA 4YY3K
chains in the Genus database with same CATH topology
1JCEA 5C15A 4H0XB 3GDQA 4IDHA 5AQFA 4WQ4C 4B9QA 3A5LC 5BRFA 4OO1J 2ZGYA 3AARA 3VTIA 3HOSA 5BN8A 4C1NI 3MCAB 5TKYA 2W40A 5C0YA 1GLJO 3A5MC 3VEZA 4BC2A 2GUPA 3T69A 3IUCA 4H5NA 4IOAL 3E1YA 4O5FA 2QM1A 4O8KA 4BRDA 1H1VA 3CJ1A 2GEMA 3CJAA 5BR9A 2A41A 4ILHA 4YDUC 1HJOA 5GAGP 1RDUA 3O1BA 2FF3B 4JHDB 1TUYA 4M7YA 1VQMN 4FWOA 4YORA 5AQZA 3M5RA 1T44A 4M7XA 3TSQA 3O9SA 3VF6A 3VEYA 1HKCA 4ILGB 3CHWA 4B1YB 1YAGA 4B1XB 2V7YA 4YOXA 2WFBA 2HOEA 2AP1A 2HBJA 4KH5A 1OKJA 4MLEA 5FPMA 4FWQA 3BEXA 2YI1A 3QBWA 4XJXA 1X9JA 4XH1A 3FZKA 2E2OA 4A2AA 4IEEA 4A57A 2ITMA 4B1ZA 5GIOA 2E1ZA 4ISFA 3LL3A 4BRCA 2CGLA 1NGDA 4CZJA 1NGAA 3O4WA 2P9UA 3CC4N 1T6CA 3MX2A 3FE1A 3K9JA 5AQJA 3SJHA 4RWTA 3R1XA 3C6HA 2Q31A 4PKGA 2BH1A 2OTLN 1XQSC 3A0IX 4WFBL 5E26A 4LC9B 5AQNA 3LDOA 2ASOA 1S72N 4BEBA 4MLHA 4EHTA 4DKWA 5AQHA 2E2QA 3UKRA 5ADXA 2P9IB 1KC8O 5FPNA 1KAZA 5AQIA 1ATRA 3U9DA 1Y64A 3VERA 1M90O 3KK7A 3CJBA 2NLXA 5BRDA 1MWMA 3SMPA 3D2FB 1WOQA 4H0TB 4WQ4A 3F9MA 2ZJRL 2DPNA 5CR4A 1NLVA 4F9OA 1QHAA 1Q7YO 1NGGA 3SBTA 3KVGA 1BDGA 3PLAA 2JWKA 4GVEA 4YOYA 4JKEA 3CQXA 1K8KA 1LCUA 2Q36A 3P39A 4KH6A 1DGKN 4RCHA 4YOUA 1K9MO 4BRHA 4CBUA 3KWIA 1C0GA 2Q1NA 3DXKB 5EX5A 4H0YB 2IVNA 1K73O 1JJ2M 3MX5A 1YVNA 3CCLN 1V4TA 2V7ZA 3CMEN 4PKHA 2YJEA 5BPLA 2ZF5O 5C10A 2FSNA 4FWPA 3D2FA 4ISEA 3QMLA 3DJCA 3DWLA 5H1SQ 2ZJQL 3VGMA 2W00A 3KZBA 4FWSA 3ENOA 2J4RA 5E84A 3I8BA 4BQZA 3CIPA 1YJ9N 4B1WB 2QEXN 5LJVA 3OBWA 1Z6RA 4H0PA 5GAEP 3ZX2A 3ENBA 2C1GA 1HX1A 3BF1A 2QWQA 4E1JA 4KBOA 3SBGA 3C0BA 2QWNA 2GWJA 3VESA 5KPTA 3CCQN 3FGUA 1VQ7N 3UKRB 5KQDA 2ASPA 2A3ZA 4JK9A 5KQ8A 2KLAA 3TPQA 4CBXA 2QTDA 3FZLA 3O9QA 1NGBA 3R6MA 3E9OA 3L4QA 4FSVA 4IEIA 4IJAA 4BROA 1WUAA 3EE8A 3O08A 1NWKA 1QQOA 1YF5L 3E66A 2QWMA 3IKMA 4ILJA 3GE1A 4QS8A 4DHYA 2QA4N 1KD1O 3SAFA 2ZJPL 4BG8A 4J8FA 1IG8A 3ZEUA 4H0OA 1YITN 2ZGZA 2Q97A 3G71N 2Q0RA 2VYPA 3W3DA 3CCMN 1K8KB 4H5RA 5AZIA 3UKUA 1X3NA 5EOYA 4MDBA 2A40A 2V52B 1U2VA 4BC5A 4BRIA 4FWMA 5MLCQ 5AQOA 3I56N 1YXQA 4BRLA 1EO1A 3HZ6A 1Z05A 2KKZA 3O80A 1ZBSA 4B1UB 3PIOL 3I55N 4JK8A 5JVHL 2C1IA 3FR0A 4AM6A 4U67L 1J6ZA 2IVOA 3EO3A 1BWFO 3Q7CA 2H3GX 3TSUA 1VQ9N 2YHYA 4NLBA 4EHUA 2E1YA 3FZFA 3MN9A 3ATUA 1BA1A 5JLFA 1ZC6A 4M63C 3CC2N 4YOTA 5EXWA 1MWKA 1TYQB 1K8AO 1BOTO 3BF3A 4BRQA 3OW2M 3H6EA 1ZXOA 1SS6A 5ADXH 5FPEA 4C1NK 3CCUN 1T6DA 3AAQA 4CD3A 3M1FA 2NRRA 2WBNA 2I7PA 5I9EB 1QVFM 5KPRA 1TUUA 2E2PA 3MN6A 2GX9A 4Y0WA 2FSJA 3IFRA 3WQTA 4YOVA 1SAZA 3QICA 2VGMA 1P8ZA 5C2DA 4GY2B 2OANA 1GLBG 1ATSA 1QQNA 4FWLA 3HBTA 4NLCA 2EWSA 4GV9A 4A59A 3VENA 4PHTX 5M1FA 1W2BM 3KWGA 2NRHA 2P9LA 3TTCA 3ULEA 3PIPL 3I33A 3VETA 5AQXA 5AZIB 3UKUB 5HOOA 5AQGA 2QWPA 3VMFB 4BVPA 5BPMA 1ATNA 3CJ9A 3CERA 3T7ZA 4O8UA 3QDKA 3U9ZA 4WFNL 1E4GT 2ASMA 4H03B 4A5BA 4GV6A 1P90A 2D0OA 1HKGA 4IO9L 3DXMA 5F1XA 3LDNA 4L3QA 3JS6A 4K43A 3N4QA 4JEPA 3LDQA 5GIPA 1JCGA 1NGEA 1Q18A 1VQLN 3O1WA 3G25A 2P9SA 3P38A 3O9UA 3UE5A 2D1KA 2D4WA 5AQLA 3HI0A 2YJFA 3K9KA 3WXKA 1HPMA 3EE9A 2P9LB 1MA9B 1X3MA 3MN7A 3ULEB 3RSEA 3O9TA 4BGBA 4CBWA 3TTDA 4HWIA 4IOCL 5AQVA 3E9PA 3O9RA 3B8AX 1YI2N 1VAZA 5M1NA 3DAWA 3W0LA 3O6WA 3LM9A 3ZETA 3LDLA 4JKDA 5AZJA 3U4LA 4JNEA 3MN5A 3R9PA 3CPEA 5DM6L 2F7TA 4FVUA 4K42A 3AGRA 1YHQN 4BRGA 3FFKB 2YHXA 4BR0A 2HF4A 3H46O 4IXCA 1KAYA 2Q2RA 4FPAA 2A5XA 4RTFD 1GLAG 3EN9A 3GG4A 1NGHA 5KPZA 2GWKA 4JKCA 3CJCA 4BR4A 3G4SN 2CH6A 3RSEB 3TTFA 1QZ5A 2P9NA 2FF6A 4ISGA 3WT0A 4A62A 3CCJN 1ILYA 3NVKA 3WXJA 5JVGL 1GLFO 2E20A 4BRPA 1NGFA 3AAPA 1YIJN 3ZETB 3SMSA 4FWNA 1NGJA 5BPNA 2RHKA 1GLDG 3CJ7A 3CXCM 3DXMB 5C12A 4CZEA 2P9UB 3H3OB 1BG3A 4OPAA 5BRHA 4A61A 3C7NA 3MWTA 4IZ9A 2P9SB 4BC3A 4EFHA 1RGIA 3FZMA 1N8RO 1Q86O 3OBYA 1S22A 4CJ7A 3GOIA 4H5WA 5JLHA 5M1PA 1NBWA 2P9NB 3SK3A 4K25A 1VQ4N 4GV3A 1NMDA 3LM2A 1VQNN 3ZEUB 2CGJA 2NZTA 1JCFA 4IO8A 3DLLL 5AFUH 3OA9A 3R3LA 4FO0A 3BP8A 2YHWA 3RVCA 4WQ5C 3VEXA 4CZGA 5GADP 3ZX0A 3ENHA 5AQYA 3A5OC 4DQ8A 5AFUA 4Z94A 3P4IA 2GELA 2JWLA 1HLUA 5M1KA 5GINA 3WUHA 4JD2A 1NM1A 3MMVA 3GBTA 4B1VA 1GLLO 4IFEA 4GNIA 4H5TA 3E9LA 4C23A 2YCHA 3QBXA 2NRTA 3J7ZO 3FLCO 4FWKA 5F0XA 4JKBA 2A42A 1YJNN 4HTLA 1BO5O 3MCPA 1YUWA 4BRKA 3DXKA 3CD6N 1LOTB 1OVYA 4BR2A 1VQ8N 4A2BA 2VGNA 2FSKA 1G99A 1TYQA 3VEWA 3SAHA 5AQKA 3CMAN 1QZ6A 4WF9L 2RE2A 4DB3A 3WXMB 4BG9A 3ZX3A 1SQKA 3VGKA 2YX6A 4JN4A 2VCPA 1XC3A 4PL7A 2D0PA 1DEJA 1GLEG 4BY9C 4EIAA 2NRXA 4WFAL 2QI2A 2E2NA 2HBKA 4CZKA 4JKAA 3VTHA 1DKGD 4PL8A 4XEIA 2QW9A 3VPZA 4BR9A 2BUPA 4JHDA 3U8XA 3HM8A 3C7NB 4BR7A 5EY4A 3CPWM 3M6GA 4IJNA 1BUPA 4CZFA 5DM7L 5BN9A 1S3XA 2GTDA 2VWBA 3AGKA 2NNWA 2V51B 3WXIA 4BC4A 5CE3A 4CZIA 3NMUA 1IJJA 5HL7L 2F9TA 1VQ5N 1VQKN 4A5AA 3FZHA 1BA0A 4UY8O 1V4SA 3MDQA 4FOEA 3L0QA 1Q82O 2AA4A 4JKFA 4BGAA 4CI6A 1D4XA 4I6MB 2HF3A 1T3VA 3D2EB 4OPHA 4R79A 5JICA 2HMPA 2NRWA 3EKUA 3J8AA 3QFPA 2E88A 4NB4A 5AR0A 5M1OA 3VOVA 5AQMA 4JD2B 4EAHD 3WEEB 3Q7BA 3UB5A 3CQYA 5LY3A 2E8AA 3D7EO 3BUZB 3MWPA 4WCEL 3TSPA 4QS9A 4G9ZA 2QWRA 3HRGA 2QWOA 3H1VX 4K41A 4WQ5A 1O13A 4QS7A 2W41A 5BREA 2ZWHA 1VQPN 4FL9A 1SZ2A 3ATVA 4JK7A 1QVGM 1QQMA 1ESVA 5AQUA 2Q0UA 5AQTA 2KHOA 4KH4A 3L6QA 4BRMA 1HUXA 4I6MA 4XH4A 3VF4A 2HSTA 1VQ6N 4BECA 3D2EA 2QWLA 3C65A 1U2VB 4WYBA 2PBDA 4CZHA 4U7BA 1VQON 2HBMA 3TU5A 3CI5A 1KQSM 5AQPA 2A6AA 3G6EN 5M1QA 3CCRN 3L4IA 4H5VA 3S41A 2QXLA 4MO5A 1NJIO 3H45C 3VF2A 1NGCA 2IVPA 4BRNA 5LJWA 3CCEN 1RDWX 3F2KA 3JXUA 3IMXA 3VEVA 4BRFA 2FLOA 3HTVA 3ID6A 1NGIA 3HSCA 1CZAN 4BVOA 2UYTA 4JAXA 3MK6A 5AQRA 5AQSA 5F2RA 2F9WA 4XH5A 2BTFA 3AY9A 4JKGA 2P9PB 2NRVA 1Q81O 5ELZA 3WXLA 3LDPA 3D6RA 5GAHP 3QB0A 4CZMA 3CETA 2P9KB 4YOWA 2PFUA 1W97L 1DT9A 4NO7A 3F5TA 5AQQA 4MDAA 3WQUA 4PKIA 5JMVA 1RFQA 1HKBA 3ID8A 5EVZA 3WEEA 3H3NO 4JKHA 1C0FA 4H0VB 1MDUB 3EL2A 3O8MA 4BREA 3NVMA 4AF1A 3SLCA 3R8EA 4BR5A 2HBLA 3VEOA 1U6ZA 3P31A 1KAXA 5FPDA 4BE7B 3CC7N 4DCHA 4FWRA 4BRAA 3SAGA 4JKGB 2WC9A 2IIRA 1GLCG 3QFUA 3CCVN 1R59O 1YJWN 2PAVA 4BQLA 2NRZA 2CGKA 2P9KA 3A8YA 3O5BA 1KXPA 4CD1A 5C2FA 4FPBA 3HOTA 3CCSN 3IDHA 4YDUA 2CH5A 3KHYA 3M3ZA 1E4FT 5TKWA 5AQWA 1M1KO 5B8HA 4IOXA 5CHIA 3EZWA 1BU6O 3N4PA 2OTJN 3H1QA 4CZLA 2WUSA 3GL1A 2FXUA 3EKSA 3VGLA 1EQYA 4MO4A 3OHRA 4IWVA 3ZYYX 1XUPO 2I7NA 3A5NC 5AZJB 3C6AA 4FOIA 4AM7A 2P9IA 2P9PA 3CF5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCE A;  4H0X B;  3GDQ A;  5AQF A;  4B9Q A;  4WQ4 C;  5BRF A;  3A5L C;  2ZGY A;  3AAR A;  5BN8 A;  5TKY A;  2W40 A;  1GLJ O;  3A5M C;  3VEZ A;  4BC2 A;  2GUP A;  3IUC A;  4H5N A;  4O5F A;  2QM1 A;  4O8K A;  4BRD A;  1H1V A;  3CJ1 A;  2GEM A;  3CJA A;  5BR9 A;  2A41 A;  4YDU C;  1HJO A;  3O1B A;  2FF3 B;  4JHD B;  1TUY A;  4M7Y A;  4FWO A;  5AQZ A;  1T44 A;  4M7X A;  3VF6 A;  3VEY A;  1HKC A;  3CHW A;  4B1Y B;  1YAG A;  4B1X B;  2V7Y A;  2HOE A;  2AP1 A;  1OKJ A;  4MLE A;  5FPM A;  4FWQ A;  3BEX A;  2YI1 A;  3QBW A;  1X9J A;  4XH1 A;  3FZK A;  2E2O A;  4A2A A;  2ITM A;  4B1Z A;  2E1Z A;  4ISF A;  3LL3 A;  4BRC A;  2CGL A;  1NGD A;  4CZJ A;  1NGA A;  3O4W A;  2P9U A;  1T6C A;  3FE1 A;  5AQJ A;  3SJH A;  4RWT A;  2Q31 A;  4PKG A;  1XQS C;  3A0I X;  5E26 A;  4LC9 B;  5AQN A;  3LDO A;  2ASO A;  4MLH A;  4EHT A;  5AQH A;  2E2Q A;  3UKR A;  5ADX A;  2P9I B;  5FPN A;  1KAZ A;  5AQI A;  1ATR A;  3U9D A;  1Y64 A;  3VER A;  3CJB A;  2NLX A;  5BRD A;  1MWM A;  3SMP A;  3D2F B;  1WOQ A;  4H0T B;  4WQ4 A;  3F9M A;  2DPN A;  4F9O A;  1NLV A;  1QHA A;  1NGG A;  3KVG A;  1BDG A;  3CQX A;  1K8K A;  1LCU A;  2Q36 A;  1DGK N;  4RCH A;  4BRH A;  4CBU A;  1C0G A;  2Q1N A;  3DXK B;  5EX5 A;  4H0Y B;  2IVN A;  1YVN A;  1V4T A;  2V7Z A;  4PKH A;  2YJE A;  5BPL A;  2ZF5 O;  2FSN A;  4FWP A;  3D2F A;  4ISE A;  3QML A;  3DJC A;  3DWL A;  3VGM A;  3KZB A;  4FWS A;  3ENO A;  2J4R A;  5E84 A;  3I8B A;  4BQZ A;  3CIP A;  4B1W B;  5LJV A;  1Z6R A;  4H0P A;  3ZX2 A;  1HX1 A;  3BF1 A;  2QWQ A;  4E1J A;  4KBO A;  3C0B A;  2QWN A;  2GWJ A;  3VES A;  5KPT A;  3FGU A;  3UKR B;  5KQD A;  2ASP A;  2A3Z A;  5KQ8 A;  3TPQ A;  4CBX A;  3FZL A;  1NGB A;  3R6M A;  4FSV A;  4BRO A;  4IJA A;  1WUA A;  3O08 A;  1NWK A;  1QQO A;  2QWM A;  4QS8 A;  3GE1 A;  4DHY A;  4BG8 A;  4J8F A;  1IG8 A;  3ZEU A;  4H0O A;  2ZGZ A;  2Q97 A;  2Q0R A;  2VYP A;  3W3D A;  1K8K B;  4H5R A;  5AZI A;  3UKU A;  1X3N A;  5EOY A;  2A40 A;  2V52 B;  1U2V A;  4BC5 A;  4BRI A;  4FWM A;  5AQO A;  1YXQ A;  4BRL A;  3HZ6 A;  1Z05 A;  3O80 A;  1ZBS A;  4B1U B;  3FR0 A;  4AM6 A;  1J6Z A;  2IVO A;  3EO3 A;  1BWF O;  2H3G X;  2YHY A;  4EHU A;  2E1Y A;  3FZF A;  3MN9 A;  3ATU A;  1BA1 A;  5JLF A;  1ZC6 A;  4M63 C;  5EXW A;  1MWK A;  1TYQ B;  1BOT O;  3BF3 A;  4BRQ A;  3H6E A;  1ZXO A;  5ADX H;  5FPE A;  1T6D A;  3AAQ A;  4CD3 A;  3M1F A;  5I9E B;  2I7P A;  5KPR A;  1TUU A;  2E2P A;  3MN6 A;  4Y0W A;  2FSJ A;  3IFR A;  3WQT A;  1SAZ A;  3QIC A;  1P8Z A;  4GY2 B;  2OAN A;  1GLB G;  1ATS A;  1QQN A;  4FWL A;  3HBT A;  2EWS A;  3VEN A;  2NRH A;  2P9L A;  3ULE A;  3I33 A;  3VET A;  5AQX A;  5AZI B;  3UKU B;  5AQG A;  2QWP A;  4BVP A;  5BPM A;  1ATN A;  3CJ9 A;  3CER A;  3U9Z A;  3QDK A;  1E4G T;  2ASM A;  4H03 B;  2D0O A;  1HKG A;  3DXM A;  5F1X A;  3LDN A;  4L3Q A;  3JS6 A;  4K43 A;  3LDQ A;  1JCG A;  1NGE A;  1Q18 A;  3O1W A;  3G25 A;  2P9S A;  3UE5 A;  2D1K A;  2D4W A;  5AQL A;  3HI0 A;  2YJF A;  3WXK A;  1HPM A;  2P9L B;  1MA9 B;  1X3M A;  3MN7 A;  3ULE B;  3RSE A;  4BGB A;  4CBW A;  4HWI A;  5AQV A;  3B8A X;  3DAW A;  3W0L A;  3O6W A;  3LM9 A;  3ZET A;  3LDL A;  5AZJ A;  3U4L A;  4JNE A;  3MN5 A;  3R9P A;  4K42 A;  4BRG A;  3FFK B;  2YHX A;  4BR0 A;  2HF4 A;  3H46 O;  4IXC A;  1KAY A;  2Q2R A;  4FPA A;  2A5X A;  4RTF D;  1GLA G;  3EN9 A;  3GG4 A;  1NGH A;  5KPZ A;  2GWK A;  3CJC A;  4BR4 A;  2CH6 A;  3RSE B;  1QZ5 A;  2P9N A;  2FF6 A;  4ISG A;  3WT0 A;  4A62 A;  3WXJ A;  1GLF O;  2E20 A;  4BRP A;  1NGF A;  3AAP A;  3ZET B;  3SMS A;  4FWN A;  1NGJ A;  5BPN A;  3CJ7 A;  1GLD G;  3DXM B;  4CZE A;  2P9U B;  3H3O B;  1BG3 A;  5BRH A;  4A61 A;  3C7N A;  4IZ9 A;  2P9S B;  4BC3 A;  4EFH A;  1RGI A;  3FZM A;  1S22 A;  4CJ7 A;  3GOI A;  4H5W A;  5JLH A;  1NBW A;  2P9N B;  3SK3 A;  4K25 A;  1NMD A;  3LM2 A;  3ZEU B;  2CGJ A;  2NZT A;  1JCF A;  4IO8 A;  5AFU H;  4FO0 A;  3BP8 A;  2YHW A;  4CZG A;  4WQ5 C;  3VEX A;  3ZX0 A;  3ENH A;  5AQY A;  3A5O C;  4DQ8 A;  5AFU A;  4Z94 A;  3P4I A;  2GEL A;  1HLU A;  3WUH A;  4JD2 A;  1NM1 A;  3MMV A;  3GBT A;  4B1V A;  1GLL O;  4GNI A;  4H5T A;  4C23 A;  2YCH A;  3QBX A;  3FLC O;  4FWK A;  5F0X A;  2A42 A;  4HTL A;  1BO5 O;  3MCP A;  1YUW A;  4BRK A;  3DXK A;  1LOT B;  4BR2 A;  4A2B A;  2FSK A;  1G99 A;  1TYQ A;  3VEW A;  5AQK A;  1QZ6 A;  4DB3 A;  4BG9 A;  3ZX3 A;  1SQK A;  3VGK A;  4JN4 A;  2VCP A;  1XC3 A;  4PL7 A;  2D0P A;  1DEJ A;  1GLE G;  4EIA A;  2E2N A;  4CZK A;  1DKG D;  4PL8 A;  4XEI A;  2QW9 A;  3VPZ A;  4BR9 A;  2BUP A;  4JHD A;  3U8X A;  3HM8 A;  3C7N B;  4BR7 A;  5EY4 A;  3M6G A;  4IJN A;  1BUP A;  4CZF A;  5BN9 A;  1S3X A;  2GTD A;  2VWB A;  2V51 B;  3WXI A;  4BC4 A;  5CE3 A;  4CZI A;  1IJJ A;  2F9T A;  3FZH A;  1BA0 A;  1V4S A;  3MDQ A;  4FOE A;  3L0Q A;  2AA4 A;  4BGA A;  4CI6 A;  1D4X A;  4I6M B;  2HF3 A;  3D2E B;  5JIC A;  2HMP A;  3EKU A;  3J8A A;  3QFP A;  2E88 A;  4NB4 A;  5AR0 A;  3VOV A;  5AQM A;  4JD2 B;  4EAH D;  3WEE B;  3UB5 A;  3CQY A;  5LY3 A;  2E8A A;  3D7E O;  3BUZ B;  4QS9 A;  2QWR A;  2QWO A;  3H1V X;  4K41 A;  4WQ5 A;  4QS7 A;  2W41 A;  5BRE A;  2ZWH A;  4FL9 A;  1SZ2 A;  3ATV A;  1QQM A;  1ESV A;  5AQU A;  2Q0U A;  5AQT A;  2KHO A;  3L6Q A;  4BRM A;  1HUX A;  4I6M A;  4XH4 A;  3VF4 A;  3D2E A;  2QWL A;  1U2V B;  4WYB A;  2PBD A;  4CZH A;  3TU5 A;  3CI5 A;  5AQP A;  2A6A A;  3L4I A;  4H5V A;  3S41 A;  2QXL A;  4MO5 A;  3H45 C;  3VF2 A;  1NGC A;  2IVP A;  4BRN A;  5LJW A;  1RDW X;  3JXU A;  3IMX A;  3VEV A;  4BRF A;  2FLO A;  3HTV A;  4BVO A;  1NGI A;  3HSC A;  1CZA N;  2UYT A;  4JAX A;  3MK6 A;  5AQR A;  5AQS A;  5F2R A;  2F9W A;  4XH5 A;  2BTF A;  3AY9 A;  2P9P B;  5ELZ A;  3WXL A;  3LDP A;  3QB0 A;  4CZM A;  3CET A;  2P9K B;  4NO7 A;  5AQQ A;  3WQU A;  4PKI A;  5JMV A;  1RFQ A;  3ID8 A;  1HKB A;  5EVZ A;  3WEE A;  3H3N O;  1C0F A;  4H0V B;  1MDU B;  3EL2 A;  3O8M A;  4BRE A;  3SLC A;  3R8E A;  4BR5 A;  3VEO A;  1U6Z A;  1KAX A;  5FPD A;  4DCH A;  4FWR A;  4BRA A;  2IIR A;  1GLC G;  3QFU A;  1R59 O;  2PAV A;  4BQL A;  2P9K A;  2CGK A;  4CD1 A;  3A8Y A;  3O5B A;  1KXP A;  4FPB A;  3IDH A;  4YDU A;  2CH5 A;  3KHY A;  3M3Z A;  1E4F T;  5AQW A;  5B8H A;  3EZW A;  1BU6 O;  3H1Q A;  4CZL A;  2WUS A;  3GL1 A;  2FXU A;  3EKS A;  3VGL A;  1EQY A;  4MO4 A;  3OHR A;  4IWV A;  1XUP O;  2I7N A;  3A5N C;  5AZJ B;  4AM7 A;  4FOI A;  2P9I A;  2P9P A; 
#chains in the Genus database with same CATH topology
 4FJ7 A;  4B9Q A;  5AQF A;  5BRF A;  4KRF A;  1GLJ O;  4AIL C;  5C24 A;  2HHT A;  3VQQ A;  3T69 A;  3K5M A;  3NAE A;  4PQU A;  3DM2 A;  3AO2 A;  3PUF A;  4NXM K;  1H1V A;  3CJ1 A;  2GEM A;  5HP1 A;  4FJ9 A;  4YDU C;  1RDU A;  4JHD B;  3NF6 A;  2OZS A;  5AQZ A;  3M5R A;  4CK1 A;  3VF6 A;  3OYD A;  3L2U A;  3JYT A;  4BDZ A;  4FYD A;  2V7Y A;  4ELV A;  2WFB A;  2HBJ A;  1BCM A;  1ZBL A;  4FWQ A;  3BEX A;  1HMV A;  3QBW A;  4FJL A;  4IEE A;  3LP1 A;  5GIO A;  2HVH A;  2X6N A;  4ISF A;  4CZJ A;  2CGL A;  1NGA A;  2G8U A;  4PY5 A;  4X64 K;  2HHH K;  5E26 A;  4LC9 B;  5AQN A;  3LDO A;  1SL1 A;  4MLH A;  1CZ9 A;  4BEB A;  2OPP A;  1G15 A;  4DTM A;  1KC8 O;  3VER A;  2YNG A;  3KK7 A;  1KFS A;  4CJU A;  4KB1 A;  1JLB A;  3SMP A;  3V6D A;  4H0T B;  4M41 A;  2ZJR L;  1NKE A;  4F9O A;  5KI6 A;  3K5O A;  1Q7Y O;  1EWQ A;  3U3Y A;  4ID1 A;  3MXM A;  3PLA A;  2JWK A;  3L8B A;  4GVE A;  4CW7 B;  4E89 A;  4C8O A;  3VQ8 A;  3P39 A;  5KGW A;  3SQ2 A;  1JJ2 M;  3MX5 A;  4Y1D A;  1YVN A;  3CCL N;  1V4T A;  2V7Z A;  4EZ6 A;  3CME N;  1BCO A;  3THX B;  3VQ6 A;  5C10 A;  4ELU A;  4DR1 K;  4FWP A;  5H1S Q;  1JL2 A;  2ZJQ L;  2O8B B;  4FWS A;  2J4R A;  5E84 A;  1XMQ K;  4JYA K;  4GKJ K;  3RMA A;  3CIP A;  4B1W B;  3B6O A;  3J81 O;  1Z6R A;  4H0P A;  5GAE P;  2C1G A;  5SZT A;  4DTS A;  3TAR A;  4KBO A;  3C0B A;  3BZK A;  2QWN A;  3K5L A;  3OJU A;  2G8K A;  5KPT A;  4B9U A;  2VQF K;  1VQ7 N;  5KQD A;  4JK9 A;  3TPQ A;  3OYI A;  2DTU A;  4LF5 K;  3DRS A;  3V9Z A;  4BRO A;  5HRR A;  1YF5 L;  3GE1 A;  4CJL A;  3NGZ A;  1BIZ A;  4E7L A;  1YIT N;  2ZGZ A;  1WSF A;  2VYP A;  3LP0 A;  4H5R A;  5AZI A;  1NJW A;  3V9U A;  3TAP A;  4FWM A;  4B9L A;  5AQO A;  3I56 N;  4BRL A;  1EO1 A;  1Z05 A;  3VQC A;  2KKZ A;  4IKF A;  3I55 N;  4CJQ A;  4U67 L;  1J6Z A;  3EO3 A;  3TSU A;  4EHU A;  2E1Y A;  3KLF A;  1REV A;  3OYL A;  2B5J A;  1ZC6 A;  3SJJ A;  4YOT A;  3SUP A;  1KVB A;  3CCU N;  4CD3 A;  2NRR A;  4I2P A;  2I7P A;  5KPR A;  3LZJ A;  4N41 A;  3SQ0 A;  1P8Z A;  3VQB A;  3HJF A;  4GV9 A;  4A59 A;  4OLB A;  1KFD A;  1W2B M;  3KWG A;  2NRH A;  2UXD K;  2ZD1 A;  3VQ4 A;  5AQX A;  5AZI B;  5AQG A;  1T03 A;  2KZZ A;  1FW6 A;  5BPM A;  4CGD A;  3CJ9 A;  4CFA A;  3CER A;  3SUQ A;  5HRO A;  4DV3 K;  3DXM A;  5F1X A;  4FJX A;  3LDN A;  1BI4 B;  4JEP A;  3VA0 A;  4FZX C;  1VQL N;  2X74 A;  4R5P A;  2D1K A;  2D4W A;  1B9D A;  3K9K A;  5KRS A;  1KSP A;  3LP3 A;  2P9L B;  1MA9 B;  3O9T A;  2UUC K;  4NCG A;  3TAM A;  2F4V K;  3HT3 A;  4IOC L;  1NJY A;  3DAW A;  3O6W A;  3MEC A;  1D9F A;  2HVI A;  3OYE A;  2EHG A;  1L5U A;  4CGF A;  3H46 O;  2Q2R A;  3CFP A;  3QIN A;  3KLE A;  4LSL A;  4DFJ A;  4Z4G A;  3EN9 A;  3TWH A;  5KPZ A;  4JKC A;  3AO4 A;  1N5Y A;  4ISG A;  2FF6 A;  3CCJ N;  4CEE A;  3CFO A;  2E4L A;  4JI8 K;  4KHY A;  2RHK A;  3CJ7 A;  4RW7 A;  3DXM B;  3HK2 A;  5BRH A;  2EX3 A;  5DMR A;  4GW6 A;  4CFC A;  4IZ9 A;  4FK4 A;  4LSN A;  2IS3 A;  2OZM A;  1RGI A;  1N8R O;  1U4B A;  4AHC A;  1EET A;  1Q86 O;  4DSK A;  1S22 A;  4CJ7 A;  5JLH A;  1RDC A;  4DSL A;  1NBW A;  2P9N B;  1VQN N;  3QLH A;  2NZT A;  3V9W A;  5AFU H;  3OA9 A;  3R3L A;  4LF9 K;  4DU4 A;  4B9T A;  5AFU A;  3ZSZ A;  4Z94 A;  1KTQ A;  1WB9 A;  5GIN A;  4JD2 A;  2ZM6 K;  1QHT A;  3TAF A;  1BIU A;  1QSL A;  4IFV A;  3T19 A;  4FM2 A;  3AA2 A;  5K14 A;  1YJN N;  4QCL A;  4HTL A;  1BO5 O;  1YUW A;  1OVY A;  1VQ8 N;  4FCY A;  1TYQ A;  3VEW A;  3QER A;  5CYQ A;  1QZ6 A;  3HXM A;  2B4J A;  4DB3 A;  4FZZ A;  1N32 K;  1BIS A;  2Z1G A;  2ZE2 A;  4BG9 A;  5J2M A;  4JN4 A;  1J53 A;  4OKK A;  4CF9 A;  4PL7 A;  2D0P A;  3NF8 A;  3NF7 A;  3K57 A;  4WFA L;  4RW9 A;  4JKA A;  3VPZ A;  3HM8 A;  4KHW A;  3LZI A;  5EY4 A;  5BN9 A;  1HYV A;  2NNW A;  4CEZ A;  5CE3 A;  4CEB A;  3OYC A;  4B3O A;  2XY7 A;  1VQ5 N;  1BA0 A;  4I9L A;  3L0Q A;  3OYK A;  2AA4 A;  2BDP A;  4BGA A;  4CJV A;  4JS4 A;  1A5V A;  3DMJ A;  1T3V A;  1R0A A;  1SKS A;  4OPH A;  2KFZ A;  2HMP A;  5AJ3 K;  3EKU A;  4NB4 A;  4KTW A;  4JD2 B;  4CCH A;  4WQ5 A;  2VG5 A;  3WNG A;  4EP4 A;  2Z1H A;  3RR7 A;  1O13 A;  4QS7 A;  3ZT2 A;  1VQP N;  5IT9 O;  1QVG M;  4KPY A;  5AQT A;  4BRM A;  2PZS A;  3VF4 A;  4BEC A;  3LAM A;  4WYB A;  2PBD A;  1S1V A;  3BZC A;  1VQO N;  3OY9 A;  1NK4 A;  4IBN A;  5AQP A;  3G6E N;  1IV0 A;  5M1Q A;  1NNE A;  3THW B;  1WBD A;  2QXL A;  2QXF A;  3H45 C;  3VF2 A;  1NGC A;  3O4Q A;  1S6P A;  4BRN A;  5LJW A;  2OYQ A;  3VEV A;  4BVO A;  2FLO A;  3HTV A;  4BRF A;  1NGI A;  4HCC A;  5AQS A;  1IKY A;  4DWI A;  2F9W A;  3AY9 A;  3CM6 A;  2P9P B;  5KRT A;  3QB0 A;  3CET A;  3VQ5 A;  1DT9 A;  3G0Z A;  4PKI A;  5JMV A;  1RFQ A;  3ID8 A;  4AHS A;  5EVZ A;  3WEE A;  3H3N O;  4RW4 A;  1C0F A;  4H0V B;  4WE1 A;  1MDU B;  1MU2 A;  3EL2 A;  3AVN A;  1JLG A;  3SLC A;  3R8E A;  4DTO A;  2YNI A;  1KAX A;  3NBP A;  4BRA A;  1YJW N;  4E7K A;  4KHS A;  2NRZ A;  2FBX A;  3A8Y A;  5C2F A;  1Q8I A;  3IDH A;  3M3Z A;  4B9V A;  4DLG A;  1M1K O;  3WNE A;  1BQN A;  4KAZ A;  5CHI A;  2F8T A;  4DU3 A;  3THW A;  2OTJ N;  1JXE A;  2GBZ A;  3HVT A;  4DR7 K;  3DLR A;  4FJM A;  3QO9 A;  1S1T A;  2FXU A;  3VGL A;  1EXQ A;  1BHL A;  1XUP O;  5LL6 Z;  3L3U A;  3C6A A;  4FOI A;  2P9I A;  4CGJ A;  2P9P A;  5FRN A;  3PX6 A;  4H0X B;  4IDH A;  1RTH A;  4OO1 J;  5D3G A;  3VTI A;  1L3U A;  3AV9 A;  3MCA B;  5TKY A;  4BC2 A;  3IUC A;  2A41 A;  4ILH A;  3O4N A;  1LAW A;  2ETJ A;  2FF3 B;  4M7Y A;  3V1Q A;  4YOR A;  4CJW A;  5LMN K;  4CF2 A;  1T44 A;  3TSQ A;  3O9S A;  2BAN A;  4ILG B;  1ZBF A;  3LPU A;  4NCB A;  2HOE A;  2IDO A;  4LF8 K;  3RWU A;  1RT5 A;  4FLY A;  4O55 A;  1TK0 A;  4XJX A;  1X9J A;  3QIP A;  4A57 A;  2ITM A;  4B1Z A;  1KLM A;  1UA1 A;  1IKW A;  4BRC A;  2O8F B;  3O4W A;  3R1X A;  1S9E A;  1TGO A;  2BH1 A;  4DG1 A;  4O4G A;  4AHT A;  4EHT A;  3ULD A;  4DKW A;  4X65 K;  3G10 A;  2QKK A;  3AVL A;  4CEQ A;  2E2Q A;  4DS5 A;  4DQI A;  5ADX A;  4W5T A;  1KAZ A;  3U9D A;  1ATR A;  3CJB A;  2NLX A;  1L3T A;  3PSF A;  4OPK A;  3IRX A;  3DLE A;  3F9M A;  3DRP A;  3ZSR A;  3QEI A;  1QHA A;  4ZTF A;  1NGG A;  1W9H A;  4E3S A;  3SBT A;  1BDG A;  2PYJ A;  4E19 A;  4JKE A;  1SL0 A;  2IOC A;  4YOU A;  1K9M O;  4Z4I A;  5BR8 K;  4BRH A;  5JS1 A;  4F2R A;  2Q1N A;  4FJN A;  2D0C A;  4PKH A;  4DLE A;  1T05 A;  4DTP A;  3DJC A;  2BE2 A;  3DWL A;  4HUF A;  2FC0 A;  3KZB A;  3ENO A;  5CZ1 A;  2O4G A;  1YJ9 N;  3KTQ A;  1ZBH A;  5LJV A;  3OBW A;  4K8Z A;  3ZX2 A;  3PX0 A;  2KZM A;  2QWQ A;  4DTX A;  3AVB A;  4IFY A;  3HPO A;  3VES A;  2G8F A;  2ASP A;  2VG7 A;  5DK5 A;  1WAJ A;  3FZL A;  1TL1 A;  2GUI A;  3R6M A;  1C0M A;  4N5S A;  2JLE A;  4IEI A;  2VQE K;  1QQO A;  3E66 A;  3IKM A;  4GVM A;  4ILJ A;  4QS8 A;  3NHG A;  2QA4 N;  2O8E B;  1RTJ A;  4J8F A;  1IG8 A;  3T1Y K;  3G71 N;  2Q0R A;  3EEQ A;  4MDB A;  3PV8 A;  3DLG A;  3K5N A;  5J2Q A;  3HZ6 A;  3V9S A;  4B3R K;  1JLF A;  2HB5 A;  4B1U B;  4CJP A;  4JK8 A;  5FLX O;  3FR0 A;  1VQ9 N;  3AVK A;  4FJH A;  3Q7C A;  2H3G X;  4LF6 K;  3AVG A;  4CJR A;  3HL8 A;  3MN9 A;  1N36 K;  2HW3 A;  1TL3 A;  4JI6 K;  1QQC A;  4M3W A;  5EXW A;  1MWK A;  2HHV A;  1BOT O;  3BF3 A;  4BRQ A;  4E72 A;  3OW2 M;  1SS6 A;  3AAQ A;  4AHR A;  5I9E B;  2YHA A;  3KLG A;  4I2Q A;  1XNR K;  1TUU A;  2E2P A;  4Y0W A;  2FSJ A;  3IFR A;  1SAZ A;  2VGM A;  1RNH A;  1RCH A;  4GY2 B;  2OAN A;  1GLB G;  2W42 A;  4FWL A;  2I5J A;  3BY5 A;  3O3G A;  3VEN A;  2KW4 A;  1RT6 A;  5M1F A;  1TK5 A;  1IBK K;  3TTC A;  3ULE A;  4DQS A;  2WTU A;  5HOO A;  3EYZ A;  3CQ8 A;  2D0A A;  1YTA A;  4CEO A;  4WFN L;  3RMB A;  4A5B A;  4H03 B;  1QTM A;  4GV6 A;  4IO9 L;  4CEC A;  3HM9 A;  4L3Q A;  1BGX T;  4E1N A;  1XMO K;  2FBY A;  4M3Z A;  5GIP A;  3S5T A;  3EZ5 A;  2P9S A;  3P38 A;  3O9U A;  3HI0 A;  2YJF A;  3WXK A;  4CFD A;  3RSE A;  4BGB A;  1NK0 A;  4F8R A;  4DR4 K;  3O9R A;  1YI2 N;  5M1N A;  3CFR A;  4CES A;  3ZET A;  3LDL A;  4IG0 A;  3U4L A;  1QSS A;  4JNE A;  1OVQ A;  3AGR A;  1W7A A;  2Y1J A;  3FFK B;  2B6A A;  4KTZ A;  3CG7 A;  2HF4 A;  1TKZ A;  2HND A;  3O3H A;  3VN5 A;  2O8B A;  3G4S N;  4CK3 A;  1QZ5 A;  1RBT A;  4A62 A;  2DFH A;  3L3V A;  3WXJ A;  5JVG L;  2E20 A;  4DUZ K;  4JI3 K;  3SMS A;  3QNO A;  1GLD G;  5C12 A;  3H3O B;  2OPR A;  4V19 S;  4A61 A;  3KK1 A;  4CHZ A;  3KKR A;  2P9S B;  3FZM A;  3GOI A;  1LW2 A;  4H5W A;  4BE2 A;  3TAN A;  5M1P A;  4N76 A;  3IAY A;  4PA1 A;  3F73 A;  3AA3 A;  2CGJ A;  4IO8 A;  4DSI A;  3DLL L;  3BP8 A;  3RVC A;  4WQ5 C;  3VEX A;  2HNY A;  2E6L A;  3QIO A;  4UQG A;  4DQ8 A;  1YT3 A;  2JWL A;  3WUH A;  1NM1 A;  3MMV A;  4B1V A;  1GLL O;  4IFE A;  4M3T A;  4JI0 K;  2OCE A;  3E9L A;  1C0T A;  1RDA A;  2NRT A;  2RF2 A;  3FLC O;  5F0X A;  4C8N A;  4JKB A;  1TVR A;  3TAE A;  3QEP A;  2Q3S A;  3VQD A;  3EY1 A;  3CD6 N;  1LOT B;  4K8X A;  4ID5 A;  5T7B A;  1G99 A;  4FM0 A;  4JI1 K;  4FW1 A;  4E1M A;  1NK7 A;  1CZB A;  3WXM B;  1SQK A;  3VGK A;  2YNF A;  3AVJ A;  3M8R A;  1IH7 A;  3LDS A;  1EP4 A;  4KHU A;  1GLE G;  1HNI A;  3S3M A;  2QI2 A;  1IO2 A;  1DKG D;  4BR9 A;  4LFB K;  3KLH A;  3U8X A;  3QEW A;  4IJN A;  1DTQ A;  2GTD A;  2VWB A;  2V51 B;  3WXI A;  4BC4 A;  4CZI A;  1IJJ A;  3OJS A;  1WSJ A;  3MDQ A;  3V1O A;  2W6L A;  4O0J A;  4JI7 K;  4CI6 A;  1D4X A;  3KIO A;  4I6M B;  1NMN A;  1WLJ A;  2HF3 A;  4H8K A;  3J80 O;  1LAV A;  4R79 A;  2X6S A;  2HHQ A;  4DQR A;  3VOV A;  1HPZ A;  4EAH D;  4KKO A;  2YKM A;  4LY7 A;  3D7E O;  3BUZ B;  2R7Y A;  4WCE L;  3HRG A;  4DSF A;  1FXX A;  3T3F A;  1Q9X A;  4KI4 A;  4CFB A;  3B6P A;  4JK7 A;  1ESV A;  3P83 D;  5KGX A;  3OYF A;  2ATQ A;  2KHO A;  3L6Q A;  1LWF A;  3D2E A;  4CJ3 A;  4Q5V A;  1S6Q A;  4CZH A;  1NU0 A;  1A5X A;  3TU5 A;  3CI5 A;  1C6V A;  3L4I A;  4BE0 A;  3ZSW A;  4CJ5 A;  4MO5 A;  1WSI A;  3BDP A;  4FLW A;  3CCE N;  1RDW X;  3F2K A;  1RTD A;  3ID6 A;  3HPH A;  4W5N A;  1CZA N;  5F2R A;  3OYM A;  3KK3 A;  1OH5 A;  4XH5 A;  2BTF A;  4JS5 A;  1Q81 O;  1NOZ A;  2HNZ A;  3WXL A;  3D6R A;  4CZM A;  3QEX A;  2PFU A;  2UU9 K;  4MDA A;  3ISN C;  1KLN A;  1HKB A;  4CHQ A;  1FK9 A;  1XHX A;  3J7Y P;  3ALY A;  5HRN A;  3DOL A;  4AF1 A;  4W5R A;  3OS2 A;  4CJK A;  4IG3 A;  3VEO A;  1U6Z A;  5FPD A;  2A1S A;  4KFB A;  4JKG B;  2IIR A;  1R59 O;  1XC9 A;  4BQL A;  2CGK A;  3O5B A;  1ASU A;  1ASV A;  3AVF A;  4YDU A;  3DLB A;  1NK8 A;  4IOX A;  3NE6 A;  2Z1J A;  2QK9 A;  1J5E K;  3EZW A;  1RBU A;  3GL1 A;  1EQY A;  4MO4 A;  4IWV A;  3ZYY X;  4EZ9 A;  3HPG A;  4BAC A;  2I7N A;  4RW8 A;  5AZJ B;  3OYG A;  3RTV A;  3U3G A;  3CF5 L;  1JCE A;  5C15 A;  2E6M A;  4FJK A;  3PO4 A;  4WQ4 C;  3A5L C;  3HOS A;  4C1N I;  2W40 A;  4XIU A;  4FM1 A;  2GUP A;  2VWK A;  3HST B;  4O8K A;  2QM1 A;  4BRD A;  4B8A B;  3CJA A;  3ZSY A;  5JEN A;  1HJO A;  1S9G A;  3O1B A;  1TUY A;  1VQM N;  1ITG A;  3TR8 A;  3E01 A;  4M7X A;  2XHB A;  3ZT0 A;  3VEY A;  5HBM A;  5LMU K;  4M3X A;  1HKC A;  1Y97 A;  1YAG A;  4B1X B;  4PUO A;  4NYN A;  4RW6 A;  2AP1 A;  5FPM A;  1L3V A;  4JRQ A;  5I42 A;  2HHX A;  3PSI A;  3LP2 A;  4XH1 A;  3FZK A;  2G8V A;  3AO5 A;  1GOB A;  5FDL A;  3LL3 A;  4LH5 A;  3QES A;  2DFF A;  2P9U A;  3CC4 N;  3MX2 A;  3K9J A;  5AQJ A;  4RWT A;  4CED A;  4FW2 A;  2Q31 A;  2OTL N;  1XQS C;  1FKP A;  2ASO A;  4JI2 K;  3AA4 A;  5AQH A;  5JS2 A;  2P9I B;  5FPN A;  1GOA A;  1Y64 A;  1CXU A;  1M90 O;  2JGU A;  1EX4 A;  5BRD A;  3D2F B;  4BDP A;  5CR4 A;  1NLV A;  1JLQ A;  1OH6 A;  4JI4 K;  3KVG A;  3OYJ A;  3C95 A;  4G1Q A;  3CQX A;  1K8K A;  1LCU A;  2Q36 A;  4RCH A;  1I3A A;  3DXK B;  4QAG A;  2O4I A;  1K73 O;  1U47 A;  2AJQ A;  2D5R A;  3ITH A;  4CF1 A;  1X9M A;  2XRI A;  1NJX A;  1X9S A;  4ISE A;  4HUE A;  1OH8 A;  4YNQ A;  1IKV A;  2W00 A;  4FLT A;  4M3R A;  2KTQ A;  4FK2 A;  4BQZ A;  5FRM A;  2FBT A;  2QEX N;  4CIE A;  1NJZ A;  4DR5 K;  4AH9 A;  4O0I A;  3IS9 A;  4AHU A;  4E1J A;  2GWJ A;  1XNQ K;  3FGU A;  4KTQ A;  4Y1C A;  3HP9 A;  3LPT A;  4JLH A;  4DV2 K;  4CJT A;  5KQ8 A;  2KLA A;  4TSX A;  2RN2 A;  2OPQ A;  4X62 K;  3K59 A;  4X66 K;  4FSV A;  2O8D A;  3OYB A;  4IJA A;  3D0P A;  1WUA A;  3EE8 A;  4OGE A;  1NWK A;  4DTR A;  4DHY A;  3SAF A;  4B3M K;  2IC3 A;  4I7F A;  3ZEU A;  3L2V A;  2Q97 A;  3W3D A;  3UKU A;  1X3N A;  5EOY A;  2V52 B;  4BRI A;  4N47 A;  5MLC Q;  4YFU A;  2RPI A;  4KV8 A;  3O80 A;  1Z26 A;  3TAB A;  1ZBS A;  5JVH L;  2KFN A;  1BWF O;  1HQE A;  4W5Q A;  3K58 A;  4QOZ B;  3ATU A;  1BA1 A;  4HCB A;  3DYA A;  4M63 C;  4CE9 A;  3CC2 N;  3HO1 A;  4KHQ A;  1TYQ B;  1JLA A;  3H6E A;  1ZXO A;  5ADX H;  4OJR A;  5FPE A;  4C1N K;  3KJV A;  1VSL A;  3M1F A;  3MXJ A;  4O44 A;  2WBN A;  3I0R A;  1QVF M;  4DR2 K;  4DR6 K;  2DY4 A;  1XI1 A;  1HR0 K;  3WQT A;  1IBM K;  4L8R B;  4YOV A;  4CJS A;  3QIC A;  5C2D A;  2UUA K;  1BI4 A;  1ATS A;  1QQN A;  5CYM A;  3HBT A;  2G8W A;  1HYZ A;  2KQ2 A;  2EWS A;  5C42 A;  4DSE A;  1RT1 A;  3NH0 A;  3VA3 A;  4DU1 A;  4ZHR A;  4C8K A;  1CXQ A;  3NF9 A;  4CGI A;  2P9L A;  3SQ4 A;  3T1A A;  3KLI A;  3UKU B;  2X78 A;  1C1A A;  2QWP A;  3T7Z A;  4O8U A;  2FBV A;  3ASM A;  3QDK A;  3U9Z A;  2ASM A;  2PY5 A;  3VQ7 A;  3JS6 A;  1NK6 A;  3N4Q A;  1NGE A;  3O1W A;  4JI5 K;  3UE5 A;  5CY4 A;  1HNZ K;  4CHY A;  3ZLJ A;  5J1E A;  1HPM A;  3K2P A;  3EE9 A;  1X3M A;  3ULE B;  1RT2 A;  2HMI A;  4HWI A;  3JAM O;  5AQV A;  3E9P A;  1VAZ A;  4KO0 A;  4MQ3 A;  1D9D A;  5HRP A;  4NXN K;  5AZJ A;  5A2Q O;  2XY5 A;  3C6T A;  3MN5 A;  2YKN A;  3CPE A;  3CYG A;  1SKR A;  4FVU A;  4BRG A;  3I0S A;  1RBV A;  2XY6 A;  1T7P A;  4FPA A;  1GLA G;  1ZYQ A;  3GG4 A;  4BR4 A;  1NKB A;  2P5G A;  3AVA A;  3TTF A;  1VSH A;  2P9N A;  4LH4 A;  3TI0 A;  3WT0 A;  1VSF A;  5J2N A;  1JL1 A;  1SL2 A;  1GLF O;  4CGG A;  2OA8 A;  1EKE A;  4OVL A;  4BRP A;  3ZET B;  4FWN A;  1NGJ A;  4F4K A;  5BPN A;  3CXC M;  3DI6 A;  3MAQ A;  4CZE A;  2P9U B;  4OPA A;  3VQA A;  3C7N A;  3MWT A;  4EFH A;  3OBY A;  4CHO A;  4CVN E;  4BWJ A;  1J9A A;  4GV3 A;  1YTU A;  4K25 A;  1NMD A;  1JCF A;  3MEG A;  4FO0 A;  1WSG A;  4BWM A;  3ENH A;  4DR3 K;  3A5O C;  3P4I A;  2GEL A;  5M1K A;  1HLU A;  4DV4 K;  3GBT A;  2UUB K;  4PWD A;  5C25 A;  2YCH A;  3J7A P;  3J7Z O;  3RRG A;  2A42 A;  3L2W A;  3F9K A;  3MCP A;  4AHV A;  4BRK A;  3DXK A;  3OS0 A;  4BR2 A;  4FVM A;  3SV3 A;  3T1H K;  2VGN A;  1S1X A;  4CIG A;  3SAH A;  1W0H A;  3CMA N;  1FKO A;  3PX4 A;  1BQM A;  2YX6 A;  3DOK A;  3O3F A;  4FLX A;  4CIF A;  1NK9 A;  1VSI A;  3OS1 A;  1X9W A;  2HHI A;  2NRX A;  1IBL K;  2E2N A;  2HBK A;  3ZT1 A;  4KHN A;  3VTH A;  4PL8 A;  4XEI A;  4IDK A;  4JHD A;  1JXB A;  1IKX A;  3CPW M;  1BUP A;  1VQK N;  2W6K A;  4A5A A;  4UY8 O;  1V4S A;  1VRU A;  4CJE A;  2XY8 A;  4JKF A;  2OPS A;  4B9S A;  1BL3 A;  1TKX A;  1VSJ A;  5I3U A;  2NRW A;  1N6Q A;  3QFP A;  5AR0 A;  2E88 A;  2D0B A;  3CQY A;  5LY3 A;  2Z1I A;  5CZ2 A;  3ZCM A;  4W5O A;  2QWO A;  3H1V X;  2O8D B;  1D8Y A;  1B92 A;  4C8L A;  1N33 K;  2W41 A;  2ZWH A;  4DV7 K;  3A2F A;  1SZ2 A;  1CLQ A;  1QQM A;  3PY8 A;  4FJG A;  5AQU A;  2Q0U A;  3I8D A;  4J2B A;  4KH4 A;  4E7J A;  1VQ6 N;  4XH4 A;  2HST A;  2QWL A;  1D5A A;  3C65 A;  1VSD A;  1RT7 A;  4BE1 A;  3OVN A;  3SNN A;  3M8S A;  3DRR A;  4U7B A;  4KI6 A;  1DLO A;  1KQS M;  4DF8 A;  1UA0 A;  1J5O A;  2F8S A;  1SV5 A;  4Z4H A;  2UXB K;  1WN7 A;  3P5J A;  3L2R A;  4NCA A;  3NDK A;  4CGH A;  3LAL A;  3CYM A;  3IMX A;  1S72 N;  1HJR A;  2UYT A;  4JAX A;  3MK6 A;  5AQR A;  3BGR A;  4FJJ A;  4I9Q A;  3S3O A;  2RKI A;  1EWR A;  5ELZ A;  5GAH P;  1IG9 A;  4CHN A;  2P9K B;  4OKJ A;  4FJ5 A;  4NO7 A;  3THY A;  4JKH A;  3OYA A;  3O8M A;  3NVM A;  4BR5 A;  3LAK A;  4Z4E A;  2LSN A;  4DFK A;  4DCH A;  1E3M A;  2YNH A;  1RDB A;  2WC9 A;  3QFU A;  3CCV N;  1LWE A;  5HLF A;  4CD1 A;  4O5B A;  1KXP A;  3SQ1 A;  3HOT A;  4H4M A;  3CCS N;  1QE1 A;  3AO3 A;  2CH5 A;  1E4F T;  4CF0 A;  5B8H A;  4ELT A;  1UWB A;  1BU6 O;  5KTQ A;  3N4P A;  4LF7 K;  3UIQ A;  4GMJ B;  1UAX A;  4CJ4 A;  4Z4C A;  4B3S K;  3KD5 E;  3OHR A;  3SI6 A;  3AVM A;  2UXC K;  4LD0 A;  4J2A A;  4FJI A;  4DTJ A;  3GDQ A;  1KVC A;  2ZGY A;  3AAR A;  5BN8 A;  1J54 A;  2Y1I A;  2A1R A;  1S5J A;  5C0Y A;  3THY B;  3M8P A;  3A5M C;  1VHX A;  1RBS A;  3VEZ A;  3DLK A;  4H5N A;  4IOA L;  1C1C A;  3E1Y A;  3SUO A;  3SPZ A;  4O5F A;  1RBR A;  4JRP A;  5BR9 A;  2O8F A;  5GAG P;  1XWL A;  4DV6 K;  4FWO A;  4E7I A;  2PYL A;  4YOX A;  3CHW A;  4B1Y B;  4OPJ A;  4DFM A;  3C94 A;  4KH5 A;  5E41 A;  3OYN A;  1OKJ A;  4MLE A;  5J2P A;  2O8C A;  2YI1 A;  4B3T K;  1FJG K;  4FLU A;  2E2O A;  3QET A;  3JSM A;  4A2A A;  4KB0 A;  2E1Z A;  1NGD A;  1T6C A;  3FE1 A;  4DV0 K;  3SJH A;  3C6H A;  4PKG A;  1GOC A;  1TKT A;  3A0I X;  4WFB L;  1LW0 A;  2ZQB A;  4OGC A;  3UKR A;  3OTO K;  4KRE A;  2NUB A;  1JLC A;  5AQI A;  1RDD A;  3VQP A;  4Q0B A;  1MWM A;  4DUY K;  1WOQ A;  4GKK K;  1KCF A;  4WQ4 A;  2DPN A;  3SCX A;  4AQY K;  4Z0U A;  4HVJ A;  2IGI A;  1N34 K;  2YV0 X;  4YOY A;  1LV5 A;  4KH6 A;  1DGK N;  4FZY A;  2VG6 A;  4CBU A;  3KWI A;  1C0G A;  5EX5 A;  4H0Y B;  2IVN A;  2VWJ A;  3LWM A;  2IAJ A;  1ZBI A;  4C8M A;  5BPL A;  2YJE A;  3RR8 A;  2ZF5 O;  2FSN A;  3D2F A;  4E0D A;  3QML A;  4FLZ A;  3NH1 A;  3VGM A;  4M42 A;  3ZSO A;  4CJF A;  3I8B A;  2O8E A;  1C0U A;  3M8Q A;  4DF4 A;  2DFE A;  3ENB A;  1U48 A;  1HX1 A;  3BF1 A;  3MXI A;  3SBG A;  3SUN A;  3V1R A;  3CCQ N;  3UKR B;  1HNX K;  2A3Z A;  4CBX A;  2QTD A;  3O9Q A;  1NGB A;  3E9O A;  3L4Q A;  5IWA K;  2G8I A;  3O08 A;  1KD1 O;  2QWM A;  2ZJP L;  3C6U A;  4BG8 A;  3KK2 A;  4H0O A;  3RMD A;  3CCM N;  3DLH A;  1K8K B;  2HHU A;  4CF8 A;  2A40 A;  4DV1 K;  1U2V A;  4BC5 A;  1DTT A;  4FXD A;  1YXQ A;  2C1I A;  3PIO L;  4AM6 A;  2IVO A;  3AVC A;  3RRH A;  2YHY A;  4NLB A;  1QSY A;  1VK0 A;  3FZF A;  3LAN A;  2XO7 A;  3SZ2 A;  3SYZ A;  5JLF A;  3CM5 A;  1YVU A;  4NYF A;  5HRS A;  1K8A O;  3V81 A;  2GV9 A;  1T6D A;  3AO1 A;  4K0K K;  1RT3 A;  2HHW A;  3MN6 A;  2GX9 A;  1T8E A;  4MFB A;  4DFP A;  3AA5 X;  1RT4 A;  4JV5 K;  4NLC A;  3V4I A;  1F21 A;  1Q9Y A;  4PHT X;  4OX9 K;  3PIP L;  3I33 A;  3VET A;  1S1W A;  3VMF B;  4BVP A;  1ATN A;  3RMC A;  3HYF A;  1E4G T;  1P90 A;  1SUQ A;  2D0O A;  1HKG A;  3KD1 E;  1TK8 A;  1WAF A;  3NH2 A;  3NFA A;  1LWC A;  4B9M A;  4K43 A;  4HHT A;  4F3O A;  3LDQ A;  1JCG A;  1Q18 A;  2E5L K;  3G25 A;  3ZSX A;  5AQL A;  4B8C A;  4CEF A;  3MN7 A;  4CBW A;  2WOM A;  1I39 A;  3TTD A;  4N56 A;  5SWM A;  1U04 A;  3HVR A;  3SV4 A;  4E7H A;  3B8A X;  3MED A;  3ZSQ A;  3W0L A;  3LM9 A;  2P1J A;  1RIL A;  4JKD A;  4DS4 A;  2QKB A;  1ZBU A;  3R9P A;  5DM6 L;  2F7T A;  4K42 A;  1WSH A;  1YHQ N;  4M3U A;  2YHX A;  1VSE A;  4BR0 A;  3AVI A;  4IXC A;  3TAG A;  1HNW K;  1KAY A;  2A5X A;  4RTF D;  1NGH A;  2GWK A;  3CJC A;  2CH6 A;  3RSE B;  3L2Q A;  1ILY A;  4CK2 A;  3TAQ A;  3NVK A;  4FJ8 A;  4CER A;  2YHB A;  3S3N A;  1NGF A;  3AAP A;  1YIJ N;  1O1W A;  2P5O A;  1K6Y A;  4DSJ A;  1TKD A;  4DQQ A;  2O8C B;  1NOY A;  1BG3 A;  1I94 K;  3ZSV A;  4BC3 A;  3ZT3 A;  2G8H A;  1VQ4 N;  3SK3 A;  3V9X A;  3LM2 A;  3S9H A;  1X1P A;  3ZEU B;  1KVA A;  2YHW A;  4CZG A;  5GAD P;  2F96 A;  1SKW A;  3ZX0 A;  5AQY A;  4H4O A;  1UOC A;  4BDY A;  1S1U A;  3U6F A;  3NCI A;  3IG1 A;  4GNI A;  3FFI A;  4H5T A;  1B9F A;  4C23 A;  3QBX A;  4HTU A;  4FWK A;  4B9N A;  3QEV A;  4M45 A;  4LFC K;  3AVH A;  5EU7 A;  4A2B A;  1TV6 A;  1A5W A;  2FSK A;  5AQK A;  4WF9 L;  2RE2 A;  4CHP A;  3QNN A;  3ZX3 A;  3LWL A;  2VCP A;  1XC3 A;  4FK0 A;  1DEJ A;  4BY9 C;  4EIA A;  4CZK A;  4DMN A;  3THX A;  2QW9 A;  2BUP A;  3C7N B;  4BR7 A;  3M6G A;  1TAU A;  4Z4F A;  4CZF A;  5DM7 L;  1S3X A;  3AGK A;  3MEE A;  3WNH A;  3NMU A;  5HL7 L;  2F9T A;  3P1G A;  3FZH A;  3VQE A;  4FOE A;  1Q82 O;  1NG9 A;  4KHP K;  3D2E B;  5JIC A;  4OKE A;  3J8A A;  3D45 A;  5M1O A;  5AQM A;  1U49 A;  3WEE B;  3Q7B A;  3UB5 A;  4LFA K;  2E8A A;  3OYH A;  3NGI A;  3MWP A;  3TSP A;  4QS9 A;  4G9Z A;  2HHS A;  2QWR A;  1WNS A;  4K41 A;  4RG8 A;  1TAQ A;  4M3Y A;  5BRE A;  4FL9 A;  3ATV A;  1WBB A;  3K0S A;  4DV5 K;  1HUX A;  1RTI A;  4I6M A;  1U45 A;  1U2V B;  3HP6 A;  1VSK A;  5FRO A;  2HBM A;  1XHZ A;  2A6A A;  3CCR N;  4H5V A;  3S41 A;  1NJI O;  4DQP A;  2IVP A;  1KRP A;  4YHH K;  2BGG A;  3WNF A;  3JXU A;  3HSC A;  1L3S A;  4EP5 A;  4OLA A;  1JLE A;  1Z25 A;  4JKG A;  2NRV A;  4DTN A;  1NK5 A;  3LDP A;  4HUG A;  3H08 A;  2P51 A;  4YOW A;  4FLV A;  1W97 L;  5AQQ A;  3F5T A;  2ITG A;  1VRT A;  3WQU A;  4B08 A;  3NGY A;  4J2E A;  1C1B A;  4BRE A;  1QS4 A;  2HBL A;  1HYS A;  3P31 A;  1NKC A;  4BE7 B;  3CC7 N;  1VSM A;  1OH7 A;  4FWR A;  3SAG A;  1GLC G;  1HQU A;  2PAV A;  3PO5 A;  2P9K A;  4F2S A;  4FPB A;  3KHY A;  3THV A;  5TKW A;  5AQW A;  1HRH A;  1JKH A;  4DTU A;  2WON A;  3SPY A;  4F3T A;  1ASW A;  3ZT4 A;  4ICL A;  3H1Q A;  4CZL A;  2WUS A;  4LF4 K;  3EKS A;  1HNV A;  3VQ9 A;  4J2D A;  1WSE A;  3KKS A;  4CEA A;  3A5N C;  4AM7 A;  4ZTJ A;  4YY3 K; 
#chains in the Genus database with same CATH homology
 1JCE A;  5C15 A;  4H0X B;  3GDQ A;  4IDH A;  5AQF A;  4WQ4 C;  4B9Q A;  3A5L C;  5BRF A;  4OO1 J;  2ZGY A;  3AAR A;  3VTI A;  3HOS A;  5BN8 A;  4C1N I;  3MCA B;  5TKY A;  2W40 A;  5C0Y A;  1GLJ O;  3A5M C;  3VEZ A;  4BC2 A;  2GUP A;  3T69 A;  3IUC A;  4H5N A;  4IOA L;  3E1Y A;  4O5F A;  2QM1 A;  4O8K A;  4BRD A;  1H1V A;  3CJ1 A;  2GEM A;  3CJA A;  5BR9 A;  2A41 A;  4ILH A;  4YDU C;  1HJO A;  5GAG P;  1RDU A;  3O1B A;  2FF3 B;  4JHD B;  1TUY A;  4M7Y A;  1VQM N;  4FWO A;  4YOR A;  5AQZ A;  3M5R A;  1T44 A;  4M7X A;  3TSQ A;  3O9S A;  3VF6 A;  3VEY A;  1HKC A;  4ILG B;  3CHW A;  4B1Y B;  1YAG A;  4B1X B;  2V7Y A;  4YOX A;  2WFB A;  2HOE A;  2AP1 A;  2HBJ A;  4KH5 A;  1OKJ A;  4MLE A;  5FPM A;  4FWQ A;  3BEX A;  2YI1 A;  3QBW A;  4XJX A;  1X9J A;  4XH1 A;  3FZK A;  2E2O A;  4A2A A;  4IEE A;  4A57 A;  2ITM A;  4B1Z A;  5GIO A;  2E1Z A;  4ISF A;  3LL3 A;  4BRC A;  2CGL A;  1NGD A;  4CZJ A;  1NGA A;  3O4W A;  2P9U A;  3CC4 N;  1T6C A;  3MX2 A;  3FE1 A;  3K9J A;  5AQJ A;  3SJH A;  4RWT A;  3R1X A;  3C6H A;  2Q31 A;  4PKG A;  2BH1 A;  2OTL N;  1XQS C;  3A0I X;  4WFB L;  5E26 A;  4LC9 B;  5AQN A;  3LDO A;  2ASO A;  1S72 N;  4BEB A;  4MLH A;  4EHT A;  4DKW A;  5AQH A;  2E2Q A;  3UKR A;  5ADX A;  2P9I B;  1KC8 O;  5FPN A;  1KAZ A;  5AQI A;  1ATR A;  3U9D A;  1Y64 A;  3VER A;  1M90 O;  3KK7 A;  3CJB A;  2NLX A;  5BRD A;  1MWM A;  3SMP A;  3D2F B;  1WOQ A;  4H0T B;  4WQ4 A;  3F9M A;  2ZJR L;  2DPN A;  5CR4 A;  1NLV A;  4F9O A;  1QHA A;  1Q7Y O;  1NGG A;  3SBT A;  3KVG A;  1BDG A;  3PLA A;  2JWK A;  4GVE A;  4YOY A;  4JKE A;  3CQX A;  1K8K A;  1LCU A;  2Q36 A;  3P39 A;  4KH6 A;  1DGK N;  4RCH A;  4YOU A;  1K9M O;  4BRH A;  4CBU A;  3KWI A;  1C0G A;  2Q1N A;  3DXK B;  5EX5 A;  4H0Y B;  2IVN A;  1K73 O;  1JJ2 M;  3MX5 A;  1YVN A;  3CCL N;  1V4T A;  2V7Z A;  3CME N;  4PKH A;  2YJE A;  5BPL A;  2ZF5 O;  5C10 A;  2FSN A;  4FWP A;  3D2F A;  4ISE A;  3QML A;  3DJC A;  3DWL A;  5H1S Q;  2ZJQ L;  3VGM A;  2W00 A;  3KZB A;  4FWS A;  3ENO A;  2J4R A;  5E84 A;  3I8B A;  4BQZ A;  3CIP A;  1YJ9 N;  4B1W B;  2QEX N;  5LJV A;  3OBW A;  1Z6R A;  4H0P A;  5GAE P;  3ZX2 A;  3ENB A;  2C1G A;  1HX1 A;  3BF1 A;  2QWQ A;  4E1J A;  4KBO A;  3SBG A;  3C0B A;  2QWN A;  2GWJ A;  3VES A;  5KPT A;  3CCQ N;  3FGU A;  1VQ7 N;  3UKR B;  5KQD A;  2ASP A;  2A3Z A;  4JK9 A;  5KQ8 A;  2KLA A;  3TPQ A;  4CBX A;  2QTD A;  3FZL A;  3O9Q A;  1NGB A;  3R6M A;  3E9O A;  3L4Q A;  4FSV A;  4IEI A;  4IJA A;  4BRO A;  1WUA A;  3EE8 A;  3O08 A;  1NWK A;  1QQO A;  1YF5 L;  3E66 A;  2QWM A;  3IKM A;  4ILJ A;  3GE1 A;  4QS8 A;  4DHY A;  2QA4 N;  1KD1 O;  3SAF A;  2ZJP L;  4BG8 A;  4J8F A;  1IG8 A;  3ZEU A;  4H0O A;  1YIT N;  2ZGZ A;  2Q97 A;  3G71 N;  2Q0R A;  2VYP A;  3W3D A;  3CCM N;  1K8K B;  4H5R A;  5AZI A;  3UKU A;  1X3N A;  5EOY A;  4MDB A;  2A40 A;  2V52 B;  1U2V A;  4BC5 A;  4BRI A;  4FWM A;  5MLC Q;  5AQO A;  3I56 N;  1YXQ A;  4BRL A;  1EO1 A;  3HZ6 A;  1Z05 A;  2KKZ A;  3O80 A;  1ZBS A;  4B1U B;  3PIO L;  3I55 N;  4JK8 A;  5JVH L;  2C1I A;  3FR0 A;  4AM6 A;  4U67 L;  1J6Z A;  2IVO A;  3EO3 A;  1BWF O;  3Q7C A;  2H3G X;  3TSU A;  1VQ9 N;  2YHY A;  4NLB A;  4EHU A;  2E1Y A;  3FZF A;  3MN9 A;  3ATU A;  1BA1 A;  5JLF A;  1ZC6 A;  4M63 C;  3CC2 N;  4YOT A;  5EXW A;  1MWK A;  1TYQ B;  1K8A O;  1BOT O;  3BF3 A;  4BRQ A;  3OW2 M;  3H6E A;  1ZXO A;  1SS6 A;  5ADX H;  5FPE A;  4C1N K;  3CCU N;  1T6D A;  3AAQ A;  4CD3 A;  3M1F A;  2NRR A;  2WBN A;  2I7P A;  5I9E B;  1QVF M;  5KPR A;  1TUU A;  2E2P A;  3MN6 A;  2GX9 A;  4Y0W A;  2FSJ A;  3IFR A;  3WQT A;  4YOV A;  1SAZ A;  3QIC A;  2VGM A;  1P8Z A;  5C2D A;  4GY2 B;  2OAN A;  1GLB G;  1ATS A;  1QQN A;  4FWL A;  3HBT A;  4NLC A;  2EWS A;  4GV9 A;  4A59 A;  3VEN A;  4PHT X;  5M1F A;  1W2B M;  3KWG A;  2NRH A;  2P9L A;  3TTC A;  3ULE A;  3PIP L;  3I33 A;  3VET A;  5AQX A;  5AZI B;  3UKU B;  5HOO A;  5AQG A;  2QWP A;  3VMF B;  4BVP A;  5BPM A;  1ATN A;  3CJ9 A;  3CER A;  3T7Z A;  4O8U A;  3QDK A;  3U9Z A;  4WFN L;  1E4G T;  2ASM A;  4H03 B;  4A5B A;  4GV6 A;  1P90 A;  2D0O A;  1HKG A;  4IO9 L;  3DXM A;  5F1X A;  3LDN A;  4L3Q A;  3JS6 A;  4K43 A;  3N4Q A;  4JEP A;  3LDQ A;  5GIP A;  1JCG A;  1NGE A;  1Q18 A;  1VQL N;  3O1W A;  3G25 A;  2P9S A;  3P38 A;  3O9U A;  3UE5 A;  2D1K A;  2D4W A;  5AQL A;  3HI0 A;  2YJF A;  3K9K A;  3WXK A;  1HPM A;  3EE9 A;  2P9L B;  1MA9 B;  1X3M A;  3MN7 A;  3ULE B;  3RSE A;  3O9T A;  4BGB A;  4CBW A;  3TTD A;  4HWI A;  4IOC L;  5AQV A;  3E9P A;  3O9R A;  3B8A X;  1YI2 N;  1VAZ A;  5M1N A;  3DAW A;  3W0L A;  3O6W A;  3LM9 A;  3ZET A;  3LDL A;  4JKD A;  5AZJ A;  3U4L A;  4JNE A;  3MN5 A;  3R9P A;  3CPE A;  5DM6 L;  2F7T A;  4FVU A;  4K42 A;  3AGR A;  1YHQ N;  4BRG A;  3FFK B;  2YHX A;  4BR0 A;  2HF4 A;  3H46 O;  4IXC A;  1KAY A;  2Q2R A;  4FPA A;  2A5X A;  4RTF D;  1GLA G;  3EN9 A;  3GG4 A;  1NGH A;  5KPZ A;  2GWK A;  4JKC A;  3CJC A;  4BR4 A;  3G4S N;  2CH6 A;  3RSE B;  3TTF A;  1QZ5 A;  2P9N A;  2FF6 A;  4ISG A;  3WT0 A;  4A62 A;  3CCJ N;  1ILY A;  3NVK A;  3WXJ A;  5JVG L;  1GLF O;  2E20 A;  4BRP A;  1NGF A;  3AAP A;  1YIJ N;  3ZET B;  3SMS A;  4FWN A;  1NGJ A;  5BPN A;  2RHK A;  1GLD G;  3CJ7 A;  3CXC M;  3DXM B;  5C12 A;  4CZE A;  2P9U B;  3H3O B;  1BG3 A;  4OPA A;  5BRH A;  4A61 A;  3C7N A;  3MWT A;  4IZ9 A;  2P9S B;  4BC3 A;  4EFH A;  1RGI A;  3FZM A;  1N8R O;  1Q86 O;  3OBY A;  1S22 A;  4CJ7 A;  3GOI A;  4H5W A;  5JLH A;  5M1P A;  1NBW A;  2P9N B;  3SK3 A;  4K25 A;  1VQ4 N;  4GV3 A;  1NMD A;  3LM2 A;  1VQN N;  3ZEU B;  2CGJ A;  2NZT A;  1JCF A;  4IO8 A;  3DLL L;  5AFU H;  3OA9 A;  3R3L A;  4FO0 A;  3BP8 A;  2YHW A;  3RVC A;  4WQ5 C;  3VEX A;  4CZG A;  5GAD P;  3ZX0 A;  3ENH A;  5AQY A;  3A5O C;  4DQ8 A;  5AFU A;  4Z94 A;  3P4I A;  2GEL A;  2JWL A;  1HLU A;  5M1K A;  5GIN A;  3WUH A;  4JD2 A;  1NM1 A;  3MMV A;  3GBT A;  4B1V A;  1GLL O;  4IFE A;  4GNI A;  4H5T A;  3E9L A;  4C23 A;  2YCH A;  3QBX A;  2NRT A;  3J7Z O;  3FLC O;  4FWK A;  5F0X A;  4JKB A;  2A42 A;  1YJN N;  4HTL A;  1BO5 O;  3MCP A;  1YUW A;  4BRK A;  3DXK A;  3CD6 N;  1LOT B;  1OVY A;  4BR2 A;  1VQ8 N;  4A2B A;  2VGN A;  2FSK A;  1G99 A;  1TYQ A;  3VEW A;  3SAH A;  5AQK A;  3CMA N;  1QZ6 A;  4WF9 L;  2RE2 A;  4DB3 A;  3WXM B;  4BG9 A;  3ZX3 A;  1SQK A;  3VGK A;  2YX6 A;  4JN4 A;  2VCP A;  1XC3 A;  4PL7 A;  2D0P A;  1DEJ A;  1GLE G;  4BY9 C;  4EIA A;  2NRX A;  4WFA L;  2QI2 A;  2E2N A;  2HBK A;  4CZK A;  4JKA A;  3VTH A;  1DKG D;  4PL8 A;  4XEI A;  2QW9 A;  3VPZ A;  4BR9 A;  2BUP A;  4JHD A;  3U8X A;  3HM8 A;  3C7N B;  4BR7 A;  5EY4 A;  3CPW M;  3M6G A;  4IJN A;  1BUP A;  4CZF A;  5DM7 L;  5BN9 A;  1S3X A;  2GTD A;  2VWB A;  3AGK A;  2NNW A;  2V51 B;  3WXI A;  4BC4 A;  5CE3 A;  4CZI A;  3NMU A;  1IJJ A;  5HL7 L;  2F9T A;  1VQ5 N;  1VQK N;  4A5A A;  3FZH A;  1BA0 A;  4UY8 O;  1V4S A;  3MDQ A;  4FOE A;  3L0Q A;  1Q82 O;  2AA4 A;  4JKF A;  4BGA A;  4CI6 A;  1D4X A;  4I6M B;  2HF3 A;  1T3V A;  3D2E B;  4OPH A;  4R79 A;  5JIC A;  2HMP A;  2NRW A;  3EKU A;  3J8A A;  3QFP A;  2E88 A;  4NB4 A;  5AR0 A;  5M1O A;  3VOV A;  5AQM A;  4JD2 B;  4EAH D;  3WEE B;  3Q7B A;  3UB5 A;  3CQY A;  5LY3 A;  2E8A A;  3D7E O;  3BUZ B;  3MWP A;  4WCE L;  3TSP A;  4QS9 A;  4G9Z A;  2QWR A;  3HRG A;  2QWO A;  3H1V X;  4K41 A;  4WQ5 A;  1O13 A;  4QS7 A;  2W41 A;  5BRE A;  2ZWH A;  1VQP N;  4FL9 A;  1SZ2 A;  3ATV A;  4JK7 A;  1QVG M;  1QQM A;  1ESV A;  5AQU A;  2Q0U A;  5AQT A;  2KHO A;  4KH4 A;  3L6Q A;  4BRM A;  1HUX A;  4I6M A;  4XH4 A;  3VF4 A;  2HST A;  1VQ6 N;  4BEC A;  3D2E A;  2QWL A;  3C65 A;  1U2V B;  4WYB A;  2PBD A;  4CZH A;  4U7B A;  1VQO N;  2HBM A;  3TU5 A;  3CI5 A;  1KQS M;  5AQP A;  2A6A A;  3G6E N;  5M1Q A;  3CCR N;  3L4I A;  4H5V A;  3S41 A;  2QXL A;  4MO5 A;  1NJI O;  3H45 C;  3VF2 A;  1NGC A;  2IVP A;  4BRN A;  5LJW A;  3CCE N;  1RDW X;  3F2K A;  3JXU A;  3IMX A;  3VEV A;  4BRF A;  2FLO A;  3HTV A;  3ID6 A;  1NGI A;  3HSC A;  1CZA N;  4BVO A;  2UYT A;  4JAX A;  3MK6 A;  5AQR A;  5AQS A;  5F2R A;  2F9W A;  4XH5 A;  2BTF A;  3AY9 A;  4JKG A;  2P9P B;  2NRV A;  1Q81 O;  5ELZ A;  3WXL A;  3LDP A;  3D6R A;  5GAH P;  3QB0 A;  4CZM A;  3CET A;  2P9K B;  4YOW A;  2PFU A;  1W97 L;  1DT9 A;  4NO7 A;  3F5T A;  5AQQ A;  4MDA A;  3WQU A;  4PKI A;  5JMV A;  1RFQ A;  1HKB A;  3ID8 A;  5EVZ A;  3WEE A;  3H3N O;  4JKH A;  1C0F A;  4H0V B;  1MDU B;  3EL2 A;  3O8M A;  4BRE A;  3NVM A;  4AF1 A;  3SLC A;  3R8E A;  4BR5 A;  2HBL A;  3VEO A;  1U6Z A;  3P31 A;  1KAX A;  5FPD A;  4BE7 B;  3CC7 N;  4DCH A;  4FWR A;  4BRA A;  3SAG A;  4JKG B;  2WC9 A;  2IIR A;  1GLC G;  3QFU A;  3CCV N;  1R59 O;  1YJW N;  2PAV A;  4BQL A;  2NRZ A;  2CGK A;  2P9K A;  3A8Y A;  3O5B A;  1KXP A;  4CD1 A;  5C2F A;  4FPB A;  3HOT A;  3CCS N;  3IDH A;  4YDU A;  2CH5 A;  3KHY A;  3M3Z A;  1E4F T;  5TKW A;  5AQW A;  1M1K O;  5B8H A;  4IOX A;  5CHI A;  3EZW A;  1BU6 O;  3N4P A;  2OTJ N;  3H1Q A;  4CZL A;  2WUS A;  3GL1 A;  2FXU A;  3EKS A;  3VGL A;  1EQY A;  4MO4 A;  3OHR A;  4IWV A;  3ZYY X;  1XUP O;  2I7N A;  3A5N C;  5AZJ B;  3C6A A;  4FOI A;  4AM7 A;  2P9I A;  2P9P A;  3CF5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...