1XQSC

Crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Regulation of Hsp70 Function by HspBP1; Structural Analysis Reveals an Alternate Mechanism for Hsp70 Nucleotide Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HSPBP1 protein
total genus 52
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1xqsC01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1xqsC02
4JHDB 2BTFA 4RTFD 3AARA 4B1YB 3WUHA 3AAQA 3D7EO 2QWPA 4CBWA 3HM8A 3CJ9A 4DQ8A 3WT0A 4BRQA 3GDQA 3WXJA 3QFUA 4BR2A 3IMXA 3O6WA 4PKGA 1GLAG 4PL8A 3D2FB 5AQWA 3D2EA 1XQSC 5AQJA 1ZC6A 4HWIA 3VEWA 1BU6O 3ULEB 3BF1A 3H3NO 3UKUB 4EHUA 3M3ZA 5AQQA 2P9LA 4CD1A 5EY4A 2FSNA 3BP8A 1NGGA 4WYBA 1QZ6A 4QS9A 1ESVA 5BPNA 4YDUC 1RFQA 1QQMA 2P9PB 4BRNA 4CZGA 1BDGA 1BA0A 1X9JA 2FF6A 4JN4A 1YAGA 5AQVA 4MLHA 1YXQA 3WXLA 4RCHA 4B9QA 3R9PA 4K43A 4AM7A 3MN7A 4BRAA 3ZX3A 2IVNA 4H5RA 2I7PA 3FZMA 4WQ4A 5BN9A 1X3MA 3VF6A 3LDPA 2HMPA 2Q36A 3HZ6A 1TYQA 5AQFA 1Y64A 4Z94A 2P9UB 3A0IX 2D4WA 1NGAA 2V52B 5EOYA 3QBXA 4LC9B 1NGHA 5EX5A 2IVPA 2QXLA 3JXUA 4E1JA 4DCHA 2OANA 2H3GX 2P9KA 4FOEA 2E1ZA 3H3OB 4CZMA 3MN5A 5AQKA 3UKRA 4CZLA 5AQZA 4K41A 2GWKA 3RSEB 3QDKA 5AFUH 1BWFO 1NMDA 3A5MC 2V7YA 5AQXA 1KAYA 3FGUA 3EKUA 3CQYA 3LDNA 3CETA 3IUCA 4CBUA 1TYQB 1NGIA 1K8KA 4BG9A 1H1VA 1TUUA 1D4XA 3DXMB 1GLEG 5BRFA 3ENHA 5AZIA 1JCEA 4BR9A 1ZXOA 3O08A 3GG4A 2F9TA 1MWKA 2HF3A 1E4FT 1YUWA 3QFPA 3AAPA 4XH5A 1GLBG 2A40A 3IFRA 1YVNA 4ISFA 1XC3A 3BUZB 3WEEB 4BC4A 3FE1A 5AQHA 5AQMA 4B1WB 4BR7A 3A5LC 3FZKA 4H0TB 1HPMA 5BRHA 3ZX2A 4BG8A 3KVGA 1NWKA 4BRMA 4M7YA 1K8KB 3CIPA 4H0XB 1EQYA 1T44A 1U2VA 2E20A 5AQUA 5F1XA 3VF4A 2YJEA 5AQOA 5KQDA 1JCGA 3O4WA 2CH5A 5KPTA 2A6AA 2QWQA 1NGCA 2UYTA 4H5WA 4BC2A 2YHYA 4FL9A 4FWQA 2FXUA 3SLCA 4DHYA 1DEJA 3U8XA 1C0GA 1KAZA 5BREA 4H03B 1WUAA 3GOIA 4CZIA 5AZJA 2YHWA 2QM1A 2WUSA 4XEIA 3O80A 5AQYA 2V7ZA 2A41A 2GELA 3GE1A 1BO5O 2FF3B 2YHXA 4BRPA 5LJWA 1NLVA 4B1VA 4RWTA 4Y0WA 5AQTA 2J4RA 5F2RA 1KXPA 4F9OA 4JAXA 3MCPA 4K42A 4FWLA 3U9ZA 1BG3A 2Q2RA 4CJ7A 3VGKA 2P9PA 3DWLA 1NGJA 2NLXA 3EN9A 3O5BA 3MK6A 3MN6A 3BEXA 4NB4A 5AZJB 4XH4A 3ATUA 3QBWA 4FWMA 4CZHA 5JLFA 3A5NC 4J8FA 4B1XB 4CD3A 3VEVA 3DAWA 4EHTA 5F0XA 4L3QA 2IIRA 3DJCA 4FWSA 3ULEA 1CZAN 1G99A 3CJBA 1GLLO 2A42A 2NZTA 3VF2A 4ISGA 2W41A 5AR0A 2FLOA 3QICA 3UE5A 3H1QA 1ATSA 3A5OC 4GNIA 5ADXA 5AQIA 4PKHA 2F9WA 1WOQA 5AZIB 5TKYA 3VEXA 3GBTA 2E2NA 4IO8A 2I7NA 2CH6A 2QWOA 3VOVA 2GEMA 5AQGA 4FWRA 1V4TA 3FR0A 3J8AA 3U4LA 3H1VX 3L6QA 4CZKA 2IVOA 2P9NB 3D2EB 3P4IA 1HKBA 2NRHA 5E26A 2AP1A 3R8EA 3O1BA 4H5TA 4BR4A 3H45C 1SZ2A 1C0FA 4H0OA 1GLDG 2ASMA 2ZGYA 4CBXA 1J6ZA 3FLCO 3UB5A 3MMVA 4H5NA 4BVOA 5ADXH 2P9LB 4M7XA 4BRKA 2Q0UA 3SMPA 4CI6A 4KBOA 2ASOA 3FZFA 1BUPA 2P9IA 1E4GT 1MWMA 3FZHA 4C23A 4BQZA 4BVPA 4WQ5A 5AQRA 4FO0A 3D2FA 4CZEA 3RSEA 2ITMA 2HOEA 5JICA 3VESA 3KHYA 1NM1A 4A2AA 3HBTA 3VENA 4CZJA 4FWNA 5BRDA 5BPLA 3EL2A 1SAZA 4JD2B 1JCFA 2VCPA 2E2OA 3ID8A 3VEOA 2Q1NA 4IWVA 2AA4A 3GL1A 3QB0A 3U9DA 3EKSA 4BRLA 1RDWX 3AY9A 4H0PA 4PKIA 4BC3A 3H6EA 3KZBA 3CHWA 1U6ZA 2KHOA 3OHRA 3ATVA 4EAHD 2VYPA 1GLCG 1V4SA 1Z05A 4M63C 4BR0A 3FZLA 3H46O 2ZF5O 3VEZA 3UKRB 3HSCA 4A2BA 2YJFA 3C7NB 4BRCA 1HLUA 2ZWHA 5BR9A 2FSKA 1S3XA 1LOTB 3O1WA 3S41A 3SJHA 1Z6RA 2E2PA 3EZWA 4FOIA 3UKUA 2E1YA 1ATRA 3VGMA 5AQSA 1XUPO 4DB3A 1HKGA 4H5VA 3LDOA 4JHDA 1U2VB 1KAXA 3LDLA 4FPAA 3EO3A 1ZBSA 1NGFA 3DXKA 5E84A 1DKGD 2A3ZA 2P9IB 4FPBA 3ENOA 2CGLA 3WQTA 4H0VB 4I6MA 4GY2B 4BR5A 1NGBA 2GWJA 2QWNA 1MDUB 2GUPA 2P9SA 5LY3A 1SQKA 4O5FA 4BRIA 3CERA 2DPNA 3CJCA 3LL3A 3B8AX 3BF3A 5JMVA 4FWKA 4MO5A 1QZ5A 3LM9A 3WQUA 5FPMA 3G25A 5AQLA 1ATNA 4WQ4C 2D1KA 2CGKA 5FPDA 4FWPA 1QQNA 2A5XA 3SMSA 5EVZA 4QS8A 2E8AA 1X3NA 3L0QA 3ZEUB 4BRHA 1MA9B 2EWSA 3WXKA 1GLFO 2E88A 4IJAA 4B1ZA 4PL7A 5LJVA 3DXKB 2V51B 2P9KB 3CJ1A 1BOTO 1S22A 2YI1A 4I6MB 3C0BA 5KQ8A 5AQPA 4YDUA 2VWBA 3HTVA 3TU5A 5I9EB 3W0LA 2D0OA 5AFUA 2P9SB 3CJ7A 3LDQA 4XH1A 3C7NA 5EXWA 3VEYA 2ZGZA 4EFHA 4BGAA 1QHAA 2HF4A 3VERA 4A62A 4MLEA 1HKCA 4NO7A 1NGEA 3MN9A 2P9UA 1IG8A 3VGLA 4H0YB 1T6CA 3A8YA 3DXMA 5FPNA 3ZX0A 5B8HA 3VPZA 4BRFA 3FFKB 3LM2A 4AM6A 2Q97A 4BROA 4HTLA 4BREA 5BPMA 3ZETB 1NGDA 3HI0A 3WXIA 2FSJA 2QWRA 4IJNA 5CE3A 4MO4A 3F9MA 1LCUA 4A61A 3MDQA 1HUXA 3I33A 5FPEA 4WQ5C 4JNEA 3R6MA 3I8BA 4K25A 5KPZA 4IXCA 5BN8A 3WEEA 1HJOA 3CI5A 2E2QA 3CJAA 1RGIA 4EIAA 1OKJA 3L4IA 3SK3A 1HX1A 4BRGA 2PBDA 3VETA 2QW9A 3M6GA 3W3DA 5ELZA 4BRDA 3JS6A 5AQNA 4FWOA 2Q0RA 3CQXA 4IZ9A 1DGKN 1P8ZA 4O8KA 3ZETA 4BC5A 2Q31A 3O8MA 3ZEUA 2CGJA 1GLJO 1NBWA 2W40A 2YCHA 2ASPA 1T6DA 4ISEA 1BA1A 2GTDA 3QMLA 1IJJA 2BUPA 3TPQA 5JLHA 4BQLA 1QQOA 4QS7A 2P9NA 1R59O 5KPRA 4CZFA 4FSVA 1TUYA 4BGBA 2PAVA 2QWLA 2QWMA 4JD2A 1Q18A 3IDHA 4B1UB 2D0PA 3M1FA
chains in the Genus database with same CATH superfamily
3NGZA 4B9NA 2BTFA 3AARA 3NH0A 4CBWA 4FK0A 3HM8A 1IKYA 4KO0A 4BDZA 1YJWN 3GDQA 3QFUA 4DF4A 4BR2A 4EP4A 3KLIA 3KKRA 3D2FB 3G6EN 4PY5A 5AQWA 5HBMA 1YTAA 1Q8IA 1XQSC 3THWB 1ZC6A 3VEWA 1BU6O 1T05A 3ZSYA 5FRNA 3N4PA 3CC4N 1KSPA 4EHUA 2G8IA 3L2WA 1VRTA 2P1JA 4E1NA 4K8XA 3K5MA 3MX5A 2FSNA 3BP8A 2F8SA 1NGGA 4WYBA 5C25A 2XY7A 4FLTA 3O9RA 1RFQA 3RMBA 2VQEK 1QQMA 3ZYYX 4BRNA 4CZGA 4OPKA 1BDGA 1X9JA 2FF6A 1BCMA 4JN4A 1KFDA 1YXQA 4DF8A 4K43A 1O13A 4AM7A 3MN7A 1U45A 2IVNA 4FK2A 3DI6A 1X9WA 3HZ6A 4E3SA 2GV9A 3K58A 3AVIA 1Y64A 3QEIA 3A0IX 2D4WA 4JKCA 4DV2K 1WSHA 5EOYA 1NGHA 5KGXA 4KHSA 5EX5A 4BECA 2F4VK 4JI6K 1LAVA 4W5NA 4ID5A 2OANA 2YKNA 3QNOA 3SQ1A 1VQKN 3MN5A 3O9SA 1NKBA 2DFFA 1ZBFA 5AFUH 1BWFO 3V1OA 3NAEA 1G15A 4R79A 3THWA 3LZIA 5CZ1A 1TYQB 1NMNA 1K8KA 5DK5A 1H1VA 5SWMA 4MDBA 3L2UA 4C8MA 1QVGM 4FJIA 2OPPA 1BHLA 1FKPA 4JK8A 1JCEA 3AGRA 2VG6A 3O08A 1WNSA 1BI4A 2F9TA 3GG4A 4B08A 1MWKA 4CESA 3ZSOA 2HF3A 1IO2A 1D9DA 5JENA 4AH9A 3SI6A 3BUZB 3WEEB 4B1WB 3CG7A 3CM6A 3PX4A 2ATQA 4LF5K 4TSXA 3V81A 3LDSA 2ZD1A 1NWKA 4BRMA 3RR8A 1JL1A 1OH5A 3AVMA 2G8UA 5KQDA 3O4WA 5KPTA 1DLOA 3WNGA 4BC2A 4FL9A 4YNQA 2UUCK 4DHYA 4BY9C 4FCYA 3K9KA 3TARA 1VSEA 5C15A 4H03B 4CECA 1YF5L 2QM1A 3MEGA 4CGFA 3OYGA 2WUSA 4XEIA 5AQYA 2A41A 2GELA 1BO5O 3HRGA 3HK2A 4CJFA 1JLQA 4BRPA 4RWTA 1NLVA 2FBXA 2YHAA 1N32K 4Y0WA 4F9OA 4OGEA 4FWLA 3QERA 4JI0K 2Q2RA 4HUEA 4CJ7A 3VGKA 2P9PA 3T1YK 4DTPA 3NHGA 4DU3A 3CFPA 3MN6A 4DQSA 4NB4A 3MWPA 3NGIA 3V4IA 3ATUA 2QTDA 5HL7L 1EKEA 4B1XB 3HPHA 4PWDA 3DAWA 1UAXA 4DSLA 2NRRA 1XC9A 4W5TA 3OS1A 4JRQA 1XWLA 5AR0A 4LFBK 5M1NA 4DFJA 1ATSA 4GNIA 5AQIA 3QO9A 2F9WA 2HW3A 4M41A 5TKYA 3VEXA 4J2AA 1BIZA 3HM9A 3VQPA 3OJUA 2E2NA 2I7NA 3ZSXA 4Z4EA 3VOVA 2GEMA 4FWRA 1V4TA 4A5AA 3FR0A 3U4LA 3OJSA 4LF7K 3H1VX 1EWQA 4CZKA 2IVOA 5DM6L 1QSYA 2P9NB 1TKZA 4A57A 3TAQA 3HP9A 4B8AB 4RW8A 2AP1A 1S1TA 1SS6A 5LMUK 4DTRA 4H5TA 3H45C 1SZ2A 1GLDG 2ZGYA 4ILHA 1J6ZA 3AVCA 3NF6A 3UB5A 1YJ9N 1NNEA 3MMVA 4H5NA 1W0HA 4CJQA 2Q0UA 1VQON 1RILA 1RTIA 2G8WA 4CERA 2XY6A 1OH8A 4FJXA 3DLKA 1D9FA 4JKEA 3FZHA 4CZEA 4BDYA 4CFBA 4FM1A 2HHUA 3RSEA 4JS5A 3THYA 1N34K 3TTDA 2O8EB 2KLAA 1W9HA 1NM1A 1VHXA 3VENA 5GAHP 1JCFA 4Q5VA 4IWVA 2AA4A 4DSJA 2IDOA 3R3LA 4LY7A 3AY9A 1A5XA 3RTVA 5HROA 3KZBA 3ATVA 1V4SA 4B9SA 2YNIA 4O55A 3IAYA 3OY9A 4M3WA 2IS3A 1SKWA 3TSQA 2VG7A 3C7NB 3KD1E 2ZWHA 1ZBIA 1LOTB 3S41A 3SJHA 2G8HA 4C8KA 4FOIA 1VQ5N 1NJIO 1X9SA 5AJ3K 4BWJA 4KTZA 2DFHA 4KAZA 4JHDA 1KAXA 1C0UA 3Q7BA 2HSTA 3SJJA 3CCSN 2QEXN 3KKSA 3SQ4A 3DXKA 3BY5A 3SAHA 4DV7K 4B3MK 2A3ZA 1S1XA 3U6FA 3G0ZA 3ZSVA 4IKFA 1RBRA 2OZMA 4I6MA 2FBTA 3K57A 4LSNA 5FDLA 1FKOA 1BL3A 1MDUB 3J7YP 1IG9A 4O5FA 4BRIA 3CERA 4GV9A 4JI8K 2W00A 3L3VA 3LL3A 3P38A 3BF3A 4KHWA 1ZBLA 5AQLA 3THVA 1ATNA 1HNXK 1YVUA 2C1GA 2A5XA 3SMSA 3O9UA 3BDPA 2B5JA 1ASUA 3CPWM 3ZEUB 3MCAB 4JEPA 4CJTA 1KFSA 3VQEA 5KRTA 3CJ1A 2UXCK 3C0BA 1XHXA 2VWBA 1C1AA 4DQPA 1WSIA 3E9PA 3W0LA 1U04A 2D0OA 3CYMA 1KVBA 3T19A 3T7ZA 3G4SN 3EYZA 4DS4A 2ZGZA 3LANA 4BGAA 2HF4A 1RBSA 1NGEA 3PV8A 4BEBA 2P9UA 1U47A 3VGLA 3V9WA 4CEOA 2RPIA 3O9QA 4FVMA 3OYNA 3DLHA 3ZX0A 5B8HA 3VPZA 3C95A 2HNYA 4AM6A 2Q97A 5HOOA 2G8VA 3ZETB 1MU2A 4BE0A 2C1IA 1RBVA 2O8DB 3ZSRA 3F9MA 1LCUA 4ID1A 4KHPK 2PFUA 5GAGP 3AA5X 4KHUA 4JI2K 4JLHA 2ZJQL 4RW9A 5KPZA 4JI5K 4FK4A 3WEEA 3CI5A 5GIOA 3TANA 3OYJA 2UUBK 1QHTA 3L4IA 3SK3A 2O8FB 1HX1A 4R5PA 4DLEA 3M6GA 1QE1A 4AHCA 3SAGA 1OH7A 3A2FA 5AQNA 5JVGL 3CMEN 4CJSA 3ZETA 2QK9A 3EE8A 4F2SA 4FZXC 4B9UA 4DTXA 4ISEA 4NYFA 2GTDA 2IAJA 3QMLA 4E7HA 3ALYA 1RCHA 3TPQA 3O9TA 3VQ9A 4BWMA 5M1FA 4YHHK 3MXJA 3ZSWA 3S5TA 3F73A 3AO2A 4BGBA 3V6DA 1HMVA 2QWLA 3AO5A 1QS4A 4W5QA 4JD2A 3OBYA 3RMCA 4B1UB 1L5UA 3AVGA 4JHDB 1IKVA 3SUOA 2Q3SA 4RTFD 2PZSA 4HHTA 1Z26A 3D7EO 2QWPA 1NK8A 1VQ4N 5GAEP 4RW4A 1C0TA 3O4NA 4DQ8A 3QEXA 4CGIA 1S1UA 2Z1GA 3PSIA 3WT0A 3I8DA 3CC2N 2DFEA 3WXJA 1JLFA 3IMXA 2B6AA 4PL8A 3C6UA 3D2EA 5AQJA 1NOYA 2KFZA 2KZZA 2QXFA 3HPGA 3ULEB 4AHTA 3PIOL 4FW2A 4KREA 1ASWA 1VQPN 4B3TK 4Z4HA 5FROA 2HHVA 4QS9A 4YDUC 3OYCA 3SNNA 4O0IA 2D0BA 3DOKA 1CXUA 4MLHA 1IBLK 3R9PA 2QA4N 1TKTA 4DUYK 1WN7A 4WFAL 4BRAA 4WQ4A 4LH4A 3VF6A 2HMPA 1KVCA 5HRPA 1Y97A 1S72N 4Z94A 1C1BA 1SKRA 1DTTA 4O8UA 4M3YA 1RDAA 2V52B 4LC9B 1VRUA 2DTUA 3ZT1A 1NOZA 3JXUA 2HBJA 2KKZA 4NXNK 3MAQA 4ZTFA 2E1ZA 4FJLA 2XRIA 4CJRA 1NK9A 4CZMA 4L8RB 4DR5K 4AHVA 5AQKA 3Q7CA 5AQZA 1CXQA 4CJVA 3LP2A 2GWKA 2D0AA 4OGCA 3RSEB 3QDKA 4CF2A 3EKUA 3CQYA 3SYZA 4FLVA 2GBZA 4OKJA 4BG9A 4MFBA 4FLXA 4OVLA 4GKJK 4GVEA 2FBYA 1VSLA 4DTSA 3RRHA 3ZSQA 4E72A 1HR0K 3OYHA 3I56N 3ENHA 1RT2A 4PUOA 3CQ8A 1E4FT 4DS5A 1OVYA 4XH5A 4EZ9A 1HYVA 2A40A 3OVNA 4ISFA 1XC3A 3FE1A 4JKHA 4CF0A 5BRHA 4BG8A 1VSHA 4K8ZA 4M7YA 4H0XB 4JI7K 3AA2A 4GMJB 1YITN 5AQUA 5F1XA 3VF4A 3K9JA 4RW7A 2CH5A 2A6AA 2QWQA 2UYTA 4AHSA 4DFMA 2ETJA 4BDPA 1JXEA 2FXUA 3SLCA 1DEJA 3K59A 4FLWA 4NCGA 4I7FA 3U8XA 4Z0UA 1S6QA 4CJKA 1WUAA 3GOIA 4CZIA 2O8BB 3O80A 2BANA 2F7TA 5IT9O 2IOCA 2RF2A 1IV0A 1YT3A 2F8TA 2FF3B 4J2EA 5LJWA 1LW2A 3CYGA 3DWLA 1N6QA 2NLXA 5J2PA 3EN9A 2GUIA 3O5BA 3VQ6A 3NDKA 3MK6A 1JL2A 3SUQA 3EE9A 1K9MO 3O3FA 2JGUA 4FWMA 1RDBA 2E4LA 3MEEA 1BQMA 4LFCK 3EY1A 2E6LA 3VEVA 4H4MA 4EHTA 1I39A 5F0XA 4PHTX 4FWSA 1CZAN 3T3FA 3CJBA 1GLLO 2A42A 2WFBA 4E7JA 3VQDA 2FLOA 3QICA 3V9SA 4CJPA 3V1RA 1RTHA 4CGGA 1WOQA 5AZIB 1I94K 1VSKA 3PY8A 4IO8A 2CH6A 5FLXO 2P5GA 4M45A 5HP1A 3AVAA 4DG1A 3ENBA 3LP1A 2I5JA 3P4IA 3HT3A 4V19S 1BGXT 2BGGA 3NGYA 3O3GA 4LSLA 1NJZA 3RR7A 4ILJA 4BR4A 3C6TA 4UQGA 3TSPA 1XMQK 4CBXA 1NK4A 5D3GA 4Q0BA 1NJWA 1W7AA 2VQFK 4C1NK 2P9IA 1E4GT 4JI3K 2KTQA 2HVHA 4DKWA 4ELUA 4BVPA 4WQ5A 1KLNA 3D2FA 2D5RA 4CGJA 1CZBA 2HHWA 5CZ2A 4CJ5A 3AA3A 5TKWA 1JLEA 4O5BA 5CR4A 5KGWA 4U67L 1GOBA 4A2AA 3HBTA 4CZJA 4U7BA 3EL2A 1LWEA 4JD2B 4M3TA 3ID8A 3VEOA 3QB0A 1KQSM 4FVUA 1XI1A 3L8BA 1RDWX 3J7AP 3CHWA 4CHOA 1HYZA 3THXB 3OHRA 1GLCG 1Z05A 3SBTA 1VQ6N 5J2MA 4E89A 1ILYA 3KLGA 1VQLN 3VEZA 2ZM6K 3HOSA 3HSCA 4A2BA 1KLMA 3U3GA 4CHNA 5J1EA 4BRCA 1HLUA 3AO4A 3HO1A 1KRPA 1M1KO 3O1WA 4CEBA 4QCLA 3DMJA 3ZT0A 1VSJA 4O0JA 3VN5A 3VGMA 5AQSA 3WXMB 4FZZA 4QAGA 3VQQA 3QEVA 1R0AA 1QTMA 1LWCA 4FJ9A 4KTQA 4OPJA 4E7IA 4FJMA 1GOAA 4YY3K 2P9IB 2GX9A 2G8FA 2CGLA 3TSUA 1WSJA 3WQTA 4DU1A 3DLBA 3MEDA 2QWNA 5CY4A 1ZBHA 4UY8O 2P9SA 1Q9YA 4DLGA 3HJFA 1FXXA 2HHTA 3CJCA 3KWGA 4MO5A 3MXMA 3LM9A 3WQUA 5I3UA 1N33K 2D1KA 2CGKA 4FJ8A 3KK1A 3ZCMA 1X3NA 1HNVA 3L0QA 4ZTJA 1MA9B 2EWSA 3WXKA 1GLFO 2E88A 4HTUA 3LWLA 4J2DA 5LJVA 1TL3A 4F4KA 2P9KB 3C94A 4I6MB 2YI1A 1KC8O 4CGHA 2HHQA 3HSTB 1KD1O 3HTVA 5E41A 2X6SA 1RTJA 2O8CB 3CJ7A 1HRHA 4JKAA 5EXWA 2W6KA 3AO3A 1S5JA 4YOUA 4JRPA 4M3XA 5GADP 2XO7A 3VQBA 1HKCA 3C6AA 4IOXA 3MN9A 3ISNC 5DM7L 5FPNA 2JWKA 1L3UA 3ZT2A 4CEFA 3LPUA 3G71N 5BPMA 3DLLL 3LWMA 4DR4K 3HI0A 2OPSA 2FSJA 3NMUA 3VA3A 3J80O 4A61A 3MDQA 2VGMA 1HUXA 1JLCA 4XIUA 4AHUA 3M8RA 3SPYA 3J7ZO 4K25A 4E19A 3I0RA 5BN8A 3TAEA 3KTQA 1S9EA 3P83D 4FLZA 4AILC 1NU0A 3VETA 5ELZA 1NG9A 3JS6A 3S3NA 1KCFA 2Q0RA 3CQXA 3BGRA 1DGKN 4QOZB 2EHGA 2CGJA 1NBWA 3THXA 3SCXA 3O4QA 1T6DA 1HNZK 1Z25A 4N56A 3F9KA 1C6VA 4B9LA 1VK0A 4IEEA 1RBTA 4HUFA 3M5RA 5KPRA 2PY5A 2YHBA 4CZFA 1P90A 1TUYA 3ITHA 1REVA 2PAVA 4DV3K 1W97L 1Q18A 3TR8A 4NCAA 2RHKA 3M1FA 3D45A 1RBUA 3RMAA 3AAQA 3G10A 1TV6A 5M1OA 4B8CA 2VWJA 4KH4A 1SUQA 4OX9K 5LL6Z 4BRQA 3SQ2A 4FJNA 4PKGA 1L3VA 1VAZA 1D8YA 1WLJA 3IRXA 3V9XA 3VQ5A 1K73O 4HWIA 3JAMO 3CCJN 1TAUA 4N5SA 4DV5K 2P9LA 3JYTA 2HNZA 1QZ6A 4JS4A 3AVKA 5BPNA 2OTJN 4NYNA 2NNWA 4F8RA 1BA0A 5AQVA 4CFCA 3OTOK 3WXLA 4RCHA 2Z1HA 4B9QA 1RT7A 4IOAL 4H5RA 2I7PA 3FZMA 4B9TA 3DRPA 1SL2A 1XNQK 2Q36A 4C8LA 3VQ4A 2P9UB 2PYJA 4BE2A 1RT3A 3I0SA 4GVMA 3LALA 3VQ8A 4F3OA 3F5TA 4CF8A 3T69A 2H3GX 2P9KA 1ITGA 2IGIA 3H3OB 5MLCQ 3HPOA 4CZLA 4K41A 3OYMA 4LF9K 4CEZA 3A5MC 1KAYA 2RE2A 3FGUA 3S3OA 2O4GA 2YX6A 1B9FA 3IUCA 1FW6A 4KKOA 3AVFA 1Q82O 1NK5A 3PO5A 1TUUA 4LF4K 3QESA 4WF9L 4KB1A 4FJ5A 2HHIA 1S1WA 3DXMB 3IG1A 4G1QA 1GLEG 3RVCA 4JKDA 3DOLA 5BRFA 1IKXA 5GIPA 4BR9A 2QKBA 3KK2A 3NH2A 4F3TA 4KV8A 1VQMN 4KHQA 1VQ9N 1YUWA 3QFPA 3AAPA 5DMRA 3CCMN 1GLBG 2FC0A 1JLGA 3TAFA 5AQHA 3V9ZA 1HPMA 2Z1IA 1RT5A 3ZX2A 4MDAA 2Z1JA 4OPHA 2O8FA 3P39A 1OVQA 3CIPA 2ZJRL 4N41A 1U2VA 2YJEA 5AQOA 5K14A 4LD0A 3J81O 1NGCA 3PX6A 1SL1A 4XJXA 2NRZA 3S9HA 3OS2A 3AVJA 1RDUA 1C0GA 4CJWA 1KAZA 1WSEA 4IDKA 4JKFA 1S6PA 3SQ0A 2OZSA 2UXDK 2X74A 2YHWA 3C6HA 1UA1A 5T7BA 1UA0A 3KK3A 4M42A 2UXBK 2YHXA 4IFYA 3OBWA 5AQTA 5F2RA 3MCPA 4Y1DA 1RT1A 3K2PA 1K8AO 4M3RA 4IO9L 4CJLA 3U9ZA 3TWHA 4HVJA 1YI2N 1F21A 4CK3A 3EEQA 3CCLN 3NCIA 2HMIA 3ASMA 5AZJB 4XH4A 3SBGA 4FLYA 4E0DA 3NBPA 3QBWA 4KB0A 4CZHA 5JLFA 1T03A 3A5NC 5KI6A 4DMNA 2ZQBA 4H8KA 4L3QA 4J2BA 2IIRA 3DJCA 2YV0X 3ULEA 1NK0A 1SL0A 4KH5A 1JJ2M 3HL8A 4DU4A 3UE5A 3H1QA 5ADXA 2YKMA 4O44A 4DSKA 3O3HA 4DV1K 2BH1A 4HCCA 3T1AA 2QWOA 1RT4A 3J8AA 3SAFA 1HNWK 1IH7A 1U49A 1SKSA 3K5NA 1HKBA 4YOXA 2NRVA 3R8EA 5CYQA 2ASMA 2OA8A 4E7KA 1U48A 3ZT4A 4BVOA 3CCRN 4M7XA 4BRKA 1XNRK 4CI6A 4KBOA 2ASOA 1TK0A 3CFRA 4YFUA 1BUPA 1VSDA 1WSFA 3QINA 3RRGA 4LF8K 2O4IA 3TTFA 3PUFA 3TABA 4A5BA 3VMFB 4BQZA 4DTMA 4FO0A 3RWUA 1RDDA 1RNHA 3QETA 2WTUA 4O4GA 2ITMA 5JICA 3VESA 4DTOA 4DR6K 4DFKA 3JSMA 3F2KA 1Q86O 3KHYA 4KI4A 3E1YA 3NVMA 5BPLA 5BRDA 4FYDA 3LZJA 2E2OA 3KK7A 4BRLA 3GL1A 1BISA 2WC9A 3EKSA 1CLQA 4H0PA 4PKIA 4BC3A 3H6EA 1T8EA 4OPAA 1T3VA 2VYPA 3CF5L 3VTIA 3LP0A 3UIQA 3FZLA 4BACA 2ZF5O 3DLGA 1X1PA 3UKRB 1LWFA 2YJFA 1LV5A 5BR9A 1VSFA 2FSKA 1NK7A 5HRSA 2NRWA 1S3XA 1XMOK 1FJGK 1Z6RA 4AHRA 2WBNA 2ZE2A 4ELTA 5M1KA 3KD5E 2E1YA 3OYIA 3TTCA 1XUPO 4WCEL 3LDOA 1B9DA 3WNFA 2JLEA 3E9OA 2PYLA 1DTQA 1NGFA 4Z4IA 3OYFA 1LW0A 2Y1JA 3ENOA 1FK9A 4B9VA 4H0VB 4GY2B 1NGBA 4Z4FA 4HCBA 4KH6A 2HVIA 2D0CA 1SQKA 4YOYA 2DPNA 1QZ5A 5FPMA 3G25A 3OA9A 4WQ4C 1BCOA 4X66K 1VQ7N 4C8OA 4N47A 4FXDA 4QS8A 2BE2A 2OYQA 3SV3A 4DSFA 4DUZK 4IJAA 1BI4B 4PL7A 4AQYK 3MXIA 4GV3A 2YNHA 3K0SA 1S22A 4CK2A 4YDUA 1QSSA 3TU5A 5I9EB 3OYLA 2XY5A 5AFUA 2P9SB 4XH1A 3OYAA 4FJGA 5H1SQ 3VERA 4A62A 4MLEA 4NO7A 1K6YA 2HNDA 3U3YA 2A1RA 4H0YB 1T6CA 3A8YA 4MQ3A 4CJEA 3ID6A 4BRFA 4DFPA 3QEWA 4CW7B 4FJJA 2LSNA 3HP6A 3WXIA 1J5EK 5CE3A 5M1PA 3C65A 1EX4A 3I33A 3D0PA 4JNEA 3DM2A 4IXCA 1HJOA 4EIAA 4KPYA 1OKJA 3ULDA 4CFDA 2PBDA 3CC7N 4BRDA 1A5WA 3QLHA 5C42A 4GV6A 4FWOA 3PLAA 1JLBA 4O8KA 4GW6A 2Q31A 4B3SK 1UOCA 5IWAK 3VQCA 3O8MA 3V1QA 2KFNA 2YCHA 3M8QA 5SZTA 3CCUN 4DWIA 4GKKK 2O8DA 3SUNA 3KJVA 3SV4A 1IJJA 2BUPA 2HBKA 4BQLA 1QQOA 3FFIA 1HNIA 3IKMA 4DSIA 3HYFA 2UUAK 4FJHA 2ZJPL 3IS9A 2NUBA 2KQ2A 4W5RA 3QNNA 1ZBUA 1IKWA 3IDHA 3L2VA 2D0PA 4C1NI 4IG3A 4OO1J 2P51A 1BQNA 3MECA 4B1YB 4JV5K 3WUHA 1NJYA 1I3AA 2X78A 3CJ9A 3P31A 3CCEN 1WAJA 2AJQA 1TAQA 3HXMA 1YHQN 2WOMA 1IBMK 1WBDA 1TL1A 1B92A 3O6WA 1GLAG 4CIGA 4BE1A 4M3UA 1YTUA 4CK1A 1QSLA 3LPTA 3DRSA 1S9GA 4CIEA 4CEQA 2KW4A 1NKCA 3BF1A 4CJ4A 1WAFA 3H3NO 3UKUB 3M3ZA 4CJUA 5AQQA 3L3UA 2NRTA 4CD1A 5EY4A 1X9MA 3ZT3A 1A5VA 1ESVA 2HB5A 1RDCA 2P9PB 1IBKK 4C8NA 1YAGA 1TK8A 4F2RA 4KHYA 1KVAA 3ZX3A 1Q7YO 5BN9A 1X3MA 3LDPA 4Z4GA 3VTHA 3OYDA 1WSGA 1DT9A 4NLCA 1TYQA 5AQFA 4JKGB 1M90O 5CHIA 3MX2A 1NGAA 3QBXA 4RW6A 2IVPA 3DYAA 2QXLA 1LAWA 2X6NA 3DLRA 3E01A 4E1JA 4DV6K 4DCHA 1L3SA 4YOTA 4KRFA 4FOEA 1J54A 1C1CA 3K5OA 4DQQA 3UKRA 1HJRA 4CEAA 1NMDA 2V7YA 5AQXA 3LDNA 3B6OA 4B3RK 3CETA 4CBUA 1NGIA 4ILGB 3H08A 3PIPL 3AA4A 1S1VA 1EXQA 4CFAA 1D4XA 4FJ7A 4CVNE 5AZIA 3B6PA 4CIFA 1ZXOA 4WFNL 3PX0A 4FJKA 2YNGA 3ZLJA 4FM2A 4CE9A 4I2QA 4EP5A 4DV4K 3L2RA 3IFRA 1YVNA 5C2FA 4BC4A 5AQMA 4BR7A 3A5LC 3FZKA 4H0TB 1QQCA 5KTQA 5HRRA 3SPZA 4LF6K 3WNHA 2R7YA 3KVGA 3TAMA 1HPZA 1N8RO 3AVNA 3E66A 5J2NA 1K8KB 1E3MA 5CYMA 1EQYA 4JKGA 1T44A 4W5OA 2E20A 3VA0A 2QI2A 1JCGA 1CZ9A 2OCEA 2EX3A 4H5WA 1QVFM 2YHYA 3CCQN 4I9QA 4FWQA 4KTWA 4CCHA 4LFAK 1BIUA 3LAMA 3NH1A 1NK6A 5BREA 4A59A 2F96A 4CHPA 4NXMK 3M8PA 4G9ZA 5AZJA 4CF1A 2O8EA 3V9UA 2HHHK 2V7ZA 4DR3K 4NCBA 1TVRA 1TKDA 3GE1A 1TK5A 2NRXA 2E6MA 4B1VA 1SV5A 2J4RA 1KXPA 4JAXA 4K42A 1HYSA 1BG3A 4FM0A 4X65K 1J53A 2YNFA 5HLFA 3NF9A 1N5YA 1NGJA 4AF1A 2OTLN 1VQ8N 4CGDA 3BEXA 1HQEA 3AVHA 3S3MA 4PQUA 2WONA 4J8FA 4IFVA 2O8BA 4CD3A 3E9LA 2XY8A 4CJ3A 1T7PA 1G99A 4IDHA 3VF2A 2NZTA 5C2DA 4OLBA 4ISGA 2W41A 1Q9XA 1HQUA 3A5OC 1RTDA 3OW2M 4K0KK 4PKHA 3CPEA 3LAKA 1WB9A 3I55N 3GBTA 2E5LK 1J9AA 1GOCA 2VWKA 5AQGA 3WNEA 3AVBA 3L6QA 4HUGA 1U4BA 5C10A 1EWRA 1XHZA 3P1GA 1EETA 3EZ5A 3D2EB 2NRHA 4OKEA 5E26A 3KLEA 2B4JA 5C12A 3O1BA 1J5OA 4FLUA 1C0FA 4H0OA 2DY4A 4DQRA 4JI4K 4DSEA 1L3TA 4X62K 3FLCO 5ADXH 2P9LB 4WFBL 4CEDA 3N4QA 3SMPA 5FRMA 5JS1A 3FZFA 1JKHA 4CF9A 4IEIA 2JWLA 1MWMA 3BZCA 3CMAN 4C23A 2RKIA 2BDPA 4CHYA 4OJRA 3TAGA 5AQRA 4IOCL 1VSIA 3CD6N 3L4QA 2Y1IA 2HOEA 4CHQA 4CHZA 4WE1A 4JKBA 3CM5A 3L2QA 4PA1A 4FWNA 1SAZA 3OS0A 5J2QA 2VCPA 3DLEA 4DR7K 1UWBA 2Q1NA 3U9DA 5BR8K 3LP3A 4DQIA 1U6ZA 3PSFA 2KHOA 3QEPA 4EAHD 3MWTA 3AGKA 4BR0A 4M63C 4E1MA 4YOVA 1O1WA 3PO4A 4N76A 1TGOA 3H46O 5C0YA 1JLAA 5JVHL 2O8CA 5KRSA 3AO1A 4DR1K 1Q81O 2E2PA 3EZWA 4CEEA 4B9MA 3UKUA 1ATRA 3ZSZA 4DB3A 4M3ZA 1HKGA 3BZKA 4LH5A 2G8KA 4H5VA 5EU7A 3OYKA 3D6RA 2KZMA 1U2VB 4DR2K 4FZYA 3LDLA 4FPAA 3EO3A 4ICLA 4JK9A 4EZ6A 2HBMA 3QIOA 1WBBA 3M8SA 1ZBSA 5E84A 1DKGD 1YJNN 2OPQA 2RN2A 4X64K 4FPBA 3CXCM 2VG5A 3T1HK 2GWJA 2W42A 5I42A 4I2PA 2GUPA 5LY3A 2QKKA 1W2BM 1VQNN 3KIOA 3B8AX 5JMVA 4FWKA 3KLFA 1NJXA 3HOTA 2ITGA 2HBLA 2HHXA 2P5OA 3SZ2A 5FPDA 4FWPA 1QQNA 2XHBA 4DV0K 5EVZA 5GINA 3KLHA 2E8AA 4BRHA 3RMDA 1NKEA 5A2QO 4B1ZA 3DXKB 2V51B 1EP4A 1BOTO 5KQ8A 2VGNA 5AQPA 3AV9A 4B3OA 1ZYQA 4KHNA 3LDQA 3C7NA 4DTJA 3VEYA 4EFHA 1QHAA 3THYB 3TAPA 1IG8A 4H4OA 4OLAA 3DXMA 4OKKA 1C0MA 3VQAA 3FFKB 3LM2A 5LMNK 4BROA 4BREA 4HTLA 5M1QA 4JK7A 1NGDA 3P5JA 2QWRA 4IJNA 2HHSA 4MO4A 4Z4CA 4YOWA 3CFOA 3NF8A 5FPEA 4WQ5C 4BE7B 3R6MA 3I8BA 4E7LA 5JS2A 2E2QA 3CJAA 1RGIA 3OYBA 4BRGA 2QW9A 4IBNA 3W3DA 1YIJN 2A1SA 2UU9K 4IZ9A 3DRRA 1P8ZA 1N36K 3NE6A 4BC5A 1D5AA 4YORA 3ZEUA 1GLJO 4KI6A 2FBVA 2W40A 4JYAK 4RG8A 4Y1CA 1ASVA 4IG0A 3KWIA 1KTQA 2ASPA 1OH6A 1BA1A 3HVTA 4NLBA 5HRNA 3R1XA 4I9LA 1TKXA 3AVLA 3NF7A 3K5LA 4KFBA 5JLHA 1JXBA 3QIPA 3CCVN 5C24A 4QS7A 2P9NA 1RT6A 1R59O 1VSMA 4IFEA 4ZHRA 2OPRA 4DTUA 4FSVA 1EO1A 3OYEA 2W6LA 4JI1K 2IC3A 2QWMA 3VQ7A 4ELVA 3SUPA 4DTNA 3TI0A 4BR5A 3HVRA 4FW1A 3NVKA 3NFAA
chains in the Genus database with same CATH topology
4JHDB 4OO1J 2BTFA 4RTFD 3AARA 4B1YB 3WUHA 3AAQA 3D7EO 2QWPA 4CBWA 2W00A 1VQ4N 3HM8A 4FVUA 3CJ9A 3P31A 5M1OA 5GAEP 3CCEN 4KH4A 4DQ8A 1YJWN 3CC2N 3WT0A 4BRQA 3GDQA 1YHQN 3WXJA 3QFUA 4BR2A 3IMXA 3O6WA 4PKGA 1GLAG 1VAZA 4PL8A 3D2FB 3G6EN 5AQWA 3D2EA 1XQSC 5AQJA 1K73O 1ZC6A 4HWIA 3VEWA 1BU6O 3CCJN 3ULEB 3PIOL 3BF1A 3N4PA 3CC4N 3H3NO 3UKUB 4EHUA 1VQPN 3M3ZA 5AQQA 2NRTA 2P9LA 3MX5A 4CD1A 5EY4A 2FSNA 3BP8A 1NGGA 4WYBA 1QZ6A 4QS9A 1ESVA 3O9RA 5BPNA 4YDUC 2OTJN 2NNWA 1RFQA 1QQMA 3ZYYX 2P9PB 4BRNA 4CZGA 1BDGA 1BA0A 1X9JA 2FF6A 4JN4A 1YAGA 5AQVA 4MLHA 1YXQA 3WXLA 4RCHA 4B9QA 3R9PA 4K43A 2QA4N 1O13A 4AM7A 3MN7A 4WFAL 4BRAA 3ZX3A 2IVNA 4IOAL 4H5RA 2I7PA 1Q7YO 3FZMA 4WQ4A 5BN9A 1X3MA 3VF6A 3LDPA 2HMPA 2Q36A 3VTHA 1DT9A 3HZ6A 4NLCA 1S72N 1TYQA 5AQFA 1Y64A 4Z94A 2P9UB 3A0IX 4JKGB 1M90O 2D4WA 4JKCA 3MX2A 5CHIA 4O8UA 1NGAA 2V52B 5EOYA 3QBXA 4LC9B 1NGHA 5EX5A 2IVPA 4BECA 3F5TA 2QXLA 3JXUA 3T69A 2HBJA 2KKZA 4E1JA 4DCHA 2OANA 2H3GX 4YOTA 2P9KA 1VQKN 4FOEA 2E1ZA 3H3OB 4CZMA 5MLCQ 3MN5A 3O9SA 5AQKA 3UKRA 3Q7CA 5AQZA 4CZLA 4K41A 2GWKA 3RSEB 3QDKA 5AFUH 1BWFO 1NMDA 3A5MC 2V7YA 5AQXA 1KAYA 2RE2A 3EKUA 3CQYA 3FGUA 3LDNA 4R79A 2YX6A 3CETA 3IUCA 4CBUA 1TYQB 1NGIA 1K8KA 4ILGB 4BG9A 4GVEA 1H1VA 3PIPL 1Q82O 1TUUA 1D4XA 4MDBA 4WF9L 3DXMB 1GLEG 3RVCA 1QVGM 4JKDA 5BRFA 3ENHA 5AZIA 3I56N 4JK8A 1JCEA 4BR9A 5GIPA 3AGRA 1ZXOA 4WFNL 3O08A 2F9TA 3GG4A 1MWKA 2HF3A 1E4FT 1OVYA 1VQMN 1VQ9N 1YUWA 3QFPA 3AAPA 4XH5A 3CCMN 1GLBG 2A40A 3IFRA 1YVNA 4ISFA 1XC3A 3BUZB 3WEEB 5C2FA 4BC4A 3FE1A 5AQHA 5AQMA 4B1WB 4JKHA 3A5LC 3FZKA 4H0TB 4BR7A 1HPMA 5BRHA 3ZX2A 4BG8A 4MDAA 3KVGA 1N8RO 4OPHA 3E66A 4BRLA 1NWKA 3P39A 4BRMA 4M7YA 1K8KB 3CIPA 4H0XB 1EQYA 2ZJRL 4JKGA 1YITN 1T44A 1U2VA 2E20A 5AQUA 5F1XA 3K9JA 2QI2A 2YJEA 5AQOA 1JCGA 3VF4A 5KQDA 3O4WA 2CH5A 5KPTA 2A6AA 2QWQA 1NGCA 2UYTA 4H5WA 4BC2A 1QVFM 2YHYA 4FL9A 3CCQN 4XJXA 4FWQA 2NRZA 2FXUA 3SLCA 4DHYA 1DEJA 4BY9C 3K9KA 1RDUA 3U8XA 1C0GA 5C15A 1KAZA 5BREA 4H03B 4A59A 1WUAA 3GOIA 4JKFA 4CZIA 4G9ZA 5AZJA 2YHWA 1YF5L 2QM1A 3C6HA 2WUSA 4XEIA 3O80A 2F7TA 5AQYA 2V7ZA 2A41A 2GELA 3GE1A 2NRXA 1BO5O 3HRGA 2FF3B 2YHXA 4BRPA 5LJWA 1NLVA 4B1VA 4RWTA 3OBWA 4Y0WA 5AQTA 2J4RA 5F2RA 1KXPA 4F9OA 4JAXA 3MCPA 4K42A 1K8AO 4FWLA 4IO9L 3U9ZA 1BG3A 1YI2N 2Q2RA 4CJ7A 3VGKA 2P9PA 3DWLA 3CCLN 1NGJA 2NLXA 4AF1A 2OTLN 3EN9A 3O5BA 1VQ8N 3MK6A 3MN6A 3BEXA 4NB4A 3MWPA 3EE9A 5AZJB 4XH4A 3SBGA 1K9MO 3ATUA 2QTDA 3QBWA 4FWMA 4CZHA 5HL7L 5JLFA 3A5NC 4J8FA 4B1XB 4CD3A 3E9LA 3VEVA 3DAWA 4EHTA 5F0XA 2NRRA 4L3QA 2IIRA 4PHTX 3DJCA 4FWSA 3ULEA 1CZAN 1G99A 3CJBA 1GLLO 2A42A 2NZTA 4IDHA 3VF2A 5C2DA 2WFBA 4KH5A 4ISGA 2W41A 1JJ2M 5AR0A 2FLOA 3QICA 5M1NA 3UE5A 3H1QA 1ATSA 3A5OC 4GNIA 5ADXA 3OW2M 5AQIA 4PKHA 3CPEA 2F9WA 1WOQA 5AZIB 5TKYA 3VEXA 3GBTA 3I55N 2BH1A 2E2NA 4IO8A 2I7NA 2CH6A 2QWOA 3VOVA 2GEMA 5AQGA 4FWRA 1V4TA 4A5AA 3FR0A 3J8AA 3U4LA 3SAFA 3H1VX 3NVKA 3L6QA 4CZKA 3ENBA 2IVOA 5DM6L 5C10A 2P9NB 4A57A 3D2EB 3P4IA 1HKBA 2NRHA 4YOXA 5E26A 2NRVA 2AP1A 5C12A 1SS6A 3R8EA 3O1BA 4H5TA 4ILJA 3H45C 4BR4A 1SZ2A 1C0FA 4H0OA 3TSPA 1GLDG 2ASMA 2ZGYA 4ILHA 4CBXA 1J6ZA 3FLCO 3UB5A 1YJ9N 3MMVA 4H5NA 4BVOA 5ADXH 3CCRN 2P9LB 4M7XA 4BRKA 2Q0UA 1VQON 4WFBL 3N4QA 3SMPA 4CI6A 4KBOA 2ASOA 3FZFA 1BUPA 4C1NK 2P9IA 3TTFA 1E4GT 4JKEA 4IEIA 2JWLA 4DKWA 1MWMA 3FZHA 3CMAN 4C23A 4A5BA 3VMFB 4BQZA 4BVPA 4WQ5A 5AQRA 4FO0A 4IOCL 3D2FA 4CZEA 3CD6N 3RSEA 3L4QA 2ITMA 2HOEA 5JICA 3VESA 3TTDA 5TKWA 5CR4A 3F2KA 2KLAA 4U67L 1Q86O 3KHYA 1NM1A 4A2AA 3HBTA 4JKBA 3VENA 4CZJA 4U7BA 3E1YA 3NVMA 4FWNA 3EL2A 1SAZA 5BPLA 5BRDA 5GAHP 4JD2B 1JCFA 2VCPA 2E2OA 3ID8A 3VEOA 2Q1NA 4IWVA 3KK7A 2AA4A 3GL1A 3QB0A 2WC9A 3EKSA 3R3LA 1RDWX 3AY9A 3U9DA 4H0PA 4PKIA 4BC3A 3H6EA 3KZBA 4OPAA 3CHWA 1U6ZA 2KHOA 3OHRA 3ATVA 4EAHD 1T3VA 2VYPA 1GLCG 1V4SA 3MWTA 3CF5L 3AGKA 1Z05A 4M63C 3SBTA 3VTIA 4BR0A 4YOVA 1VQ6N 3FZLA 1ILYA 3H46O 1VQLN 2ZF5O 3VEZA 3HOSA 5C0YA 3UKRB 5JVHL 3HSCA 3TSQA 4A2BA 2YJFA 3C7NB 4BRCA 1HLUA 2ZWHA 5BR9A 2FSKA 1Q81O 2NRWA 1S3XA 1LOTB 1M1KO 3O1WA 3S41A 3SJHA 1Z6RA 2E2PA 3EZWA 2WBNA 4FOIA 3UKUA 5M1KA 1NJIO 2E1YA 1VQ5N 1ATRA 3TTCA 3VGMA 5AQSA 1XUPO 4DB3A 4WCEL 3WXMB 1HKGA 4H5VA 3LDOA 3D6RA 4JHDA 1U2VB 1KAXA 3LDLA 4FPAA 3EO3A 4JK9A 3Q7BA 2HBMA 2HSTA 3E9OA 3CCSN 1ZBSA 2QEXN 1NGFA 3DXKA 3SAHA 5E84A 1DKGD 2A3ZA 1YJNN 2P9IB 4FPBA 2GX9A 3CXCM 3ENOA 2CGLA 3TSUA 3WQTA 4H0VB 4I6MA 4GY2B 4BR5A 1NGBA 2GWJA 2QWNA 4KH6A 4UY8O 1MDUB 2GUPA 2P9SA 5LY3A 1SQKA 4O5FA 4BRIA 3CERA 1W2BM 4YOYA 4GV9A 2DPNA 3P38A 3CJCA 3LL3A 3B8AX 3BF3A 3KWGA 5JMVA 4FWKA 4MO5A 1KQSM 1QZ5A 3LM9A 3WQUA 3HOTA 5FPMA 3G25A 2HBLA 3OA9A 5AQLA 1ATNA 4WQ4C 2D1KA 2CGKA 5FPDA 4FWPA 1VQ7N 1QQNA 2A5XA 3SMSA 3O9UA 2C1GA 5EVZA 4QS8A 5GINA 3CPWM 2E8AA 1X3NA 3L0QA 3ZEUB 4BRHA 1MA9B 2EWSA 3MCAB 1GLFO 2E88A 4JEPA 3WXKA 4IJAA 4B1ZA 4PL7A 5LJVA 4GV3A 3DXKB 2V51B 2P9KB 3CJ1A 1BOTO 1S22A 2VGNA 2YI1A 3C0BA 4I6MB 5KQ8A 5AQPA 1KC8O 4YDUA 1KD1O 2VWBA 3HTVA 3TU5A 3E9PA 3W0LA 5I9EB 2D0OA 5AFUA 2P9SB 3CJ7A 3LDQA 4XH1A 3C7NA 4JKAA 5EXWA 3T7ZA 3G4SN 4YOUA 3VEYA 2ZGZA 4EFHA 4BGAA 1QHAA 5GADP 5H1SQ 2HF4A 3VERA 4A62A 4MLEA 1HKCA 4NO7A 1NGEA 3C6AA 4IOXA 4BEBA 3MN9A 2P9UA 1IG8A 3VGLA 5DM7L 3O9QA 4H0YB 1T6CA 3A8YA 3DXMA 3ID6A 5FPNA 3ZX0A 5B8HA 3VPZA 2JWKA 3FFKB 3LM2A 4AM6A 4BRFA 2Q97A 4BROA 4HTLA 5M1QA 4JK7A 4BREA 3ZETB 5BPMA 1NGDA 5HOOA 3G71N 3HI0A 3DLLL 3WXIA 2FSJA 2QWRA 4IJNA 3NMUA 2C1IA 5CE3A 5M1PA 4MO4A 3F9MA 1LCUA 4A61A 3MDQA 2VGMA 4YOWA 2PFUA 1HUXA 3C65A 3I33A 5GAGP 5FPEA 4WQ5C 4BE7B 4JNEA 3R6MA 2ZJQL 3J7ZO 3I8BA 4K25A 5KPZA 4IXCA 5BN8A 3WEEA 1HJOA 3CI5A 2E2QA 3CJAA 5GIOA 1RGIA 4EIAA 1OKJA 3L4IA 3SK3A 1HX1A 4BRGA 2PBDA 3VETA 2QW9A 3M6GA 3W3DA 3CC7N 5ELZA 1YIJN 4BRDA 3JS6A 3SAGA 5AQNA 5JVGL 4GV6A 4FWOA 3CMEN 2Q0RA 3CQXA 4IZ9A 1DGKN 3PLAA 1P8ZA 4O8KA 3ZETA 4BC5A 2Q31A 3EE8A 3O8MA 4YORA 2CGJA 1GLJO 3ZEUA 1NBWA 2W40A 2YCHA 3KWIA 3CCUN 2ASPA 1T6DA 4ISEA 1BA1A 4NLBA 2GTDA 3QMLA 3R1XA 1IJJA 2BUPA 2HBKA 3TPQA 5JLHA 3O9TA 5M1FA 3CCVN 4IEEA 4BQLA 1QQOA 4QS7A 2P9NA 1R59O 3IKMA 3M5RA 4IFEA 5KPRA 2ZJPL 4CZFA 1P90A 4FSVA 1TUYA 4BGBA 1VQNN 1EO1A 2PAVA 2QWLA 2QWMA 1W97L 4JD2A 1Q18A 3OBYA 2RHKA 3IDHA 4B1UB 2D0PA 4C1NI 3M1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHD B;  2BTF A;  4RTF D;  3AAR A;  4B1Y B;  3WUH A;  3AAQ A;  3D7E O;  2QWP A;  4CBW A;  3HM8 A;  3CJ9 A;  4DQ8 A;  3WT0 A;  4BRQ A;  3GDQ A;  3WXJ A;  3QFU A;  4BR2 A;  3IMX A;  3O6W A;  4PKG A;  1GLA G;  4PL8 A;  3D2F B;  5AQW A;  3D2E A;  1XQS C;  5AQJ A;  1ZC6 A;  4HWI A;  3VEW A;  1BU6 O;  3ULE B;  3BF1 A;  3H3N O;  3UKU B;  4EHU A;  3M3Z A;  5AQQ A;  2P9L A;  4CD1 A;  5EY4 A;  2FSN A;  3BP8 A;  1NGG A;  4WYB A;  1QZ6 A;  4QS9 A;  1ESV A;  5BPN A;  4YDU C;  1RFQ A;  1QQM A;  2P9P B;  4BRN A;  4CZG A;  1BDG A;  1BA0 A;  1X9J A;  2FF6 A;  4JN4 A;  1YAG A;  5AQV A;  4MLH A;  1YXQ A;  3WXL A;  4RCH A;  4B9Q A;  3R9P A;  4K43 A;  4AM7 A;  3MN7 A;  4BRA A;  3ZX3 A;  2IVN A;  4H5R A;  2I7P A;  3FZM A;  4WQ4 A;  5BN9 A;  1X3M A;  3VF6 A;  3LDP A;  2HMP A;  2Q36 A;  3HZ6 A;  1TYQ A;  5AQF A;  1Y64 A;  4Z94 A;  2P9U B;  3A0I X;  2D4W A;  1NGA A;  2V52 B;  5EOY A;  3QBX A;  4LC9 B;  1NGH A;  5EX5 A;  2IVP A;  2QXL A;  3JXU A;  4E1J A;  4DCH A;  2OAN A;  2H3G X;  2P9K A;  4FOE A;  2E1Z A;  3H3O B;  4CZM A;  3MN5 A;  5AQK A;  3UKR A;  4CZL A;  5AQZ A;  4K41 A;  2GWK A;  3RSE B;  3QDK A;  5AFU H;  1BWF O;  1NMD A;  3A5M C;  2V7Y A;  5AQX A;  1KAY A;  3FGU A;  3EKU A;  3CQY A;  3LDN A;  3CET A;  3IUC A;  4CBU A;  1TYQ B;  1NGI A;  1K8K A;  4BG9 A;  1H1V A;  1TUU A;  1D4X A;  3DXM B;  1GLE G;  5BRF A;  3ENH A;  5AZI A;  1JCE A;  4BR9 A;  1ZXO A;  3O08 A;  3GG4 A;  2F9T A;  1MWK A;  2HF3 A;  1E4F T;  1YUW A;  3QFP A;  3AAP A;  4XH5 A;  1GLB G;  2A40 A;  3IFR A;  1YVN A;  4ISF A;  1XC3 A;  3BUZ B;  3WEE B;  4BC4 A;  3FE1 A;  5AQH A;  5AQM A;  4B1W B;  4BR7 A;  3A5L C;  3FZK A;  4H0T B;  1HPM A;  5BRH A;  3ZX2 A;  4BG8 A;  3KVG A;  1NWK A;  4BRM A;  4M7Y A;  1K8K B;  3CIP A;  4H0X B;  1EQY A;  1T44 A;  1U2V A;  2E20 A;  5AQU A;  5F1X A;  3VF4 A;  2YJE A;  5AQO A;  5KQD A;  1JCG A;  3O4W A;  2CH5 A;  5KPT A;  2A6A A;  2QWQ A;  1NGC A;  2UYT A;  4H5W A;  4BC2 A;  2YHY A;  4FL9 A;  4FWQ A;  2FXU A;  3SLC A;  4DHY A;  1DEJ A;  3U8X A;  1C0G A;  1KAZ A;  5BRE A;  4H03 B;  1WUA A;  3GOI A;  4CZI A;  5AZJ A;  2YHW A;  2QM1 A;  2WUS A;  4XEI A;  3O80 A;  5AQY A;  2V7Z A;  2A41 A;  2GEL A;  3GE1 A;  1BO5 O;  2FF3 B;  2YHX A;  4BRP A;  5LJW A;  1NLV A;  4B1V A;  4RWT A;  4Y0W A;  5AQT A;  2J4R A;  5F2R A;  1KXP A;  4F9O A;  4JAX A;  3MCP A;  4K42 A;  4FWL A;  3U9Z A;  1BG3 A;  2Q2R A;  4CJ7 A;  3VGK A;  2P9P A;  3DWL A;  1NGJ A;  2NLX A;  3EN9 A;  3O5B A;  3MK6 A;  3MN6 A;  3BEX A;  4NB4 A;  5AZJ B;  4XH4 A;  3ATU A;  3QBW A;  4FWM A;  4CZH A;  5JLF A;  3A5N C;  4J8F A;  4B1X B;  4CD3 A;  3VEV A;  3DAW A;  4EHT A;  5F0X A;  4L3Q A;  2IIR A;  3DJC A;  4FWS A;  3ULE A;  1CZA N;  1G99 A;  3CJB A;  1GLL O;  2A42 A;  2NZT A;  3VF2 A;  4ISG A;  2W41 A;  5AR0 A;  2FLO A;  3QIC A;  3UE5 A;  3H1Q A;  1ATS A;  3A5O C;  4GNI A;  5ADX A;  5AQI A;  4PKH A;  2F9W A;  1WOQ A;  5AZI B;  5TKY A;  3VEX A;  3GBT A;  2E2N A;  4IO8 A;  2I7N A;  2CH6 A;  2QWO A;  3VOV A;  2GEM A;  5AQG A;  4FWR A;  1V4T A;  3FR0 A;  3J8A A;  3U4L A;  3H1V X;  3L6Q A;  4CZK A;  2IVO A;  2P9N B;  3D2E B;  3P4I A;  1HKB A;  2NRH A;  5E26 A;  2AP1 A;  3R8E A;  3O1B A;  4H5T A;  4BR4 A;  3H45 C;  1SZ2 A;  1C0F A;  4H0O A;  1GLD G;  2ASM A;  2ZGY A;  4CBX A;  1J6Z A;  3FLC O;  3UB5 A;  3MMV A;  4H5N A;  4BVO A;  5ADX H;  2P9L B;  4M7X A;  4BRK A;  2Q0U A;  3SMP A;  4CI6 A;  4KBO A;  2ASO A;  3FZF A;  1BUP A;  2P9I A;  1E4G T;  1MWM A;  3FZH A;  4C23 A;  4BQZ A;  4BVP A;  4WQ5 A;  5AQR A;  4FO0 A;  3D2F A;  4CZE A;  3RSE A;  2ITM A;  2HOE A;  5JIC A;  3VES A;  3KHY A;  1NM1 A;  4A2A A;  3HBT A;  3VEN A;  4CZJ A;  4FWN A;  5BRD A;  5BPL A;  3EL2 A;  1SAZ A;  4JD2 B;  1JCF A;  2VCP A;  2E2O A;  3ID8 A;  3VEO A;  2Q1N A;  4IWV A;  2AA4 A;  3GL1 A;  3QB0 A;  3U9D A;  3EKS A;  4BRL A;  1RDW X;  3AY9 A;  4H0P A;  4PKI A;  4BC3 A;  3H6E A;  3KZB A;  3CHW A;  1U6Z A;  2KHO A;  3OHR A;  3ATV A;  4EAH D;  2VYP A;  1GLC G;  1V4S A;  1Z05 A;  4M63 C;  4BR0 A;  3FZL A;  3H46 O;  2ZF5 O;  3VEZ A;  3UKR B;  3HSC A;  4A2B A;  2YJF A;  3C7N B;  4BRC A;  1HLU A;  2ZWH A;  5BR9 A;  2FSK A;  1S3X A;  1LOT B;  3O1W A;  3S41 A;  3SJH A;  1Z6R A;  2E2P A;  3EZW A;  4FOI A;  3UKU A;  2E1Y A;  1ATR A;  3VGM A;  5AQS A;  1XUP O;  4DB3 A;  1HKG A;  4H5V A;  3LDO A;  4JHD A;  1U2V B;  1KAX A;  3LDL A;  4FPA A;  3EO3 A;  1ZBS A;  1NGF A;  3DXK A;  5E84 A;  1DKG D;  2A3Z A;  2P9I B;  4FPB A;  3ENO A;  2CGL A;  3WQT A;  4H0V B;  4I6M A;  4GY2 B;  4BR5 A;  1NGB A;  2GWJ A;  2QWN A;  1MDU B;  2GUP A;  2P9S A;  5LY3 A;  1SQK A;  4O5F A;  4BRI A;  3CER A;  2DPN A;  3CJC A;  3LL3 A;  3B8A X;  3BF3 A;  5JMV A;  4FWK A;  4MO5 A;  1QZ5 A;  3LM9 A;  3WQU A;  5FPM A;  3G25 A;  5AQL A;  1ATN A;  4WQ4 C;  2D1K A;  2CGK A;  5FPD A;  4FWP A;  1QQN A;  2A5X A;  3SMS A;  5EVZ A;  4QS8 A;  2E8A A;  1X3N A;  3L0Q A;  3ZEU B;  4BRH A;  1MA9 B;  2EWS A;  3WXK A;  1GLF O;  2E88 A;  4IJA A;  4B1Z A;  4PL7 A;  5LJV A;  3DXK B;  2V51 B;  2P9K B;  3CJ1 A;  1BOT O;  1S22 A;  2YI1 A;  4I6M B;  3C0B A;  5KQ8 A;  5AQP A;  4YDU A;  2VWB A;  3HTV A;  3TU5 A;  5I9E B;  3W0L A;  2D0O A;  5AFU A;  2P9S B;  3CJ7 A;  3LDQ A;  4XH1 A;  3C7N A;  5EXW A;  3VEY A;  2ZGZ A;  4EFH A;  4BGA A;  1QHA A;  2HF4 A;  3VER A;  4A62 A;  4MLE A;  1HKC A;  4NO7 A;  1NGE A;  3MN9 A;  2P9U A;  1IG8 A;  3VGL A;  4H0Y B;  1T6C A;  3A8Y A;  3DXM A;  5FPN A;  3ZX0 A;  5B8H A;  3VPZ A;  4BRF A;  3FFK B;  3LM2 A;  4AM6 A;  2Q97 A;  4BRO A;  4HTL A;  4BRE A;  5BPM A;  3ZET B;  1NGD A;  3HI0 A;  3WXI A;  2FSJ A;  2QWR A;  4IJN A;  5CE3 A;  4MO4 A;  3F9M A;  1LCU A;  4A61 A;  3MDQ A;  1HUX A;  3I33 A;  5FPE A;  4WQ5 C;  4JNE A;  3R6M A;  3I8B A;  4K25 A;  5KPZ A;  4IXC A;  5BN8 A;  3WEE A;  1HJO A;  3CI5 A;  2E2Q A;  3CJA A;  1RGI A;  4EIA A;  1OKJ A;  3L4I A;  3SK3 A;  1HX1 A;  4BRG A;  2PBD A;  3VET A;  2QW9 A;  3M6G A;  3W3D A;  5ELZ A;  4BRD A;  3JS6 A;  5AQN A;  4FWO A;  2Q0R A;  3CQX A;  4IZ9 A;  1DGK N;  1P8Z A;  4O8K A;  3ZET A;  4BC5 A;  2Q31 A;  3O8M A;  3ZEU A;  2CGJ A;  1GLJ O;  1NBW A;  2W40 A;  2YCH A;  2ASP A;  1T6D A;  4ISE A;  1BA1 A;  2GTD A;  3QML A;  1IJJ A;  2BUP A;  3TPQ A;  5JLH A;  4BQL A;  1QQO A;  4QS7 A;  2P9N A;  1R59 O;  5KPR A;  4CZF A;  4FSV A;  1TUY A;  4BGB A;  2PAV A;  2QWL A;  2QWM A;  4JD2 A;  1Q18 A;  3IDH A;  4B1U B;  2D0P A;  3M1F A; 
#chains in the Genus database with same CATH topology
 3NGZ A;  4B9N A;  2BTF A;  3AAR A;  3NH0 A;  4CBW A;  4FK0 A;  3HM8 A;  1IKY A;  4KO0 A;  4BDZ A;  1YJW N;  3GDQ A;  3QFU A;  4DF4 A;  4BR2 A;  4EP4 A;  3KLI A;  3KKR A;  3D2F B;  3G6E N;  4PY5 A;  5AQW A;  5HBM A;  1YTA A;  1Q8I A;  1XQS C;  3THW B;  1ZC6 A;  3VEW A;  1BU6 O;  1T05 A;  3ZSY A;  5FRN A;  3N4P A;  3CC4 N;  1KSP A;  4EHU A;  2G8I A;  3L2W A;  1VRT A;  2P1J A;  4E1N A;  4K8X A;  3K5M A;  3MX5 A;  2FSN A;  3BP8 A;  2F8S A;  1NGG A;  4WYB A;  5C25 A;  2XY7 A;  4FLT A;  3O9R A;  1RFQ A;  3RMB A;  2VQE K;  1QQM A;  3ZYY X;  4BRN A;  4CZG A;  4OPK A;  1BDG A;  1X9J A;  2FF6 A;  1BCM A;  4JN4 A;  1KFD A;  1YXQ A;  4DF8 A;  4K43 A;  1O13 A;  4AM7 A;  3MN7 A;  1U45 A;  2IVN A;  4FK2 A;  3DI6 A;  1X9W A;  3HZ6 A;  4E3S A;  2GV9 A;  3K58 A;  3AVI A;  1Y64 A;  3QEI A;  3A0I X;  2D4W A;  4JKC A;  4DV2 K;  1WSH A;  5EOY A;  1NGH A;  5KGX A;  4KHS A;  5EX5 A;  4BEC A;  2F4V K;  4JI6 K;  1LAV A;  4W5N A;  4ID5 A;  2OAN A;  2YKN A;  3QNO A;  3SQ1 A;  1VQK N;  3MN5 A;  3O9S A;  1NKB A;  2DFF A;  1ZBF A;  5AFU H;  1BWF O;  3V1O A;  3NAE A;  1G15 A;  4R79 A;  3THW A;  3LZI A;  5CZ1 A;  1TYQ B;  1NMN A;  1K8K A;  5DK5 A;  1H1V A;  5SWM A;  4MDB A;  3L2U A;  4C8M A;  1QVG M;  4FJI A;  2OPP A;  1BHL A;  1FKP A;  4JK8 A;  1JCE A;  3AGR A;  2VG6 A;  3O08 A;  1WNS A;  1BI4 A;  2F9T A;  3GG4 A;  4B08 A;  1MWK A;  4CES A;  3ZSO A;  2HF3 A;  1IO2 A;  1D9D A;  5JEN A;  4AH9 A;  3SI6 A;  3BUZ B;  3WEE B;  4B1W B;  3CG7 A;  3CM6 A;  3PX4 A;  2ATQ A;  4LF5 K;  4TSX A;  3V81 A;  3LDS A;  2ZD1 A;  1NWK A;  4BRM A;  3RR8 A;  1JL1 A;  1OH5 A;  3AVM A;  2G8U A;  5KQD A;  3O4W A;  5KPT A;  1DLO A;  3WNG A;  4BC2 A;  4FL9 A;  4YNQ A;  2UUC K;  4DHY A;  4BY9 C;  4FCY A;  3K9K A;  3TAR A;  1VSE A;  5C15 A;  4H03 B;  4CEC A;  1YF5 L;  2QM1 A;  3MEG A;  4CGF A;  3OYG A;  2WUS A;  4XEI A;  5AQY A;  2A41 A;  2GEL A;  1BO5 O;  3HRG A;  3HK2 A;  4CJF A;  1JLQ A;  4BRP A;  4RWT A;  1NLV A;  2FBX A;  2YHA A;  1N32 K;  4Y0W A;  4F9O A;  4OGE A;  4FWL A;  3QER A;  4JI0 K;  2Q2R A;  4HUE A;  4CJ7 A;  3VGK A;  2P9P A;  3T1Y K;  4DTP A;  3NHG A;  4DU3 A;  3CFP A;  3MN6 A;  4DQS A;  4NB4 A;  3MWP A;  3NGI A;  3V4I A;  3ATU A;  2QTD A;  5HL7 L;  1EKE A;  4B1X B;  3HPH A;  4PWD A;  3DAW A;  1UAX A;  4DSL A;  2NRR A;  1XC9 A;  4W5T A;  3OS1 A;  4JRQ A;  1XWL A;  5AR0 A;  4LFB K;  5M1N A;  4DFJ A;  1ATS A;  4GNI A;  5AQI A;  3QO9 A;  2F9W A;  2HW3 A;  4M41 A;  5TKY A;  3VEX A;  4J2A A;  1BIZ A;  3HM9 A;  3VQP A;  3OJU A;  2E2N A;  2I7N A;  3ZSX A;  4Z4E A;  3VOV A;  2GEM A;  4FWR A;  1V4T A;  4A5A A;  3FR0 A;  3U4L A;  3OJS A;  4LF7 K;  3H1V X;  1EWQ A;  4CZK A;  2IVO A;  5DM6 L;  1QSY A;  2P9N B;  1TKZ A;  4A57 A;  3TAQ A;  3HP9 A;  4B8A B;  4RW8 A;  2AP1 A;  1S1T A;  1SS6 A;  5LMU K;  4DTR A;  4H5T A;  3H45 C;  1SZ2 A;  1GLD G;  2ZGY A;  4ILH A;  1J6Z A;  3AVC A;  3NF6 A;  3UB5 A;  1YJ9 N;  1NNE A;  3MMV A;  4H5N A;  1W0H A;  4CJQ A;  2Q0U A;  1VQO N;  1RIL A;  1RTI A;  2G8W A;  4CER A;  2XY6 A;  1OH8 A;  4FJX A;  3DLK A;  1D9F A;  4JKE A;  3FZH A;  4CZE A;  4BDY A;  4CFB A;  4FM1 A;  2HHU A;  3RSE A;  4JS5 A;  3THY A;  1N34 K;  3TTD A;  2O8E B;  2KLA A;  1W9H A;  1NM1 A;  1VHX A;  3VEN A;  5GAH P;  1JCF A;  4Q5V A;  4IWV A;  2AA4 A;  4DSJ A;  2IDO A;  3R3L A;  4LY7 A;  3AY9 A;  1A5X A;  3RTV A;  5HRO A;  3KZB A;  3ATV A;  1V4S A;  4B9S A;  2YNI A;  4O55 A;  3IAY A;  3OY9 A;  4M3W A;  2IS3 A;  1SKW A;  3TSQ A;  2VG7 A;  3C7N B;  3KD1 E;  2ZWH A;  1ZBI A;  1LOT B;  3S41 A;  3SJH A;  2G8H A;  4C8K A;  4FOI A;  1VQ5 N;  1NJI O;  1X9S A;  5AJ3 K;  4BWJ A;  4KTZ A;  2DFH A;  4KAZ A;  4JHD A;  1KAX A;  1C0U A;  3Q7B A;  2HST A;  3SJJ A;  3CCS N;  2QEX N;  3KKS A;  3SQ4 A;  3DXK A;  3BY5 A;  3SAH A;  4DV7 K;  4B3M K;  2A3Z A;  1S1X A;  3U6F A;  3G0Z A;  3ZSV A;  4IKF A;  1RBR A;  2OZM A;  4I6M A;  2FBT A;  3K57 A;  4LSN A;  5FDL A;  1FKO A;  1BL3 A;  1MDU B;  3J7Y P;  1IG9 A;  4O5F A;  4BRI A;  3CER A;  4GV9 A;  4JI8 K;  2W00 A;  3L3V A;  3LL3 A;  3P38 A;  3BF3 A;  4KHW A;  1ZBL A;  5AQL A;  3THV A;  1ATN A;  1HNX K;  1YVU A;  2C1G A;  2A5X A;  3SMS A;  3O9U A;  3BDP A;  2B5J A;  1ASU A;  3CPW M;  3ZEU B;  3MCA B;  4JEP A;  4CJT A;  1KFS A;  3VQE A;  5KRT A;  3CJ1 A;  2UXC K;  3C0B A;  1XHX A;  2VWB A;  1C1A A;  4DQP A;  1WSI A;  3E9P A;  3W0L A;  1U04 A;  2D0O A;  3CYM A;  1KVB A;  3T19 A;  3T7Z A;  3G4S N;  3EYZ A;  4DS4 A;  2ZGZ A;  3LAN A;  4BGA A;  2HF4 A;  1RBS A;  1NGE A;  3PV8 A;  4BEB A;  2P9U A;  1U47 A;  3VGL A;  3V9W A;  4CEO A;  2RPI A;  3O9Q A;  4FVM A;  3OYN A;  3DLH A;  3ZX0 A;  5B8H A;  3VPZ A;  3C95 A;  2HNY A;  4AM6 A;  2Q97 A;  5HOO A;  2G8V A;  3ZET B;  1MU2 A;  4BE0 A;  2C1I A;  1RBV A;  2O8D B;  3ZSR A;  3F9M A;  1LCU A;  4ID1 A;  4KHP K;  2PFU A;  5GAG P;  3AA5 X;  4KHU A;  4JI2 K;  4JLH A;  2ZJQ L;  4RW9 A;  5KPZ A;  4JI5 K;  4FK4 A;  3WEE A;  3CI5 A;  5GIO A;  3TAN A;  3OYJ A;  2UUB K;  1QHT A;  3L4I A;  3SK3 A;  2O8F B;  1HX1 A;  4R5P A;  4DLE A;  3M6G A;  1QE1 A;  4AHC A;  3SAG A;  1OH7 A;  3A2F A;  5AQN A;  5JVG L;  3CME N;  4CJS A;  3ZET A;  2QK9 A;  3EE8 A;  4F2S A;  4FZX C;  4B9U A;  4DTX A;  4ISE A;  4NYF A;  2GTD A;  2IAJ A;  3QML A;  4E7H A;  3ALY A;  1RCH A;  3TPQ A;  3O9T A;  3VQ9 A;  4BWM A;  5M1F A;  4YHH K;  3MXJ A;  3ZSW A;  3S5T A;  3F73 A;  3AO2 A;  4BGB A;  3V6D A;  1HMV A;  2QWL A;  3AO5 A;  1QS4 A;  4W5Q A;  4JD2 A;  3OBY A;  3RMC A;  4B1U B;  1L5U A;  3AVG A;  4JHD B;  1IKV A;  3SUO A;  2Q3S A;  4RTF D;  2PZS A;  4HHT A;  1Z26 A;  3D7E O;  2QWP A;  1NK8 A;  1VQ4 N;  5GAE P;  4RW4 A;  1C0T A;  3O4N A;  4DQ8 A;  3QEX A;  4CGI A;  1S1U A;  2Z1G A;  3PSI A;  3WT0 A;  3I8D A;  3CC2 N;  2DFE A;  3WXJ A;  1JLF A;  3IMX A;  2B6A A;  4PL8 A;  3C6U A;  3D2E A;  5AQJ A;  1NOY A;  2KFZ A;  2KZZ A;  2QXF A;  3HPG A;  3ULE B;  4AHT A;  3PIO L;  4FW2 A;  4KRE A;  1ASW A;  1VQP N;  4B3T K;  4Z4H A;  5FRO A;  2HHV A;  4QS9 A;  4YDU C;  3OYC A;  3SNN A;  4O0I A;  2D0B A;  3DOK A;  1CXU A;  4MLH A;  1IBL K;  3R9P A;  2QA4 N;  1TKT A;  4DUY K;  1WN7 A;  4WFA L;  4BRA A;  4WQ4 A;  4LH4 A;  3VF6 A;  2HMP A;  1KVC A;  5HRP A;  1Y97 A;  1S72 N;  4Z94 A;  1C1B A;  1SKR A;  1DTT A;  4O8U A;  4M3Y A;  1RDA A;  2V52 B;  4LC9 B;  1VRU A;  2DTU A;  3ZT1 A;  1NOZ A;  3JXU A;  2HBJ A;  2KKZ A;  4NXN K;  3MAQ A;  4ZTF A;  2E1Z A;  4FJL A;  2XRI A;  4CJR A;  1NK9 A;  4CZM A;  4L8R B;  4DR5 K;  4AHV A;  5AQK A;  3Q7C A;  5AQZ A;  1CXQ A;  4CJV A;  3LP2 A;  2GWK A;  2D0A A;  4OGC A;  3RSE B;  3QDK A;  4CF2 A;  3EKU A;  3CQY A;  3SYZ A;  4FLV A;  2GBZ A;  4OKJ A;  4BG9 A;  4MFB A;  4FLX A;  4OVL A;  4GKJ K;  4GVE A;  2FBY A;  1VSL A;  4DTS A;  3RRH A;  3ZSQ A;  4E72 A;  1HR0 K;  3OYH A;  3I56 N;  3ENH A;  1RT2 A;  4PUO A;  3CQ8 A;  1E4F T;  4DS5 A;  1OVY A;  4XH5 A;  4EZ9 A;  1HYV A;  2A40 A;  3OVN A;  4ISF A;  1XC3 A;  3FE1 A;  4JKH A;  4CF0 A;  5BRH A;  4BG8 A;  1VSH A;  4K8Z A;  4M7Y A;  4H0X B;  4JI7 K;  3AA2 A;  4GMJ B;  1YIT N;  5AQU A;  5F1X A;  3VF4 A;  3K9J A;  4RW7 A;  2CH5 A;  2A6A A;  2QWQ A;  2UYT A;  4AHS A;  4DFM A;  2ETJ A;  4BDP A;  1JXE A;  2FXU A;  3SLC A;  1DEJ A;  3K59 A;  4FLW A;  4NCG A;  4I7F A;  3U8X A;  4Z0U A;  1S6Q A;  4CJK A;  1WUA A;  3GOI A;  4CZI A;  2O8B B;  3O80 A;  2BAN A;  2F7T A;  5IT9 O;  2IOC A;  2RF2 A;  1IV0 A;  1YT3 A;  2F8T A;  2FF3 B;  4J2E A;  5LJW A;  1LW2 A;  3CYG A;  3DWL A;  1N6Q A;  2NLX A;  5J2P A;  3EN9 A;  2GUI A;  3O5B A;  3VQ6 A;  3NDK A;  3MK6 A;  1JL2 A;  3SUQ A;  3EE9 A;  1K9M O;  3O3F A;  2JGU A;  4FWM A;  1RDB A;  2E4L A;  3MEE A;  1BQM A;  4LFC K;  3EY1 A;  2E6L A;  3VEV A;  4H4M A;  4EHT A;  1I39 A;  5F0X A;  4PHT X;  4FWS A;  1CZA N;  3T3F A;  3CJB A;  1GLL O;  2A42 A;  2WFB A;  4E7J A;  3VQD A;  2FLO A;  3QIC A;  3V9S A;  4CJP A;  3V1R A;  1RTH A;  4CGG A;  1WOQ A;  5AZI B;  1I94 K;  1VSK A;  3PY8 A;  4IO8 A;  2CH6 A;  5FLX O;  2P5G A;  4M45 A;  5HP1 A;  3AVA A;  4DG1 A;  3ENB A;  3LP1 A;  2I5J A;  3P4I A;  3HT3 A;  4V19 S;  1BGX T;  2BGG A;  3NGY A;  3O3G A;  4LSL A;  1NJZ A;  3RR7 A;  4ILJ A;  4BR4 A;  3C6T A;  4UQG A;  3TSP A;  1XMQ K;  4CBX A;  1NK4 A;  5D3G A;  4Q0B A;  1NJW A;  1W7A A;  2VQF K;  4C1N K;  2P9I A;  1E4G T;  4JI3 K;  2KTQ A;  2HVH A;  4DKW A;  4ELU A;  4BVP A;  4WQ5 A;  1KLN A;  3D2F A;  2D5R A;  4CGJ A;  1CZB A;  2HHW A;  5CZ2 A;  4CJ5 A;  3AA3 A;  5TKW A;  1JLE A;  4O5B A;  5CR4 A;  5KGW A;  4U67 L;  1GOB A;  4A2A A;  3HBT A;  4CZJ A;  4U7B A;  3EL2 A;  1LWE A;  4JD2 B;  4M3T A;  3ID8 A;  3VEO A;  3QB0 A;  1KQS M;  4FVU A;  1XI1 A;  3L8B A;  1RDW X;  3J7A P;  3CHW A;  4CHO A;  1HYZ A;  3THX B;  3OHR A;  1GLC G;  1Z05 A;  3SBT A;  1VQ6 N;  5J2M A;  4E89 A;  1ILY A;  3KLG A;  1VQL N;  3VEZ A;  2ZM6 K;  3HOS A;  3HSC A;  4A2B A;  1KLM A;  3U3G A;  4CHN A;  5J1E A;  4BRC A;  1HLU A;  3AO4 A;  3HO1 A;  1KRP A;  1M1K O;  3O1W A;  4CEB A;  4QCL A;  3DMJ A;  3ZT0 A;  1VSJ A;  4O0J A;  3VN5 A;  3VGM A;  5AQS A;  3WXM B;  4FZZ A;  4QAG A;  3VQQ A;  3QEV A;  1R0A A;  1QTM A;  1LWC A;  4FJ9 A;  4KTQ A;  4OPJ A;  4E7I A;  4FJM A;  1GOA A;  4YY3 K;  2P9I B;  2GX9 A;  2G8F A;  2CGL A;  3TSU A;  1WSJ A;  3WQT A;  4DU1 A;  3DLB A;  3MED A;  2QWN A;  5CY4 A;  1ZBH A;  4UY8 O;  2P9S A;  1Q9Y A;  4DLG A;  3HJF A;  1FXX A;  2HHT A;  3CJC A;  3KWG A;  4MO5 A;  3MXM A;  3LM9 A;  3WQU A;  5I3U A;  1N33 K;  2D1K A;  2CGK A;  4FJ8 A;  3KK1 A;  3ZCM A;  1X3N A;  1HNV A;  3L0Q A;  4ZTJ A;  1MA9 B;  2EWS A;  3WXK A;  1GLF O;  2E88 A;  4HTU A;  3LWL A;  4J2D A;  5LJV A;  1TL3 A;  4F4K A;  2P9K B;  3C94 A;  4I6M B;  2YI1 A;  1KC8 O;  4CGH A;  2HHQ A;  3HST B;  1KD1 O;  3HTV A;  5E41 A;  2X6S A;  1RTJ A;  2O8C B;  3CJ7 A;  1HRH A;  4JKA A;  5EXW A;  2W6K A;  3AO3 A;  1S5J A;  4YOU A;  4JRP A;  4M3X A;  5GAD P;  2XO7 A;  3VQB A;  1HKC A;  3C6A A;  4IOX A;  3MN9 A;  3ISN C;  5DM7 L;  5FPN A;  2JWK A;  1L3U A;  3ZT2 A;  4CEF A;  3LPU A;  3G71 N;  5BPM A;  3DLL L;  3LWM A;  4DR4 K;  3HI0 A;  2OPS A;  2FSJ A;  3NMU A;  3VA3 A;  3J80 O;  4A61 A;  3MDQ A;  2VGM A;  1HUX A;  1JLC A;  4XIU A;  4AHU A;  3M8R A;  3SPY A;  3J7Z O;  4K25 A;  4E19 A;  3I0R A;  5BN8 A;  3TAE A;  3KTQ A;  1S9E A;  3P83 D;  4FLZ A;  4AIL C;  1NU0 A;  3VET A;  5ELZ A;  1NG9 A;  3JS6 A;  3S3N A;  1KCF A;  2Q0R A;  3CQX A;  3BGR A;  1DGK N;  4QOZ B;  2EHG A;  2CGJ A;  1NBW A;  3THX A;  3SCX A;  3O4Q A;  1T6D A;  1HNZ K;  1Z25 A;  4N56 A;  3F9K A;  1C6V A;  4B9L A;  1VK0 A;  4IEE A;  1RBT A;  4HUF A;  3M5R A;  5KPR A;  2PY5 A;  2YHB A;  4CZF A;  1P90 A;  1TUY A;  3ITH A;  1REV A;  2PAV A;  4DV3 K;  1W97 L;  1Q18 A;  3TR8 A;  4NCA A;  2RHK A;  3M1F A;  3D45 A;  1RBU A;  3RMA A;  3AAQ A;  3G10 A;  1TV6 A;  5M1O A;  4B8C A;  2VWJ A;  4KH4 A;  1SUQ A;  4OX9 K;  5LL6 Z;  4BRQ A;  3SQ2 A;  4FJN A;  4PKG A;  1L3V A;  1VAZ A;  1D8Y A;  1WLJ A;  3IRX A;  3V9X A;  3VQ5 A;  1K73 O;  4HWI A;  3JAM O;  3CCJ N;  1TAU A;  4N5S A;  4DV5 K;  2P9L A;  3JYT A;  2HNZ A;  1QZ6 A;  4JS4 A;  3AVK A;  5BPN A;  2OTJ N;  4NYN A;  2NNW A;  4F8R A;  1BA0 A;  5AQV A;  4CFC A;  3OTO K;  3WXL A;  4RCH A;  2Z1H A;  4B9Q A;  1RT7 A;  4IOA L;  4H5R A;  2I7P A;  3FZM A;  4B9T A;  3DRP A;  1SL2 A;  1XNQ K;  2Q36 A;  4C8L A;  3VQ4 A;  2P9U B;  2PYJ A;  4BE2 A;  1RT3 A;  3I0S A;  4GVM A;  3LAL A;  3VQ8 A;  4F3O A;  3F5T A;  4CF8 A;  3T69 A;  2H3G X;  2P9K A;  1ITG A;  2IGI A;  3H3O B;  5MLC Q;  3HPO A;  4CZL A;  4K41 A;  3OYM A;  4LF9 K;  4CEZ A;  3A5M C;  1KAY A;  2RE2 A;  3FGU A;  3S3O A;  2O4G A;  2YX6 A;  1B9F A;  3IUC A;  1FW6 A;  4KKO A;  3AVF A;  1Q82 O;  1NK5 A;  3PO5 A;  1TUU A;  4LF4 K;  3QES A;  4WF9 L;  4KB1 A;  4FJ5 A;  2HHI A;  1S1W A;  3DXM B;  3IG1 A;  4G1Q A;  1GLE G;  3RVC A;  4JKD A;  3DOL A;  5BRF A;  1IKX A;  5GIP A;  4BR9 A;  2QKB A;  3KK2 A;  3NH2 A;  4F3T A;  4KV8 A;  1VQM N;  4KHQ A;  1VQ9 N;  1YUW A;  3QFP A;  3AAP A;  5DMR A;  3CCM N;  1GLB G;  2FC0 A;  1JLG A;  3TAF A;  5AQH A;  3V9Z A;  1HPM A;  2Z1I A;  1RT5 A;  3ZX2 A;  4MDA A;  2Z1J A;  4OPH A;  2O8F A;  3P39 A;  1OVQ A;  3CIP A;  2ZJR L;  4N41 A;  1U2V A;  2YJE A;  5AQO A;  5K14 A;  4LD0 A;  3J81 O;  1NGC A;  3PX6 A;  1SL1 A;  4XJX A;  2NRZ A;  3S9H A;  3OS2 A;  3AVJ A;  1RDU A;  1C0G A;  4CJW A;  1KAZ A;  1WSE A;  4IDK A;  4JKF A;  1S6P A;  3SQ0 A;  2OZS A;  2UXD K;  2X74 A;  2YHW A;  3C6H A;  1UA1 A;  5T7B A;  1UA0 A;  3KK3 A;  4M42 A;  2UXB K;  2YHX A;  4IFY A;  3OBW A;  5AQT A;  5F2R A;  3MCP A;  4Y1D A;  1RT1 A;  3K2P A;  1K8A O;  4M3R A;  4IO9 L;  4CJL A;  3U9Z A;  3TWH A;  4HVJ A;  1YI2 N;  1F21 A;  4CK3 A;  3EEQ A;  3CCL N;  3NCI A;  2HMI A;  3ASM A;  5AZJ B;  4XH4 A;  3SBG A;  4FLY A;  4E0D A;  3NBP A;  3QBW A;  4KB0 A;  4CZH A;  5JLF A;  1T03 A;  3A5N C;  5KI6 A;  4DMN A;  2ZQB A;  4H8K A;  4L3Q A;  4J2B A;  2IIR A;  3DJC A;  2YV0 X;  3ULE A;  1NK0 A;  1SL0 A;  4KH5 A;  1JJ2 M;  3HL8 A;  4DU4 A;  3UE5 A;  3H1Q A;  5ADX A;  2YKM A;  4O44 A;  4DSK A;  3O3H A;  4DV1 K;  2BH1 A;  4HCC A;  3T1A A;  2QWO A;  1RT4 A;  3J8A A;  3SAF A;  1HNW K;  1IH7 A;  1U49 A;  1SKS A;  3K5N A;  1HKB A;  4YOX A;  2NRV A;  3R8E A;  5CYQ A;  2ASM A;  2OA8 A;  4E7K A;  1U48 A;  3ZT4 A;  4BVO A;  3CCR N;  4M7X A;  4BRK A;  1XNR K;  4CI6 A;  4KBO A;  2ASO A;  1TK0 A;  3CFR A;  4YFU A;  1BUP A;  1VSD A;  1WSF A;  3QIN A;  3RRG A;  4LF8 K;  2O4I A;  3TTF A;  3PUF A;  3TAB A;  4A5B A;  3VMF B;  4BQZ A;  4DTM A;  4FO0 A;  3RWU A;  1RDD A;  1RNH A;  3QET A;  2WTU A;  4O4G A;  2ITM A;  5JIC A;  3VES A;  4DTO A;  4DR6 K;  4DFK A;  3JSM A;  3F2K A;  1Q86 O;  3KHY A;  4KI4 A;  3E1Y A;  3NVM A;  5BPL A;  5BRD A;  4FYD A;  3LZJ A;  2E2O A;  3KK7 A;  4BRL A;  3GL1 A;  1BIS A;  2WC9 A;  3EKS A;  1CLQ A;  4H0P A;  4PKI A;  4BC3 A;  3H6E A;  1T8E A;  4OPA A;  1T3V A;  2VYP A;  3CF5 L;  3VTI A;  3LP0 A;  3UIQ A;  3FZL A;  4BAC A;  2ZF5 O;  3DLG A;  1X1P A;  3UKR B;  1LWF A;  2YJF A;  1LV5 A;  5BR9 A;  1VSF A;  2FSK A;  1NK7 A;  5HRS A;  2NRW A;  1S3X A;  1XMO K;  1FJG K;  1Z6R A;  4AHR A;  2WBN A;  2ZE2 A;  4ELT A;  5M1K A;  3KD5 E;  2E1Y A;  3OYI A;  3TTC A;  1XUP O;  4WCE L;  3LDO A;  1B9D A;  3WNF A;  2JLE A;  3E9O A;  2PYL A;  1DTQ A;  1NGF A;  4Z4I A;  3OYF A;  1LW0 A;  2Y1J A;  3ENO A;  1FK9 A;  4B9V A;  4H0V B;  4GY2 B;  1NGB A;  4Z4F A;  4HCB A;  4KH6 A;  2HVI A;  2D0C A;  1SQK A;  4YOY A;  2DPN A;  1QZ5 A;  5FPM A;  3G25 A;  3OA9 A;  4WQ4 C;  1BCO A;  4X66 K;  1VQ7 N;  4C8O A;  4N47 A;  4FXD A;  4QS8 A;  2BE2 A;  2OYQ A;  3SV3 A;  4DSF A;  4DUZ K;  4IJA A;  1BI4 B;  4PL7 A;  4AQY K;  3MXI A;  4GV3 A;  2YNH A;  3K0S A;  1S22 A;  4CK2 A;  4YDU A;  1QSS A;  3TU5 A;  5I9E B;  3OYL A;  2XY5 A;  5AFU A;  2P9S B;  4XH1 A;  3OYA A;  4FJG A;  5H1S Q;  3VER A;  4A62 A;  4MLE A;  4NO7 A;  1K6Y A;  2HND A;  3U3Y A;  2A1R A;  4H0Y B;  1T6C A;  3A8Y A;  4MQ3 A;  4CJE A;  3ID6 A;  4BRF A;  4DFP A;  3QEW A;  4CW7 B;  4FJJ A;  2LSN A;  3HP6 A;  3WXI A;  1J5E K;  5CE3 A;  5M1P A;  3C65 A;  1EX4 A;  3I33 A;  3D0P A;  4JNE A;  3DM2 A;  4IXC A;  1HJO A;  4EIA A;  4KPY A;  1OKJ A;  3ULD A;  4CFD A;  2PBD A;  3CC7 N;  4BRD A;  1A5W A;  3QLH A;  5C42 A;  4GV6 A;  4FWO A;  3PLA A;  1JLB A;  4O8K A;  4GW6 A;  2Q31 A;  4B3S K;  1UOC A;  5IWA K;  3VQC A;  3O8M A;  3V1Q A;  2KFN A;  2YCH A;  3M8Q A;  5SZT A;  3CCU N;  4DWI A;  4GKK K;  2O8D A;  3SUN A;  3KJV A;  3SV4 A;  1IJJ A;  2BUP A;  2HBK A;  4BQL A;  1QQO A;  3FFI A;  1HNI A;  3IKM A;  4DSI A;  3HYF A;  2UUA K;  4FJH A;  2ZJP L;  3IS9 A;  2NUB A;  2KQ2 A;  4W5R A;  3QNN A;  1ZBU A;  1IKW A;  3IDH A;  3L2V A;  2D0P A;  4C1N I;  4IG3 A;  4OO1 J;  2P51 A;  1BQN A;  3MEC A;  4B1Y B;  4JV5 K;  3WUH A;  1NJY A;  1I3A A;  2X78 A;  3CJ9 A;  3P31 A;  3CCE N;  1WAJ A;  2AJQ A;  1TAQ A;  3HXM A;  1YHQ N;  2WOM A;  1IBM K;  1WBD A;  1TL1 A;  1B92 A;  3O6W A;  1GLA G;  4CIG A;  4BE1 A;  4M3U A;  1YTU A;  4CK1 A;  1QSL A;  3LPT A;  3DRS A;  1S9G A;  4CIE A;  4CEQ A;  2KW4 A;  1NKC A;  3BF1 A;  4CJ4 A;  1WAF A;  3H3N O;  3UKU B;  3M3Z A;  4CJU A;  5AQQ A;  3L3U A;  2NRT A;  4CD1 A;  5EY4 A;  1X9M A;  3ZT3 A;  1A5V A;  1ESV A;  2HB5 A;  1RDC A;  2P9P B;  1IBK K;  4C8N A;  1YAG A;  1TK8 A;  4F2R A;  4KHY A;  1KVA A;  3ZX3 A;  1Q7Y O;  5BN9 A;  1X3M A;  3LDP A;  4Z4G A;  3VTH A;  3OYD A;  1WSG A;  1DT9 A;  4NLC A;  1TYQ A;  5AQF A;  4JKG B;  1M90 O;  5CHI A;  3MX2 A;  1NGA A;  3QBX A;  4RW6 A;  2IVP A;  3DYA A;  2QXL A;  1LAW A;  2X6N A;  3DLR A;  3E01 A;  4E1J A;  4DV6 K;  4DCH A;  1L3S A;  4YOT A;  4KRF A;  4FOE A;  1J54 A;  1C1C A;  3K5O A;  4DQQ A;  3UKR A;  1HJR A;  4CEA A;  1NMD A;  2V7Y A;  5AQX A;  3LDN A;  3B6O A;  4B3R K;  3CET A;  4CBU A;  1NGI A;  4ILG B;  3H08 A;  3PIP L;  3AA4 A;  1S1V A;  1EXQ A;  4CFA A;  1D4X A;  4FJ7 A;  4CVN E;  5AZI A;  3B6P A;  4CIF A;  1ZXO A;  4WFN L;  3PX0 A;  4FJK A;  2YNG A;  3ZLJ A;  4FM2 A;  4CE9 A;  4I2Q A;  4EP5 A;  4DV4 K;  3L2R A;  3IFR A;  1YVN A;  5C2F A;  4BC4 A;  5AQM A;  4BR7 A;  3A5L C;  3FZK A;  4H0T B;  1QQC A;  5KTQ A;  5HRR A;  3SPZ A;  4LF6 K;  3WNH A;  2R7Y A;  3KVG A;  3TAM A;  1HPZ A;  1N8R O;  3AVN A;  3E66 A;  5J2N A;  1K8K B;  1E3M A;  5CYM A;  1EQY A;  4JKG A;  1T44 A;  4W5O A;  2E20 A;  3VA0 A;  2QI2 A;  1JCG A;  1CZ9 A;  2OCE A;  2EX3 A;  4H5W A;  1QVF M;  2YHY A;  3CCQ N;  4I9Q A;  4FWQ A;  4KTW A;  4CCH A;  4LFA K;  1BIU A;  3LAM A;  3NH1 A;  1NK6 A;  5BRE A;  4A59 A;  2F96 A;  4CHP A;  4NXM K;  3M8P A;  4G9Z A;  5AZJ A;  4CF1 A;  2O8E A;  3V9U A;  2HHH K;  2V7Z A;  4DR3 K;  4NCB A;  1TVR A;  1TKD A;  3GE1 A;  1TK5 A;  2NRX A;  2E6M A;  4B1V A;  1SV5 A;  2J4R A;  1KXP A;  4JAX A;  4K42 A;  1HYS A;  1BG3 A;  4FM0 A;  4X65 K;  1J53 A;  2YNF A;  5HLF A;  3NF9 A;  1N5Y A;  1NGJ A;  4AF1 A;  2OTL N;  1VQ8 N;  4CGD A;  3BEX A;  1HQE A;  3AVH A;  3S3M A;  4PQU A;  2WON A;  4J8F A;  4IFV A;  2O8B A;  4CD3 A;  3E9L A;  2XY8 A;  4CJ3 A;  1T7P A;  1G99 A;  4IDH A;  3VF2 A;  2NZT A;  5C2D A;  4OLB A;  4ISG A;  2W41 A;  1Q9X A;  1HQU A;  3A5O C;  1RTD A;  3OW2 M;  4K0K K;  4PKH A;  3CPE A;  3LAK A;  1WB9 A;  3I55 N;  3GBT A;  2E5L K;  1J9A A;  1GOC A;  2VWK A;  5AQG A;  3WNE A;  3AVB A;  3L6Q A;  4HUG A;  1U4B A;  5C10 A;  1EWR A;  1XHZ A;  3P1G A;  1EET A;  3EZ5 A;  3D2E B;  2NRH A;  4OKE A;  5E26 A;  3KLE A;  2B4J A;  5C12 A;  3O1B A;  1J5O A;  4FLU A;  1C0F A;  4H0O A;  2DY4 A;  4DQR A;  4JI4 K;  4DSE A;  1L3T A;  4X62 K;  3FLC O;  5ADX H;  2P9L B;  4WFB L;  4CED A;  3N4Q A;  3SMP A;  5FRM A;  5JS1 A;  3FZF A;  1JKH A;  4CF9 A;  4IEI A;  2JWL A;  1MWM A;  3BZC A;  3CMA N;  4C23 A;  2RKI A;  2BDP A;  4CHY A;  4OJR A;  3TAG A;  5AQR A;  4IOC L;  1VSI A;  3CD6 N;  3L4Q A;  2Y1I A;  2HOE A;  4CHQ A;  4CHZ A;  4WE1 A;  4JKB A;  3CM5 A;  3L2Q A;  4PA1 A;  4FWN A;  1SAZ A;  3OS0 A;  5J2Q A;  2VCP A;  3DLE A;  4DR7 K;  1UWB A;  2Q1N A;  3U9D A;  5BR8 K;  3LP3 A;  4DQI A;  1U6Z A;  3PSF A;  2KHO A;  3QEP A;  4EAH D;  3MWT A;  3AGK A;  4BR0 A;  4M63 C;  4E1M A;  4YOV A;  1O1W A;  3PO4 A;  4N76 A;  1TGO A;  3H46 O;  5C0Y A;  1JLA A;  5JVH L;  2O8C A;  5KRS A;  3AO1 A;  4DR1 K;  1Q81 O;  2E2P A;  3EZW A;  4CEE A;  4B9M A;  3UKU A;  1ATR A;  3ZSZ A;  4DB3 A;  4M3Z A;  1HKG A;  3BZK A;  4LH5 A;  2G8K A;  4H5V A;  5EU7 A;  3OYK A;  3D6R A;  2KZM A;  1U2V B;  4DR2 K;  4FZY A;  3LDL A;  4FPA A;  3EO3 A;  4ICL A;  4JK9 A;  4EZ6 A;  2HBM A;  3QIO A;  1WBB A;  3M8S A;  1ZBS A;  5E84 A;  1DKG D;  1YJN N;  2OPQ A;  2RN2 A;  4X64 K;  4FPB A;  3CXC M;  2VG5 A;  3T1H K;  2GWJ A;  2W42 A;  5I42 A;  4I2P A;  2GUP A;  5LY3 A;  2QKK A;  1W2B M;  1VQN N;  3KIO A;  3B8A X;  5JMV A;  4FWK A;  3KLF A;  1NJX A;  3HOT A;  2ITG A;  2HBL A;  2HHX A;  2P5O A;  3SZ2 A;  5FPD A;  4FWP A;  1QQN A;  2XHB A;  4DV0 K;  5EVZ A;  5GIN A;  3KLH A;  2E8A A;  4BRH A;  3RMD A;  1NKE A;  5A2Q O;  4B1Z A;  3DXK B;  2V51 B;  1EP4 A;  1BOT O;  5KQ8 A;  2VGN A;  5AQP A;  3AV9 A;  4B3O A;  1ZYQ A;  4KHN A;  3LDQ A;  3C7N A;  4DTJ A;  3VEY A;  4EFH A;  1QHA A;  3THY B;  3TAP A;  1IG8 A;  4H4O A;  4OLA A;  3DXM A;  4OKK A;  1C0M A;  3VQA A;  3FFK B;  3LM2 A;  5LMN K;  4BRO A;  4BRE A;  4HTL A;  5M1Q A;  4JK7 A;  1NGD A;  3P5J A;  2QWR A;  4IJN A;  2HHS A;  4MO4 A;  4Z4C A;  4YOW A;  3CFO A;  3NF8 A;  5FPE A;  4WQ5 C;  4BE7 B;  3R6M A;  3I8B A;  4E7L A;  5JS2 A;  2E2Q A;  3CJA A;  1RGI A;  3OYB A;  4BRG A;  2QW9 A;  4IBN A;  3W3D A;  1YIJ N;  2A1S A;  2UU9 K;  4IZ9 A;  3DRR A;  1P8Z A;  1N36 K;  3NE6 A;  4BC5 A;  1D5A A;  4YOR A;  3ZEU A;  1GLJ O;  4KI6 A;  2FBV A;  2W40 A;  4JYA K;  4RG8 A;  4Y1C A;  1ASV A;  4IG0 A;  3KWI A;  1KTQ A;  2ASP A;  1OH6 A;  1BA1 A;  3HVT A;  4NLB A;  5HRN A;  3R1X A;  4I9L A;  1TKX A;  3AVL A;  3NF7 A;  3K5L A;  4KFB A;  5JLH A;  1JXB A;  3QIP A;  3CCV N;  5C24 A;  4QS7 A;  2P9N A;  1RT6 A;  1R59 O;  1VSM A;  4IFE A;  4ZHR A;  2OPR A;  4DTU A;  4FSV A;  1EO1 A;  3OYE A;  2W6L A;  4JI1 K;  2IC3 A;  2QWM A;  3VQ7 A;  4ELV A;  3SUP A;  4DTN A;  3TI0 A;  4BR5 A;  3HVR A;  4FW1 A;  3NVK A;  3NFA A; 
#chains in the Genus database with same CATH homology
 4JHD B;  4OO1 J;  2BTF A;  4RTF D;  3AAR A;  4B1Y B;  3WUH A;  3AAQ A;  3D7E O;  2QWP A;  4CBW A;  2W00 A;  1VQ4 N;  3HM8 A;  4FVU A;  3CJ9 A;  3P31 A;  5M1O A;  5GAE P;  3CCE N;  4KH4 A;  4DQ8 A;  1YJW N;  3CC2 N;  3WT0 A;  4BRQ A;  3GDQ A;  1YHQ N;  3WXJ A;  3QFU A;  4BR2 A;  3IMX A;  3O6W A;  4PKG A;  1GLA G;  1VAZ A;  4PL8 A;  3D2F B;  3G6E N;  5AQW A;  3D2E A;  1XQS C;  5AQJ A;  1K73 O;  1ZC6 A;  4HWI A;  3VEW A;  1BU6 O;  3CCJ N;  3ULE B;  3PIO L;  3BF1 A;  3N4P A;  3CC4 N;  3H3N O;  3UKU B;  4EHU A;  1VQP N;  3M3Z A;  5AQQ A;  2NRT A;  2P9L A;  3MX5 A;  4CD1 A;  5EY4 A;  2FSN A;  3BP8 A;  1NGG A;  4WYB A;  1QZ6 A;  4QS9 A;  1ESV A;  3O9R A;  5BPN A;  4YDU C;  2OTJ N;  2NNW A;  1RFQ A;  1QQM A;  3ZYY X;  2P9P B;  4BRN A;  4CZG A;  1BDG A;  1BA0 A;  1X9J A;  2FF6 A;  4JN4 A;  1YAG A;  5AQV A;  4MLH A;  1YXQ A;  3WXL A;  4RCH A;  4B9Q A;  3R9P A;  4K43 A;  2QA4 N;  1O13 A;  4AM7 A;  3MN7 A;  4WFA L;  4BRA A;  3ZX3 A;  2IVN A;  4IOA L;  4H5R A;  2I7P A;  1Q7Y O;  3FZM A;  4WQ4 A;  5BN9 A;  1X3M A;  3VF6 A;  3LDP A;  2HMP A;  2Q36 A;  3VTH A;  1DT9 A;  3HZ6 A;  4NLC A;  1S72 N;  1TYQ A;  5AQF A;  1Y64 A;  4Z94 A;  2P9U B;  3A0I X;  4JKG B;  1M90 O;  2D4W A;  4JKC A;  3MX2 A;  5CHI A;  4O8U A;  1NGA A;  2V52 B;  5EOY A;  3QBX A;  4LC9 B;  1NGH A;  5EX5 A;  2IVP A;  4BEC A;  3F5T A;  2QXL A;  3JXU A;  3T69 A;  2HBJ A;  2KKZ A;  4E1J A;  4DCH A;  2OAN A;  2H3G X;  4YOT A;  2P9K A;  1VQK N;  4FOE A;  2E1Z A;  3H3O B;  4CZM A;  5MLC Q;  3MN5 A;  3O9S A;  5AQK A;  3UKR A;  3Q7C A;  5AQZ A;  4CZL A;  4K41 A;  2GWK A;  3RSE B;  3QDK A;  5AFU H;  1BWF O;  1NMD A;  3A5M C;  2V7Y A;  5AQX A;  1KAY A;  2RE2 A;  3EKU A;  3CQY A;  3FGU A;  3LDN A;  4R79 A;  2YX6 A;  3CET A;  3IUC A;  4CBU A;  1TYQ B;  1NGI A;  1K8K A;  4ILG B;  4BG9 A;  4GVE A;  1H1V A;  3PIP L;  1Q82 O;  1TUU A;  1D4X A;  4MDB A;  4WF9 L;  3DXM B;  1GLE G;  3RVC A;  1QVG M;  4JKD A;  5BRF A;  3ENH A;  5AZI A;  3I56 N;  4JK8 A;  1JCE A;  4BR9 A;  5GIP A;  3AGR A;  1ZXO A;  4WFN L;  3O08 A;  2F9T A;  3GG4 A;  1MWK A;  2HF3 A;  1E4F T;  1OVY A;  1VQM N;  1VQ9 N;  1YUW A;  3QFP A;  3AAP A;  4XH5 A;  3CCM N;  1GLB G;  2A40 A;  3IFR A;  1YVN A;  4ISF A;  1XC3 A;  3BUZ B;  3WEE B;  5C2F A;  4BC4 A;  3FE1 A;  5AQH A;  5AQM A;  4B1W B;  4JKH A;  3A5L C;  3FZK A;  4H0T B;  4BR7 A;  1HPM A;  5BRH A;  3ZX2 A;  4BG8 A;  4MDA A;  3KVG A;  1N8R O;  4OPH A;  3E66 A;  4BRL A;  1NWK A;  3P39 A;  4BRM A;  4M7Y A;  1K8K B;  3CIP A;  4H0X B;  1EQY A;  2ZJR L;  4JKG A;  1YIT N;  1T44 A;  1U2V A;  2E20 A;  5AQU A;  5F1X A;  3K9J A;  2QI2 A;  2YJE A;  5AQO A;  1JCG A;  3VF4 A;  5KQD A;  3O4W A;  2CH5 A;  5KPT A;  2A6A A;  2QWQ A;  1NGC A;  2UYT A;  4H5W A;  4BC2 A;  1QVF M;  2YHY A;  4FL9 A;  3CCQ N;  4XJX A;  4FWQ A;  2NRZ A;  2FXU A;  3SLC A;  4DHY A;  1DEJ A;  4BY9 C;  3K9K A;  1RDU A;  3U8X A;  1C0G A;  5C15 A;  1KAZ A;  5BRE A;  4H03 B;  4A59 A;  1WUA A;  3GOI A;  4JKF A;  4CZI A;  4G9Z A;  5AZJ A;  2YHW A;  1YF5 L;  2QM1 A;  3C6H A;  2WUS A;  4XEI A;  3O80 A;  2F7T A;  5AQY A;  2V7Z A;  2A41 A;  2GEL A;  3GE1 A;  2NRX A;  1BO5 O;  3HRG A;  2FF3 B;  2YHX A;  4BRP A;  5LJW A;  1NLV A;  4B1V A;  4RWT A;  3OBW A;  4Y0W A;  5AQT A;  2J4R A;  5F2R A;  1KXP A;  4F9O A;  4JAX A;  3MCP A;  4K42 A;  1K8A O;  4FWL A;  4IO9 L;  3U9Z A;  1BG3 A;  1YI2 N;  2Q2R A;  4CJ7 A;  3VGK A;  2P9P A;  3DWL A;  3CCL N;  1NGJ A;  2NLX A;  4AF1 A;  2OTL N;  3EN9 A;  3O5B A;  1VQ8 N;  3MK6 A;  3MN6 A;  3BEX A;  4NB4 A;  3MWP A;  3EE9 A;  5AZJ B;  4XH4 A;  3SBG A;  1K9M O;  3ATU A;  2QTD A;  3QBW A;  4FWM A;  4CZH A;  5HL7 L;  5JLF A;  3A5N C;  4J8F A;  4B1X B;  4CD3 A;  3E9L A;  3VEV A;  3DAW A;  4EHT A;  5F0X A;  2NRR A;  4L3Q A;  2IIR A;  4PHT X;  3DJC A;  4FWS A;  3ULE A;  1CZA N;  1G99 A;  3CJB A;  1GLL O;  2A42 A;  2NZT A;  4IDH A;  3VF2 A;  5C2D A;  2WFB A;  4KH5 A;  4ISG A;  2W41 A;  1JJ2 M;  5AR0 A;  2FLO A;  3QIC A;  5M1N A;  3UE5 A;  3H1Q A;  1ATS A;  3A5O C;  4GNI A;  5ADX A;  3OW2 M;  5AQI A;  4PKH A;  3CPE A;  2F9W A;  1WOQ A;  5AZI B;  5TKY A;  3VEX A;  3GBT A;  3I55 N;  2BH1 A;  2E2N A;  4IO8 A;  2I7N A;  2CH6 A;  2QWO A;  3VOV A;  2GEM A;  5AQG A;  4FWR A;  1V4T A;  4A5A A;  3FR0 A;  3J8A A;  3U4L A;  3SAF A;  3H1V X;  3NVK A;  3L6Q A;  4CZK A;  3ENB A;  2IVO A;  5DM6 L;  5C10 A;  2P9N B;  4A57 A;  3D2E B;  3P4I A;  1HKB A;  2NRH A;  4YOX A;  5E26 A;  2NRV A;  2AP1 A;  5C12 A;  1SS6 A;  3R8E A;  3O1B A;  4H5T A;  4ILJ A;  3H45 C;  4BR4 A;  1SZ2 A;  1C0F A;  4H0O A;  3TSP A;  1GLD G;  2ASM A;  2ZGY A;  4ILH A;  4CBX A;  1J6Z A;  3FLC O;  3UB5 A;  1YJ9 N;  3MMV A;  4H5N A;  4BVO A;  5ADX H;  3CCR N;  2P9L B;  4M7X A;  4BRK A;  2Q0U A;  1VQO N;  4WFB L;  3N4Q A;  3SMP A;  4CI6 A;  4KBO A;  2ASO A;  3FZF A;  1BUP A;  4C1N K;  2P9I A;  3TTF A;  1E4G T;  4JKE A;  4IEI A;  2JWL A;  4DKW A;  1MWM A;  3FZH A;  3CMA N;  4C23 A;  4A5B A;  3VMF B;  4BQZ A;  4BVP A;  4WQ5 A;  5AQR A;  4FO0 A;  4IOC L;  3D2F A;  4CZE A;  3CD6 N;  3RSE A;  3L4Q A;  2ITM A;  2HOE A;  5JIC A;  3VES A;  3TTD A;  5TKW A;  5CR4 A;  3F2K A;  2KLA A;  4U67 L;  1Q86 O;  3KHY A;  1NM1 A;  4A2A A;  3HBT A;  4JKB A;  3VEN A;  4CZJ A;  4U7B A;  3E1Y A;  3NVM A;  4FWN A;  3EL2 A;  1SAZ A;  5BPL A;  5BRD A;  5GAH P;  4JD2 B;  1JCF A;  2VCP A;  2E2O A;  3ID8 A;  3VEO A;  2Q1N A;  4IWV A;  3KK7 A;  2AA4 A;  3GL1 A;  3QB0 A;  2WC9 A;  3EKS A;  3R3L A;  1RDW X;  3AY9 A;  3U9D A;  4H0P A;  4PKI A;  4BC3 A;  3H6E A;  3KZB A;  4OPA A;  3CHW A;  1U6Z A;  2KHO A;  3OHR A;  3ATV A;  4EAH D;  1T3V A;  2VYP A;  1GLC G;  1V4S A;  3MWT A;  3CF5 L;  3AGK A;  1Z05 A;  4M63 C;  3SBT A;  3VTI A;  4BR0 A;  4YOV A;  1VQ6 N;  3FZL A;  1ILY A;  3H46 O;  1VQL N;  2ZF5 O;  3VEZ A;  3HOS A;  5C0Y A;  3UKR B;  5JVH L;  3HSC A;  3TSQ A;  4A2B A;  2YJF A;  3C7N B;  4BRC A;  1HLU A;  2ZWH A;  5BR9 A;  2FSK A;  1Q81 O;  2NRW A;  1S3X A;  1LOT B;  1M1K O;  3O1W A;  3S41 A;  3SJH A;  1Z6R A;  2E2P A;  3EZW A;  2WBN A;  4FOI A;  3UKU A;  5M1K A;  1NJI O;  2E1Y A;  1VQ5 N;  1ATR A;  3TTC A;  3VGM A;  5AQS A;  1XUP O;  4DB3 A;  4WCE L;  3WXM B;  1HKG A;  4H5V A;  3LDO A;  3D6R A;  4JHD A;  1U2V B;  1KAX A;  3LDL A;  4FPA A;  3EO3 A;  4JK9 A;  3Q7B A;  2HBM A;  2HST A;  3E9O A;  3CCS N;  1ZBS A;  2QEX N;  1NGF A;  3DXK A;  3SAH A;  5E84 A;  1DKG D;  2A3Z A;  1YJN N;  2P9I B;  4FPB A;  2GX9 A;  3CXC M;  3ENO A;  2CGL A;  3TSU A;  3WQT A;  4H0V B;  4I6M A;  4GY2 B;  4BR5 A;  1NGB A;  2GWJ A;  2QWN A;  4KH6 A;  4UY8 O;  1MDU B;  2GUP A;  2P9S A;  5LY3 A;  1SQK A;  4O5F A;  4BRI A;  3CER A;  1W2B M;  4YOY A;  4GV9 A;  2DPN A;  3P38 A;  3CJC A;  3LL3 A;  3B8A X;  3BF3 A;  3KWG A;  5JMV A;  4FWK A;  4MO5 A;  1KQS M;  1QZ5 A;  3LM9 A;  3WQU A;  3HOT A;  5FPM A;  3G25 A;  2HBL A;  3OA9 A;  5AQL A;  1ATN A;  4WQ4 C;  2D1K A;  2CGK A;  5FPD A;  4FWP A;  1VQ7 N;  1QQN A;  2A5X A;  3SMS A;  3O9U A;  2C1G A;  5EVZ A;  4QS8 A;  5GIN A;  3CPW M;  2E8A A;  1X3N A;  3L0Q A;  3ZEU B;  4BRH A;  1MA9 B;  2EWS A;  3MCA B;  1GLF O;  2E88 A;  4JEP A;  3WXK A;  4IJA A;  4B1Z A;  4PL7 A;  5LJV A;  4GV3 A;  3DXK B;  2V51 B;  2P9K B;  3CJ1 A;  1BOT O;  1S22 A;  2VGN A;  2YI1 A;  3C0B A;  4I6M B;  5KQ8 A;  5AQP A;  1KC8 O;  4YDU A;  1KD1 O;  2VWB A;  3HTV A;  3TU5 A;  3E9P A;  3W0L A;  5I9E B;  2D0O A;  5AFU A;  2P9S B;  3CJ7 A;  3LDQ A;  4XH1 A;  3C7N A;  4JKA A;  5EXW A;  3T7Z A;  3G4S N;  4YOU A;  3VEY A;  2ZGZ A;  4EFH A;  4BGA A;  1QHA A;  5GAD P;  5H1S Q;  2HF4 A;  3VER A;  4A62 A;  4MLE A;  1HKC A;  4NO7 A;  1NGE A;  3C6A A;  4IOX A;  4BEB A;  3MN9 A;  2P9U A;  1IG8 A;  3VGL A;  5DM7 L;  3O9Q A;  4H0Y B;  1T6C A;  3A8Y A;  3DXM A;  3ID6 A;  5FPN A;  3ZX0 A;  5B8H A;  3VPZ A;  2JWK A;  3FFK B;  3LM2 A;  4AM6 A;  4BRF A;  2Q97 A;  4BRO A;  4HTL A;  5M1Q A;  4JK7 A;  4BRE A;  3ZET B;  5BPM A;  1NGD A;  5HOO A;  3G71 N;  3HI0 A;  3DLL L;  3WXI A;  2FSJ A;  2QWR A;  4IJN A;  3NMU A;  2C1I A;  5CE3 A;  5M1P A;  4MO4 A;  3F9M A;  1LCU A;  4A61 A;  3MDQ A;  2VGM A;  4YOW A;  2PFU A;  1HUX A;  3C65 A;  3I33 A;  5GAG P;  5FPE A;  4WQ5 C;  4BE7 B;  4JNE A;  3R6M A;  2ZJQ L;  3J7Z O;  3I8B A;  4K25 A;  5KPZ A;  4IXC A;  5BN8 A;  3WEE A;  1HJO A;  3CI5 A;  2E2Q A;  3CJA A;  5GIO A;  1RGI A;  4EIA A;  1OKJ A;  3L4I A;  3SK3 A;  1HX1 A;  4BRG A;  2PBD A;  3VET A;  2QW9 A;  3M6G A;  3W3D A;  3CC7 N;  5ELZ A;  1YIJ N;  4BRD A;  3JS6 A;  3SAG A;  5AQN A;  5JVG L;  4GV6 A;  4FWO A;  3CME N;  2Q0R A;  3CQX A;  4IZ9 A;  1DGK N;  3PLA A;  1P8Z A;  4O8K A;  3ZET A;  4BC5 A;  2Q31 A;  3EE8 A;  3O8M A;  4YOR A;  2CGJ A;  1GLJ O;  3ZEU A;  1NBW A;  2W40 A;  2YCH A;  3KWI A;  3CCU N;  2ASP A;  1T6D A;  4ISE A;  1BA1 A;  4NLB A;  2GTD A;  3QML A;  3R1X A;  1IJJ A;  2BUP A;  2HBK A;  3TPQ A;  5JLH A;  3O9T A;  5M1F A;  3CCV N;  4IEE A;  4BQL A;  1QQO A;  4QS7 A;  2P9N A;  1R59 O;  3IKM A;  3M5R A;  4IFE A;  5KPR A;  2ZJP L;  4CZF A;  1P90 A;  4FSV A;  1TUY A;  4BGB A;  1VQN N;  1EO1 A;  2PAV A;  2QWL A;  2QWM A;  1W97 L;  4JD2 A;  1Q18 A;  3OBY A;  2RHK A;  3IDH A;  4B1U B;  2D0P A;  4C1N I;  3M1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...