1XQSC

Crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
b'ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HSPBP1 protein
publication title Regulation of Hsp70 Function by HspBP1; Structural Analysis Reveals an Alternate Mechanism for Hsp70 Nucleotide Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 52
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1xqsC01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1xqsC02
3FR0A 3J8AA 3R8EA 3VEWA 3O5BA 1SQKA 1JCGA 2ASOA 4O5FA 3FZLA 4Z94A 3M1FA 4BRCA 2ITMA 3SMSA 3UKRB 3CHWA 1MDUB 3P4IA 5EX5A 2GWJA 5BRFA 5AQPA 2V7YA 4PKHA 2P9SA 3CIPA 5AZJA 1YAGA 2P9UA 4A2BA 4MO5A 2P9IB 5F0XA 3EKSA 2NZTA 1BDGA 5LJVA 1V4TA 1U6ZA 5CE3A 2P9SB 5AZJB 2P9UB 2VYPA 4WQ5C 3GOIA 2A6AA 3D7EO 4M63C 3C7NA 4BR0A 5BPNA 4PL8A 5EOYA 3CQXA 1GLEG 1X3NA 4FWOA 4M7YA 5BN9A 3BF3A 4BRNA 1TYQA 2P9NA 4FOIA 3O6WA 1D4XA 4JAXA 2HMPA 3C7NB 4YDUC 4CZFA 1WOQA 3O8MA 1TUYA 1BU6O 4H0XB 2AP1A 1QQNA 2Q0RA 3A5NC 2ASPA 1TYQB 2P9NB 4H0OA 4B1ZA 4B1UB 4EAHD 1Q18A 4WQ4A 1KXPA 4L3QA 4RTFD 2PAVA 2EWSA 3VENA 3EZWA 4IXCA 5AQIA 3EN9A 4YDUA 2QWMA 3LDNA 5TKYA 4BR4A 3ENHA 3H46O 2D0OA 4NB4A 1NLVA 4BC3A 3SLCA 4CI6A 2P9PA 3QICA 1EQYA 4BR9A 5I9EB 5FPNA 1NGHA 1ATNA 2FF3B 1BA1A 3LDLA 1MA9B 3TU5A 3WUHA 4CBUA 1C0FA 4CZJA 4CBWA 3DAWA 2IIRA 3VEZA 3HZ6A 3FLCO 4CD3A 1BWFO 2F9WA 2Q97A 5AQMA 3HM8A 3GL1A 4FSVA 3H3NO 2VWBA 3WQUA 3HI0A 1NMDA 4BC4A 5B8HA 4PKGA 3U4LA 4MLHA 3S41A 1P8ZA 3TPQA 2E88A 3VGLA 2A3ZA 1SZ2A 2CH5A 2FSKA 4BRPA 3WEEA 4CD1A 1ATSA 1E4FT 2HF4A 5AQVA 4J8FA 2E1ZA 4B1WB 2FXUA 3H6EA 3W0LA 1NM1A 3AAQA 1NGIA 4FWNA 3ZX3A 4LC9B 3DWLA 4CZMA 3L6QA 3LL3A 4K42A 4FOEA 4FWQA 4FWLA 1NWKA 4FL9A 2I7PA 5E84A 4H0VB 4CZIA 3SMPA 1NGJA 3CETA 3GDQA 3GBTA 1C0GA 3FZKA 2E2NA 3F9MA 3MMVA 1BG3A 4H5WA 2BUPA 5AQFA 5AQOA 4NO7A 2GELA 3FZMA 2E2OA 3FZHA 1RFQA 3L0QA 3VOVA 2QM1A 2D0PA 2E20A 5BRDA 1QQOA 5FPEA 2J4RA 3MN7A 3A5LC 3FZFA 4FWMA 3C0BA 3CJ9A 3JS6A 2I7NA 3EL2A 4H03B 3LDOA 5AQQA 5AZIA 1DGKN 3H45C 5AQWA 4A2AA 3AAPA 4JNEA 4BGAA 3QDKA 5AQNA 1T44A 1MWMA 4BG8A 4IJAA 3IDHA 5E26A 4XEIA 3AARA 4B1YB 4BVPA 4EIAA 1GLLO 4K25A 5AZIB 2F9TA 1T6DA 5AR0A 1KAZA 2P9LA 1S3XA 4CJ7A 5BREA 5BN8A 2Q36A 5AQUA 5FPMA 3W3DA 4WQ4C 3VETA 2CGKA 2E1YA 3R6MA 2E2QA 2GEMA 3D2FA 2P9LB 3MN6A 3LM9A 3R9PA 4B1VA 1BOTO 2YHYA 1HUXA 3WQTA 4IZ9A 1G99A 4CZLA 4IJNA 3H1VX 3VF4A 1QQMA 3WXKA 4BRLA 3D2FB 5F1XA 1CZAN 5JMVA 1XQSC 4Y0WA 2QWNA 1ZXOA 2FLOA 3U9ZA 3DXMA 5AQSA 4H0YB 4H5TA 2HOEA 3O08A 1BUPA 2ASMA 3VF6A 1HX1A 2Q1NA 4XH4A 3I8BA 3BUZB 4IO8A 5KPRA 1U2VA 3FFKB 1BA0A 3DXMB 2NLXA 1HKBA 4BG9A 3LDPA 3L4IA 1TUUA 4CBXA 2P9PB 4MLEA 4A62A 4DHYA 3CJ1A 4QS7A 1HKCA 3GE1A 4BC5A 2GTDA 4PL7A 2A42A 4MO4A 1U2VB 1LOTB 3D2EA 3DXKA 4BQZA 2Q31A 2QW9A 3HTVA 4EHUA 3GG4A 3MCPA 1T6CA 3QMLA 4EHTA 2OANA 3OHRA 3QBWA 1YUWA 2KHOA 3B8AX 2IVPA 5EXWA 3D2EB 3IUCA 5KQDA 3A8YA 3DXKB 3BEXA 2P9KA 4DB3A 4BRHA 2IVNA 2CH6A 3CJAA 3EO3A 3I33A 4RCHA 4EFHA 3VESA 5JLFA 5ADXH 3U9DA 1DKGD 5AQTA 2V51B 3WEEB 1HPMA 4BC2A 5AQLA 5ADXA 2P9KB 5AQXA 2QWLA 3A5OC 4O8KA 3AY9A 3BF1A 2PBDA 3MDQA 2A5XA 3WXIA 1GLBG 2GUPA 3QBXA 5EVZA 4GNIA 2IVOA 1QZ6A 2V52B 5AFUH 1H1VA 4JHDA 3SK3A 1KAYA 1GLCG 4QS8A 4M7XA 1HJOA 1ESVA 1LCUA 3ID8A 4KBOA 4BQLA 3ZX2A 4FPBA 1Z6RA 4FWSA 5JLHA 4ISEA 1NGEA 4WYBA 2ZGYA 5EY4A 3ZX0A 5BPMA 3CJCA 4B1XB 4C23A 4H5RA 4FPAA 4BRAA 3VEVA 4BR5A 5LY3A 3A5MC 5F2RA 4BRQA 2FF6A 4DCHA 3VEXA 4BRIA 3ENOA 4BRMA 3O80A 3QB0A 5AQKA 4BREA 5BPLA 2P9IA 2QWOA 1WUAA 4CZKA 3VEYA 1S22A 4BGBA 4I6MA 3BP8A 3A0IX 3HSCA 4BR2A 1Z05A 4QS9A 1YVNA 1SAZA 5KPTA 1MWKA 3H1QA 1JCEA 4H0TB 2QWQA 5AQYA 4ISFA 1HLUA 3SJHA 2YI1A 4I6MB 1ZBSA 3IFRA 1NGGA 4HWIA 3LM2A 3U8XA 1BO5O 3CQYA 1ATRA 4BR7A 3M6GA 5AQZA 5JICA 3MK6A 1V4SA 2Q0UA 3UKUA 3H3OB 3ZETA 4BRGA 3G25A 1NBWA 1NGDA 2E8AA 5BR9A 2W40A 3WXJA 1OKJA 2BTFA 2Q2RA 4HTLA 4WQ5A 2D4WA 1HKGA 5AQHA 3VGMA 4FWPA 4CZEA 2YJEA 4XH5A 3UE5A 1QHAA 1XUPO 2QWRA 1RDWX 1GLAG 1X9JA 3QFUA 4H5VA 4AM7A 1RGIA 3HBTA 4DQ8A 4IWVA 4RWTA 3UKUB 3ZETB 3O4WA 1KAXA 3WT0A 3JXUA 5AQRA 4E1JA 1X3MA 4ISGA 2A40A 3ZEUA 1DEJA 3KVGA 4BROA 2YHXA 5AQGA 3M3ZA 3ULEA 2FSNA 1R59O 2GWKA 1IG8A 3IMXA 4PKIA 3KHYA 1YXQA 2CGLA 2H3GX 2UYTA 4JN4A 4BRDA 3VPZA 3CJ7A 3CJBA 4FO0A 3WXLA 3ZEUB 4H0PA 3EKUA 3UB5A 1QZ5A 1GLJO 1NGCA 3ULEB 1ZC6A 1NGAA 5BRHA 5KQ8A 3O1WA 1XC3A 4K43A 2A41A 4GY2B 1E4GT 5LJWA 3RSEA 1NGBA 4AM6A 2V7ZA 2E2PA 5KPZA 4FWKA 1GLDG 1JCFA 2WUSA 3VEOA 4H5NA 4CZGA 3O1BA 3FE1A 2QWPA 3VGKA 1K8KA 2ZWHA 5ELZA 2CGJA 3VERA 2AA4A 2FSJA 1NGFA 3RSEB 3DJCA 3ATVA 3QFPA 4JD2A 3LDQA 2W41A 3CI5A 4XH1A 3FGUA 2DPNA 4BRKA 1K8KB 1IJJA 5AQJA 2ZGZA 1Y64A 3KZBA 3VF2A 4K41A 2VCPA 4JD2B 3MN5A 2YHWA 2QXLA 5AFUA 2NRHA 2YJFA 4BRFA 4BVOA 4F9OA 1GLFO 2YCHA 4A61A 2ZF5O 2HF3A 1J6ZA 5FPDA 4JHDB 3CERA 4CZHA 4B9QA 3UKRA 3MN9A 2D1KA 3ATUA 4FWRA
chains in the Genus database with same CATH superfamily
3AO1A 3J8AA 3AA3A 3VEWA 3O5BA 1SQKA 1JCGA 3ZSRA 3ZLJA 3T1AA 4DV5K 1HYSA 2WTUA 4M45A 4B3RK 4CHQA 1KVAA 1MDUB 3P4IA 3CF5L 2X78A 3CPEA 3LPUA 1XI1A 3BZCA 4EZ9A 5FRNA 2P9SA 5AZJA 1YAGA 2BGGA 5SZTA 1QVFM 3M8QA 3R3LA 4MO5A 4C8KA 3EKSA 1ASVA 2R7YA 4E7KA 3SAHA 1JXBA 5KTQA 1YF5L 5HRSA 4NCGA 1NK8A 3L2WA 3KWGA 5CR4A 4YNQA 3V9UA 3C7NA 4K8ZA 5HROA 1NU0A 1TL1A 4M7YA 3AA4A 3BF3A 3TSPA 4FVMA 2O4GA 1D4XA 4JAXA 3EY1A 2IS3A 4DV2K 2D0BA 4YDUC 4EP4A 5J2QA 2RPIA 3THVA 4CHYA 2PFUA 1QE1A 1BU6O 4B1ZA 4IOXA 1TYQB 2P9NB 3MX2A 5C2FA 3KLHA 1XMQK 1I3AA 3EZWA 4DKWA 4BR4A 4AH9A 3MECA 2VQFK 4NB4A 2Z1JA 2P1JA 3SLCA 4CI6A 4J2EA 3QICA 1RBUA 1WSGA 3K57A 5I9EB 5FPNA 5HBMA 3IS9A 4A5AA 1BA1A 3ITHA 3Q7BA 5T7BA 3LDLA 3TU5A 3WUHA 4CESA 4FK2A 2IIRA 3HZ6A 2G8IA 1BWFO 3VQPA 3HM8A 4FSVA 3TTDA 3WQUA 3QEPA 4B8AB 1U47A 1YTAA 3IAYA 2HW3A 4BC4A 5GADP 3U4LA 1BI4A 1P8ZA 4JV5K 2WONA 1BHLA 1C1CA 3V1RA 3HM9A 4CE9A 1SZ2A 2FSKA 4BE7B 4DFJA 4OKEA 5GINA 1E4FT 2HF4A 4QCLA 2ZJRL 4K0KK 3HRGA 3V6DA 1NGIA 3ZX3A 1U45A 3VTIA 3LL3A 3SBGA 4FWLA 4QOZB 1OVQA 1ITGA 2X6SA 3TABA 3SMPA 3T1HK 3GDQA 5C0YA 2XO7A 1J5EK 4DUZK 3I0SA 1BGXT 3MMVA 4H5WA 2BUPA 4LF6K 4CJ5A 5CYQA 2GELA 1RFQA 3VOVA 3MWTA 4LD0A 3NGIA 4CJ3A 2E20A 1RDBA 2VGMA 3C6UA 3FZFA 4FWMA 3C0BA 3EL2A 3HT3A 1RTJA 3LDOA 5AQQA 4LF4K 4KREA 5AQWA 4JNEA 1M1KO 1S1UA 1SV5A 2FBYA 2W6LA 5GAEP 3NCIA 3CCLN 2Y1JA 5JVHL 5AZIB 1CXUA 2F9TA 1T6DA 1KVBA 1ZBFA 4CJKA 4DFKA 3KJVA 2ATQA 2GV9A 2Y1IA 3NH2A 2Q36A 2O8BA 1YI2N 3H08A 4ELTA 3VETA 2CGKA 1CXQA 3R6MA 3D2FA 1N36K 1OH7A 4KHNA 1U49A 1BOTO 4IZ9A 1G99A 3AVKA 3DRRA 4IJNA 3H1VX 4RW7A 1QQMA 3VF4A 3WXKA 4AILC 1LAVA 3AO5A 4B9NA 1IKXA 1CZAN 1C1BA 1RBTA 1B92A 4Y0WA 2LSNA 3VQ6A 4C8MA 1NJWA 5A2QO 2KFZA 4OGCA 3OYFA 4LFBK 3S3OA 3D6RA 1NOYA 4M3YA 5KPRA 3OYLA 1HKBA 4BG9A 1ZBHA 3LDPA 1TUUA 4CIGA 2HBMA 3L4QA 4BACA 4MLEA 4A62A 1NK4A 4BC5A 4ELUA 4MO4A 1LOTB 1VSMA 4J2AA 4JKDA 1KVCA 2QW9A 1RT4A 1T6CA 3QMLA 4EHTA 2OANA 2O8CB 3B8AX 3L8BA 3D2EB 3TARA 3A8YA 3O3FA 3ISNC 4N5SA 1EWQA 2P9KA 1N32K 4BRHA 4I9QA 4KI6A 4DSFA 3TAEA 3CC4N 3CFOA 1DKGD 3WEEB 1SL2A 2RE2A 1J9AA 4O8KA 5E41A 2NUBA 3BF1A 2HBLA 4CF9A 1KLMA 3K58A 4KH5A 5KRSA 1B9DA 2VWKA 3SAFA 3SK3A 4HUFA 1GLCG 3THXB 4DSJA 2F7TA 4M7XA 1ESVA 4BQLA 4FWSA 4EZ6A 1NGEA 4WYBA 2ZGYA 5EY4A 5BPMA 3CJCA 5FDLA 3ZT0A 2A1RA 1W2BM 4BR5A 4CEAA 1LW2A 3A5MC 2NNWA 5JVGL 4GKJK 5F2RA 1VQMN 1BCOA 5CY4A 4YOYA 3VEXA 5HL7L 5C25A 3QB0A 1RT1A 1FW6A 2BDPA 3RVCA 1NK5A 1EKEA 2QWOA 4B8CA 3QIPA 3TAPA 1TKTA 3L3UA 1RDDA 3NVKA 1YVUA 3VQCA 1WSIA 3VQ4A 3SUOA 1VQNN 5KPTA 3ASMA 4YOUA 1MWKA 3H1QA 3G71N 2FC0A 3DLLL 2QWQA 1WB9A 1Y97A 1CLQA 1HLUA 3SJHA 5SWMA 3TAGA 2XRIA 1RDAA 4LH5A 4HWIA 3QNNA 4FK4A 1WAJA 5HOOA 4DQSA 3K2PA 4J2BA 1BO5O 1ATRA 4CEOA 4FJGA 3M6GA 3CFPA 1TKZA 3ZETA 3CCVN 3WXJA 2Q2RA 4HTLA 3J7AP 1RT3A 2D4WA 4CZEA 3OVNA 2YJEA 1HPZA 3O9RA 4F4KA 3HBTA 5CYMA 4DQ8A 4RWTA 4CF1A 2DFFA 3DLBA 1JL2A 3L2RA 3O4WA 1KAXA 3JXUA 2KW4A 3ZSZA 4ISGA 3QINA 2A40A 4IEIA 4ID5A 3KVGA 3CMEN 3RMBA 4JLHA 3M3ZA 3T19A 3SPYA 3U3YA 3IMXA 4G9ZA 4PKIA 3EE9A 3I8DA 4KTZA 1YXQA 1EX4A 2UYTA 4E7IA 3RR7A 3ZEUB 4N76A 4CJ4A 1RT5A 1NGCA 5BRHA 1JXEA 4GV9A 2OCEA 1XWLA 3DLKA 4GY2B 2E5LK 3RRGA 3QERA 1D5AA 2E2PA 3AVIA 1GLDG 5KPZA 1JCFA 2ETJA 1C0MA 3O1BA 3DI6A 1L3UA 4IFYA 2KTQA 3VERA 1WBDA 1O1WA 2FSJA 4X64K 4WF9L 3LZIA 3CYMA 2O8EB 2RHKA 5I3UA 2W41A 2VG5A 4DF8A 5J2PA 4BRKA 4CEZA 3KZBA 3K5OA 3KLFA 4JD2B 2YHWA 4LSLA 1VSIA 1J5OA 4BECA 2JWKA 1GLFO 4F9OA 2YCHA 1UOCA 4FJKA 4Z4GA 4CZHA 4GV6A 1GOAA 3UKRA 3I55N 3LM2A 3ATUA 3CCRN 4FWRA 5J2MA 3PLAA 3EYZA 4O4GA 1LW0A 2ASOA 3QETA 4DUYK 3FZLA 3RMAA 1VRTA 2ITMA 4HVJA 2UXDK 1JJ2M 1T7PA 1ILYA 3V4IA 3CIPA 1A5VA 2P9UA 3JSMA 1I94K 5F0XA 3OTOK 4CGGA 2Z1GA 4U67L 3OYKA 3V1OA 2VYPA 1HMVA 4YHHK 2A6AA 1S9EA 1KQSM 1NKEA 3TSUA 2XHBA 4M3XA 4BR0A 2GUIA 4FJ8A 2XY5A 1GLEG 3E01A 1UWBA 3CCSN 3TAMA 2ZD1A 3VQ9A 4BRNA 4B9UA 1NJZA 2QA4N 3AVFA 4TSXA 4H0XB 2IGIA 1QQNA 2Q0RA 2ASPA 4H0OA 4EAHD 4B1UB 4RTFD 4DV1K 2GX9A 1W7AA 2XY8A 4E72A 4IXCA 5AQIA 4JYAK 4YDUA 5TKYA 3H46O 3MEDA 4GV3A 1Q81O 1D9FA 4CF8A 4Q0BA 4MQ3A 1OH6A 5HRPA 4FJIA 4DSEA 2IDOA 3C65A 3ENBA 3OYNA 1TAQA 4YOVA 1YJWN 4JK7A 1TV6A 1NGHA 2FF3B 1RT7A 4IFVA 2HHQA 1SKRA 1BIZA 2C1IA 2QK9A 3I56N 2Q97A 3GL1A 3K9JA 1N5YA 5FRMA 3NMUA 3HI0A 1VSFA 4DLGA 3ZCMA 5M1FA 5B8HA 4B9SA 4PKGA 4ZTJA 1W97L 3S41A 3TPQA 3VGLA 2O8FB 2VG7A 4H4MA 4BRPA 3WEEA 3KLIA 3M5RA 5IT9O 1XMOK 2E1ZA 2FXUA 4CHOA 1E3MA 4FWNA 4CZMA 2IAJA 1KCFA 4FOEA 4Q5VA 2XY7A 4FWQA 2UU9K 4AQYK 1T03A 3U3GA 3CCEN 2UUBK 4H0VB 4CEQA 4CZIA 1C6VA 2WC9A 1RT2A 1C0GA 3FZKA 4CECA 2E2NA 3RTVA 3WNGA 1IKVA 3F9MA 1BG3A 2D0CA 3MX5A 4JI6K 4Z0UA 3NE6A 4DR3K 3FZMA 3CC2N 3L0QA 4NXNK 1QQOA 5FPEA 2J4RA 2Z1IA 2VQEK 1LWCA 1GOCA 3DMJA 4X62K 4O44A 2PY5A 3JS6A 1GOBA 4H03B 1JLCA 5M1NA 2B6AA 4FM2A 4CHPA 3KK7A 4F2SA 3QDKA 1T44A 4BG8A 4IJAA 4XEIA 3AARA 1DT9A 4I2QA 4JKGB 4EIAA 3PX4A 4HUEA 1VQON 5AR0A 1KAZA 1SS6A 2P9LA 1QHTA 3SI6A 4YFUA 5AQUA 1YJNN 3DLGA 3VQEA 3IRXA 3S3MA 3AVGA 3ZYYX 1QQCA 3Q7CA 3LANA 3VQBA 1HYVA 4GMJB 5F1XA 4FZYA 4PWDA 4FLUA 5IWAK 1Z26A 5DM6L 5JMVA 2I5JA 4JK8A 4B9MA 4Z4EA 1ZXOA 3OYAA 3HPOA 4X65K 3TWHA 5AQSA 4H0YB 1K6YA 3AVNA 3O08A 3O3GA 1VSDA 2ASMA 3VF6A 4DSLA 3SV4A 4IBNA 5JENA 3E1YA 3OYJA 5BR8K 2F4VK 3I8BA 4RW4A 4RW8A 3DXMB 3HPGA 4CFBA 4N47A 1WSEA 3L4IA 3CJ1A 3GE1A 1K9MO 2GTDA 4PL7A 1U2VB 4BWJA 2ZM6K 3OW2M 4F2RA 3DXKA 2D5RA 4EHUA 4CIFA 1S5JA 3OHRA 3QBWA 1KTQA 1YUWA 3VQ5A 3AO4A 5EXWA 3IUCA 3SQ1A 4CHNA 1T05A 3V9SA 1L5UA 5C2DA 3V9ZA 2CH6A 4FLWA 3O4NA 3EO3A 3HPHA 4CJFA 3I33A 4RCHA 4YORA 4V19S 2Q3SA 3E9PA 5JLFA 3V81A 5ADXH 3NDKA 5M1KA 4BWMA 1QTMA 1HPMA 4BC2A 3OA9A 4FM0A 3DOLA 2QWLA 1L3SA 4H4OA 4LSNA 4K8XA 4L8RB 3QBXA 2OZSA 1Q9YA 1WSFA 2JLEA 4FYDA 4XJXA 2ZJQL 1IBLK 4CFAA 4KH6A 4JRPA 4OKJA 4QS8A 1MU2A 3CCMN 3ID8A 4KBOA 1X9SA 3AVHA 4CIEA 3TTCA 4AHSA 4PHTX 4FM1A 3ZX0A 1RBVA 1VK0A 1F21A 2HNDA 1YJ9N 4FJLA 3AVCA 3BZKA 4CGFA 3O80A 4E7LA 3P5JA 4BREA 1WUAA 4B9VA 4BGBA 5HLFA 3BP8A 1HQEA 4C8NA 3OYMA 3HSCA 4BR2A 3SBTA 4KHPK 3NBPA 4ZHRA 3EE8A 4KV8A 4IOAL 1SAZA 4BDZA 3DLHA 2W42A 3ZSXA 3U6FA 4ISFA 2HHTA 3PSIA 4ELVA 4I6MB 1ZBSA 1VSHA 3C6TA 1NGGA 3QEIA 3V9XA 4JRQA 4DTUA 3LP1A 1ASWA 4Z4HA 5DM7L 5AQZA 5JICA 4GW6A 2IOCA 2Q0UA 5M1QA 3G25A 1NBWA 5CZ2A 2W40A 1IH7A 5AQHA 4CJVA 2KZMA 4FWPA 4IOCL 4XH5A 4DU1A 4E1NA 3SQ2A 1GLAG 3LP3A 3QFUA 4AM7A 4H5VA 4OPHA 3ZSWA 3QO9A 2C1GA 2O4IA 3THYB 3UKUB 4E19A 4FJMA 5M1OA 5DMRA 4CJSA 5C24A 3C94A 2YNFA 1DEJA 3SCXA 2YHXA 3AA5X 3CXCM 1A5WA 2FSNA 4O0JA 1KFSA 4G1QA 1TK0A 1IG8A 4U7BA 1RDUA 4IG3A 2E6MA 1NKBA 4JN4A 3TI0A 4BRDA 3CJ7A 3R1XA 5C42A 3QESA 4H0PA 2EX3A 2HVHA 1LV5A 1GLJO 3ULEB 1EO1A 1FKPA 2KFNA 3O1WA 3KK2A 2HNYA 4JI3K 4LY7A 1FKOA 3KKRA 3L2VA 2V7ZA 4BDYA 1Q86O 1X9MA 4FWKA 1KRPA 1T3VA 4DV0K 4H5NA 3RR8A 1VSJA 3FE1A 3K5LA 2QWPA 3BY5A 5FROA 1NJXA 3HP9A 2OYQA 2O8DA 3PUFA 3RSEB 2ZE2A 3HVRA 3ATVA 3QFPA 3CCJN 1C0UA 2HSTA 3J80O 1K8KB 3M8SA 1IJJA 1K8AO 4NLCA 3MAQA 4F3OA 3VF2A 3KK3A 5EU7A 1ZYQA 1VQ5N 4I7FA 4PY5A 4FW2A 4KH4A 5AFUA 3KLGA 3HOTA 4DTMA 4FLYA 4BVOA 3ZT2A 1N6QA 4O0IA 3CERA 3DLEA 3DRSA 2D1KA 1N34K 3R8EA 1NOZA 3M1FA 4BRCA 4E7HA 1NK7A 3QNOA 1P90A 4AHVA 5EX5A 3SYZA 3L3VA 2V7YA 4OLAA 4A2BA 1TK8A 4OKKA 1W0HA 2UXCK 3P38A 3CMAN 4C1NK 4FJJA 1BDGA 4B3SK 4F3TA 2P9SB 3KWIA 5AZJB 2OPPA 2YHBA 3GOIA 1M90O 1ASUA 4DR1K 4FJ9A 4JK9A 3CD6N 4FWOA 3CG7A 5BN9A 4CERA 1TYQA 2P9NA 3CPWM 3PIOL 4CJRA 1YITN 5GIOA 4DF4A 2HMPA 3PX0A 1RNHA 3C7NB 4CZFA 4NXMK 4KTWA 2HHIA 3HO1A 1WOQA 1TUYA 4QAGA 2DY4A 2HHXA 1A5XA 2AP1A 3A5NC 4WQ4A 1KXPA 4L3QA 2EWSA 3EN9A 1TK5A 2QXFA 1S6PA 1LWEA 3JAMO 4DQPA 4E7JA 2OA8A 3L2UA 2DFEA 1G15A 3CCUN 4DFMA 1NLVA 3AVBA 4CHZA 1WLJA 1QSSA 1EQYA 4BR9A 4KB0A 1U4BA 1ATNA 1XNQK 4DTPA 3NFAA 3AVJA 3F5TA 4CBUA 3G10A 3HXMA 4IKFA 3K5NA 3VEZA 3FLCO 5J2NA 4CD3A 1JLAA 5AQMA 3E66A 3V1QA 4JKEA 4M3TA 4KTQA 1RCHA 4CGIA 1NMDA 1R0AA 2NRWA 3ZSYA 3PIPL 4DTNA 4FJNA 3AGKA 4MLHA 3TAFA 3ZSOA 1WNSA 4WE1A 1LWFA 1BQMA 2E88A 2A3ZA 4E89A 2CH5A 3S9HA 2RF2A 3VTHA 1T8EA 4B9TA 4FJXA 1ATSA 1W9HA 4KKOA 5AQVA 4J8FA 1BI4B 4DLEA 3SJJA 2BH1A 3H6EA 3W0LA 4FLVA 1RBRA 3HOSA 4LC9B 3OYHA 4AHUA 1EP4A 2YHAA 4FZZA 2I7PA 1NK9A 2KQ2A 5E84A 4DQRA 1NGJA 3CETA 3LALA 4B3OA 3G4SN 1KLNA 5AQOA 4W5NA 1Q9XA 1IO2A 3O9UA 2ZQBA 4LFCK 5I42A 3FZHA 2YKMA 3NF8A 1HQUA 1RILA 2QKKA 4BE0A 3ZSVA 1HJRA 1BCMA 4DSIA 3A5LC 5KGWA 3C6HA 4CVNE 5AZIA 3F2KA 4DU3A 1VQ7N 5KI6A 3L2QA 4DR7K 4A2AA 3SUPA 4BGAA 3IKMA 5AQNA 3BGRA 2HBKA 3CM5A 1RDCA 3OYCA 1KSPA 1ZBIA 4BVPA 1HYZA 3WNHA 3TANA 5D3GA 1EWRA 4CJ7A 4M42A 5BN8A 1JL1A 4R79A 4WQ4C 2E1YA 4Y1CA 2E2QA 4IDHA 4IEEA 5HRNA 1VAZA 4FCYA 3HL8A 2WBNA 4DTSA 4B1VA 3R9PA 2YHYA 3WQTA 4CZLA 1WBBA 2PYJA 1TKDA 2NRRA 2O8BB 3SQ0A 4BRLA 4FLZA 3D2FB 3KIOA 3VMFB 3C95A 4N56A 4RW9A 3EEQA 3LZJA 2QWNA 1VSEA 3VQAA 2YKNA 1LAWA 4H5TA 1VQPN 1BUPA 2JGUA 4JKHA 4OPKA 3K9KA 1HX1A 5C10A 1XHZA 4XH4A 3BUZB 3P83D 1BA0A 2NLXA 4OVLA 3SNNA 2HVIA 4B3MK 3KTQA 4CBXA 2P9PB 4DHYA 1HKCA 2O8CA 3MXMA 1VRUA 1NG9A 3D2EA 5GIPA 3THWB 2P5GA 1Q8IA 4NYNA 1VQ9N 3GG4A 2W6KA 2HHHK 4LFAK 2IVPA 3AV9A 4Z4FA 4HCBA 3G6EN 1S1TA 4R5PA 2IVNA 3CJAA 3LWLA 4NCAA 4EFHA 1BL3A 1XC9A 3VESA 4M3UA 4M3RA 2V51B 4FK0A 1SL1A 2P9KB 2G8VA 4JS4A 3AY9A 3THXA 2PBDA 3MDQA 2A5XA 4PQUA 4DG1A 4KFBA 3CC7N 2GUPA 4GNIA 1QZ6A 3T69A 2YX6A 5FLXO 3OYBA 3T1YK 5AFUH 2OTJN 1S1XA 1HJOA 2KLAA 3TSQA 5JLHA 4ISEA 1N8RO 1VSLA 2G8UA 4C23A 4XIUA 4DWIA 4H5RA 1JLBA 4I9LA 4BRAA 3BDPA 5LY3A 1VHXA 3F9KA 4BRQA 4GVEA 1VSKA 1J54A 3AGRA 1CZ9A 4BRIA 3ENOA 4KPYA 3VEYA 1S22A 3HSTB 3OJUA 3D45A 3E9OA 2QKBA 4IDKA 1JLEA 3FFIA 4DFPA 4H0TB 4W5TA 5AQYA 1DTTA 2UUCK 2YI1A 1HRHA 4DTJA 3WXMB 1HNZK 3S3NA 4N41A 4YOXA 4NCBA 3MCAB 3T7ZA 4BDPA 3U8XA 3SAGA 3CQYA 1YHQN 1S72N 1JLGA 3O9SA 5J1EA 5TKWA 2E6LA 4BY9C 3H3OB 4KAZA 3PY8A 3N4PA 2BTFA 4WQ5A 4CGDA 3KLEA 1NK0A 2HMIA 3UE5A 1QHAA 3OYIA 4DQIA 1RDWX 1X9JA 1RGIA 4C1NI 2ITGA 4IWVA 1B9FA 4I2PA 3ZETB 1IBMK 3WT0A 5AQRA 5JS2A 1X3MA 3S5TA 4OPJA 4WCEL 3RMCA 2DFHA 4EP5A 3ZEUA 2E4LA 4OPAA 2OPQA 4CJPA 2HB5A 2VWJA 5AQGA 4JKCA 1JKHA 1FJGK 1QSYA 3AVAA 2P5OA 3NH0A 1WSJA 4MDAA 3UIQA 3VPZA 4UY8O 3EKUA 3UB5A 1VQ8N 4FLTA 1ZC6A 1NGAA 4A57A 3ZT3A 5KQ8A 1RTDA 3WNFA 1XC3A 4K43A 5C12A 4J2DA 1WSHA 1D8YA 4A59A 2B4JA 1NGBA 3ULDA 1WAFA 1SKSA 2O8EA 2WUSA 1C0TA 3VGKA 5ELZA 2IC3A 4CK3A 2AA4A 2YNIA 1NGFA 3DJCA 3HK2A 1REVA 4JD2A 4DR6K 3SZ2A 3CI5A 4XH1A 4YOTA 3N4QA 1IV0A 2DPNA 4JS5A 1RBSA 4KHWA 3CFRA 3HP6A 3PSFA 4OJRA 5AQJA 2RKIA 2ZGZA 4RW6A 4W5RA 2QXLA 1S1WA 4CK1A 3CQ8A 3QLHA 4BRFA 3DLRA 1NJIO 2OPRA 4CEBA 2ZF5O 1EXQA 4LH4A 4M41A 5FPDA 4JHDB 1N33K 1NJYA 4B9QA 1C1AA 1U48A 5M1PA 4FJ5A 3O4QA 3FR0A 3VQDA 1NMNA 4Z4IA 4O5FA 1CZBA 3PO4A 4Z94A 4CGHA 4NLBA 2BE2A 4NYFA 4AHRA 3SMSA 3UKRB 3CHWA 2GWJA 4F8RA 5BRFA 5AQPA 1YT3A 1I39A 3OYGA 4PKHA 3NVMA 4X66K 2JWLA 3NH1A 2P9IB 1BISA 4JKBA 2NZTA 5LJVA 1V4TA 1U6ZA 5CE3A 4CK2A 1K73O 2KKZA 3K0SA 2P9UB 4WQ5C 3D7EO 2BANA 4M63C 5BPNA 4DTOA 4PL8A 5EOYA 3CQXA 1QS4A 1X3NA 1L3VA 4FOIA 1EETA 1RT6A 1HNXK 3O6WA 2OTLN 3SQ4A 1NKCA 4WFBL 4BE1A 3O8MA 2HHVA 3K59A 3P1GA 4O8UA 3VQQA 1Q18A 3MXIA 2PAVA 4MFBA 3VENA 3J7YP 3O9QA 3MXJA 4JI1K 3M8RA 4MDBA 3CCQN 1HNVA 2QWMA 3LDNA 5LL6Z 4DS5A 3ENHA 4BEBA 1S6QA 4FLXA 2D0OA 1Z25A 4ILJA 4BC3A 2WFBA 2P9PA 4ILHA 1KFDA 1MA9B 5DK5A 3THWA 3VN5A 1C0FA 4CZJA 4KHSA 4CBWA 3DAWA 3QEVA 4CJLA 3DM2A 2F9WA 5LMUK 4OLBA 1HNWK 3SV3A 3EZ5A 3H3NO 2VWBA 2RN2A 2HNZA 2O8FA 3F73A 3T3FA 2VG6A 4O5BA 3AVLA 3DRPA 3ZT1A 2HHWA 2D0AA 3VQ8A 4PA1A 5JS1A 3LAKA 1QVGM 1VQKN 4KHQA 4CD1A 3NAEA 3AVMA 4B1WB 4CJTA 1TAUA 2VGNA 2HHSA 1NM1A 3AAQA 3DWLA 3L6QA 2G8FA 3K5MA 3MEGA 1RTHA 4GVMA 4K42A 1OH8A 4DSKA 3QEWA 1NWKA 2GBZA 4FL9A 5GAGP 3V9WA 3RRHA 1ZBLA 4YOWA 1FK9A 3OS2A 2P51A 4CFCA 3AO2A 5HRRA 2PYLA 3J7ZO 3GBTA 3MEEA 2OZMA 4KHUA 1QSLA 3MWPA 4HCCA 5AQFA 3VA3A 4OX9K 4PUOA 1OVYA 4NO7A 2E2OA 1UA0A 3CYGA 2QM1A 2D0PA 3QIOA 5BRDA 4DU4A 1BQNA 4CEDA 5GAHP 3MN7A 3NF9A 4HHTA 3HJFA 3CJ9A 3RMDA 2I7NA 5C15A 4DTXA 1J53A 4Z4CA 3PV8A 4JKGA 4JI7K 4W5QA 1DGKN 3H45C 4E1MA 4ICLA 3AAPA 1SL0A 1WN7A 3OS0A 1VQLN 1MWMA 3IDHA 5E26A 4JI4K 3TTFA 3OYEA 4B1YB 1IKYA 1VQ6N 1GLLO 4K25A 3ZSQA 4DV4K 4DV6K 4LF5K 3JYTA 4DS4A 4AHCA 1IG9A 1S3XA 2NRXA 2ZJPL 5BREA 3SPZA 5FPMA 3P39A 2B5JA 3W3DA 2HBJA 1VQ4N 1KD1O 2GEMA 4CGJA 4UQGA 3KKSA 4DV7K 1JLFA 2P9LB 3MN6A 3LM9A 4HTUA 2HHUA 1HUXA 3KK1A 1X9WA 3DOKA 2QI2A 3IG1A 4KRFA 1UA1A 4FJ7A 3KD1E 4FXDA 3PX6A 2Z1HA 4JI2K 1JLQA 1XQSC 1YTUA 5MLCQ 2FLOA 3U9ZA 4Y1DA 3DXMA 3NHGA 3O9TA 3LDSA 2UUAK 4IG0A 2HOEA 4C8OA 4E0DA 5LMNK 5KRTA 2DTUA 2Q1NA 4CJWA 4IO8A 2NRZA 1U2VA 3FFKB 1FXXA 1HR0K 4BE2A 3AO3A 1UAXA 4QS7A 5H1SQ 2A42A 1O13A 4BQZA 2Q31A 3HTVA 3MCPA 1U04A 2YNGA 4HUGA 2X74A 4YY3K 4WFAL 2KHOA 4DQQA 1OH5A 4E3SA 1S1VA 5KQDA 4KI4A 4FW1A 3DXKB 4DV3K 3BEXA 4C8LA 4DB3A 3WNEA 3HVTA 4OO1J 2YV0X 3B6PA 4LF9K 3G0ZA 4DR5K 3U9DA 3OS1A 1TL3A 5AQTA 5CHIA 4M3WA 2YNHA 5AQLA 5ADXA 5AQXA 3A5OC 3AA2A 3WXIA 3NF6A 1GLBG 5EVZA 5AJ3K 4AF1A 4CEEA 2IVOA 4JI5K 2V52B 3B6OA 1H1VA 4JKAA 4JHDA 2KZZA 4JI8K 1KAYA 4ILGB 1LCUA 2A1SA 1DTQA 4B3TK 3C6AA 4DR4K 3ZX2A 3LAMA 4FPBA 1Z6RA 2G8KA 3LWMA 4B1XB 4CJUA 3SUNA 4FPAA 4A5BA 3VEVA 1KC8O 1ZBUA 1HNIA 1S9GA 4CEFA 2FF6A 4DCHA 4BRMA 4OGEA 5AQKA 1RTIA 5BPLA 2P9IA 4CZKA 3OBWA 1SKWA 4JI0K 4I6MA 3O3HA 3A0IX 3PO5A 1XNRK 1Z05A 4QS9A 1YVNA 2EHGA 4JEPA 4CW7B 3QEXA 3OYDA 1Q82O 3D0PA 1JCEA 4DTRA 2UXBK 3RWUA 3NGZA 1TKXA 1IKWA 2W00A 2G8WA 4CFDA 3IFRA 2FBTA 3CM6A 4CJQA 3A2FA 3ID6A 3VA0A 4DR2K 4DMNA 4BR7A 2NRTA 3NGYA 3J81O 3MK6A 1NNEA 3E9LA 4KB1A 1V4SA 3THYA 4FZXC 3UKUA 4BRGA 5CZ1A 3TR8A 1NGDA 2E8AA 3HYFA 5BR9A 3VQ7A 1OKJA 1HKGA 3VGMA 3KD5E 2F96A 1XUPO 2QWRA 4CJEA 4FVUA 4E1JA 2NRVA 4W5OA 1X1PA 5HP1A 4BROA 4JKFA 3LP2A 3ZT4A 4ZTFA 3ULEA 1R59O 2GWKA 2F8TA 4ID1A 3KHYA 2QEXN 4CCHA 2CGLA 2H3GX 4FJHA 2PZSA 1L3TA 3OBYA 3I0RA 3CJBA 4FO0A 3WXLA 3ALYA 3LP0A 1YIJN 1QZ5A 3TAQA 4IFEA 2OPSA 4M3ZA 2A41A 2FBVA 4LF7K 1E4GT 5LJWA 2QTDA 3RSEA 4AM6A 4B9LA 4LF8K 3VEOA 4CZGA 4O55A 1BIUA 3NF7A 4WFNL 3SUQA 4IO9L 1K8KA 2ZWHA 4KO0A 3P31A 2F8SA 3OY9A 2CGJA 2WOMA 2X6NA 4RG8A 3LDQA 2FBXA 4AHTA 4CF2A 3FGUA 1TVRA 5K14A 2G8HA 1Y64A 1SUQA 3LPTA 1NK6A 4K41A 1TGOA 2O8DB 2VCPA 3DYAA 3MN5A 2XY6A 2NRHA 2YJFA 1D9DA 3M8PA 5KGXA 4KHYA 2AJQA 4A61A 3OJSA 1IBKK 4H8KA 2HF3A 1J6ZA 4GKKK 1Q7YO 4B08A 1XHXA 4CF0A 3MN9A 1DLOA
chains in the Genus database with same CATH topology
3PLAA 3FR0A 3J8AA 3R8EA 3VEWA 3O5BA 1SQKA 1JCGA 2ASOA 4O5FA 3FZLA 4Z94A 3M1FA 4BRCA 2ITMA 4NLBA 3SMSA 3UKRB 3CHWA 1MDUB 1P90A 3P4IA 5EX5A 2GWJA 3CF5L 5BRFA 5AQPA 1JJ2M 3CPEA 1ILYA 2V7YA 4PKHA 2P9SA 3CIPA 3NVMA 5AZJA 1YAGA 2P9UA 2JWLA 4A2BA 1QVFM 4MO5A 3R3LA 2P9IB 5F0XA 3EKSA 3P38A 3CMAN 4JKBA 4C1NK 2NZTA 1BDGA 4U67L 1V4TA 5LJVA 3SAHA 1U6ZA 5CE3A 1K73O 2P9SB 3KWIA 1YF5L 2KKZA 5AZJB 2P9UB 2VYPA 4WQ5C 3GOIA 2A6AA 1M90O 3D7EO 3KWGA 5CR4A 1KQSM 3TSUA 4M63C 3C7NA 4BR0A 5BPNA 4PL8A 5EOYA 4JK9A 3CQXA 1GLEG 1X3NA 3CD6N 3CCSN 4FWOA 4M7YA 5BN9A 3BF3A 3TSPA 4BRNA 1TYQA 2P9NA 4FOIA 3CPWM 3PIOL 1YITN 3O6WA 1D4XA 5GIOA 4JAXA 2OTLN 2HMPA 2QA4N 3C7NB 4YDUC 4CZFA 4WFBL 2PFUA 1WOQA 3O8MA 1TUYA 1BU6O 4H0XB 2AP1A 1QQNA 2Q0RA 3A5NC 2ASPA 1TYQB 2P9NB 3MX2A 4H0OA 4IOXA 4O8UA 1Q18A 4WQ4A 4B1UB 1KXPA 4L3QA 4EAHD 4RTFD 5C2FA 3I55N 2GX9A 2EWSA 2PAVA 3VENA 3EZWA 3O9QA 4IXCA 5AQIA 3EN9A 4MDBA 4YDUA 2QWMA 3CCQN 3LDNA 5TKYA 4DKWA 4BR4A 3ENHA 3H46O 4GV3A 4BEBA 2D0OA 1Q81O 4NB4A 3CCUN 1NLVA 4ILJA 4BC3A 3SLCA 2WFBA 2P9PA 3C65A 3ENBA 3QICA 4CI6A 1YJWN 4YOVA 1EQYA 4ILHA 4JK7A 4BR9A 5I9EB 5FPNA 4A5AA 1NGHA 1ATNA 2FF3B 1BA1A 3Q7BA 3LDLA 1MA9B 3TU5A 3WUHA 3F5TA 4CBUA 1C0FA 4CZJA 4CBWA 3DAWA 2IIRA 2C1IA 3VEZA 3HZ6A 3FLCO 4CD3A 1BWFO 2F9WA 2Q97A 5AQMA 3I56N 3E66A 3HM8A 3GL1A 3K9JA 4FSVA 4JKEA 3TTDA 3H3NO 2VWBA 3WQUA 3NMUA 3HI0A 1NMDA 2NRWA 3PIPL 5M1FA 4BC4A 5B8HA 5GADP 4PKGA 3U4LA 3AGKA 4MLHA 1W97L 3S41A 1P8ZA 3TPQA 2E88A 3VGLA 2A3ZA 1SZ2A 2CH5A 2FSKA 3VTHA 4BRPA 4BE7B 3WEEA 1QVGM 1VQKN 4CD1A 1ATSA 3M5RA 5GINA 1E4FT 2HF4A 5AQVA 4J8FA 2ZJRL 2E1ZA 3HRGA 4B1WB 2FXUA 2BH1A 3H6EA 2VGNA 3W0LA 1NM1A 3AAQA 1NGIA 4FWNA 3ZX3A 4LC9B 3DWLA 3HOSA 4CZMA 3L6QA 3VTIA 3LL3A 4K42A 4FOEA 4FWQA 3SBGA 4FWLA 1NWKA 4FL9A 5GAGP 2I7PA 3CCEN 4YOWA 5E84A 4H0VB 4CZIA 3SMPA 1NGJA 3CETA 3GDQA 5C0YA 3J7ZO 2WC9A 3GBTA 1C0GA 3FZKA 2E2NA 3F9MA 3MWPA 3G4SN 3MMVA 1BG3A 3MX5A 2BUPA 4H5WA 5AQFA 1OVYA 3O9UA 4NO7A 5AQOA 2GELA 3FZMA 3CC2N 2E2OA 3FZHA 1RFQA 3L0QA 3VOVA 3MWTA 2QM1A 2D0PA 2E20A 2VGMA 5BRDA 1QQOA 5GAHP 5FPEA 2J4RA 3MN7A 3A5LC 3FZFA 4FWMA 3C0BA 3C6HA 3CJ9A 3JS6A 2I7NA 5C15A 3EL2A 4H03B 4JKGA 3LDOA 5AQQA 5AZIA 1DGKN 3F2KA 3H45C 5M1NA 1VQ7N 5AQWA 3KK7A 4A2AA 3AAPA 4JNEA 4BGAA 1M1KO 3IKMA 3QDKA 5AQNA 1T44A 2HBKA 1VQLN 1MWMA 4BG8A 5GAEP 4IJAA 3IDHA 5E26A 4XEIA 3AARA 3TTFA 3CCLN 1DT9A 4B1YB 5JVHL 4BVPA 4JKGB 1GLLO 4K25A 4EIAA 5AZIB 1VQON 1VQ6N 2F9TA 1T6DA 5AR0A 1KAZA 1SS6A 2P9LA 4B1ZA 1S3XA 2NRXA 4CJ7A 2ZJPL 5BREA 5BN8A 2Q36A 5AQUA 1YI2N 5FPMA 3P39A 3W3DA 2HBJA 4WQ4C 3VETA 2CGKA 2E1YA 4R79A 1YJNN 3R6MA 2E2QA 2GEMA 4IDHA 3D2FA 4IEEA 1KD1O 1VAZA 2WBNA 3ZYYX 2P9LB 3MN6A 3LM9A 3R9PA 4B1VA 1BOTO 2YHYA 1HUXA 3WQTA 4IZ9A 1G99A 4CZLA 3Q7CA 2NRRA 3H1VX 4IJNA 1QQMA 3VF4A 3WXKA 2QI2A 4BRLA 3D2FB 5F1XA 1CZAN 3VMFB 5DM6L 5JMVA 4JK8A 1XQSC 4Y0WA 5MLCQ 2QWNA 1ZXOA 2FLOA 3U9ZA 3DXMA 5AQSA 3O9TA 4H0YB 4H5TA 1VQPN 2HOEA 3O08A 1BUPA 4JKHA 2ASMA 3VF6A 3K9KA 1HX1A 3E1YA 5C10A 2Q1NA 4XH4A 3I8BA 3BUZB 3D6RA 4IO8A 2NRZA 5KPRA 1U2VA 3FFKB 1BA0A 3DXMB 2NLXA 1HKBA 4BG9A 3LDPA 3L4IA 1TUUA 2HBMA 3L4QA 4CBXA 2P9PB 4MLEA 4A62A 4DHYA 3CJ1A 4QS7A 5H1SQ 1HKCA 3GE1A 4BC5A 2GTDA 1K9MO 4PL7A 2A42A 4MO4A 1U2VB 1LOTB 3D2EA 5GIPA 3OW2M 3DXKA 1VQ9N 1O13A 4BQZA 4JKDA 2Q31A 2QW9A 3HTVA 4EHUA 3GG4A 3MCPA 1T6CA 3QMLA 4EHTA 2OANA 3OHRA 3QBWA 1YUWA 4WFAL 2KHOA 3B8AX 2IVPA 5EXWA 3D2EB 3IUCA 5KQDA 3A8YA 3DXKB 3G6EN 3BEXA 5C2DA 2P9KA 4DB3A 4BRHA 2IVNA 2CH6A 3CJAA 3EO3A 3I33A 3CCVN 4RCHA 4OO1J 4YORA 4EFHA 3E9PA 3VESA 5JLFA 3CC4N 5ADXH 3U9DA 1DKGD 5AQTA 5M1KA 2V51B 5CHIA 3WEEB 1HPMA 4BC2A 5AQLA 5ADXA 2P9KB 3OA9A 2RE2A 5AQXA 2QWLA 3A5OC 4O8KA 3AY9A 3BF1A 2PBDA 3MDQA 2A5XA 2HBLA 3WXIA 3CC7N 1GLBG 2GUPA 3QBXA 5EVZA 4AF1A 4GNIA 2IVOA 1QZ6A 3T69A 2YX6A 4XJXA 2ZJQL 4KH5A 4KH6A 2V52B 5AFUH 1H1VA 4JKAA 4JHDA 3SAFA 3SK3A 1KAYA 2OTJN 1GLCG 4QS8A 2F7TA 4ILGB 1HJOA 1ESVA 1LCUA 2KLAA 4M7XA 3CCMN 3ID8A 4KBOA 3C6AA 4BQLA 3ZX2A 4FPBA 1Z6RA 4FWSA 3TTCA 3TSQA 5JLHA 4ISEA 1N8RO 1NGEA 4WYBA 4PHTX 2ZGYA 5EY4A 3ZX0A 5BPMA 3CJCA 4B1XB 4C23A 4H5RA 4FPAA 4A5BA 4BRAA 1YJ9N 1W2BM 3VEVA 4BR5A 5LY3A 1KC8O 3A5MC 2NNWA 5JVGL 5F2RA 4BRQA 1VQMN 4GVEA 4YOYA 2FF6A 4DCHA 3AGRA 3VEXA 4BRIA 5HL7L 3ENOA 4BRMA 3O80A 3QB0A 5AQKA 4BREA 5BPLA 2P9IA 3RVCA 2QWOA 1WUAA 4CZKA 1VQ4N 3VEYA 1S22A 3OBWA 4BGBA 4I6MA 3BP8A 3E9OA 3A0IX 3HSCA 4BR2A 3SBTA 1Z05A 3NVKA 4QS9A 1YVNA 3EE8A 4IOAL 4JEPA 1SAZA 1Q82O 1VQNN 5KPTA 4YOUA 1MWKA 3H1QA 1JCEA 4H0TB 3G71N 3DLLL 2QWQA 5AQYA 4ISFA 1HLUA 3SJHA 2YI1A 4I6MB 2W00A 1ZBSA 3WXMB 3IFRA 4YOXA 1NGGA 4HWIA 3MCAB 3T7ZA 3LM2A 3ID6A 3U8XA 5HOOA 3SAGA 1BO5O 3CQYA 1ATRA 1YHQN 5DM7L 4BR7A 3M6GA 5AQZA 5JICA 2NRTA 1S72N 3MK6A 3O9SA 3E9LA 5TKWA 1V4SA 5M1QA 2Q0UA 4BY9C 3UKUA 3H3OB 3ZETA 4BRGA 3G25A 1NBWA 1NGDA 2E8AA 5BR9A 2W40A 3N4PA 3WXJA 1OKJA 2BTFA 2Q2RA 4HTLA 4WQ5A 2D4WA 1HKGA 5AQHA 3VGMA 4FWPA 4CZEA 4IOCL 2YJEA 4XH5A 3UE5A 1QHAA 1XUPO 2QWRA 1RDWX 1GLAG 3O9RA 1X9JA 3QFUA 4H5VA 4OPHA 4AM7A 1RGIA 4C1NI 2C1GA 3HBTA 4DQ8A 4IWVA 4RWTA 3UKUB 3ZETB 3O4WA 4FVUA 1KAXA 3WT0A 3JXUA 5AQRA 5M1OA 4E1JA 1X3MA 4ISGA 4WCEL 2NRVA 2A40A 3ZEUA 4IEIA 4OPAA 1DEJA 3KVGA 4BROA 3CMEN 2YHXA 4JKFA 3CXCM 5AQGA 4JKCA 3M3ZA 3ULEA 2FSNA 1R59O 2GWKA 1IG8A 4U7BA 3IMXA 4G9ZA 1RDUA 4PKIA 3EE9A 3KHYA 2QEXN 1YXQA 2CGLA 2H3GX 2UYTA 4JN4A 3OBYA 4BRDA 4MDAA 3VPZA 3CJ7A 3CJBA 3R1XA 4FO0A 3WXLA 3ZEUB 4H0PA 4UY8O 3EKUA 3UB5A 1VQ8N 1YIJN 1QZ5A 4IFEA 1GLJO 1NGCA 3ULEB 1ZC6A 1NGAA 1EO1A 4A57A 5BRHA 5KQ8A 3O1WA 4GV9A 1XC3A 4K43A 5C12A 2A41A 4GY2B 1E4GT 5LJWA 4A59A 2QTDA 3RSEA 1NGBA 4AM6A 2V7ZA 2E2PA 5KPZA 4FWKA 1GLDG 1Q86O 1T3VA 1JCFA 2WUSA 3VEOA 4H5NA 4CZGA 3O1BA 3FE1A 2QWPA 3VGKA 4WFNL 4IO9L 1K8KA 2ZWHA 5ELZA 3P31A 2CGJA 3VERA 2AA4A 2FSJA 1NGFA 3RSEB 4WF9L 3DJCA 3ATVA 3QFPA 3CCJN 4JD2A 3LDQA 2HSTA 2RHKA 2W41A 3CI5A 4XH1A 4YOTA 3N4QA 3FGUA 2DPNA 4BRKA 1K8KB 1IJJA 5AQJA 1K8AO 2ZGZA 1Y64A 4NLCA 3KZBA 3VF2A 4K41A 1VQ5N 2VCPA 4JD2B 3MN5A 2YHWA 4KH4A 2QXLA 5AFUA 2NRHA 2YJFA 3HOTA 4BRFA 4BECA 4BVOA 2JWKA 1GLFO 4F9OA 2YCHA 4A61A 1NJIO 2ZF5O 2HF3A 1J6ZA 5FPDA 1Q7YO 4JHDB 3CERA 4CZHA 4GV6A 4B9QA 5M1PA 3UKRA 3MN9A 2D1KA 3ATUA 3CCRN 4FWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FR0 A;  3J8A A;  3R8E A;  3VEW A;  3O5B A;  1SQK A;  1JCG A;  2ASO A;  4O5F A;  3FZL A;  4Z94 A;  3M1F A;  4BRC A;  2ITM A;  3SMS A;  3UKR B;  3CHW A;  1MDU B;  3P4I A;  5EX5 A;  2GWJ A;  5BRF A;  5AQP A;  2V7Y A;  4PKH A;  2P9S A;  3CIP A;  5AZJ A;  1YAG A;  2P9U A;  4A2B A;  4MO5 A;  2P9I B;  5F0X A;  3EKS A;  2NZT A;  1BDG A;  5LJV A;  1V4T A;  1U6Z A;  5CE3 A;  2P9S B;  5AZJ B;  2P9U B;  2VYP A;  4WQ5 C;  3GOI A;  2A6A A;  3D7E O;  4M63 C;  3C7N A;  4BR0 A;  5BPN A;  4PL8 A;  5EOY A;  3CQX A;  1GLE G;  1X3N A;  4FWO A;  4M7Y A;  5BN9 A;  3BF3 A;  4BRN A;  1TYQ A;  2P9N A;  4FOI A;  3O6W A;  1D4X A;  4JAX A;  2HMP A;  3C7N B;  4YDU C;  4CZF A;  1WOQ A;  3O8M A;  1TUY A;  1BU6 O;  4H0X B;  2AP1 A;  1QQN A;  2Q0R A;  3A5N C;  2ASP A;  1TYQ B;  2P9N B;  4H0O A;  4B1Z A;  4B1U B;  4EAH D;  1Q18 A;  4WQ4 A;  1KXP A;  4L3Q A;  4RTF D;  2PAV A;  2EWS A;  3VEN A;  3EZW A;  4IXC A;  5AQI A;  3EN9 A;  4YDU A;  2QWM A;  3LDN A;  5TKY A;  4BR4 A;  3ENH A;  3H46 O;  2D0O A;  4NB4 A;  1NLV A;  4BC3 A;  3SLC A;  4CI6 A;  2P9P A;  3QIC A;  1EQY A;  4BR9 A;  5I9E B;  5FPN A;  1NGH A;  1ATN A;  2FF3 B;  1BA1 A;  3LDL A;  1MA9 B;  3TU5 A;  3WUH A;  4CBU A;  1C0F A;  4CZJ A;  4CBW A;  3DAW A;  2IIR A;  3VEZ A;  3HZ6 A;  3FLC O;  4CD3 A;  1BWF O;  2F9W A;  2Q97 A;  5AQM A;  3HM8 A;  3GL1 A;  4FSV A;  3H3N O;  2VWB A;  3WQU A;  3HI0 A;  1NMD A;  4BC4 A;  5B8H A;  4PKG A;  3U4L A;  4MLH A;  3S41 A;  1P8Z A;  3TPQ A;  2E88 A;  3VGL A;  2A3Z A;  1SZ2 A;  2CH5 A;  2FSK A;  4BRP A;  3WEE A;  4CD1 A;  1ATS A;  1E4F T;  2HF4 A;  5AQV A;  4J8F A;  2E1Z A;  4B1W B;  2FXU A;  3H6E A;  3W0L A;  1NM1 A;  3AAQ A;  1NGI A;  4FWN A;  3ZX3 A;  4LC9 B;  3DWL A;  4CZM A;  3L6Q A;  3LL3 A;  4K42 A;  4FOE A;  4FWQ A;  4FWL A;  1NWK A;  4FL9 A;  2I7P A;  5E84 A;  4H0V B;  4CZI A;  3SMP A;  1NGJ A;  3CET A;  3GDQ A;  3GBT A;  1C0G A;  3FZK A;  2E2N A;  3F9M A;  3MMV A;  1BG3 A;  4H5W A;  2BUP A;  5AQF A;  5AQO A;  4NO7 A;  2GEL A;  3FZM A;  2E2O A;  3FZH A;  1RFQ A;  3L0Q A;  3VOV A;  2QM1 A;  2D0P A;  2E20 A;  5BRD A;  1QQO A;  5FPE A;  2J4R A;  3MN7 A;  3A5L C;  3FZF A;  4FWM A;  3C0B A;  3CJ9 A;  3JS6 A;  2I7N A;  3EL2 A;  4H03 B;  3LDO A;  5AQQ A;  5AZI A;  1DGK N;  3H45 C;  5AQW A;  4A2A A;  3AAP A;  4JNE A;  4BGA A;  3QDK A;  5AQN A;  1T44 A;  1MWM A;  4BG8 A;  4IJA A;  3IDH A;  5E26 A;  4XEI A;  3AAR A;  4B1Y B;  4BVP A;  4EIA A;  1GLL O;  4K25 A;  5AZI B;  2F9T A;  1T6D A;  5AR0 A;  1KAZ A;  2P9L A;  1S3X A;  4CJ7 A;  5BRE A;  5BN8 A;  2Q36 A;  5AQU A;  5FPM A;  3W3D A;  4WQ4 C;  3VET A;  2CGK A;  2E1Y A;  3R6M A;  2E2Q A;  2GEM A;  3D2F A;  2P9L B;  3MN6 A;  3LM9 A;  3R9P A;  4B1V A;  1BOT O;  2YHY A;  1HUX A;  3WQT A;  4IZ9 A;  1G99 A;  4CZL A;  4IJN A;  3H1V X;  3VF4 A;  1QQM A;  3WXK A;  4BRL A;  3D2F B;  5F1X A;  1CZA N;  5JMV A;  1XQS C;  4Y0W A;  2QWN A;  1ZXO A;  2FLO A;  3U9Z A;  3DXM A;  5AQS A;  4H0Y B;  4H5T A;  2HOE A;  3O08 A;  1BUP A;  2ASM A;  3VF6 A;  1HX1 A;  2Q1N A;  4XH4 A;  3I8B A;  3BUZ B;  4IO8 A;  5KPR A;  1U2V A;  3FFK B;  1BA0 A;  3DXM B;  2NLX A;  1HKB A;  4BG9 A;  3LDP A;  3L4I A;  1TUU A;  4CBX A;  2P9P B;  4MLE A;  4A62 A;  4DHY A;  3CJ1 A;  4QS7 A;  1HKC A;  3GE1 A;  4BC5 A;  2GTD A;  4PL7 A;  2A42 A;  4MO4 A;  1U2V B;  1LOT B;  3D2E A;  3DXK A;  4BQZ A;  2Q31 A;  2QW9 A;  3HTV A;  4EHU A;  3GG4 A;  3MCP A;  1T6C A;  3QML A;  4EHT A;  2OAN A;  3OHR A;  3QBW A;  1YUW A;  2KHO A;  3B8A X;  2IVP A;  5EXW A;  3D2E B;  3IUC A;  5KQD A;  3A8Y A;  3DXK B;  3BEX A;  2P9K A;  4DB3 A;  4BRH A;  2IVN A;  2CH6 A;  3CJA A;  3EO3 A;  3I33 A;  4RCH A;  4EFH A;  3VES A;  5JLF A;  5ADX H;  3U9D A;  1DKG D;  5AQT A;  2V51 B;  3WEE B;  1HPM A;  4BC2 A;  5AQL A;  5ADX A;  2P9K B;  5AQX A;  2QWL A;  3A5O C;  4O8K A;  3AY9 A;  3BF1 A;  2PBD A;  3MDQ A;  2A5X A;  3WXI A;  1GLB G;  2GUP A;  3QBX A;  5EVZ A;  4GNI A;  2IVO A;  1QZ6 A;  2V52 B;  5AFU H;  1H1V A;  4JHD A;  3SK3 A;  1KAY A;  1GLC G;  4QS8 A;  4M7X A;  1HJO A;  1ESV A;  1LCU A;  3ID8 A;  4KBO A;  4BQL A;  3ZX2 A;  4FPB A;  1Z6R A;  4FWS A;  5JLH A;  4ISE A;  1NGE A;  4WYB A;  2ZGY A;  5EY4 A;  3ZX0 A;  5BPM A;  3CJC A;  4B1X B;  4C23 A;  4H5R A;  4FPA A;  4BRA A;  3VEV A;  4BR5 A;  5LY3 A;  3A5M C;  5F2R A;  4BRQ A;  2FF6 A;  4DCH A;  3VEX A;  4BRI A;  3ENO A;  4BRM A;  3O80 A;  3QB0 A;  5AQK A;  4BRE A;  5BPL A;  2P9I A;  2QWO A;  1WUA A;  4CZK A;  3VEY A;  1S22 A;  4BGB A;  4I6M A;  3BP8 A;  3A0I X;  3HSC A;  4BR2 A;  1Z05 A;  4QS9 A;  1YVN A;  1SAZ A;  5KPT A;  1MWK A;  3H1Q A;  1JCE A;  4H0T B;  2QWQ A;  5AQY A;  4ISF A;  1HLU A;  3SJH A;  2YI1 A;  4I6M B;  1ZBS A;  3IFR A;  1NGG A;  4HWI A;  3LM2 A;  3U8X A;  1BO5 O;  3CQY A;  1ATR A;  4BR7 A;  3M6G A;  5AQZ A;  5JIC A;  3MK6 A;  1V4S A;  2Q0U A;  3UKU A;  3H3O B;  3ZET A;  4BRG A;  3G25 A;  1NBW A;  1NGD A;  2E8A A;  5BR9 A;  2W40 A;  3WXJ A;  1OKJ A;  2BTF A;  2Q2R A;  4HTL A;  4WQ5 A;  2D4W A;  1HKG A;  5AQH A;  3VGM A;  4FWP A;  4CZE A;  2YJE A;  4XH5 A;  3UE5 A;  1QHA A;  1XUP O;  2QWR A;  1RDW X;  1GLA G;  1X9J A;  3QFU A;  4H5V A;  4AM7 A;  1RGI A;  3HBT A;  4DQ8 A;  4IWV A;  4RWT A;  3UKU B;  3ZET B;  3O4W A;  1KAX A;  3WT0 A;  3JXU A;  5AQR A;  4E1J A;  1X3M A;  4ISG A;  2A40 A;  3ZEU A;  1DEJ A;  3KVG A;  4BRO A;  2YHX A;  5AQG A;  3M3Z A;  3ULE A;  2FSN A;  1R59 O;  2GWK A;  1IG8 A;  3IMX A;  4PKI A;  3KHY A;  1YXQ A;  2CGL A;  2H3G X;  2UYT A;  4JN4 A;  4BRD A;  3VPZ A;  3CJ7 A;  3CJB A;  4FO0 A;  3WXL A;  3ZEU B;  4H0P A;  3EKU A;  3UB5 A;  1QZ5 A;  1GLJ O;  1NGC A;  3ULE B;  1ZC6 A;  1NGA A;  5BRH A;  5KQ8 A;  3O1W A;  1XC3 A;  4K43 A;  2A41 A;  4GY2 B;  1E4G T;  5LJW A;  3RSE A;  1NGB A;  4AM6 A;  2V7Z A;  2E2P A;  5KPZ A;  4FWK A;  1GLD G;  1JCF A;  2WUS A;  3VEO A;  4H5N A;  4CZG A;  3O1B A;  3FE1 A;  2QWP A;  3VGK A;  1K8K A;  2ZWH A;  5ELZ A;  2CGJ A;  3VER A;  2AA4 A;  2FSJ A;  1NGF A;  3RSE B;  3DJC A;  3ATV A;  3QFP A;  4JD2 A;  3LDQ A;  2W41 A;  3CI5 A;  4XH1 A;  3FGU A;  2DPN A;  4BRK A;  1K8K B;  1IJJ A;  5AQJ A;  2ZGZ A;  1Y64 A;  3KZB A;  3VF2 A;  4K41 A;  2VCP A;  4JD2 B;  3MN5 A;  2YHW A;  2QXL A;  5AFU A;  2NRH A;  2YJF A;  4BRF A;  4BVO A;  4F9O A;  1GLF O;  2YCH A;  4A61 A;  2ZF5 O;  2HF3 A;  1J6Z A;  5FPD A;  4JHD B;  3CER A;  4CZH A;  4B9Q A;  3UKR A;  3MN9 A;  2D1K A;  3ATU A;  4FWR A; 
#chains in the Genus database with same CATH topology
 3AO1 A;  3J8A A;  3AA3 A;  3VEW A;  3O5B A;  1SQK A;  1JCG A;  3ZSR A;  3ZLJ A;  3T1A A;  4DV5 K;  1HYS A;  2WTU A;  4M45 A;  4B3R K;  4CHQ A;  1KVA A;  1MDU B;  3P4I A;  3CF5 L;  2X78 A;  3CPE A;  3LPU A;  1XI1 A;  3BZC A;  4EZ9 A;  5FRN A;  2P9S A;  5AZJ A;  1YAG A;  2BGG A;  5SZT A;  1QVF M;  3M8Q A;  3R3L A;  4MO5 A;  4C8K A;  3EKS A;  1ASV A;  2R7Y A;  4E7K A;  3SAH A;  1JXB A;  5KTQ A;  1YF5 L;  5HRS A;  4NCG A;  1NK8 A;  3L2W A;  3KWG A;  5CR4 A;  4YNQ A;  3V9U A;  3C7N A;  4K8Z A;  5HRO A;  1NU0 A;  1TL1 A;  4M7Y A;  3AA4 A;  3BF3 A;  3TSP A;  4FVM A;  2O4G A;  1D4X A;  4JAX A;  3EY1 A;  2IS3 A;  4DV2 K;  2D0B A;  4YDU C;  4EP4 A;  5J2Q A;  2RPI A;  3THV A;  4CHY A;  2PFU A;  1QE1 A;  1BU6 O;  4B1Z A;  4IOX A;  1TYQ B;  2P9N B;  3MX2 A;  5C2F A;  3KLH A;  1XMQ K;  1I3A A;  3EZW A;  4DKW A;  4BR4 A;  4AH9 A;  3MEC A;  2VQF K;  4NB4 A;  2Z1J A;  2P1J A;  3SLC A;  4CI6 A;  4J2E A;  3QIC A;  1RBU A;  1WSG A;  3K57 A;  5I9E B;  5FPN A;  5HBM A;  3IS9 A;  4A5A A;  1BA1 A;  3ITH A;  3Q7B A;  5T7B A;  3LDL A;  3TU5 A;  3WUH A;  4CES A;  4FK2 A;  2IIR A;  3HZ6 A;  2G8I A;  1BWF O;  3VQP A;  3HM8 A;  4FSV A;  3TTD A;  3WQU A;  3QEP A;  4B8A B;  1U47 A;  1YTA A;  3IAY A;  2HW3 A;  4BC4 A;  5GAD P;  3U4L A;  1BI4 A;  1P8Z A;  4JV5 K;  2WON A;  1BHL A;  1C1C A;  3V1R A;  3HM9 A;  4CE9 A;  1SZ2 A;  2FSK A;  4BE7 B;  4DFJ A;  4OKE A;  5GIN A;  1E4F T;  2HF4 A;  4QCL A;  2ZJR L;  4K0K K;  3HRG A;  3V6D A;  1NGI A;  3ZX3 A;  1U45 A;  3VTI A;  3LL3 A;  3SBG A;  4FWL A;  4QOZ B;  1OVQ A;  1ITG A;  2X6S A;  3TAB A;  3SMP A;  3T1H K;  3GDQ A;  5C0Y A;  2XO7 A;  1J5E K;  4DUZ K;  3I0S A;  1BGX T;  3MMV A;  4H5W A;  2BUP A;  4LF6 K;  4CJ5 A;  5CYQ A;  2GEL A;  1RFQ A;  3VOV A;  3MWT A;  4LD0 A;  3NGI A;  4CJ3 A;  2E20 A;  1RDB A;  2VGM A;  3C6U A;  3FZF A;  4FWM A;  3C0B A;  3EL2 A;  3HT3 A;  1RTJ A;  3LDO A;  5AQQ A;  4LF4 K;  4KRE A;  5AQW A;  4JNE A;  1M1K O;  1S1U A;  1SV5 A;  2FBY A;  2W6L A;  5GAE P;  3NCI A;  3CCL N;  2Y1J A;  5JVH L;  5AZI B;  1CXU A;  2F9T A;  1T6D A;  1KVB A;  1ZBF A;  4CJK A;  4DFK A;  3KJV A;  2ATQ A;  2GV9 A;  2Y1I A;  3NH2 A;  2Q36 A;  2O8B A;  1YI2 N;  3H08 A;  4ELT A;  3VET A;  2CGK A;  1CXQ A;  3R6M A;  3D2F A;  1N36 K;  1OH7 A;  4KHN A;  1U49 A;  1BOT O;  4IZ9 A;  1G99 A;  3AVK A;  3DRR A;  4IJN A;  3H1V X;  4RW7 A;  1QQM A;  3VF4 A;  3WXK A;  4AIL C;  1LAV A;  3AO5 A;  4B9N A;  1IKX A;  1CZA N;  1C1B A;  1RBT A;  1B92 A;  4Y0W A;  2LSN A;  3VQ6 A;  4C8M A;  1NJW A;  5A2Q O;  2KFZ A;  4OGC A;  3OYF A;  4LFB K;  3S3O A;  3D6R A;  1NOY A;  4M3Y A;  5KPR A;  3OYL A;  1HKB A;  4BG9 A;  1ZBH A;  3LDP A;  1TUU A;  4CIG A;  2HBM A;  3L4Q A;  4BAC A;  4MLE A;  4A62 A;  1NK4 A;  4BC5 A;  4ELU A;  4MO4 A;  1LOT B;  1VSM A;  4J2A A;  4JKD A;  1KVC A;  2QW9 A;  1RT4 A;  1T6C A;  3QML A;  4EHT A;  2OAN A;  2O8C B;  3B8A X;  3L8B A;  3D2E B;  3TAR A;  3A8Y A;  3O3F A;  3ISN C;  4N5S A;  1EWQ A;  2P9K A;  1N32 K;  4BRH A;  4I9Q A;  4KI6 A;  4DSF A;  3TAE A;  3CC4 N;  3CFO A;  1DKG D;  3WEE B;  1SL2 A;  2RE2 A;  1J9A A;  4O8K A;  5E41 A;  2NUB A;  3BF1 A;  2HBL A;  4CF9 A;  1KLM A;  3K58 A;  4KH5 A;  5KRS A;  1B9D A;  2VWK A;  3SAF A;  3SK3 A;  4HUF A;  1GLC G;  3THX B;  4DSJ A;  2F7T A;  4M7X A;  1ESV A;  4BQL A;  4FWS A;  4EZ6 A;  1NGE A;  4WYB A;  2ZGY A;  5EY4 A;  5BPM A;  3CJC A;  5FDL A;  3ZT0 A;  2A1R A;  1W2B M;  4BR5 A;  4CEA A;  1LW2 A;  3A5M C;  2NNW A;  5JVG L;  4GKJ K;  5F2R A;  1VQM N;  1BCO A;  5CY4 A;  4YOY A;  3VEX A;  5HL7 L;  5C25 A;  3QB0 A;  1RT1 A;  1FW6 A;  2BDP A;  3RVC A;  1NK5 A;  1EKE A;  2QWO A;  4B8C A;  3QIP A;  3TAP A;  1TKT A;  3L3U A;  1RDD A;  3NVK A;  1YVU A;  3VQC A;  1WSI A;  3VQ4 A;  3SUO A;  1VQN N;  5KPT A;  3ASM A;  4YOU A;  1MWK A;  3H1Q A;  3G71 N;  2FC0 A;  3DLL L;  2QWQ A;  1WB9 A;  1Y97 A;  1CLQ A;  1HLU A;  3SJH A;  5SWM A;  3TAG A;  2XRI A;  1RDA A;  4LH5 A;  4HWI A;  3QNN A;  4FK4 A;  1WAJ A;  5HOO A;  4DQS A;  3K2P A;  4J2B A;  1BO5 O;  1ATR A;  4CEO A;  4FJG A;  3M6G A;  3CFP A;  1TKZ A;  3ZET A;  3CCV N;  3WXJ A;  2Q2R A;  4HTL A;  3J7A P;  1RT3 A;  2D4W A;  4CZE A;  3OVN A;  2YJE A;  1HPZ A;  3O9R A;  4F4K A;  3HBT A;  5CYM A;  4DQ8 A;  4RWT A;  4CF1 A;  2DFF A;  3DLB A;  1JL2 A;  3L2R A;  3O4W A;  1KAX A;  3JXU A;  2KW4 A;  3ZSZ A;  4ISG A;  3QIN A;  2A40 A;  4IEI A;  4ID5 A;  3KVG A;  3CME N;  3RMB A;  4JLH A;  3M3Z A;  3T19 A;  3SPY A;  3U3Y A;  3IMX A;  4G9Z A;  4PKI A;  3EE9 A;  3I8D A;  4KTZ A;  1YXQ A;  1EX4 A;  2UYT A;  4E7I A;  3RR7 A;  3ZEU B;  4N76 A;  4CJ4 A;  1RT5 A;  1NGC A;  5BRH A;  1JXE A;  4GV9 A;  2OCE A;  1XWL A;  3DLK A;  4GY2 B;  2E5L K;  3RRG A;  3QER A;  1D5A A;  2E2P A;  3AVI A;  1GLD G;  5KPZ A;  1JCF A;  2ETJ A;  1C0M A;  3O1B A;  3DI6 A;  1L3U A;  4IFY A;  2KTQ A;  3VER A;  1WBD A;  1O1W A;  2FSJ A;  4X64 K;  4WF9 L;  3LZI A;  3CYM A;  2O8E B;  2RHK A;  5I3U A;  2W41 A;  2VG5 A;  4DF8 A;  5J2P A;  4BRK A;  4CEZ A;  3KZB A;  3K5O A;  3KLF A;  4JD2 B;  2YHW A;  4LSL A;  1VSI A;  1J5O A;  4BEC A;  2JWK A;  1GLF O;  4F9O A;  2YCH A;  1UOC A;  4FJK A;  4Z4G A;  4CZH A;  4GV6 A;  1GOA A;  3UKR A;  3I55 N;  3LM2 A;  3ATU A;  3CCR N;  4FWR A;  5J2M A;  3PLA A;  3EYZ A;  4O4G A;  1LW0 A;  2ASO A;  3QET A;  4DUY K;  3FZL A;  3RMA A;  1VRT A;  2ITM A;  4HVJ A;  2UXD K;  1JJ2 M;  1T7P A;  1ILY A;  3V4I A;  3CIP A;  1A5V A;  2P9U A;  3JSM A;  1I94 K;  5F0X A;  3OTO K;  4CGG A;  2Z1G A;  4U67 L;  3OYK A;  3V1O A;  2VYP A;  1HMV A;  4YHH K;  2A6A A;  1S9E A;  1KQS M;  1NKE A;  3TSU A;  2XHB A;  4M3X A;  4BR0 A;  2GUI A;  4FJ8 A;  2XY5 A;  1GLE G;  3E01 A;  1UWB A;  3CCS N;  3TAM A;  2ZD1 A;  3VQ9 A;  4BRN A;  4B9U A;  1NJZ A;  2QA4 N;  3AVF A;  4TSX A;  4H0X B;  2IGI A;  1QQN A;  2Q0R A;  2ASP A;  4H0O A;  4EAH D;  4B1U B;  4RTF D;  4DV1 K;  2GX9 A;  1W7A A;  2XY8 A;  4E72 A;  4IXC A;  5AQI A;  4JYA K;  4YDU A;  5TKY A;  3H46 O;  3MED A;  4GV3 A;  1Q81 O;  1D9F A;  4CF8 A;  4Q0B A;  4MQ3 A;  1OH6 A;  5HRP A;  4FJI A;  4DSE A;  2IDO A;  3C65 A;  3ENB A;  3OYN A;  1TAQ A;  4YOV A;  1YJW N;  4JK7 A;  1TV6 A;  1NGH A;  2FF3 B;  1RT7 A;  4IFV A;  2HHQ A;  1SKR A;  1BIZ A;  2C1I A;  2QK9 A;  3I56 N;  2Q97 A;  3GL1 A;  3K9J A;  1N5Y A;  5FRM A;  3NMU A;  3HI0 A;  1VSF A;  4DLG A;  3ZCM A;  5M1F A;  5B8H A;  4B9S A;  4PKG A;  4ZTJ A;  1W97 L;  3S41 A;  3TPQ A;  3VGL A;  2O8F B;  2VG7 A;  4H4M A;  4BRP A;  3WEE A;  3KLI A;  3M5R A;  5IT9 O;  1XMO K;  2E1Z A;  2FXU A;  4CHO A;  1E3M A;  4FWN A;  4CZM A;  2IAJ A;  1KCF A;  4FOE A;  4Q5V A;  2XY7 A;  4FWQ A;  2UU9 K;  4AQY K;  1T03 A;  3U3G A;  3CCE N;  2UUB K;  4H0V B;  4CEQ A;  4CZI A;  1C6V A;  2WC9 A;  1RT2 A;  1C0G A;  3FZK A;  4CEC A;  2E2N A;  3RTV A;  3WNG A;  1IKV A;  3F9M A;  1BG3 A;  2D0C A;  3MX5 A;  4JI6 K;  4Z0U A;  3NE6 A;  4DR3 K;  3FZM A;  3CC2 N;  3L0Q A;  4NXN K;  1QQO A;  5FPE A;  2J4R A;  2Z1I A;  2VQE K;  1LWC A;  1GOC A;  3DMJ A;  4X62 K;  4O44 A;  2PY5 A;  3JS6 A;  1GOB A;  4H03 B;  1JLC A;  5M1N A;  2B6A A;  4FM2 A;  4CHP A;  3KK7 A;  4F2S A;  3QDK A;  1T44 A;  4BG8 A;  4IJA A;  4XEI A;  3AAR A;  1DT9 A;  4I2Q A;  4JKG B;  4EIA A;  3PX4 A;  4HUE A;  1VQO N;  5AR0 A;  1KAZ A;  1SS6 A;  2P9L A;  1QHT A;  3SI6 A;  4YFU A;  5AQU A;  1YJN N;  3DLG A;  3VQE A;  3IRX A;  3S3M A;  3AVG A;  3ZYY X;  1QQC A;  3Q7C A;  3LAN A;  3VQB A;  1HYV A;  4GMJ B;  5F1X A;  4FZY A;  4PWD A;  4FLU A;  5IWA K;  1Z26 A;  5DM6 L;  5JMV A;  2I5J A;  4JK8 A;  4B9M A;  4Z4E A;  1ZXO A;  3OYA A;  3HPO A;  4X65 K;  3TWH A;  5AQS A;  4H0Y B;  1K6Y A;  3AVN A;  3O08 A;  3O3G A;  1VSD A;  2ASM A;  3VF6 A;  4DSL A;  3SV4 A;  4IBN A;  5JEN A;  3E1Y A;  3OYJ A;  5BR8 K;  2F4V K;  3I8B A;  4RW4 A;  4RW8 A;  3DXM B;  3HPG A;  4CFB A;  4N47 A;  1WSE A;  3L4I A;  3CJ1 A;  3GE1 A;  1K9M O;  2GTD A;  4PL7 A;  1U2V B;  4BWJ A;  2ZM6 K;  3OW2 M;  4F2R A;  3DXK A;  2D5R A;  4EHU A;  4CIF A;  1S5J A;  3OHR A;  3QBW A;  1KTQ A;  1YUW A;  3VQ5 A;  3AO4 A;  5EXW A;  3IUC A;  3SQ1 A;  4CHN A;  1T05 A;  3V9S A;  1L5U A;  5C2D A;  3V9Z A;  2CH6 A;  4FLW A;  3O4N A;  3EO3 A;  3HPH A;  4CJF A;  3I33 A;  4RCH A;  4YOR A;  4V19 S;  2Q3S A;  3E9P A;  5JLF A;  3V81 A;  5ADX H;  3NDK A;  5M1K A;  4BWM A;  1QTM A;  1HPM A;  4BC2 A;  3OA9 A;  4FM0 A;  3DOL A;  2QWL A;  1L3S A;  4H4O A;  4LSN A;  4K8X A;  4L8R B;  3QBX A;  2OZS A;  1Q9Y A;  1WSF A;  2JLE A;  4FYD A;  4XJX A;  2ZJQ L;  1IBL K;  4CFA A;  4KH6 A;  4JRP A;  4OKJ A;  4QS8 A;  1MU2 A;  3CCM N;  3ID8 A;  4KBO A;  1X9S A;  3AVH A;  4CIE A;  3TTC A;  4AHS A;  4PHT X;  4FM1 A;  3ZX0 A;  1RBV A;  1VK0 A;  1F21 A;  2HND A;  1YJ9 N;  4FJL A;  3AVC A;  3BZK A;  4CGF A;  3O80 A;  4E7L A;  3P5J A;  4BRE A;  1WUA A;  4B9V A;  4BGB A;  5HLF A;  3BP8 A;  1HQE A;  4C8N A;  3OYM A;  3HSC A;  4BR2 A;  3SBT A;  4KHP K;  3NBP A;  4ZHR A;  3EE8 A;  4KV8 A;  4IOA L;  1SAZ A;  4BDZ A;  3DLH A;  2W42 A;  3ZSX A;  3U6F A;  4ISF A;  2HHT A;  3PSI A;  4ELV A;  4I6M B;  1ZBS A;  1VSH A;  3C6T A;  1NGG A;  3QEI A;  3V9X A;  4JRQ A;  4DTU A;  3LP1 A;  1ASW A;  4Z4H A;  5DM7 L;  5AQZ A;  5JIC A;  4GW6 A;  2IOC A;  2Q0U A;  5M1Q A;  3G25 A;  1NBW A;  5CZ2 A;  2W40 A;  1IH7 A;  5AQH A;  4CJV A;  2KZM A;  4FWP A;  4IOC L;  4XH5 A;  4DU1 A;  4E1N A;  3SQ2 A;  1GLA G;  3LP3 A;  3QFU A;  4AM7 A;  4H5V A;  4OPH A;  3ZSW A;  3QO9 A;  2C1G A;  2O4I A;  3THY B;  3UKU B;  4E19 A;  4FJM A;  5M1O A;  5DMR A;  4CJS A;  5C24 A;  3C94 A;  2YNF A;  1DEJ A;  3SCX A;  2YHX A;  3AA5 X;  3CXC M;  1A5W A;  2FSN A;  4O0J A;  1KFS A;  4G1Q A;  1TK0 A;  1IG8 A;  4U7B A;  1RDU A;  4IG3 A;  2E6M A;  1NKB A;  4JN4 A;  3TI0 A;  4BRD A;  3CJ7 A;  3R1X A;  5C42 A;  3QES A;  4H0P A;  2EX3 A;  2HVH A;  1LV5 A;  1GLJ O;  3ULE B;  1EO1 A;  1FKP A;  2KFN A;  3O1W A;  3KK2 A;  2HNY A;  4JI3 K;  4LY7 A;  1FKO A;  3KKR A;  3L2V A;  2V7Z A;  4BDY A;  1Q86 O;  1X9M A;  4FWK A;  1KRP A;  1T3V A;  4DV0 K;  4H5N A;  3RR8 A;  1VSJ A;  3FE1 A;  3K5L A;  2QWP A;  3BY5 A;  5FRO A;  1NJX A;  3HP9 A;  2OYQ A;  2O8D A;  3PUF A;  3RSE B;  2ZE2 A;  3HVR A;  3ATV A;  3QFP A;  3CCJ N;  1C0U A;  2HST A;  3J80 O;  1K8K B;  3M8S A;  1IJJ A;  1K8A O;  4NLC A;  3MAQ A;  4F3O A;  3VF2 A;  3KK3 A;  5EU7 A;  1ZYQ A;  1VQ5 N;  4I7F A;  4PY5 A;  4FW2 A;  4KH4 A;  5AFU A;  3KLG A;  3HOT A;  4DTM A;  4FLY A;  4BVO A;  3ZT2 A;  1N6Q A;  4O0I A;  3CER A;  3DLE A;  3DRS A;  2D1K A;  1N34 K;  3R8E A;  1NOZ A;  3M1F A;  4BRC A;  4E7H A;  1NK7 A;  3QNO A;  1P90 A;  4AHV A;  5EX5 A;  3SYZ A;  3L3V A;  2V7Y A;  4OLA A;  4A2B A;  1TK8 A;  4OKK A;  1W0H A;  2UXC K;  3P38 A;  3CMA N;  4C1N K;  4FJJ A;  1BDG A;  4B3S K;  4F3T A;  2P9S B;  3KWI A;  5AZJ B;  2OPP A;  2YHB A;  3GOI A;  1M90 O;  1ASU A;  4DR1 K;  4FJ9 A;  4JK9 A;  3CD6 N;  4FWO A;  3CG7 A;  5BN9 A;  4CER A;  1TYQ A;  2P9N A;  3CPW M;  3PIO L;  4CJR A;  1YIT N;  5GIO A;  4DF4 A;  2HMP A;  3PX0 A;  1RNH A;  3C7N B;  4CZF A;  4NXM K;  4KTW A;  2HHI A;  3HO1 A;  1WOQ A;  1TUY A;  4QAG A;  2DY4 A;  2HHX A;  1A5X A;  2AP1 A;  3A5N C;  4WQ4 A;  1KXP A;  4L3Q A;  2EWS A;  3EN9 A;  1TK5 A;  2QXF A;  1S6P A;  1LWE A;  3JAM O;  4DQP A;  4E7J A;  2OA8 A;  3L2U A;  2DFE A;  1G15 A;  3CCU N;  4DFM A;  1NLV A;  3AVB A;  4CHZ A;  1WLJ A;  1QSS A;  1EQY A;  4BR9 A;  4KB0 A;  1U4B A;  1ATN A;  1XNQ K;  4DTP A;  3NFA A;  3AVJ A;  3F5T A;  4CBU A;  3G10 A;  3HXM A;  4IKF A;  3K5N A;  3VEZ A;  3FLC O;  5J2N A;  4CD3 A;  1JLA A;  5AQM A;  3E66 A;  3V1Q A;  4JKE A;  4M3T A;  4KTQ A;  1RCH A;  4CGI A;  1NMD A;  1R0A A;  2NRW A;  3ZSY A;  3PIP L;  4DTN A;  4FJN A;  3AGK A;  4MLH A;  3TAF A;  3ZSO A;  1WNS A;  4WE1 A;  1LWF A;  1BQM A;  2E88 A;  2A3Z A;  4E89 A;  2CH5 A;  3S9H A;  2RF2 A;  3VTH A;  1T8E A;  4B9T A;  4FJX A;  1ATS A;  1W9H A;  4KKO A;  5AQV A;  4J8F A;  1BI4 B;  4DLE A;  3SJJ A;  2BH1 A;  3H6E A;  3W0L A;  4FLV A;  1RBR A;  3HOS A;  4LC9 B;  3OYH A;  4AHU A;  1EP4 A;  2YHA A;  4FZZ A;  2I7P A;  1NK9 A;  2KQ2 A;  5E84 A;  4DQR A;  1NGJ A;  3CET A;  3LAL A;  4B3O A;  3G4S N;  1KLN A;  5AQO A;  4W5N A;  1Q9X A;  1IO2 A;  3O9U A;  2ZQB A;  4LFC K;  5I42 A;  3FZH A;  2YKM A;  3NF8 A;  1HQU A;  1RIL A;  2QKK A;  4BE0 A;  3ZSV A;  1HJR A;  1BCM A;  4DSI A;  3A5L C;  5KGW A;  3C6H A;  4CVN E;  5AZI A;  3F2K A;  4DU3 A;  1VQ7 N;  5KI6 A;  3L2Q A;  4DR7 K;  4A2A A;  3SUP A;  4BGA A;  3IKM A;  5AQN A;  3BGR A;  2HBK A;  3CM5 A;  1RDC A;  3OYC A;  1KSP A;  1ZBI A;  4BVP A;  1HYZ A;  3WNH A;  3TAN A;  5D3G A;  1EWR A;  4CJ7 A;  4M42 A;  5BN8 A;  1JL1 A;  4R79 A;  4WQ4 C;  2E1Y A;  4Y1C A;  2E2Q A;  4IDH A;  4IEE A;  5HRN A;  1VAZ A;  4FCY A;  3HL8 A;  2WBN A;  4DTS A;  4B1V A;  3R9P A;  2YHY A;  3WQT A;  4CZL A;  1WBB A;  2PYJ A;  1TKD A;  2NRR A;  2O8B B;  3SQ0 A;  4BRL A;  4FLZ A;  3D2F B;  3KIO A;  3VMF B;  3C95 A;  4N56 A;  4RW9 A;  3EEQ A;  3LZJ A;  2QWN A;  1VSE A;  3VQA A;  2YKN A;  1LAW A;  4H5T A;  1VQP N;  1BUP A;  2JGU A;  4JKH A;  4OPK A;  3K9K A;  1HX1 A;  5C10 A;  1XHZ A;  4XH4 A;  3BUZ B;  3P83 D;  1BA0 A;  2NLX A;  4OVL A;  3SNN A;  2HVI A;  4B3M K;  3KTQ A;  4CBX A;  2P9P B;  4DHY A;  1HKC A;  2O8C A;  3MXM A;  1VRU A;  1NG9 A;  3D2E A;  5GIP A;  3THW B;  2P5G A;  1Q8I A;  4NYN A;  1VQ9 N;  3GG4 A;  2W6K A;  2HHH K;  4LFA K;  2IVP A;  3AV9 A;  4Z4F A;  4HCB A;  3G6E N;  1S1T A;  4R5P A;  2IVN A;  3CJA A;  3LWL A;  4NCA A;  4EFH A;  1BL3 A;  1XC9 A;  3VES A;  4M3U A;  4M3R A;  2V51 B;  4FK0 A;  1SL1 A;  2P9K B;  2G8V A;  4JS4 A;  3AY9 A;  3THX A;  2PBD A;  3MDQ A;  2A5X A;  4PQU A;  4DG1 A;  4KFB A;  3CC7 N;  2GUP A;  4GNI A;  1QZ6 A;  3T69 A;  2YX6 A;  5FLX O;  3OYB A;  3T1Y K;  5AFU H;  2OTJ N;  1S1X A;  1HJO A;  2KLA A;  3TSQ A;  5JLH A;  4ISE A;  1N8R O;  1VSL A;  2G8U A;  4C23 A;  4XIU A;  4DWI A;  4H5R A;  1JLB A;  4I9L A;  4BRA A;  3BDP A;  5LY3 A;  1VHX A;  3F9K A;  4BRQ A;  4GVE A;  1VSK A;  1J54 A;  3AGR A;  1CZ9 A;  4BRI A;  3ENO A;  4KPY A;  3VEY A;  1S22 A;  3HST B;  3OJU A;  3D45 A;  3E9O A;  2QKB A;  4IDK A;  1JLE A;  3FFI A;  4DFP A;  4H0T B;  4W5T A;  5AQY A;  1DTT A;  2UUC K;  2YI1 A;  1HRH A;  4DTJ A;  3WXM B;  1HNZ K;  3S3N A;  4N41 A;  4YOX A;  4NCB A;  3MCA B;  3T7Z A;  4BDP A;  3U8X A;  3SAG A;  3CQY A;  1YHQ N;  1S72 N;  1JLG A;  3O9S A;  5J1E A;  5TKW A;  2E6L A;  4BY9 C;  3H3O B;  4KAZ A;  3PY8 A;  3N4P A;  2BTF A;  4WQ5 A;  4CGD A;  3KLE A;  1NK0 A;  2HMI A;  3UE5 A;  1QHA A;  3OYI A;  4DQI A;  1RDW X;  1X9J A;  1RGI A;  4C1N I;  2ITG A;  4IWV A;  1B9F A;  4I2P A;  3ZET B;  1IBM K;  3WT0 A;  5AQR A;  5JS2 A;  1X3M A;  3S5T A;  4OPJ A;  4WCE L;  3RMC A;  2DFH A;  4EP5 A;  3ZEU A;  2E4L A;  4OPA A;  2OPQ A;  4CJP A;  2HB5 A;  2VWJ A;  5AQG A;  4JKC A;  1JKH A;  1FJG K;  1QSY A;  3AVA A;  2P5O A;  3NH0 A;  1WSJ A;  4MDA A;  3UIQ A;  3VPZ A;  4UY8 O;  3EKU A;  3UB5 A;  1VQ8 N;  4FLT A;  1ZC6 A;  1NGA A;  4A57 A;  3ZT3 A;  5KQ8 A;  1RTD A;  3WNF A;  1XC3 A;  4K43 A;  5C12 A;  4J2D A;  1WSH A;  1D8Y A;  4A59 A;  2B4J A;  1NGB A;  3ULD A;  1WAF A;  1SKS A;  2O8E A;  2WUS A;  1C0T A;  3VGK A;  5ELZ A;  2IC3 A;  4CK3 A;  2AA4 A;  2YNI A;  1NGF A;  3DJC A;  3HK2 A;  1REV A;  4JD2 A;  4DR6 K;  3SZ2 A;  3CI5 A;  4XH1 A;  4YOT A;  3N4Q A;  1IV0 A;  2DPN A;  4JS5 A;  1RBS A;  4KHW A;  3CFR A;  3HP6 A;  3PSF A;  4OJR A;  5AQJ A;  2RKI A;  2ZGZ A;  4RW6 A;  4W5R A;  2QXL A;  1S1W A;  4CK1 A;  3CQ8 A;  3QLH A;  4BRF A;  3DLR A;  1NJI O;  2OPR A;  4CEB A;  2ZF5 O;  1EXQ A;  4LH4 A;  4M41 A;  5FPD A;  4JHD B;  1N33 K;  1NJY A;  4B9Q A;  1C1A A;  1U48 A;  5M1P A;  4FJ5 A;  3O4Q A;  3FR0 A;  3VQD A;  1NMN A;  4Z4I A;  4O5F A;  1CZB A;  3PO4 A;  4Z94 A;  4CGH A;  4NLB A;  2BE2 A;  4NYF A;  4AHR A;  3SMS A;  3UKR B;  3CHW A;  2GWJ A;  4F8R A;  5BRF A;  5AQP A;  1YT3 A;  1I39 A;  3OYG A;  4PKH A;  3NVM A;  4X66 K;  2JWL A;  3NH1 A;  2P9I B;  1BIS A;  4JKB A;  2NZT A;  5LJV A;  1V4T A;  1U6Z A;  5CE3 A;  4CK2 A;  1K73 O;  2KKZ A;  3K0S A;  2P9U B;  4WQ5 C;  3D7E O;  2BAN A;  4M63 C;  5BPN A;  4DTO A;  4PL8 A;  5EOY A;  3CQX A;  1QS4 A;  1X3N A;  1L3V A;  4FOI A;  1EET A;  1RT6 A;  1HNX K;  3O6W A;  2OTL N;  3SQ4 A;  1NKC A;  4WFB L;  4BE1 A;  3O8M A;  2HHV A;  3K59 A;  3P1G A;  4O8U A;  3VQQ A;  1Q18 A;  3MXI A;  2PAV A;  4MFB A;  3VEN A;  3J7Y P;  3O9Q A;  3MXJ A;  4JI1 K;  3M8R A;  4MDB A;  3CCQ N;  1HNV A;  2QWM A;  3LDN A;  5LL6 Z;  4DS5 A;  3ENH A;  4BEB A;  1S6Q A;  4FLX A;  2D0O A;  1Z25 A;  4ILJ A;  4BC3 A;  2WFB A;  2P9P A;  4ILH A;  1KFD A;  1MA9 B;  5DK5 A;  3THW A;  3VN5 A;  1C0F A;  4CZJ A;  4KHS A;  4CBW A;  3DAW A;  3QEV A;  4CJL A;  3DM2 A;  2F9W A;  5LMU K;  4OLB A;  1HNW K;  3SV3 A;  3EZ5 A;  3H3N O;  2VWB A;  2RN2 A;  2HNZ A;  2O8F A;  3F73 A;  3T3F A;  2VG6 A;  4O5B A;  3AVL A;  3DRP A;  3ZT1 A;  2HHW A;  2D0A A;  3VQ8 A;  4PA1 A;  5JS1 A;  3LAK A;  1QVG M;  1VQK N;  4KHQ A;  4CD1 A;  3NAE A;  3AVM A;  4B1W B;  4CJT A;  1TAU A;  2VGN A;  2HHS A;  1NM1 A;  3AAQ A;  3DWL A;  3L6Q A;  2G8F A;  3K5M A;  3MEG A;  1RTH A;  4GVM A;  4K42 A;  1OH8 A;  4DSK A;  3QEW A;  1NWK A;  2GBZ A;  4FL9 A;  5GAG P;  3V9W A;  3RRH A;  1ZBL A;  4YOW A;  1FK9 A;  3OS2 A;  2P51 A;  4CFC A;  3AO2 A;  5HRR A;  2PYL A;  3J7Z O;  3GBT A;  3MEE A;  2OZM A;  4KHU A;  1QSL A;  3MWP A;  4HCC A;  5AQF A;  3VA3 A;  4OX9 K;  4PUO A;  1OVY A;  4NO7 A;  2E2O A;  1UA0 A;  3CYG A;  2QM1 A;  2D0P A;  3QIO A;  5BRD A;  4DU4 A;  1BQN A;  4CED A;  5GAH P;  3MN7 A;  3NF9 A;  4HHT A;  3HJF A;  3CJ9 A;  3RMD A;  2I7N A;  5C15 A;  4DTX A;  1J53 A;  4Z4C A;  3PV8 A;  4JKG A;  4JI7 K;  4W5Q A;  1DGK N;  3H45 C;  4E1M A;  4ICL A;  3AAP A;  1SL0 A;  1WN7 A;  3OS0 A;  1VQL N;  1MWM A;  3IDH A;  5E26 A;  4JI4 K;  3TTF A;  3OYE A;  4B1Y B;  1IKY A;  1VQ6 N;  1GLL O;  4K25 A;  3ZSQ A;  4DV4 K;  4DV6 K;  4LF5 K;  3JYT A;  4DS4 A;  4AHC A;  1IG9 A;  1S3X A;  2NRX A;  2ZJP L;  5BRE A;  3SPZ A;  5FPM A;  3P39 A;  2B5J A;  3W3D A;  2HBJ A;  1VQ4 N;  1KD1 O;  2GEM A;  4CGJ A;  4UQG A;  3KKS A;  4DV7 K;  1JLF A;  2P9L B;  3MN6 A;  3LM9 A;  4HTU A;  2HHU A;  1HUX A;  3KK1 A;  1X9W A;  3DOK A;  2QI2 A;  3IG1 A;  4KRF A;  1UA1 A;  4FJ7 A;  3KD1 E;  4FXD A;  3PX6 A;  2Z1H A;  4JI2 K;  1JLQ A;  1XQS C;  1YTU A;  5MLC Q;  2FLO A;  3U9Z A;  4Y1D A;  3DXM A;  3NHG A;  3O9T A;  3LDS A;  2UUA K;  4IG0 A;  2HOE A;  4C8O A;  4E0D A;  5LMN K;  5KRT A;  2DTU A;  2Q1N A;  4CJW A;  4IO8 A;  2NRZ A;  1U2V A;  3FFK B;  1FXX A;  1HR0 K;  4BE2 A;  3AO3 A;  1UAX A;  4QS7 A;  5H1S Q;  2A42 A;  1O13 A;  4BQZ A;  2Q31 A;  3HTV A;  3MCP A;  1U04 A;  2YNG A;  4HUG A;  2X74 A;  4YY3 K;  4WFA L;  2KHO A;  4DQQ A;  1OH5 A;  4E3S A;  1S1V A;  5KQD A;  4KI4 A;  4FW1 A;  3DXK B;  4DV3 K;  3BEX A;  4C8L A;  4DB3 A;  3WNE A;  3HVT A;  4OO1 J;  2YV0 X;  3B6P A;  4LF9 K;  3G0Z A;  4DR5 K;  3U9D A;  3OS1 A;  1TL3 A;  5AQT A;  5CHI A;  4M3W A;  2YNH A;  5AQL A;  5ADX A;  5AQX A;  3A5O C;  3AA2 A;  3WXI A;  3NF6 A;  1GLB G;  5EVZ A;  5AJ3 K;  4AF1 A;  4CEE A;  2IVO A;  4JI5 K;  2V52 B;  3B6O A;  1H1V A;  4JKA A;  4JHD A;  2KZZ A;  4JI8 K;  1KAY A;  4ILG B;  1LCU A;  2A1S A;  1DTQ A;  4B3T K;  3C6A A;  4DR4 K;  3ZX2 A;  3LAM A;  4FPB A;  1Z6R A;  2G8K A;  3LWM A;  4B1X B;  4CJU A;  3SUN A;  4FPA A;  4A5B A;  3VEV A;  1KC8 O;  1ZBU A;  1HNI A;  1S9G A;  4CEF A;  2FF6 A;  4DCH A;  4BRM A;  4OGE A;  5AQK A;  1RTI A;  5BPL A;  2P9I A;  4CZK A;  3OBW A;  1SKW A;  4JI0 K;  4I6M A;  3O3H A;  3A0I X;  3PO5 A;  1XNR K;  1Z05 A;  4QS9 A;  1YVN A;  2EHG A;  4JEP A;  4CW7 B;  3QEX A;  3OYD A;  1Q82 O;  3D0P A;  1JCE A;  4DTR A;  2UXB K;  3RWU A;  3NGZ A;  1TKX A;  1IKW A;  2W00 A;  2G8W A;  4CFD A;  3IFR A;  2FBT A;  3CM6 A;  4CJQ A;  3A2F A;  3ID6 A;  3VA0 A;  4DR2 K;  4DMN A;  4BR7 A;  2NRT A;  3NGY A;  3J81 O;  3MK6 A;  1NNE A;  3E9L A;  4KB1 A;  1V4S A;  3THY A;  4FZX C;  3UKU A;  4BRG A;  5CZ1 A;  3TR8 A;  1NGD A;  2E8A A;  3HYF A;  5BR9 A;  3VQ7 A;  1OKJ A;  1HKG A;  3VGM A;  3KD5 E;  2F96 A;  1XUP O;  2QWR A;  4CJE A;  4FVU A;  4E1J A;  2NRV A;  4W5O A;  1X1P A;  5HP1 A;  4BRO A;  4JKF A;  3LP2 A;  3ZT4 A;  4ZTF A;  3ULE A;  1R59 O;  2GWK A;  2F8T A;  4ID1 A;  3KHY A;  2QEX N;  4CCH A;  2CGL A;  2H3G X;  4FJH A;  2PZS A;  1L3T A;  3OBY A;  3I0R A;  3CJB A;  4FO0 A;  3WXL A;  3ALY A;  3LP0 A;  1YIJ N;  1QZ5 A;  3TAQ A;  4IFE A;  2OPS A;  4M3Z A;  2A41 A;  2FBV A;  4LF7 K;  1E4G T;  5LJW A;  2QTD A;  3RSE A;  4AM6 A;  4B9L A;  4LF8 K;  3VEO A;  4CZG A;  4O55 A;  1BIU A;  3NF7 A;  4WFN L;  3SUQ A;  4IO9 L;  1K8K A;  2ZWH A;  4KO0 A;  3P31 A;  2F8S A;  3OY9 A;  2CGJ A;  2WOM A;  2X6N A;  4RG8 A;  3LDQ A;  2FBX A;  4AHT A;  4CF2 A;  3FGU A;  1TVR A;  5K14 A;  2G8H A;  1Y64 A;  1SUQ A;  3LPT A;  1NK6 A;  4K41 A;  1TGO A;  2O8D B;  2VCP A;  3DYA A;  3MN5 A;  2XY6 A;  2NRH A;  2YJF A;  1D9D A;  3M8P A;  5KGX A;  4KHY A;  2AJQ A;  4A61 A;  3OJS A;  1IBK K;  4H8K A;  2HF3 A;  1J6Z A;  4GKK K;  1Q7Y O;  4B08 A;  1XHX A;  4CF0 A;  3MN9 A;  1DLO A; 
#chains in the Genus database with same CATH homology
 3PLA A;  3FR0 A;  3J8A A;  3R8E A;  3VEW A;  3O5B A;  1SQK A;  1JCG A;  2ASO A;  4O5F A;  3FZL A;  4Z94 A;  3M1F A;  4BRC A;  2ITM A;  4NLB A;  3SMS A;  3UKR B;  3CHW A;  1MDU B;  1P90 A;  3P4I A;  5EX5 A;  2GWJ A;  3CF5 L;  5BRF A;  5AQP A;  1JJ2 M;  3CPE A;  1ILY A;  2V7Y A;  4PKH A;  2P9S A;  3CIP A;  3NVM A;  5AZJ A;  1YAG A;  2P9U A;  2JWL A;  4A2B A;  1QVF M;  4MO5 A;  3R3L A;  2P9I B;  5F0X A;  3EKS A;  3P38 A;  3CMA N;  4JKB A;  4C1N K;  2NZT A;  1BDG A;  4U67 L;  1V4T A;  5LJV A;  3SAH A;  1U6Z A;  5CE3 A;  1K73 O;  2P9S B;  3KWI A;  1YF5 L;  2KKZ A;  5AZJ B;  2P9U B;  2VYP A;  4WQ5 C;  3GOI A;  2A6A A;  1M90 O;  3D7E O;  3KWG A;  5CR4 A;  1KQS M;  3TSU A;  4M63 C;  3C7N A;  4BR0 A;  5BPN A;  4PL8 A;  5EOY A;  4JK9 A;  3CQX A;  1GLE G;  1X3N A;  3CD6 N;  3CCS N;  4FWO A;  4M7Y A;  5BN9 A;  3BF3 A;  3TSP A;  4BRN A;  1TYQ A;  2P9N A;  4FOI A;  3CPW M;  3PIO L;  1YIT N;  3O6W A;  1D4X A;  5GIO A;  4JAX A;  2OTL N;  2HMP A;  2QA4 N;  3C7N B;  4YDU C;  4CZF A;  4WFB L;  2PFU A;  1WOQ A;  3O8M A;  1TUY A;  1BU6 O;  4H0X B;  2AP1 A;  1QQN A;  2Q0R A;  3A5N C;  2ASP A;  1TYQ B;  2P9N B;  3MX2 A;  4H0O A;  4IOX A;  4O8U A;  1Q18 A;  4WQ4 A;  4B1U B;  1KXP A;  4L3Q A;  4EAH D;  4RTF D;  5C2F A;  3I55 N;  2GX9 A;  2EWS A;  2PAV A;  3VEN A;  3EZW A;  3O9Q A;  4IXC A;  5AQI A;  3EN9 A;  4MDB A;  4YDU A;  2QWM A;  3CCQ N;  3LDN A;  5TKY A;  4DKW A;  4BR4 A;  3ENH A;  3H46 O;  4GV3 A;  4BEB A;  2D0O A;  1Q81 O;  4NB4 A;  3CCU N;  1NLV A;  4ILJ A;  4BC3 A;  3SLC A;  2WFB A;  2P9P A;  3C65 A;  3ENB A;  3QIC A;  4CI6 A;  1YJW N;  4YOV A;  1EQY A;  4ILH A;  4JK7 A;  4BR9 A;  5I9E B;  5FPN A;  4A5A A;  1NGH A;  1ATN A;  2FF3 B;  1BA1 A;  3Q7B A;  3LDL A;  1MA9 B;  3TU5 A;  3WUH A;  3F5T A;  4CBU A;  1C0F A;  4CZJ A;  4CBW A;  3DAW A;  2IIR A;  2C1I A;  3VEZ A;  3HZ6 A;  3FLC O;  4CD3 A;  1BWF O;  2F9W A;  2Q97 A;  5AQM A;  3I56 N;  3E66 A;  3HM8 A;  3GL1 A;  3K9J A;  4FSV A;  4JKE A;  3TTD A;  3H3N O;  2VWB A;  3WQU A;  3NMU A;  3HI0 A;  1NMD A;  2NRW A;  3PIP L;  5M1F A;  4BC4 A;  5B8H A;  5GAD P;  4PKG A;  3U4L A;  3AGK A;  4MLH A;  1W97 L;  3S41 A;  1P8Z A;  3TPQ A;  2E88 A;  3VGL A;  2A3Z A;  1SZ2 A;  2CH5 A;  2FSK A;  3VTH A;  4BRP A;  4BE7 B;  3WEE A;  1QVG M;  1VQK N;  4CD1 A;  1ATS A;  3M5R A;  5GIN A;  1E4F T;  2HF4 A;  5AQV A;  4J8F A;  2ZJR L;  2E1Z A;  3HRG A;  4B1W B;  2FXU A;  2BH1 A;  3H6E A;  2VGN A;  3W0L A;  1NM1 A;  3AAQ A;  1NGI A;  4FWN A;  3ZX3 A;  4LC9 B;  3DWL A;  3HOS A;  4CZM A;  3L6Q A;  3VTI A;  3LL3 A;  4K42 A;  4FOE A;  4FWQ A;  3SBG A;  4FWL A;  1NWK A;  4FL9 A;  5GAG P;  2I7P A;  3CCE N;  4YOW A;  5E84 A;  4H0V B;  4CZI A;  3SMP A;  1NGJ A;  3CET A;  3GDQ A;  5C0Y A;  3J7Z O;  2WC9 A;  3GBT A;  1C0G A;  3FZK A;  2E2N A;  3F9M A;  3MWP A;  3G4S N;  3MMV A;  1BG3 A;  3MX5 A;  2BUP A;  4H5W A;  5AQF A;  1OVY A;  3O9U A;  4NO7 A;  5AQO A;  2GEL A;  3FZM A;  3CC2 N;  2E2O A;  3FZH A;  1RFQ A;  3L0Q A;  3VOV A;  3MWT A;  2QM1 A;  2D0P A;  2E20 A;  2VGM A;  5BRD A;  1QQO A;  5GAH P;  5FPE A;  2J4R A;  3MN7 A;  3A5L C;  3FZF A;  4FWM A;  3C0B A;  3C6H A;  3CJ9 A;  3JS6 A;  2I7N A;  5C15 A;  3EL2 A;  4H03 B;  4JKG A;  3LDO A;  5AQQ A;  5AZI A;  1DGK N;  3F2K A;  3H45 C;  5M1N A;  1VQ7 N;  5AQW A;  3KK7 A;  4A2A A;  3AAP A;  4JNE A;  4BGA A;  1M1K O;  3IKM A;  3QDK A;  5AQN A;  1T44 A;  2HBK A;  1VQL N;  1MWM A;  4BG8 A;  5GAE P;  4IJA A;  3IDH A;  5E26 A;  4XEI A;  3AAR A;  3TTF A;  3CCL N;  1DT9 A;  4B1Y B;  5JVH L;  4BVP A;  4JKG B;  1GLL O;  4K25 A;  4EIA A;  5AZI B;  1VQO N;  1VQ6 N;  2F9T A;  1T6D A;  5AR0 A;  1KAZ A;  1SS6 A;  2P9L A;  4B1Z A;  1S3X A;  2NRX A;  4CJ7 A;  2ZJP L;  5BRE A;  5BN8 A;  2Q36 A;  5AQU A;  1YI2 N;  5FPM A;  3P39 A;  3W3D A;  2HBJ A;  4WQ4 C;  3VET A;  2CGK A;  2E1Y A;  4R79 A;  1YJN N;  3R6M A;  2E2Q A;  2GEM A;  4IDH A;  3D2F A;  4IEE A;  1KD1 O;  1VAZ A;  2WBN A;  3ZYY X;  2P9L B;  3MN6 A;  3LM9 A;  3R9P A;  4B1V A;  1BOT O;  2YHY A;  1HUX A;  3WQT A;  4IZ9 A;  1G99 A;  4CZL A;  3Q7C A;  2NRR A;  3H1V X;  4IJN A;  1QQM A;  3VF4 A;  3WXK A;  2QI2 A;  4BRL A;  3D2F B;  5F1X A;  1CZA N;  3VMF B;  5DM6 L;  5JMV A;  4JK8 A;  1XQS C;  4Y0W A;  5MLC Q;  2QWN A;  1ZXO A;  2FLO A;  3U9Z A;  3DXM A;  5AQS A;  3O9T A;  4H0Y B;  4H5T A;  1VQP N;  2HOE A;  3O08 A;  1BUP A;  4JKH A;  2ASM A;  3VF6 A;  3K9K A;  1HX1 A;  3E1Y A;  5C10 A;  2Q1N A;  4XH4 A;  3I8B A;  3BUZ B;  3D6R A;  4IO8 A;  2NRZ A;  5KPR A;  1U2V A;  3FFK B;  1BA0 A;  3DXM B;  2NLX A;  1HKB A;  4BG9 A;  3LDP A;  3L4I A;  1TUU A;  2HBM A;  3L4Q A;  4CBX A;  2P9P B;  4MLE A;  4A62 A;  4DHY A;  3CJ1 A;  4QS7 A;  5H1S Q;  1HKC A;  3GE1 A;  4BC5 A;  2GTD A;  1K9M O;  4PL7 A;  2A42 A;  4MO4 A;  1U2V B;  1LOT B;  3D2E A;  5GIP A;  3OW2 M;  3DXK A;  1VQ9 N;  1O13 A;  4BQZ A;  4JKD A;  2Q31 A;  2QW9 A;  3HTV A;  4EHU A;  3GG4 A;  3MCP A;  1T6C A;  3QML A;  4EHT A;  2OAN A;  3OHR A;  3QBW A;  1YUW A;  4WFA L;  2KHO A;  3B8A X;  2IVP A;  5EXW A;  3D2E B;  3IUC A;  5KQD A;  3A8Y A;  3DXK B;  3G6E N;  3BEX A;  5C2D A;  2P9K A;  4DB3 A;  4BRH A;  2IVN A;  2CH6 A;  3CJA A;  3EO3 A;  3I33 A;  3CCV N;  4RCH A;  4OO1 J;  4YOR A;  4EFH A;  3E9P A;  3VES A;  5JLF A;  3CC4 N;  5ADX H;  3U9D A;  1DKG D;  5AQT A;  5M1K A;  2V51 B;  5CHI A;  3WEE B;  1HPM A;  4BC2 A;  5AQL A;  5ADX A;  2P9K B;  3OA9 A;  2RE2 A;  5AQX A;  2QWL A;  3A5O C;  4O8K A;  3AY9 A;  3BF1 A;  2PBD A;  3MDQ A;  2A5X A;  2HBL A;  3WXI A;  3CC7 N;  1GLB G;  2GUP A;  3QBX A;  5EVZ A;  4AF1 A;  4GNI A;  2IVO A;  1QZ6 A;  3T69 A;  2YX6 A;  4XJX A;  2ZJQ L;  4KH5 A;  4KH6 A;  2V52 B;  5AFU H;  1H1V A;  4JKA A;  4JHD A;  3SAF A;  3SK3 A;  1KAY A;  2OTJ N;  1GLC G;  4QS8 A;  2F7T A;  4ILG B;  1HJO A;  1ESV A;  1LCU A;  2KLA A;  4M7X A;  3CCM N;  3ID8 A;  4KBO A;  3C6A A;  4BQL A;  3ZX2 A;  4FPB A;  1Z6R A;  4FWS A;  3TTC A;  3TSQ A;  5JLH A;  4ISE A;  1N8R O;  1NGE A;  4WYB A;  4PHT X;  2ZGY A;  5EY4 A;  3ZX0 A;  5BPM A;  3CJC A;  4B1X B;  4C23 A;  4H5R A;  4FPA A;  4A5B A;  4BRA A;  1YJ9 N;  1W2B M;  3VEV A;  4BR5 A;  5LY3 A;  1KC8 O;  3A5M C;  2NNW A;  5JVG L;  5F2R A;  4BRQ A;  1VQM N;  4GVE A;  4YOY A;  2FF6 A;  4DCH A;  3AGR A;  3VEX A;  4BRI A;  5HL7 L;  3ENO A;  4BRM A;  3O80 A;  3QB0 A;  5AQK A;  4BRE A;  5BPL A;  2P9I A;  3RVC A;  2QWO A;  1WUA A;  4CZK A;  1VQ4 N;  3VEY A;  1S22 A;  3OBW A;  4BGB A;  4I6M A;  3BP8 A;  3E9O A;  3A0I X;  3HSC A;  4BR2 A;  3SBT A;  1Z05 A;  3NVK A;  4QS9 A;  1YVN A;  3EE8 A;  4IOA L;  4JEP A;  1SAZ A;  1Q82 O;  1VQN N;  5KPT A;  4YOU A;  1MWK A;  3H1Q A;  1JCE A;  4H0T B;  3G71 N;  3DLL L;  2QWQ A;  5AQY A;  4ISF A;  1HLU A;  3SJH A;  2YI1 A;  4I6M B;  2W00 A;  1ZBS A;  3WXM B;  3IFR A;  4YOX A;  1NGG A;  4HWI A;  3MCA B;  3T7Z A;  3LM2 A;  3ID6 A;  3U8X A;  5HOO A;  3SAG A;  1BO5 O;  3CQY A;  1ATR A;  1YHQ N;  5DM7 L;  4BR7 A;  3M6G A;  5AQZ A;  5JIC A;  2NRT A;  1S72 N;  3MK6 A;  3O9S A;  3E9L A;  5TKW A;  1V4S A;  5M1Q A;  2Q0U A;  4BY9 C;  3UKU A;  3H3O B;  3ZET A;  4BRG A;  3G25 A;  1NBW A;  1NGD A;  2E8A A;  5BR9 A;  2W40 A;  3N4P A;  3WXJ A;  1OKJ A;  2BTF A;  2Q2R A;  4HTL A;  4WQ5 A;  2D4W A;  1HKG A;  5AQH A;  3VGM A;  4FWP A;  4CZE A;  4IOC L;  2YJE A;  4XH5 A;  3UE5 A;  1QHA A;  1XUP O;  2QWR A;  1RDW X;  1GLA G;  3O9R A;  1X9J A;  3QFU A;  4H5V A;  4OPH A;  4AM7 A;  1RGI A;  4C1N I;  2C1G A;  3HBT A;  4DQ8 A;  4IWV A;  4RWT A;  3UKU B;  3ZET B;  3O4W A;  4FVU A;  1KAX A;  3WT0 A;  3JXU A;  5AQR A;  5M1O A;  4E1J A;  1X3M A;  4ISG A;  4WCE L;  2NRV A;  2A40 A;  3ZEU A;  4IEI A;  4OPA A;  1DEJ A;  3KVG A;  4BRO A;  3CME N;  2YHX A;  4JKF A;  3CXC M;  5AQG A;  4JKC A;  3M3Z A;  3ULE A;  2FSN A;  1R59 O;  2GWK A;  1IG8 A;  4U7B A;  3IMX A;  4G9Z A;  1RDU A;  4PKI A;  3EE9 A;  3KHY A;  2QEX N;  1YXQ A;  2CGL A;  2H3G X;  2UYT A;  4JN4 A;  3OBY A;  4BRD A;  4MDA A;  3VPZ A;  3CJ7 A;  3CJB A;  3R1X A;  4FO0 A;  3WXL A;  3ZEU B;  4H0P A;  4UY8 O;  3EKU A;  3UB5 A;  1VQ8 N;  1YIJ N;  1QZ5 A;  4IFE A;  1GLJ O;  1NGC A;  3ULE B;  1ZC6 A;  1NGA A;  1EO1 A;  4A57 A;  5BRH A;  5KQ8 A;  3O1W A;  4GV9 A;  1XC3 A;  4K43 A;  5C12 A;  2A41 A;  4GY2 B;  1E4G T;  5LJW A;  4A59 A;  2QTD A;  3RSE A;  1NGB A;  4AM6 A;  2V7Z A;  2E2P A;  5KPZ A;  4FWK A;  1GLD G;  1Q86 O;  1T3V A;  1JCF A;  2WUS A;  3VEO A;  4H5N A;  4CZG A;  3O1B A;  3FE1 A;  2QWP A;  3VGK A;  4WFN L;  4IO9 L;  1K8K A;  2ZWH A;  5ELZ A;  3P31 A;  2CGJ A;  3VER A;  2AA4 A;  2FSJ A;  1NGF A;  3RSE B;  4WF9 L;  3DJC A;  3ATV A;  3QFP A;  3CCJ N;  4JD2 A;  3LDQ A;  2HST A;  2RHK A;  2W41 A;  3CI5 A;  4XH1 A;  4YOT A;  3N4Q A;  3FGU A;  2DPN A;  4BRK A;  1K8K B;  1IJJ A;  5AQJ A;  1K8A O;  2ZGZ A;  1Y64 A;  4NLC A;  3KZB A;  3VF2 A;  4K41 A;  1VQ5 N;  2VCP A;  4JD2 B;  3MN5 A;  2YHW A;  4KH4 A;  2QXL A;  5AFU A;  2NRH A;  2YJF A;  3HOT A;  4BRF A;  4BEC A;  4BVO A;  2JWK A;  1GLF O;  4F9O A;  2YCH A;  4A61 A;  1NJI O;  2ZF5 O;  2HF3 A;  1J6Z A;  5FPD A;  1Q7Y O;  4JHD B;  3CER A;  4CZH A;  4GV6 A;  4B9Q A;  5M1P A;  3UKR A;  3MN9 A;  2D1K A;  3ATU A;  3CCR N;  4FWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...