1XQSC

Crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
ERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HSPBP1 protein
publication title Regulation of Hsp70 Function by HspBP1; Structural Analysis Reveals an Alternate Mechanism for Hsp70 Nucleotide Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 52
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1xqsC01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1xqsC02
5AZIB 3ENOA 1NGJA 3FFKB 3ID8A 2KHOA 3R8EA 2WUSA 1HPMA 4XH1A 1NGDA 4FOEA 1K8KB 3MN6A 4BC4A 3BEXA 3GG4A 4BR5A 3AARA 5BRFA 1KXPA 4BRHA 3ZX3A 1QHAA 3O1WA 2QWLA 4M7XA 2YHXA 3EZWA 5LY3A 4EFHA 4H0VB 2NLXA 4FWRA 4LC9B 4PL8A 2QXLA 3BF3A 5BPMA 3O1BA 1SAZA 5AQZA 3SMSA 3ULEA 4BRPA 4BRKA 5B8HA 1MA9B 1ZXOA 5FPNA 5AQQA 4IO8A 4F9OA 2P9KB 3VEWA 4IZ9A 3QICA 1CZAN 4QS9A 3ZETA 2FXUA 1QQNA 2E1ZA 3QMLA 1T6CA 4CBUA 4BRLA 2E2PA 3UKUA 3UE5A 1TUUA 3O4WA 4H0XB 3HM8A 4O5FA 3LM2A 5AQKA 4QS7A 3KVGA 3CERA 3EO3A 1Z6RA 1HKBA 4K42A 3EKSA 4DB3A 3QBXA 2YI1A 4FWLA 4DCHA 1V4SA 3D2EB 4BG9A 5AQJA 4GNIA 1YAGA 3QB0A 5AQIA 3VF4A 4BR4A 5KPZA 3BUZB 2QW9A 3I33A 3GBTA 1WOQA 5AZJB 3FZKA 2GUPA 3VEVA 2F9TA 2ASPA 5AQVA 3ZEUA 3HTVA 2ZF5O 5JLFA 3CHWA 2P9NA 3HSCA 3CETA 4PKGA 3QFPA 3IDHA 1HLUA 4HWIA 5EXWA 5LJVA 3G25A 1BG3A 2QWNA 1BUPA 4FWKA 4B1YB 4EIAA 1IJJA 2HF4A 4YDUA 4B1ZA 5BRDA 1IG8A 4MLEA 1NM1A 3O8MA 2BTFA 2P9SB 5BPLA 1NLVA 2E2NA 3WT0A 1XUPO 4BRCA 5AQHA 5AR0A 3CJBA 4FPBA 4M63C 3WUHA 1NGBA 2UYTA 1XC3A 1S22A 1HKGA 2FF6A 2A41A 5E26A 3VF2A 5KQDA 3WXJA 4H5NA 4K25A 1WUAA 1TUYA 5AQPA 3VETA 5BN8A 3FZFA 4XH4A 1JCFA 2QWMA 2F9WA 1JCEA 4BC5A 5FPMA 2D0PA 2V7ZA 4EHUA 5BN9A 1BU6O 1C0GA 5AQRA 4CZMA 3KHYA 2HOEA 1GLBG 3GL1A 4XEIA 3TU5A 1MWMA 3HZ6A 3VOVA 3WXKA 3MK6A 2E1YA 1U2VB 4QS8A 3DXMA 3U4LA 3KZBA 1BA1A 4CZFA 3QFUA 4CJ7A 4A2BA 2CGKA 4K41A 1KAZA 3ULEB 3MN9A 5AFUA 5LJWA 1DGKN 3ATUA 4BR2A 1U2VA 4FWNA 3AY9A 3R9PA 2CH6A 3DJCA 3LM9A 1RDWX 3ZETB 4H0PA 2A6AA 3SJHA 5AQFA 5ADXH 2YJEA 1QZ5A 3JXUA 4ISFA 4NO7A 3IUCA 3UKUB 4CBWA 3FZLA 1G99A 1NWKA 3LDQA 2HMPA 4JAXA 2H3GX 2Q0RA 3MMVA 3QDKA 2IVPA 2D0OA 3A8YA 5FPEA 2BUPA 1R59O 1HJOA 4BC2A 4A62A 3HI0A 4BGBA 1X3NA 2VWBA 2FF3B 4BROA 2Q0UA 3CJ7A 3W3DA 3DAWA 2P9IA 3O6WA 4BRGA 1X3MA 3CJ9A 2QWRA 2A3ZA 3D2FA 1DEJA 3FR0A 3M6GA 2W41A 2J4RA 3W0LA 3ZEUB 1HX1A 5I9EB 2P9NB 2ITMA 3CJ1A 3CIPA 4MO5A 4BG8A 3FGUA 3IMXA 3LDLA 1QZ6A 1HKCA 1NGHA 3H46O 1NBWA 3A5LC 1SQKA 2GWKA 5ADXA 4WQ4C 4JNEA 4NB4A 3VPZA 1D4XA 2GEMA 4WQ5C 3C7NA 4Y0WA 5AQWA 2Q2RA 2QWOA 1KAXA 4A2AA 4H5VA 1NGFA 2IVOA 5FPDA 1ZBSA 3ATVA 4BRAA 5F1XA 4JHDA 3WEEA 3C0BA 2GTDA 2QWPA 3FZMA 5TKYA 3MDQA 3VGLA 2NRHA 2A42A 3BF1A 5AQTA 4HTLA 3ENHA 2FLOA 3L6QA 4DHYA 2FSKA 2P9UA 3WQUA 2ASOA 4BVOA 2A40A 3J8AA 3L4IA 3EL2A 3VERA 3HBTA 4JN4A 3WXIA 1V4TA 3EN9A 3IFRA 4B1WB 4E1JA 3GDQA 2ZWHA 3P4IA 4I6MA 3UKRA 3VENA 4DQ8A 1MDUB 1SZ2A 2DPNA 3U8XA 2YJFA 2ZGYA 1T6DA 3DXMB 2P9LA 3WQTA 2CH5A 1RGIA 5F2RA 2I7PA 1Q18A 3MCPA 4FO0A 4CZKA 1ZC6A 1HUXA 1T44A 2V52B 4AM7A 3A5MC 4GY2B 1QQOA 2QM1A 2V7YA 3DXKA 1C0FA 4CZHA 3ZX2A 3MN7A 4PKIA 1LCUA 3RSEA 4IJAA 3MN5A 4FSVA 2HF3A 3DWLA 2E88A 4BC3A 3TPQA 2AP1A 5KPTA 1GLDG 3H45C 4CZEA 4H0TB 3CJCA 3LL3A 3H3NO 2E8AA 3M1FA 4J8FA 4FWSA 2E2OA 4BQLA 1NGIA 4BR7A 5JICA 3AAPA 3FZHA 2A5XA 5EVZA 1BOTO 1YXQA 4RWTA 4RTFD 4M7YA 2CGLA 3CI5A 1MWKA 4FPAA 3QBWA 5AQGA 3VEXA 4Z94A 2YHWA 2P9IB 4B1UB 4JD2A 2FSNA 4IJNA 3CQXA 4BRNA 2D4WA 3D2FB 5AQSA 4CZIA 2OANA 4EAHD 3O5BA 5AQXA 2IVNA 3CQYA 2EWSA 3FLCO 4BRQA 3LDPA 4CZGA 1TYQA 5EX5A 1U6ZA 1E4FT 5JMVA 4FWPA 4FOIA 5AZIA 3VF6A 1NGEA 3EKUA 3BP8A 4PL7A 1YUWA 3LDOA 1NGGA 4FL9A 4B9QA 5AQNA 1K8KA 3C7NB 5BPNA 2VCPA 2AA4A 5AQOA 5F0XA 4ISGA 4BGAA 5KPRA 3H1QA 4MO4A 5JLHA 4PKHA 2D1KA 4B1XB 1X9JA 5AQLA 4C23A 4JHDB 3WEEB 3ZX0A 3A5NC 4H0OA 4RCHA 2FSJA 2IIRA 4EHTA 3M3ZA 4BRFA 2I7NA 4B1VA 3D7EO 1RFQA 2YCHA 5EY4A 1BO5O 3A0IX 3O80A 4BRDA 1NGAA 5CE3A 2P9KA 2P9UB 4FWMA 3S41A 4BR0A 4H0YB 4A61A 4WQ4A 2E20A 1BDGA 2CGJA 1QQMA 2VYPA 4CD3A 1ESVA 4WQ5A 4O8KA 3VGMA 2P9PB 4MLHA 3AAQA 3B8AX 5AQYA 1GLAG 4I6MB 3UKRB 1GLJO 1P8ZA 5BREA 3F9MA 2E2QA 3U9DA 2P9LB 1JCGA 2Q31A 3VEOA 4BREA 1S3XA 4CI6A 3H6EA 1ATSA 5BRHA 3A5OC 1H1VA 1LOTB 3VEZA 1OKJA 4FWOA 3WXLA 1ATNA 3D2EA 4YDUC 2YHYA 5BR9A 4H03B 4H5WA 2P9PA 4IXCA 4L3QA 3UB5A 3DXKB 4CZJA 2Q36A 2QWQA 1DKGD 2Q97A 5AQUA 5AZJA 3L0QA 2Q1NA 1GLEG 3SLCA 3RSEB 3OHRA 5E84A 3VESA 2ZGZA 5KQ8A 4CD1A 5AQMA 4BRIA 1BA0A 3O08A 1EQYA 3GE1A 5AFUH 3FE1A 4AM6A 4CBXA 3SMPA 3VGKA 4CZLA 4BQZA 4KBOA 4BRMA 1NGCA 5EOYA 3GOIA 3LDNA 5ELZA 1J6ZA 2ASMA 4FWQA 4H5TA 3VEYA 1YVNA 1ATRA 2P9SA 2V51B 3U9ZA 3H1VX 4ISEA 4BVPA 4JD2B 2GELA 1BWFO 4XH5A 3JS6A 1GLLO 2NZTA 3H3OB 4H5RA 4WYBA 3CJAA 1KAYA 1Z05A 3SK3A 1GLFO 1XQSC 2PAVA 2W40A 4IWVA 4BR9A 1GLCG 2PBDA 1NMDA 3R6MA 1E4GT 1TYQB 2GWJA 1Y64A 4K43A 3I8BA
chains in the Genus database with same CATH superfamily
1KVBA 4DQRA 1DTQA 3TARA 3E01A 3HO1A 1P90A 3KWIA 1HPMA 3E9OA 1EWRA 5KRSA 3MN6A 3BEXA 4CF9A 3NH0A 3AARA 3I8DA 4BRHA 3ZX3A 2UXCK 3QEWA 2QWLA 4CEZA 4M7XA 4KREA 3PO5A 4FWRA 3DOLA 1J53A 4DSFA 3L2RA 2QXLA 3HK2A 3K2PA 3CM5A 4DTXA 2YHBA 4ELVA 4OPJA 1L5UA 4DQQA 3VEWA 4JRPA 3CMEN 5D3GA 4CJSA 1CZAN 3U6FA 2O8BA 3ZETA 2FXUA 5JVHL 2O8DA 5JENA 4BRLA 4FVMA 1TUUA 3O4WA 4H0XB 3CC2N 3HM8A 4DSIA 5HRPA 1CLQA 2HSTA 4HUFA 4QS7A 3PX4A 4NXNK 4KHPK 5I42A 2ETJA 3NAEA 1HKBA 1RDAA 3EKSA 4DB3A 4JK7A 3TAMA 3AVHA 3S9HA 3RMBA 1L3SA 3D2EB 4GVEA 3L2WA 1OVQA 2OPRA 3HPGA 2PFUA 5KPZA 2QW9A 1VSHA 4KB0A 1C6VA 4L8RB 2XO7A 4E1NA 2O8EA 2GUIA 1JXBA 4PKGA 1HLUA 4LSLA 5C2FA 4HWIA 5EXWA 1TGOA 4KTWA 4YOTA 3Q7CA 1WSGA 1BUPA 4KHUA 1VSIA 4FJNA 4FLYA 1SUQA 2BTFA 4CHPA 4PHTX 3NHGA 1IKYA 4NCBA 3G10A 3CJBA 4JKFA 1NGBA 1NOZA 1X9MA 4DV7K 1QHTA 4DR3K 4CJ3A 2AJQA 4H5NA 5A2QO 4K25A 3OYFA 3NF8A 1TUYA 5AQPA 5BN8A 4XH4A 3BGRA 2WOMA 2W6KA 4PA1A 2V7ZA 1LW2A 4OLBA 5BN9A 1C0GA 4GV6A 2A1SA 4CZMA 3B6PA 1GLBG 3TU5A 1MWMA 2UU9K 2GV9A 4QS8A 3SV3A 3DXMA 2HNDA 3D6RA 4BWMA 1ILYA 2CGKA 3V1OA 4FLZA 3AVKA 1JJ2M 1KAZA 3SAFA 3ULEB 4EP4A 1TKXA 3T1HK 4R79A 3NVKA 1U2VA 5FRMA 4M41A 4CJQA 4KHQA 3ZT4A 2A6AA 5AQFA 5C15A 4OX9K 3E1YA 5GINA 3BY5A 3THYB 3LDQA 4OKJA 1W2BM 3QDKA 2IVPA 1R59O 3TTDA 3O9SA 1C1BA 4FM2A 4RW6A 3VQAA 2FF3B 2Q0UA 4GVMA 1TK0A 3TTCA 2QI2A 1KQSM 2A3ZA 1DEJA 5IWAK 2A1RA 2W41A 3CMAN 2DTUA 4GV3A 1HX1A 3LANA 5I9EB 3JYTA 4CJPA 3SUPA 1QZ6A 1NGHA 3CCUN 3WXMB 2UXBK 1SQKA 4JNEA 3OBWA 4M3XA 4BE2A 2BDPA 3MEDA 4CESA 1LWFA 3C7NA 5AQWA 3M8PA 1YVUA 3B6OA 3S3MA 4BWJA 3C65A 4F2RA 4CJUA 2PYJA 2IVOA 4LH5A 3EZ5A 5LMNK 3WEEA 2GTDA 3MAQA 4OVLA 4CHOA 4C8MA 2FBXA 3EEQA 5HRNA 4HTLA 2FSKA 2P9UA 3WQUA 2ASOA 4FJMA 4K8XA 1K8AO 3U3GA 4JI0K 3TAFA 4KHNA 1SL2A 4FJ7A 4B1WB 4IKFA 1TL1A 2PYLA 3AGKA 3UKRA 5E41A 3KLIA 1VHXA 3U8XA 5FROA 1N34K 2YJFA 1T6DA 1OVYA 4O4GA 3VQ9A 2NRRA 3LZIA 3OYJA 3TANA 3O9RA 4LD0A 1Q18A 5J2MA 4FLUA 3T7ZA 1IG9A 3NE6A 4FYDA 2V52B 4CEDA 4FJIA 2V7YA 1XWLA 3QO9A 4NXMK 1VRTA 4CZHA 3ZX2A 3SZ2A 4JV5K 1VSJA 2ZM6K 4DTMA 5CR4A 4LF6K 4FSVA 1S1TA 3NF9A 4DV3K 1K73O 2AP1A 4C1NK 1GLDG 3H45C 3AVIA 2HHWA 4R5PA 2G8IA 4AHUA 1M90O 3THXA 3SPZA 2NRTA 2HVIA 2E2OA 1BQMA 4E0DA 3AAPA 4BE0A 2XY5A 5JVGL 3FZHA 3SBGA 1BOTO 1YXQA 4A59A 4DV0K 4RTFD 5HOOA 1MWKA 3QBWA 3QEVA 1FXXA 2EX3A 3VQ7A 3ZSQA 3CFRA 3FFIA 4Z4FA 4BRNA 5AQSA 3OYKA 2KFNA 4JS5A 2OANA 4EAHD 4Z4CA 3T3FA 3OYAA 4KTZA 1KCFA 3PUFA 4LY7A 1BL3A 1QVFM 1E4FT 2QTDA 5JMVA 1CZBA 1VQON 3HJFA 1Q7YO 3EKUA 4PL7A 1DTTA 3A2FA 1C0UA 1NGGA 2Y1JA 5BPNA 5AQOA 1NK6A 1WSFA 4C8LA 1D9DA 2IOCA 3LPTA 5JLHA 4PKHA 4NLBA 4B1XB 1X9JA 4C23A 3OYMA 3OYIA 2IIRA 4DTSA 4E7HA 4BRFA 3P39A 5EY4A 3KLHA 1BO5O 2OZSA 4FWMA 3S41A 4H4OA 4GW6A 2RF2A 2CGJA 4N47A 3PX0A 2HVHA 4LH4A 4CGIA 4DQSA 1YJ9N 1QS4A 1HNIA 4CF8A 3OTOK 4DQIA 2XY8A 5LMUK 1FKOA 5BREA 4JKDA 4M3UA 4KKOA 3OW2M 1Z25A 1NJWA 3H6EA 3AA4A 4PWDA 3A5OC 3WXLA 1ATNA 3D2EA 4YDUC 3CFOA 4IXCA 1R0AA 4L3QA 3UB5A 1WLJA 2Q36A 4FM1A 5GIPA 1DKGD 1HNZK 4Q5VA 3IRXA 3RSEB 4Y1CA 4NYNA 4RW4A 3RMDA 3VESA 3DRSA 2ZGZA 3J80O 4B9SA 5AQMA 1EQYA 4X66K 3GE1A 5AFUH 5CZ2A 3HP9A 1Z26A 1XI1A 1VQLN 4BQZA 1WSHA 4CGFA 1I39A 4WFAL 3CQ8A 3RTVA 2ASMA 3DLRA 3L2UA 4CCHA 3P38A 1YTUA 1J9AA 1YVNA 4PUOA 3K5MA 4AHTA 1Q81O 3H1VX 4ISEA 2HHIA 3V4IA 4IOAL 4FW2A 2ZD1A 4XH5A 3JS6A 1S6QA 3F5TA 3ITHA 4KH6A 4WYBA 4DR2K 4HVJA 3AA3A 3CJAA 1YJWN 4B3OA 1CZ9A 1XQSC 4DF4A 1SS6A 1N33K 4Z0UA 2PBDA 4CVNE 4BDPA 2IAJA 1E4GT 4DQPA 2OTLN 3NBPA 3SQ2A 1VSEA 1NGJA 3C6TA 2KHOA 3R8EA 4CHYA 5DK5A 3IG1A 3J81O 4BC4A 3GG4A 3TSPA 5KRTA 3OJUA 4F3TA 2YHXA 2HW3A 4EFHA 4H0VB 3KTQA 3WNHA 3E9LA 4DFMA 1JLBA 1SAZA 3ULEA 4BRPA 4BRKA 3ZSXA 3HVRA 1TVRA 4E7LA 3AVLA 3KJVA 1MA9B 2HHHK 1JLEA 5FPNA 4YOUA 4F9OA 1BQNA 4IDKA 4IZ9A 2O8FB 3QICA 4IEIA 2YX6A 1QQNA 1VSFA 1BISA 4CBUA 4PQUA 4AH9A 4EP5A 4X62K 3OYEA 4BACA 3THYA 2RKIA 3KLEA 3LM2A 3HPHA 4FK4A 2HNYA 4LF5K 3EO3A 1Z6RA 4ILHA 3LWLA 5K14A 3NMUA 2ZJPL 2G8UA 3CCQN 4LF4K 4BG9A 5AQJA 2G8FA 3AO4A 2X74A 1YAGA 5AQIA 3O4QA 3ZSZA 4N41A 3HT3A 3K59A 3OVNA 1WOQA 1S1WA 2GUPA 3AVGA 2F9TA 5M1OA 5KI6A 2ASPA 5AQVA 4EZ9A 3CHWA 1IBKK 3CETA 1VQ6N 2D0AA 5DM7L 1UWBA 4FK0A 1VRUA 3OY9A 3OYNA 4FJHA 3NGZA 1I94K 2HF4A 1KTQA 4YDUA 4FJ9A 1G15A 4QAGA 5LL6Z 1OH5A 4MLEA 3O8MA 2KLAA 1LWEA 2P9SB 1NLVA 2E2NA 1KVAA 4DTUA 1NNEA 4DTPA 4BRCA 1K6YA 1RTIA 4O8UA 3OA9A 4M63C 1WN7A 1XC3A 4RW7A 4FZXC 5BR8K 1HKGA 5E26A 2G8KA 3WXJA 3TWHA 1RDCA 1CXQA 2QWMA 4CF0A 1JCEA 4OO1J 4J2AA 1LAVA 1YI2N 3KHYA 4CIEA 1IKVA 4XEIA 1JLGA 1B92A 1LWCA 1JL2A 4GKKK 4J2DA 1N8RO 4DV4K 3LALA 1BA1A 2RE2A 1S9GA 4B9VA 4DSJA 4JI8K 2YNFA 3QFUA 1ZBLA 4K41A 4O44A 3MN9A 3QINA 1DGKN 2B5JA 3OJSA 2WC9A 4OPHA 4FWNA 4HUGA 3R9PA 3ZYYX 3JXUA 3WNEA 3IUCA 4PY5A 3UKUB 4CBWA 3VQCA 4E1MA 1G99A 4C8OA 2FBVA 3VN5A 3QIPA 5J2QA 3OYDA 3RR7A 3ZSOA 2Q0RA 4DSLA 4GV9A 2KZZA 4A62A 2P5OA 4YY3K 3V9UA 3HI0A 1X3NA 4BROA 4JK9A 3CJ7A 3DRPA 3K5OA 3BDPA 4BRGA 1HR0K 2F96A 1MU2A 4IO9L 1OH6A 1JLFA 3DOKA 4IFEA 3V9SA 1NKCA 1J54A 4MO5A 1VQ4N 2HHVA 3IMXA 3LDLA 1HKCA 3H46O 4DTRA 3EY1A 4CEQA 2NUBA 3A5LC 1U4BA 3SJJA 1S1UA 4NB4A 1CXUA 3THVA 1D4XA 4B9NA 2Q2RA 1KAXA 3K5LA 3HXMA 1VSDA 4A2AA 2XRIA 1NGFA 2Z1IA 1S1VA 1ZBSA 1SL0A 3V1RA 1ASVA 3ATVA 3VQBA 4BRAA 1J5OA 1U48A 4DTOA 2D0CA 2WFBA 5C24A 1T3VA 3MDQA 5TKYA 4BE1A 3VGLA 4CGGA 2A42A 5TKWA 3P5JA 1BCOA 4DHYA 4BVOA 4E7IA 1O1WA 3L4IA 3PIOL 3VERA 1V4TA 1FW6A 3QETA 4QOZB 3IFRA 3KK2A 3CCJN 2ZWHA 3P4IA 3K58A 1RT4A 3S5TA 1SZ2A 1SKSA 4K8ZA 3SQ0A 1BIZA 3KD5E 4MDAA 3MEEA 1NJIO 3T69A 3WQTA 4KHSA 2QK9A 4B9LA 5F2RA 3MCPA 4CZKA 1ZC6A 1BIUA 2HHUA 4AM7A 3A5MC 3IKMA 4CHNA 1C0FA 3RSEA 3I55N 2HF3A 4BC3A 4JKBA 2NRVA 5J2NA 4KRFA 4CZEA 2BGGA 3LL3A 2E8AA 4W5QA 1NGIA 5M1QA 3T1AA 1HPZA 1WB9A 5JICA 2KTQA 2HMIA 4FPAA 4NCGA 3DLKA 3VEXA 5HP1A 2P9IB 4B1UB 3NF6A 4C8KA 3IAYA 1BGXT 1D5AA 2DFFA 4IJNA 2XY7A 1L3UA 2D4WA 5HROA 1IKXA 4NCAA 1VK0A 1HYSA 4BY9C 3ASMA 3TI0A 4BRQA 2QA4N 3HVTA 4IEEA 1U6ZA 4CFCA 4FWPA 4DTNA 3V9XA 3VF6A 3I56N 5HRRA 2IGIA 1NGEA 3ZSWA 4DV2K 5DMRA 1YUWA 3LDOA 1X9SA 4B9QA 4DLEA 4CEAA 2QXFA 1SKWA 2AA4A 4HUEA 3H1QA 1VSMA 4A57A 2D1KA 4IG3A 3V6DA 5AQLA 4EHTA 4KPYA 2FSJA 2I7NA 1NJYA 5KGXA 4CJRA 1WAJA 3AVCA 1EX4A 4A5AA 1JLQA 5CHIA 4DKWA 1NGAA 3CFPA 2P51A 3VMFB 4W5OA 4AHRA 3O3HA 4G9ZA 3NF7A 1X1PA 2O8FA 5DM6L 5GADP 4YOYA 2OPPA 2RPIA 4RW9A 4CD3A 3VGMA 2P9PB 1DLOA 4I6MB 1GLJO 4FLWA 3QIOA 3OYBA 2Q31A 4I2QA 2OCEA 2VWKA 3L2VA 1KLNA 1K9MO 5BRHA 3SV4A 2ZJRL 1OKJA 4FWOA 5CY4A 3DLEA 1IV0A 3CPWM 4DR5K 3HYFA 2VG6A 4JI6K 4HCCA 3NVMA 4NYFA 2Q97A 3L0QA 2HBLA 2HNZA 2C1IA 1YIJN 5KQ8A 4IOCL 2X78A 5KGWA 1BA0A 3KK3A 3LP0A 4CEOA 3FE1A 4AM6A 1FJGK 4CZLA 4O0JA 3ZT1A 2VWJA 3TAPA 4BRMA 1NGCA 5EOYA 1KLMA 4W5TA 4CJLA 3ALYA 3ZLJA 3AGRA 1SV5A 2P9SA 3ZSVA 5CYQA 1NK5A 4JD2B 2GELA 1BI4A 1BWFO 1T03A 4B3MK 4DMNA 2NZTA 3C94A 1J5EK 2O4GA 3MXMA 1KAYA 3NH2A 2VG7A 5IT9O 3SQ4A 3SK3A 2FC0A 3BZKA 1TYQB 3ZT2A 4AHVA 4DU4A 3I8BA 4ZTJA 5AZIB 3ZCMA 2VGNA 5EU7A 1VQKN 2B4JA 2B6AA 2WUSA 4XH1A 1S9EA 4CJ4A 1NGDA 4FOEA 4CEBA 4BR5A 3KD1E 1KXPA 3QLHA 4WE1A 3EZWA 4CK1A 1XHZA 4AILC 4LC9B 4PL8A 5FDLA 3U3YA 4JI5K 4DFPA 5BPMA 1RNHA 3O1BA 3BZCA 3O9UA 5B8HA 2VQFK 1IBLK 1ZXOA 3TAEA 2P9KB 2G8VA 1SKRA 3N4PA 1RBTA 4CFBA 2E1ZA 1NJXA 2E2PA 3UKUA 1UA1A 3UE5A 4DV5K 3ZT3A 4DUYK 3K9JA 4IBNA 3SUOA 4MFBA 3K57A 4A5BA 2O8EB 3LWMA 5JS2A 4DV6K 3QBXA 2YI1A 4FWLA 4YOVA 4JI4K 3AO3A 1V4SA 4FLXA 3MXIA 4Z4EA 2YNHA 3P1GA 4M3YA 3VF4A 3I33A 3GBTA 2HBKA 3FZKA 4KHYA 4O5BA 4CJKA 3HTVA 2JWKA 2GBZA 1TK8A 1BHLA 3IDHA 5M1NA 5GIOA 3RRGA 2IC3A 1WSJA 1RT5A 3G25A 1BG3A 2UUBK 4DR4K 5GAGP 5I3UA 1FKPA 3THWB 3TABA 3DI6A 2KQ2A 4B1YB 4EIAA 1IJJA 4B1ZA 3TR8A 3CC4N 3MECA 3CCMN 2DFEA 4HHTA 4BEBA 1ITGA 5BPLA 1N32K 3SUNA 1XUPO 4FCYA 4YOWA 1HNXK 3WUHA 1RCHA 3PY8A 2R7YA 2KFZA 1S22A 2F4VK 5KQDA 2A41A 4JK8A 2P1JA 4IFVA 1WUAA 3TTFA 2OTJN 3VETA 1EO1A 3FZFA 1TV6A 1ZBFA 4JLHA 2F9WA 1C0MA 2D0PA 2NRZA 5FPMA 4EHUA 5AQRA 1SL1A 3LPUA 4J2BA 3L3VA 4M45A 3GL1A 3KK1A 3VA3A 3OBYA 3HZ6A 3WXKA 3OS2A 4KI6A 4DS4A 1FK9A 1U2VB 3D0PA 3SUQA 1DT9A 4LFBK 3C6AA 3KZBA 2W00A 4Z4IA 5FLXO 4CZFA 4CJ7A 4A2BA 1N6QA 1B9DA 3MCAB 5AFUA 1HMVA 1TKTA 4BR2A 4E7KA 1RTDA 3T1YK 4JKCA 4DUZK 1RDDA 3LM9A 3I0RA 4E72A 1GOAA 2ZE2A 3F2KA 4AF1A 2YJEA 3DLGA 4ISFA 3AVFA 4DU3A 1X9WA 3Q7BA 3FZLA 4K0KK 3QEPA 3R3LA 3RWUA 4JAXA 4JKEA 2H3GX 3MMVA 3PX6A 2D0OA 3A8YA 3LP3A 5C42A 2BUPA 4BC2A 1HJOA 4E19A 4ZTFA 2G8WA 3KKRA 5M1FA 2OPQA 1QSLA 4FJJA 4ELTA 3DAWA 2P9IA 3O6WA 3CJ9A 3P83D 4OPKA 3S3OA 4M3RA 3FR0A 4FJGA 2F8SA 3M6GA 3EE9A 1TL3A 2FBYA 1VQ9N 3W0LA 4F4KA 3ZEUB 3CXCM 2P9NB 2QKBA 4BE7B 1NU0A 4CGJA 1OH8A 3FGUA 1REVA 3L2QA 1Q82O 4CIGA 4M3WA 4KH4A 2F7TA 3K0SA 2RHKA 2YNGA 3L4QA 3PV8A 3AVJA 2F8TA 3VPZA 3K9KA 1EP4A 4LFCK 2GEMA 1RBSA 4WQ5C 3O9QA 3TAGA 4WFBL 1QVGM 3TAQA 4KAZA 4QCLA 2E5LK 1M1KO 2BE2A 4DR1K 2O4IA 3C0BA 5M1KA 4UQGA 2QWPA 3FZMA 1WAFA 5AQTA 1EXQA 3RMCA 2FLOA 4FW1A 2OPSA 1Q9XA 1GOBA 2ZJQL 2GX9A 4MDBA 1NK4A 3SQ1A 3J8AA 4CK3A 1WBBA 1YHQN 3HBTA 4AHSA 1A5VA 3AV9A 4DV1K 3EN9A 1T8EA 2IS3A 3CCLN 4I6MA 4DQ8A 3VENA 4JI2K 4XIUA 1NKBA 2ZGYA 3MX2A 2CH5A 3G71N 4CHQA 3NH1A 1RGIA 1Q86O 2I7PA 4FO0A 1T44A 3THXB 4B3SK 2YHAA 4GY2B 2HB5A 1S72N 1LV5A 1LCUA 5FRNA 1XHXA 3MN5A 2O8CB 3DWLA 2E88A 4BDZA 1NMNA 5KPTA 2HHXA 3HM9A 4H0TB 4FJ8A 3CJCA 3H3NO 5J2PA 3M1FA 4J8FA 4FWSA 1JKHA 4BR7A 4BECA 4E89A 1HYZA 3MX5A 3O9TA 2QKKA 2A5XA 5EVZA 3PLAA 3JSMA 3CI5A 1QSSA 5AQGA 4Z94A 2YHWA 4Z4GA 5C2DA 4JD2A 4CJ5A 4GKJK 4G1QA 3D2FB 3IS9A 1ZBHA 3J7ZO 3AVNA 4CZIA 3DYAA 3M5RA 3NFAA 3O5BA 5AQXA 2IVNA 3CQYA 4LF8K 2E6MA 4YHHK 4DFJA 2PY5A 1TYQA 5CZ1A 5AZIA 1VQ5N 3SNNA 3RRHA 3BP8A 1QSYA 1LAWA 4DTJA 1KC8O 1B9FA 4WFNL 1ZBUA 2VCPA 4ISGA 4H4MA 1WBDA 5C25A 4MO4A 2D5RA 3D45A 4JHDB 2KZMA 3ZX0A 3A5NC 4IOXA 3EYZA 1NK0A 1UA0A 1VQMN 2YCHA 3VA0A 3A0IX 4BRDA 1C1AA 5CE3A 3L8BA 2P9KA 4C8NA 2C1GA 4H0YB 4CGDA 4CW7B 3SCXA 1BDGA 1ESVA 4WQ5A 3CPEA 4CEEA 5HL7L 4MLHA 3HOTA 2IDOA 3B8AX 1GLAG 3CYGA 4FLVA 3VQEA 3F9MA 4B3RK 2P9LB 1JCGA 3V81A 3VEOA 2PZSA 4CI6A 1ATSA 3E9PA 1H1VA 3VEZA 3CYMA 3AO2A 3ISNC 3DLHA 3N4QA 4H5WA 4YFUA 2XY6A 3DXKB 1RTJA 4CZJA 1JL1A 4OPAA 2QEXN 3QNOA 1GLEG 4YORA 1VSKA 3SI6A 1TK5A 5E84A 4YNQA 4FZYA 4BRIA 3VGKA 3SYZA 4N5SA 5HLFA 5T7BA 3NCIA 4LF7K 4N76A 4KBOA 2NRWA 3THWA 1W97L 3GOIA 2X6NA 3LDNA 5ELZA 4KTQA 3UIQA 4FWQA 4H5TA 3VEYA 1RDUA 1ATRA 4C1NI 3O4NA 3U9ZA 4ID1A 5GAHP 1HQEA 4BVPA 4M3ZA 3ZT0A 1GLLO 4H5RA 1C0TA 3KWGA 2UUCK 1Z05A 4U7BA 1D8YA 1ZBIA 4IWVA 1GLCG 4RG8A 1NMDA 1NKEA 1Y64A 1HYVA 1S6PA 3ENOA 3TSUA 2HHSA 2VGMA 1YT3A 3FFKB 3ID8A 4Q0BA 1K8KB 4I2PA 1KRPA 4CJEA 1QE1A 5BRFA 3MEGA 1W9HA 3QEXA 1XMQK 1QHAA 3O1WA 3CG7A 4DU1A 5LY3A 1C1CA 4CJTA 2NLXA 4LSNA 4CGHA 3MXJA 1Q9YA 3AA5X 3BF3A 4CF1A 4E3SA 4TSXA 4J2EA 5AQZA 3SMSA 1HRHA 5AQQA 3AO5A 2X6SA 4IO8A 4CFDA 3LP2A 4OGEA 3KLGA 4B9TA 4GMJB 4JKHA 2LSNA 4QS9A 4CJWA 3QMLA 1T6CA 1N36K 1KSPA 1RT2A 4ELUA 4O5FA 4JS4A 5AQKA 3KVGA 3CERA 3PSFA 4X64K 4K42A 5SWMA 1VQ8N 1N5YA 1O13A 1S5JA 4DCHA 4KB1A 3LZJA 3QNNA 4FZZA 4CFAA 1TKZA 3V9ZA 4F2SA 4GNIA 3QB0A 4BR4A 5H1SQ 3O3GA 3BUZB 3QEIA 5AZJB 4B9UA 3DLBA 3NDKA 3VEVA 4CJVA 3R1XA 3CF5L 5JLFA 3ZEUA 2VG5A 2ZF5O 2P9NA 4ZHRA 3HSCA 1IO2A 3QFPA 3PSIA 1RT1A 5LJVA 3HL8A 2QWNA 2UUAK 4CIFA 4FWKA 3MWTA 1I3AA 4CF2A 5BRDA 4UY8O 1IG8A 1EETA 4IG0A 1NM1A 3J7YP 1W7AA 3VTIA 4DS5A 2P5GA 3WT0A 1YJNN 1XC9A 3VQDA 5KTQA 5AR0A 5CYMA 1HJRA 5AQHA 4FPBA 3VQ5A 2UXDK 2UYTA 4FVUA 3NGYA 3OS1A 3ENBA 2FF6A 3VF2A 3VQ6A 3CCEN 4OJRA 4OKKA 1QQCA 3C95A 4O0IA 3HP6A 1JCFA 4IDHA 4JKGB 4BC5A 3RR8A 1U49A 1BU6O 1VAZA 3PIPL 4FXDA 4JI7K 4F3OA 2HOEA 1E3MA 1NK8A 3VOVA 3MK6A 1T7PA 2E1YA 4CECA 2NRXA 1D9FA 3U4LA 4W5RA 1HQUA 2OYQA 4HCBA 3HSTB 4KV8A 5HBMA 2XHBA 1NOYA 1JXEA 1F21A 4W5NA 2KKZA 1RDBA 3G0ZA 2YV0X 5LJWA 5MLCQ 1LW0A 3LP1A 3SBTA 3ATUA 4DR7K 1ZYQA 2JWLA 4CJFA 4DSKA 4DG1A 2DFHA 3KKSA 3DRRA 2O8CA 3AY9A 3S3NA 2CH6A 3DJCA 3ZETB 1RDWX 4JRQA 2O8BB 4H0PA 1QTMA 3SJHA 4LFAK 5ADXH 2O8DB 1QZ5A 4NO7A 4Y1DA 3EE8A 4Z4HA 1NWKA 2HMPA 1RT3A 4M3TA 3CC7N 2ZQBA 5FPEA 4FJ5A 1IH7A 2FBTA 4BGBA 3AVMA 2VWBA 3OS0A 4B8CA 3AA2A 3W3DA 4EZ6A 1X3MA 2HBMA 2QWRA 4FM0A 3D2FA 3VQ8A 2J4RA 1VQPN 1T05A 2ITMA 3CJ1A 3CIPA 4BG8A 2WBNA 2W6LA 1NBWA 3PO4A 2GWKA 3VTHA 5ADXA 4YOXA 4WQ4C 3RVCA 1JLAA 1A5XA 4Y0WA 3AVBA 3P31A 3C6UA 2QWOA 3M8SA 3MWPA 3JAMO 4H5VA 5FPDA 5F1XA 4JHDA 1Y97A 3L3UA 1NG9A 4FLTA 3LAMA 4IFYA 1W0HA 2D0BA 2NRHA 5J1EA 4DSEA 3BF1A 4KHWA 4KI4A 3ENHA 1KD1O 2ATQA 3L6QA 3M8RA 4CEFA 4FJLA 2DY4A 4ILGB 2A40A 3DM2A 3EL2A 4JN4A 3WXIA 3C6HA 2OZMA 3H08A 1YITN 3LAKA 4E1JA 3GDQA 1U45A 2E6LA 1MDUB 1VSLA 2DPNA 2YKNA 4DLGA 3DXMB 1NK7A 2P9LA 1YTAA 4DR6K 1L3TA 4CE9A 4DFKA 4I9LA 5SZTA 2HHTA 4DWIA 1HUXA 4KFBA 3CD6N 4ILJA 3OYGA 1QQOA 2QM1A 1HNVA 4ID5A 4JYAK 3DXKA 3MN7A 1IKWA 3F73A 3KK7A 4PKIA 3J7AP 4IJAA 4OGCA 1XNQK 3TPQA 3T19A 3SAHA 4CHZA 1XMOK 3VQPA 3G4SN 1RT7A 2YKMA 3HPOA 3VQ4A 4BQLA 2W42A 3VQQA 1WSEA 4E7JA 4M42A 2HBJA 4BDYA 5GAEP 4RWTA 5C12A 4M7YA 4RW8A 2CGLA 4B3TK 1RTHA 3V1QA 1VQ7N 1GOCA 2WTUA 2FSNA 3CQXA 1RILA 4B9MA 5AJ3K 1ASUA 3KLFA 2EWSA 2KW4A 3FLCO 1YF5L 3LDPA 4CZGA 2NNWA 2BANA 5EX5A 4I9QA 3WNFA 3LDSA 4B8AB 4FOIA 2Q3SA 4OLAA 4NLCA 1KFSA 2Z1GA 2VQEK 4FL9A 1TAUA 5AQNA 1K8KA 3TSQA 3C7NB 5F0XA 4U67L 3OYLA 4BGAA 1BCMA 3V9WA 1NJZA 5KPRA 3G6EN 4WCEL 1OH7A 5M1PA 3QERA 3WEEB 4H0OA 4RCHA 2WONA 3M3ZA 4JKAA 4B1VA 3D7EO 1L3VA 1KFDA 1RFQA 2I5JA 3O80A 2YNIA 2OA8A 2P9UB 3CCSN 1NK9A 1Q8IA 1U47A 4BR0A 4I7FA 4A61A 1S1XA 4WQ4A 2E20A 3SPYA 1QQMA 2Z1JA 1HNWK 1VQNN 2VYPA 4O8KA 3DMJA 2G8HA 1U04A 3AAQA 1UAXA 5AQYA 4KO0A 3UKRB 1P8ZA 3F9KA 2E2QA 3U9DA 4JI1K 4CERA 1WNSA 2E4LA 2ITGA 1EKEA 3CM6A 4BREA 1S3XA 3OYHA 1LOTB 4MQ3A 1TKDA 2Y1IA 1A5WA 2YHYA 5BR9A 4H03B 4XJXA 4DF8A 3CCRN 2P9PA 3AO1A 3ID6A 4HTUA 2JLEA 2QWQA 4CK2A 5AQUA 5AZJA 2Q1NA 3SLCA 4AQYK 3ZSYA 3OHRA 3HOSA 3ULDA 3AVAA 2Z1HA 2JGUA 3SAGA 4LF9K 4CD1A 4O55A 1TAQA 1RBVA 4B08A 3O08A 1XNRK 3M8QA 4ICLA 5C10A 1IBMK 3O3FA 4CBXA 4KH5A 4N56A 1BI4B 1EWQA 3SMPA 2RN2A 3RMAA 4JEPA 4FK2A 4WF9L 1RT6A 5JS1A 3ZSRA 3CCVN 3DLLL 1UOCA 1J6ZA 3HRGA 2HHQA 1RBUA 4F8RA 5HRSA 3KIOA 3OYCA 2V51B 4X65K 3WNGA 4FJKA 3K5NA 1RBRA 1WSIA 1JLCA 3H3OB 2EHGA 3E66A 4AHCA 1KVCA 4JI3K 3I0SA 1ASWA 4OKEA 2BH1A 1GLFO 4V19S 2PAVA 2W40A 4BR9A 3NGIA 3R6MA 4FJXA 2GWJA 4H8KA 3QESA 4K43A 4JKGA 5C0YA
chains in the Genus database with same CATH topology
5AZIB 3ENOA 3TSUA 2VGNA 1VQKN 2VGMA 1NGJA 1P90A 3FFKB 3ID8A 2KHOA 3KWIA 3R8EA 2WUSA 1HPMA 3E9OA 4XH1A 1NGDA 4FOEA 1K8KB 3MN6A 4BC4A 3BEXA 3GG4A 3TSPA 4BR5A 3AARA 5BRFA 1KXPA 4BRHA 3ZX3A 1QHAA 3O1WA 2QWLA 4M7XA 2YHXA 3EZWA 5LY3A 4EFHA 4H0VB 2NLXA 4FWRA 4LC9B 4PL8A 2QXLA 3BF3A 3E9LA 5BPMA 3O1BA 1SAZA 5AQZA 3O9UA 3SMSA 3ULEA 4BRPA 4BRKA 5B8HA 1MA9B 1ZXOA 5FPNA 4YOUA 5AQQA 4IO8A 4F9OA 2P9KB 3VEWA 3CMEN 3N4PA 4IZ9A 3QICA 4IEIA 4JKHA 1CZAN 4QS9A 3ZETA 2YX6A 2FXUA 1QQNA 5JVHL 2E1ZA 3QMLA 1T6CA 4CBUA 4BRLA 2E2PA 3UKUA 3UE5A 1TUUA 3O4WA 4H0XB 3CC2N 3HM8A 4O5FA 2HSTA 3K9JA 3LM2A 5AQKA 4QS7A 3KVGA 4A5BA 3CERA 3EO3A 1Z6RA 1HKBA 4K42A 3EKSA 4DB3A 1VQ8N 4JK7A 4ILHA 3QBXA 1O13A 2YI1A 3NMUA 4FWLA 2ZJPL 4DCHA 4YOVA 1V4SA 3D2EB 3CCQN 4BG9A 5AQJA 4GVEA 4GNIA 2PFUA 1YAGA 3QB0A 5AQIA 3VF4A 4BR4A 5KPZA 5H1SQ 3BUZB 2QW9A 3I33A 3GBTA 1WOQA 2HBKA 3FZKA 5AZJB 2GUPA 3VEVA 2F9TA 3R1XA 5M1OA 3CF5L 2ASPA 5AQVA 3ZEUA 3HTVA 2ZF5O 5JLFA 3CHWA 2P9NA 2JWKA 3HSCA 3CETA 4PKGA 3QFPA 1VQ6N 3IDHA 1HLUA 5M1NA 5GIOA 5C2FA 4HWIA 5EXWA 5LJVA 5DM7L 4YOTA 3G25A 3Q7CA 1BG3A 2QWNA 1BUPA 4FWKA 3MWTA 5GAGP 4B1YB 4EIAA 1IJJA 2HF4A 4YDUA 4B1ZA 5BRDA 4UY8O 1IG8A 3CC4N 3CCMN 4MLEA 1NM1A 3O8MA 2BTFA 2KLAA 4BEBA 2P9SB 4PHTX 3VTIA 5BPLA 1NLVA 2E2NA 3WT0A 1YJNN 1XUPO 4BRCA 5AQHA 5AR0A 4O8UA 3CJBA 3OA9A 4FPBA 4JKFA 4M63C 3WUHA 1NGBA 2UYTA 4YOWA 4FVUA 1XC3A 1S22A 3ENBA 1HKGA 2FF6A 2A41A 4JK8A 5E26A 3VF2A 5KQDA 3WXJA 4H5NA 4K25A 3CCEN 1WUAA 3TTFA 1TUYA 2OTJN 5AQPA 3VETA 5BN8A 1EO1A 3FZFA 4XH4A 1JCFA 2QWMA 4IDHA 2F9WA 1JCEA 4JKGB 5FPMA 2D0PA 2NRZA 2V7ZA 4BC5A 4EHUA 4OO1J 5BN9A 1YI2N 1BU6O 1C0GA 1VAZA 4GV6A 5AQRA 3PIPL 4CZMA 3KHYA 2HOEA 1GLBG 3GL1A 4XEIA 3TU5A 1MWMA 3OBYA 3HZ6A 3VOVA 3WXKA 3MK6A 2E1YA 1U2VB 1DT9A 2NRXA 4QS8A 3DXMA 3U4LA 3D6RA 3C6AA 3KZBA 1N8RO 2W00A 1BA1A 2RE2A 4CZFA 1ILYA 3QFUA 4CJ7A 4A2BA 2CGKA 3MCAB 4K41A 1KAZA 3SAFA 3ULEB 1JJ2M 2KKZA 3MN9A 5AFUA 5LJWA 5MLCQ 3SBTA 1DGKN 3ATUA 2JWLA 4BR2A 4R79A 3NVKA 1U2VA 2WC9A 4JKCA 4OPHA 4FWNA 3AY9A 3R9PA 2CH6A 3DJCA 3LM9A 1RDWX 3ZETB 3ZYYX 4H0PA 2A6AA 3F2KA 5AQFA 3SJHA 2YJEA 1QZ5A 3JXUA 4ISFA 4AF1A 5ADXH 4NO7A 3IUCA 5C15A 3E1YA 3EE8A 3Q7BA 3UKUB 3FZLA 4CBWA 5GINA 1G99A 3R3LA 1NWKA 3LDQA 2HMPA 4JAXA 4JKEA 2H3GX 1W2BM 2Q0RA 3MMVA 3QDKA 2IVPA 2D0OA 3A8YA 5FPEA 3CC7N 2BUPA 1R59O 1HJOA 3TTDA 4BC2A 4GV9A 4A62A 3O9SA 5M1FA 3HI0A 4BGBA 1X3NA 2VWBA 2FF3B 4BROA 4JK9A 2Q0UA 3CJ7A 3TTCA 3W3DA 3DAWA 2P9IA 2QI2A 3O6WA 1X3MA 3CJ9A 4BRGA 1KQSM 2HBMA 2QWRA 2A3ZA 3D2FA 1DEJA 3FR0A 3M6GA 3EE9A 2W41A 4IO9L 3CMAN 2J4RA 1VQPN 3W0LA 1VQ9N 4IFEA 4GV3A 3ZEUB 1HX1A 5I9EB 3CXCM 2P9NB 2ITMA 4BE7B 3CJ1A 3CIPA 4MO5A 4BG8A 2WBNA 1VQ4N 3FGUA 3IMXA 3LDLA 1QZ6A 1HKCA 1NGHA 1Q82O 3H46O 3CCUN 3WXMB 1NBWA 4KH4A 2F7TA 3A5LC 1SQKA 2RHKA 2GWKA 3L4QA 3VTHA 5ADXA 4YOXA 4WQ4C 4JNEA 4NB4A 3RVCA 3VPZA 3OBWA 3K9KA 1D4XA 2GEMA 4WQ5C 3C7NA 4Y0WA 3P31A 5AQWA 3O9QA 2Q2RA 2QWOA 1KAXA 4WFBL 1QVGM 4A2AA 3C65A 3MWPA 4H5VA 1NGFA 2IVOA 5FPDA 1M1KO 1ZBSA 3ATVA 4BRAA 5F1XA 4JHDA 3WEEA 3C0BA 5M1KA 2GTDA 2QWPA 2WFBA 3FZMA 1T3VA 3MDQA 5TKYA 3VGLA 2NRHA 2A42A 3BF1A 5TKWA 5AQTA 4HTLA 3ENHA 1KD1O 2FLOA 3L6QA 4DHYA 2ZJQL 2FSKA 2GX9A 2P9UA 2ASOA 3WQUA 4MDBA 4BVOA 4ILGB 2A40A 1K8AO 3J8AA 3L4IA 3EL2A 3PIOL 3VERA 3HBTA 4JN4A 3WXIA 1V4TA 3C6HA 1YHQN 3EN9A 3IFRA 4B1WB 1YITN 4E1JA 3GDQA 2ZWHA 3AGKA 3P4IA 4I6MA 3UKRA 3VENA 4DQ8A 3CCJN 1MDUB 3CCLN 1SZ2A 2DPNA 3U8XA 2YJFA 2ZGYA 1T6DA 1OVYA 2P9LA 3DXMB 3MX2A 4MDAA 2CH5A 3T69A 3WQTA 3G71N 2NRRA 1Q86O 1RGIA 3O9RA 5F2RA 2I7PA 1Q18A 3MCPA 4FO0A 4CZKA 3T7ZA 1ZC6A 1HUXA 3CD6N 1T44A 2V52B 4AM7A 3A5MC 4ILJA 3IKMA 4GY2B 1QQOA 2QM1A 2V7YA 3DXKA 1C0FA 4CZHA 1S72N 3ZX2A 3MN7A 3KK7A 4PKIA 1LCUA 5CR4A 3RSEA 3I55N 4IJAA 3MN5A 4FSVA 2HF3A 3DWLA 2E88A 4BC3A 3TPQA 3SAHA 1K73O 4JKBA 2NRVA 2AP1A 5KPTA 4C1NK 1GLDG 3H45C 4CZEA 4H0TB 3CJCA 3LL3A 3H3NO 1M90O 3G4SN 2E8AA 2NRTA 3M1FA 4J8FA 4FWSA 2E2OA 4BQLA 1NGIA 5M1QA 4BR7A 4BECA 2HBJA 3MX5A 5JICA 3AAPA 3O9TA 5JVGL 5GAEP 3FZHA 2A5XA 5EVZA 3SBGA 1BOTO 1YXQA 4A59A 5C12A 4RTFD 4M7YA 4RWTA 3PLAA 2CGLA 3CI5A 5HOOA 1MWKA 4FPAA 3QBWA 5AQGA 3VEXA 4Z94A 2YHWA 2P9IB 1VQ7N 4B1UB 5C2DA 4JD2A 2FSNA 4IJNA 3CQXA 4BRNA 2D4WA 3D2FB 5AQSA 3J7ZO 4CZIA 3M5RA 4BY9C 2OANA 4EAHD 3O5BA 5AQXA 2IVNA 3CQYA 2EWSA 3FLCO 4BRQA 1YF5L 3LDPA 4CZGA 2NNWA 2QA4N 4IEEA 1QVFM 1TYQA 5EX5A 1U6ZA 1E4FT 2QTDA 5JMVA 4FWPA 4FOIA 5AZIA 1VQ5N 4NLCA 1VQON 3VF6A 3I56N 1NGEA 1Q7YO 3EKUA 3BP8A 4PL7A 1YUWA 3LDOA 1NGGA 4FL9A 4B9QA 1KC8O 5AQNA 1K8KA 3TSQA 4WFNL 3C7NB 5BPNA 2VCPA 2AA4A 5AQOA 4U67L 4ISGA 5F0XA 4BGAA 5KPRA 3H1QA 4MO4A 3G6EN 5JLHA 4PKHA 4A57A 4NLBA 2D1KA 4WCEL 4B1XB 1X9JA 5AQLA 5M1PA 4C23A 4JHDB 3WEEB 3ZX0A 3A5NC 4H0OA 4IOXA 2FSJA 2IIRA 4RCHA 3M3ZA 4JKAA 4EHTA 4BRFA 2I7NA 4B1VA 1VQMN 3D7EO 1RFQA 3P39A 2YCHA 4A5AA 5EY4A 1BO5O 3A0IX 3O80A 4BRDA 5CHIA 4DKWA 1NGAA 5CE3A 2P9KA 2P9UB 3VMFB 4FWMA 3S41A 3CCSN 4G9ZA 4BR0A 2C1GA 4H0YB 4A61A 5DM6L 4WQ4A 2E20A 5GADP 1BDGA 2CGJA 1QQMA 4YOYA 1VQNN 2VYPA 4CD3A 1ESVA 4WQ5A 3CPEA 4O8KA 1YJ9N 3VGMA 2P9PB 4MLHA 5HL7L 3HOTA 3AAQA 3B8AX 5AQYA 1GLAG 4I6MB 3UKRB 1GLJO 1P8ZA 5BREA 3F9MA 4JKDA 2E2QA 3OW2M 3U9DA 2P9LB 1JCGA 2Q31A 3VEOA 4BREA 1S3XA 4CI6A 3H6EA 1ATSA 1K9MO 5BRHA 3E9PA 3A5OC 1H1VA 1LOTB 3VEZA 1OKJA 4FWOA 3WXLA 2ZJRL 1ATNA 3D2EA 4YDUC 4XJXA 2YHYA 5BR9A 3N4QA 4H03B 4H5WA 3CCRN 2P9PA 4IXCA 3CPWM 3ID6A 4L3QA 3UB5A 3DXKB 4CZJA 2Q36A 3NVMA 2QWQA 1DKGD 5GIPA 2Q97A 4OPAA 5AQUA 5AZJA 2QEXN 3L0QA 2Q1NA 2HBLA 1GLEG 3SLCA 4YORA 3RSEB 3OHRA 3HOSA 2C1IA 5E84A 3VESA 1YIJN 3SAGA 2ZGZA 5KQ8A 4CD1A 5AQMA 4BRIA 4IOCL 1BA0A 3O08A 1EQYA 5C10A 3GE1A 5AFUH 3FE1A 4KH5A 4AM6A 4CBXA 3SMPA 3VGKA 4CZLA 4JEPA 1VQLN 4BQZA 4WF9L 1NJIO 4KBOA 4BRMA 1NGCA 5EOYA 2NRWA 4WFAL 3CCVN 1W97L 3GOIA 3DLLL 3LDNA 5ELZA 1J6ZA 2ASMA 3HRGA 4FWQA 4H5TA 3P38A 3VEYA 1RDUA 1YVNA 3AGRA 1ATRA 4C1NI 2P9SA 2V51B 3U9ZA 3H1VX 5GAHP 1Q81O 4ISEA 4BVPA 4IOAL 4JD2B 2GELA 1BWFO 4XH5A 3JS6A 1GLLO 2NZTA 3E66A 3F5TA 3H3OB 4KH6A 4H5RA 4WYBA 3CJAA 1YJWN 1KAYA 3KWGA 2BH1A 1Z05A 3SK3A 1GLFO 1XQSC 4U7BA 2PAVA 1SS6A 2W40A 4IWVA 4BR9A 1GLCG 2PBDA 1NMDA 3R6MA 1E4GT 1TYQB 2GWJA 2OTLN 1Y64A 4K43A 4JKGA 3I8BA 5C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AZI B;  3ENO A;  1NGJ A;  3FFK B;  3ID8 A;  2KHO A;  3R8E A;  2WUS A;  1HPM A;  4XH1 A;  1NGD A;  4FOE A;  1K8K B;  3MN6 A;  4BC4 A;  3BEX A;  3GG4 A;  4BR5 A;  3AAR A;  5BRF A;  1KXP A;  4BRH A;  3ZX3 A;  1QHA A;  3O1W A;  2QWL A;  4M7X A;  2YHX A;  3EZW A;  5LY3 A;  4EFH A;  4H0V B;  2NLX A;  4FWR A;  4LC9 B;  4PL8 A;  2QXL A;  3BF3 A;  5BPM A;  3O1B A;  1SAZ A;  5AQZ A;  3SMS A;  3ULE A;  4BRP A;  4BRK A;  5B8H A;  1MA9 B;  1ZXO A;  5FPN A;  5AQQ A;  4IO8 A;  4F9O A;  2P9K B;  3VEW A;  4IZ9 A;  3QIC A;  1CZA N;  4QS9 A;  3ZET A;  2FXU A;  1QQN A;  2E1Z A;  3QML A;  1T6C A;  4CBU A;  4BRL A;  2E2P A;  3UKU A;  3UE5 A;  1TUU A;  3O4W A;  4H0X B;  3HM8 A;  4O5F A;  3LM2 A;  5AQK A;  4QS7 A;  3KVG A;  3CER A;  3EO3 A;  1Z6R A;  1HKB A;  4K42 A;  3EKS A;  4DB3 A;  3QBX A;  2YI1 A;  4FWL A;  4DCH A;  1V4S A;  3D2E B;  4BG9 A;  5AQJ A;  4GNI A;  1YAG A;  3QB0 A;  5AQI A;  3VF4 A;  4BR4 A;  5KPZ A;  3BUZ B;  2QW9 A;  3I33 A;  3GBT A;  1WOQ A;  5AZJ B;  3FZK A;  2GUP A;  3VEV A;  2F9T A;  2ASP A;  5AQV A;  3ZEU A;  3HTV A;  2ZF5 O;  5JLF A;  3CHW A;  2P9N A;  3HSC A;  3CET A;  4PKG A;  3QFP A;  3IDH A;  1HLU A;  4HWI A;  5EXW A;  5LJV A;  3G25 A;  1BG3 A;  2QWN A;  1BUP A;  4FWK A;  4B1Y B;  4EIA A;  1IJJ A;  2HF4 A;  4YDU A;  4B1Z A;  5BRD A;  1IG8 A;  4MLE A;  1NM1 A;  3O8M A;  2BTF A;  2P9S B;  5BPL A;  1NLV A;  2E2N A;  3WT0 A;  1XUP O;  4BRC A;  5AQH A;  5AR0 A;  3CJB A;  4FPB A;  4M63 C;  3WUH A;  1NGB A;  2UYT A;  1XC3 A;  1S22 A;  1HKG A;  2FF6 A;  2A41 A;  5E26 A;  3VF2 A;  5KQD A;  3WXJ A;  4H5N A;  4K25 A;  1WUA A;  1TUY A;  5AQP A;  3VET A;  5BN8 A;  3FZF A;  4XH4 A;  1JCF A;  2QWM A;  2F9W A;  1JCE A;  4BC5 A;  5FPM A;  2D0P A;  2V7Z A;  4EHU A;  5BN9 A;  1BU6 O;  1C0G A;  5AQR A;  4CZM A;  3KHY A;  2HOE A;  1GLB G;  3GL1 A;  4XEI A;  3TU5 A;  1MWM A;  3HZ6 A;  3VOV A;  3WXK A;  3MK6 A;  2E1Y A;  1U2V B;  4QS8 A;  3DXM A;  3U4L A;  3KZB A;  1BA1 A;  4CZF A;  3QFU A;  4CJ7 A;  4A2B A;  2CGK A;  4K41 A;  1KAZ A;  3ULE B;  3MN9 A;  5AFU A;  5LJW A;  1DGK N;  3ATU A;  4BR2 A;  1U2V A;  4FWN A;  3AY9 A;  3R9P A;  2CH6 A;  3DJC A;  3LM9 A;  1RDW X;  3ZET B;  4H0P A;  2A6A A;  3SJH A;  5AQF A;  5ADX H;  2YJE A;  1QZ5 A;  3JXU A;  4ISF A;  4NO7 A;  3IUC A;  3UKU B;  4CBW A;  3FZL A;  1G99 A;  1NWK A;  3LDQ A;  2HMP A;  4JAX A;  2H3G X;  2Q0R A;  3MMV A;  3QDK A;  2IVP A;  2D0O A;  3A8Y A;  5FPE A;  2BUP A;  1R59 O;  1HJO A;  4BC2 A;  4A62 A;  3HI0 A;  4BGB A;  1X3N A;  2VWB A;  2FF3 B;  4BRO A;  2Q0U A;  3CJ7 A;  3W3D A;  3DAW A;  2P9I A;  3O6W A;  4BRG A;  1X3M A;  3CJ9 A;  2QWR A;  2A3Z A;  3D2F A;  1DEJ A;  3FR0 A;  3M6G A;  2W41 A;  2J4R A;  3W0L A;  3ZEU B;  1HX1 A;  5I9E B;  2P9N B;  2ITM A;  3CJ1 A;  3CIP A;  4MO5 A;  4BG8 A;  3FGU A;  3IMX A;  3LDL A;  1QZ6 A;  1HKC A;  1NGH A;  3H46 O;  1NBW A;  3A5L C;  1SQK A;  2GWK A;  5ADX A;  4WQ4 C;  4JNE A;  4NB4 A;  3VPZ A;  1D4X A;  2GEM A;  4WQ5 C;  3C7N A;  4Y0W A;  5AQW A;  2Q2R A;  2QWO A;  1KAX A;  4A2A A;  4H5V A;  1NGF A;  2IVO A;  5FPD A;  1ZBS A;  3ATV A;  4BRA A;  5F1X A;  4JHD A;  3WEE A;  3C0B A;  2GTD A;  2QWP A;  3FZM A;  5TKY A;  3MDQ A;  3VGL A;  2NRH A;  2A42 A;  3BF1 A;  5AQT A;  4HTL A;  3ENH A;  2FLO A;  3L6Q A;  4DHY A;  2FSK A;  2P9U A;  3WQU A;  2ASO A;  4BVO A;  2A40 A;  3J8A A;  3L4I A;  3EL2 A;  3VER A;  3HBT A;  4JN4 A;  3WXI A;  1V4T A;  3EN9 A;  3IFR A;  4B1W B;  4E1J A;  3GDQ A;  2ZWH A;  3P4I A;  4I6M A;  3UKR A;  3VEN A;  4DQ8 A;  1MDU B;  1SZ2 A;  2DPN A;  3U8X A;  2YJF A;  2ZGY A;  1T6D A;  3DXM B;  2P9L A;  3WQT A;  2CH5 A;  1RGI A;  5F2R A;  2I7P A;  1Q18 A;  3MCP A;  4FO0 A;  4CZK A;  1ZC6 A;  1HUX A;  1T44 A;  2V52 B;  4AM7 A;  3A5M C;  4GY2 B;  1QQO A;  2QM1 A;  2V7Y A;  3DXK A;  1C0F A;  4CZH A;  3ZX2 A;  3MN7 A;  4PKI A;  1LCU A;  3RSE A;  4IJA A;  3MN5 A;  4FSV A;  2HF3 A;  3DWL A;  2E88 A;  4BC3 A;  3TPQ A;  2AP1 A;  5KPT A;  1GLD G;  3H45 C;  4CZE A;  4H0T B;  3CJC A;  3LL3 A;  3H3N O;  2E8A A;  3M1F A;  4J8F A;  4FWS A;  2E2O A;  4BQL A;  1NGI A;  4BR7 A;  5JIC A;  3AAP A;  3FZH A;  2A5X A;  5EVZ A;  1BOT O;  1YXQ A;  4RWT A;  4RTF D;  4M7Y A;  2CGL A;  3CI5 A;  1MWK A;  4FPA A;  3QBW A;  5AQG A;  3VEX A;  4Z94 A;  2YHW A;  2P9I B;  4B1U B;  4JD2 A;  2FSN A;  4IJN A;  3CQX A;  4BRN A;  2D4W A;  3D2F B;  5AQS A;  4CZI A;  2OAN A;  4EAH D;  3O5B A;  5AQX A;  2IVN A;  3CQY A;  2EWS A;  3FLC O;  4BRQ A;  3LDP A;  4CZG A;  1TYQ A;  5EX5 A;  1U6Z A;  1E4F T;  5JMV A;  4FWP A;  4FOI A;  5AZI A;  3VF6 A;  1NGE A;  3EKU A;  3BP8 A;  4PL7 A;  1YUW A;  3LDO A;  1NGG A;  4FL9 A;  4B9Q A;  5AQN A;  1K8K A;  3C7N B;  5BPN A;  2VCP A;  2AA4 A;  5AQO A;  5F0X A;  4ISG A;  4BGA A;  5KPR A;  3H1Q A;  4MO4 A;  5JLH A;  4PKH A;  2D1K A;  4B1X B;  1X9J A;  5AQL A;  4C23 A;  4JHD B;  3WEE B;  3ZX0 A;  3A5N C;  4H0O A;  4RCH A;  2FSJ A;  2IIR A;  4EHT A;  3M3Z A;  4BRF A;  2I7N A;  4B1V A;  3D7E O;  1RFQ A;  2YCH A;  5EY4 A;  1BO5 O;  3A0I X;  3O80 A;  4BRD A;  1NGA A;  5CE3 A;  2P9K A;  2P9U B;  4FWM A;  3S41 A;  4BR0 A;  4H0Y B;  4A61 A;  4WQ4 A;  2E20 A;  1BDG A;  2CGJ A;  1QQM A;  2VYP A;  4CD3 A;  1ESV A;  4WQ5 A;  4O8K A;  3VGM A;  2P9P B;  4MLH A;  3AAQ A;  3B8A X;  5AQY A;  1GLA G;  4I6M B;  3UKR B;  1GLJ O;  1P8Z A;  5BRE A;  3F9M A;  2E2Q A;  3U9D A;  2P9L B;  1JCG A;  2Q31 A;  3VEO A;  4BRE A;  1S3X A;  4CI6 A;  3H6E A;  1ATS A;  5BRH A;  3A5O C;  1H1V A;  1LOT B;  3VEZ A;  1OKJ A;  4FWO A;  3WXL A;  1ATN A;  3D2E A;  4YDU C;  2YHY A;  5BR9 A;  4H03 B;  4H5W A;  2P9P A;  4IXC A;  4L3Q A;  3UB5 A;  3DXK B;  4CZJ A;  2Q36 A;  2QWQ A;  1DKG D;  2Q97 A;  5AQU A;  5AZJ A;  3L0Q A;  2Q1N A;  1GLE G;  3SLC A;  3RSE B;  3OHR A;  5E84 A;  3VES A;  2ZGZ A;  5KQ8 A;  4CD1 A;  5AQM A;  4BRI A;  1BA0 A;  3O08 A;  1EQY A;  3GE1 A;  5AFU H;  3FE1 A;  4AM6 A;  4CBX A;  3SMP A;  3VGK A;  4CZL A;  4BQZ A;  4KBO A;  4BRM A;  1NGC A;  5EOY A;  3GOI A;  3LDN A;  5ELZ A;  1J6Z A;  2ASM A;  4FWQ A;  4H5T A;  3VEY A;  1YVN A;  1ATR A;  2P9S A;  2V51 B;  3U9Z A;  3H1V X;  4ISE A;  4BVP A;  4JD2 B;  2GEL A;  1BWF O;  4XH5 A;  3JS6 A;  1GLL O;  2NZT A;  3H3O B;  4H5R A;  4WYB A;  3CJA A;  1KAY A;  1Z05 A;  3SK3 A;  1GLF O;  1XQS C;  2PAV A;  2W40 A;  4IWV A;  4BR9 A;  1GLC G;  2PBD A;  1NMD A;  3R6M A;  1E4G T;  1TYQ B;  2GWJ A;  1Y64 A;  4K43 A;  3I8B A; 
#chains in the Genus database with same CATH topology
 1KVB A;  4DQR A;  1DTQ A;  3TAR A;  3E01 A;  3HO1 A;  1P90 A;  3KWI A;  1HPM A;  3E9O A;  1EWR A;  5KRS A;  3MN6 A;  3BEX A;  4CF9 A;  3NH0 A;  3AAR A;  3I8D A;  4BRH A;  3ZX3 A;  2UXC K;  3QEW A;  2QWL A;  4CEZ A;  4M7X A;  4KRE A;  3PO5 A;  4FWR A;  3DOL A;  1J53 A;  4DSF A;  3L2R A;  2QXL A;  3HK2 A;  3K2P A;  3CM5 A;  4DTX A;  2YHB A;  4ELV A;  4OPJ A;  1L5U A;  4DQQ A;  3VEW A;  4JRP A;  3CME N;  5D3G A;  4CJS A;  1CZA N;  3U6F A;  2O8B A;  3ZET A;  2FXU A;  5JVH L;  2O8D A;  5JEN A;  4BRL A;  4FVM A;  1TUU A;  3O4W A;  4H0X B;  3CC2 N;  3HM8 A;  4DSI A;  5HRP A;  1CLQ A;  2HST A;  4HUF A;  4QS7 A;  3PX4 A;  4NXN K;  4KHP K;  5I42 A;  2ETJ A;  3NAE A;  1HKB A;  1RDA A;  3EKS A;  4DB3 A;  4JK7 A;  3TAM A;  3AVH A;  3S9H A;  3RMB A;  1L3S A;  3D2E B;  4GVE A;  3L2W A;  1OVQ A;  2OPR A;  3HPG A;  2PFU A;  5KPZ A;  2QW9 A;  1VSH A;  4KB0 A;  1C6V A;  4L8R B;  2XO7 A;  4E1N A;  2O8E A;  2GUI A;  1JXB A;  4PKG A;  1HLU A;  4LSL A;  5C2F A;  4HWI A;  5EXW A;  1TGO A;  4KTW A;  4YOT A;  3Q7C A;  1WSG A;  1BUP A;  4KHU A;  1VSI A;  4FJN A;  4FLY A;  1SUQ A;  2BTF A;  4CHP A;  4PHT X;  3NHG A;  1IKY A;  4NCB A;  3G10 A;  3CJB A;  4JKF A;  1NGB A;  1NOZ A;  1X9M A;  4DV7 K;  1QHT A;  4DR3 K;  4CJ3 A;  2AJQ A;  4H5N A;  5A2Q O;  4K25 A;  3OYF A;  3NF8 A;  1TUY A;  5AQP A;  5BN8 A;  4XH4 A;  3BGR A;  2WOM A;  2W6K A;  4PA1 A;  2V7Z A;  1LW2 A;  4OLB A;  5BN9 A;  1C0G A;  4GV6 A;  2A1S A;  4CZM A;  3B6P A;  1GLB G;  3TU5 A;  1MWM A;  2UU9 K;  2GV9 A;  4QS8 A;  3SV3 A;  3DXM A;  2HND A;  3D6R A;  4BWM A;  1ILY A;  2CGK A;  3V1O A;  4FLZ A;  3AVK A;  1JJ2 M;  1KAZ A;  3SAF A;  3ULE B;  4EP4 A;  1TKX A;  3T1H K;  4R79 A;  3NVK A;  1U2V A;  5FRM A;  4M41 A;  4CJQ A;  4KHQ A;  3ZT4 A;  2A6A A;  5AQF A;  5C15 A;  4OX9 K;  3E1Y A;  5GIN A;  3BY5 A;  3THY B;  3LDQ A;  4OKJ A;  1W2B M;  3QDK A;  2IVP A;  1R59 O;  3TTD A;  3O9S A;  1C1B A;  4FM2 A;  4RW6 A;  3VQA A;  2FF3 B;  2Q0U A;  4GVM A;  1TK0 A;  3TTC A;  2QI2 A;  1KQS M;  2A3Z A;  1DEJ A;  5IWA K;  2A1R A;  2W41 A;  3CMA N;  2DTU A;  4GV3 A;  1HX1 A;  3LAN A;  5I9E B;  3JYT A;  4CJP A;  3SUP A;  1QZ6 A;  1NGH A;  3CCU N;  3WXM B;  2UXB K;  1SQK A;  4JNE A;  3OBW A;  4M3X A;  4BE2 A;  2BDP A;  3MED A;  4CES A;  1LWF A;  3C7N A;  5AQW A;  3M8P A;  1YVU A;  3B6O A;  3S3M A;  4BWJ A;  3C65 A;  4F2R A;  4CJU A;  2PYJ A;  2IVO A;  4LH5 A;  3EZ5 A;  5LMN K;  3WEE A;  2GTD A;  3MAQ A;  4OVL A;  4CHO A;  4C8M A;  2FBX A;  3EEQ A;  5HRN A;  4HTL A;  2FSK A;  2P9U A;  3WQU A;  2ASO A;  4FJM A;  4K8X A;  1K8A O;  3U3G A;  4JI0 K;  3TAF A;  4KHN A;  1SL2 A;  4FJ7 A;  4B1W B;  4IKF A;  1TL1 A;  2PYL A;  3AGK A;  3UKR A;  5E41 A;  3KLI A;  1VHX A;  3U8X A;  5FRO A;  1N34 K;  2YJF A;  1T6D A;  1OVY A;  4O4G A;  3VQ9 A;  2NRR A;  3LZI A;  3OYJ A;  3TAN A;  3O9R A;  4LD0 A;  1Q18 A;  5J2M A;  4FLU A;  3T7Z A;  1IG9 A;  3NE6 A;  4FYD A;  2V52 B;  4CED A;  4FJI A;  2V7Y A;  1XWL A;  3QO9 A;  4NXM K;  1VRT A;  4CZH A;  3ZX2 A;  3SZ2 A;  4JV5 K;  1VSJ A;  2ZM6 K;  4DTM A;  5CR4 A;  4LF6 K;  4FSV A;  1S1T A;  3NF9 A;  4DV3 K;  1K73 O;  2AP1 A;  4C1N K;  1GLD G;  3H45 C;  3AVI A;  2HHW A;  4R5P A;  2G8I A;  4AHU A;  1M90 O;  3THX A;  3SPZ A;  2NRT A;  2HVI A;  2E2O A;  1BQM A;  4E0D A;  3AAP A;  4BE0 A;  2XY5 A;  5JVG L;  3FZH A;  3SBG A;  1BOT O;  1YXQ A;  4A59 A;  4DV0 K;  4RTF D;  5HOO A;  1MWK A;  3QBW A;  3QEV A;  1FXX A;  2EX3 A;  3VQ7 A;  3ZSQ A;  3CFR A;  3FFI A;  4Z4F A;  4BRN A;  5AQS A;  3OYK A;  2KFN A;  4JS5 A;  2OAN A;  4EAH D;  4Z4C A;  3T3F A;  3OYA A;  4KTZ A;  1KCF A;  3PUF A;  4LY7 A;  1BL3 A;  1QVF M;  1E4F T;  2QTD A;  5JMV A;  1CZB A;  1VQO N;  3HJF A;  1Q7Y O;  3EKU A;  4PL7 A;  1DTT A;  3A2F A;  1C0U A;  1NGG A;  2Y1J A;  5BPN A;  5AQO A;  1NK6 A;  1WSF A;  4C8L A;  1D9D A;  2IOC A;  3LPT A;  5JLH A;  4PKH A;  4NLB A;  4B1X B;  1X9J A;  4C23 A;  3OYM A;  3OYI A;  2IIR A;  4DTS A;  4E7H A;  4BRF A;  3P39 A;  5EY4 A;  3KLH A;  1BO5 O;  2OZS A;  4FWM A;  3S41 A;  4H4O A;  4GW6 A;  2RF2 A;  2CGJ A;  4N47 A;  3PX0 A;  2HVH A;  4LH4 A;  4CGI A;  4DQS A;  1YJ9 N;  1QS4 A;  1HNI A;  4CF8 A;  3OTO K;  4DQI A;  2XY8 A;  5LMU K;  1FKO A;  5BRE A;  4JKD A;  4M3U A;  4KKO A;  3OW2 M;  1Z25 A;  1NJW A;  3H6E A;  3AA4 A;  4PWD A;  3A5O C;  3WXL A;  1ATN A;  3D2E A;  4YDU C;  3CFO A;  4IXC A;  1R0A A;  4L3Q A;  3UB5 A;  1WLJ A;  2Q36 A;  4FM1 A;  5GIP A;  1DKG D;  1HNZ K;  4Q5V A;  3IRX A;  3RSE B;  4Y1C A;  4NYN A;  4RW4 A;  3RMD A;  3VES A;  3DRS A;  2ZGZ A;  3J80 O;  4B9S A;  5AQM A;  1EQY A;  4X66 K;  3GE1 A;  5AFU H;  5CZ2 A;  3HP9 A;  1Z26 A;  1XI1 A;  1VQL N;  4BQZ A;  1WSH A;  4CGF A;  1I39 A;  4WFA L;  3CQ8 A;  3RTV A;  2ASM A;  3DLR A;  3L2U A;  4CCH A;  3P38 A;  1YTU A;  1J9A A;  1YVN A;  4PUO A;  3K5M A;  4AHT A;  1Q81 O;  3H1V X;  4ISE A;  2HHI A;  3V4I A;  4IOA L;  4FW2 A;  2ZD1 A;  4XH5 A;  3JS6 A;  1S6Q A;  3F5T A;  3ITH A;  4KH6 A;  4WYB A;  4DR2 K;  4HVJ A;  3AA3 A;  3CJA A;  1YJW N;  4B3O A;  1CZ9 A;  1XQS C;  4DF4 A;  1SS6 A;  1N33 K;  4Z0U A;  2PBD A;  4CVN E;  4BDP A;  2IAJ A;  1E4G T;  4DQP A;  2OTL N;  3NBP A;  3SQ2 A;  1VSE A;  1NGJ A;  3C6T A;  2KHO A;  3R8E A;  4CHY A;  5DK5 A;  3IG1 A;  3J81 O;  4BC4 A;  3GG4 A;  3TSP A;  5KRT A;  3OJU A;  4F3T A;  2YHX A;  2HW3 A;  4EFH A;  4H0V B;  3KTQ A;  3WNH A;  3E9L A;  4DFM A;  1JLB A;  1SAZ A;  3ULE A;  4BRP A;  4BRK A;  3ZSX A;  3HVR A;  1TVR A;  4E7L A;  3AVL A;  3KJV A;  1MA9 B;  2HHH K;  1JLE A;  5FPN A;  4YOU A;  4F9O A;  1BQN A;  4IDK A;  4IZ9 A;  2O8F B;  3QIC A;  4IEI A;  2YX6 A;  1QQN A;  1VSF A;  1BIS A;  4CBU A;  4PQU A;  4AH9 A;  4EP5 A;  4X62 K;  3OYE A;  4BAC A;  3THY A;  2RKI A;  3KLE A;  3LM2 A;  3HPH A;  4FK4 A;  2HNY A;  4LF5 K;  3EO3 A;  1Z6R A;  4ILH A;  3LWL A;  5K14 A;  3NMU A;  2ZJP L;  2G8U A;  3CCQ N;  4LF4 K;  4BG9 A;  5AQJ A;  2G8F A;  3AO4 A;  2X74 A;  1YAG A;  5AQI A;  3O4Q A;  3ZSZ A;  4N41 A;  3HT3 A;  3K59 A;  3OVN A;  1WOQ A;  1S1W A;  2GUP A;  3AVG A;  2F9T A;  5M1O A;  5KI6 A;  2ASP A;  5AQV A;  4EZ9 A;  3CHW A;  1IBK K;  3CET A;  1VQ6 N;  2D0A A;  5DM7 L;  1UWB A;  4FK0 A;  1VRU A;  3OY9 A;  3OYN A;  4FJH A;  3NGZ A;  1I94 K;  2HF4 A;  1KTQ A;  4YDU A;  4FJ9 A;  1G15 A;  4QAG A;  5LL6 Z;  1OH5 A;  4MLE A;  3O8M A;  2KLA A;  1LWE A;  2P9S B;  1NLV A;  2E2N A;  1KVA A;  4DTU A;  1NNE A;  4DTP A;  4BRC A;  1K6Y A;  1RTI A;  4O8U A;  3OA9 A;  4M63 C;  1WN7 A;  1XC3 A;  4RW7 A;  4FZX C;  5BR8 K;  1HKG A;  5E26 A;  2G8K A;  3WXJ A;  3TWH A;  1RDC A;  1CXQ A;  2QWM A;  4CF0 A;  1JCE A;  4OO1 J;  4J2A A;  1LAV A;  1YI2 N;  3KHY A;  4CIE A;  1IKV A;  4XEI A;  1JLG A;  1B92 A;  1LWC A;  1JL2 A;  4GKK K;  4J2D A;  1N8R O;  4DV4 K;  3LAL A;  1BA1 A;  2RE2 A;  1S9G A;  4B9V A;  4DSJ A;  4JI8 K;  2YNF A;  3QFU A;  1ZBL A;  4K41 A;  4O44 A;  3MN9 A;  3QIN A;  1DGK N;  2B5J A;  3OJS A;  2WC9 A;  4OPH A;  4FWN A;  4HUG A;  3R9P A;  3ZYY X;  3JXU A;  3WNE A;  3IUC A;  4PY5 A;  3UKU B;  4CBW A;  3VQC A;  4E1M A;  1G99 A;  4C8O A;  2FBV A;  3VN5 A;  3QIP A;  5J2Q A;  3OYD A;  3RR7 A;  3ZSO A;  2Q0R A;  4DSL A;  4GV9 A;  2KZZ A;  4A62 A;  2P5O A;  4YY3 K;  3V9U A;  3HI0 A;  1X3N A;  4BRO A;  4JK9 A;  3CJ7 A;  3DRP A;  3K5O A;  3BDP A;  4BRG A;  1HR0 K;  2F96 A;  1MU2 A;  4IO9 L;  1OH6 A;  1JLF A;  3DOK A;  4IFE A;  3V9S A;  1NKC A;  1J54 A;  4MO5 A;  1VQ4 N;  2HHV A;  3IMX A;  3LDL A;  1HKC A;  3H46 O;  4DTR A;  3EY1 A;  4CEQ A;  2NUB A;  3A5L C;  1U4B A;  3SJJ A;  1S1U A;  4NB4 A;  1CXU A;  3THV A;  1D4X A;  4B9N A;  2Q2R A;  1KAX A;  3K5L A;  3HXM A;  1VSD A;  4A2A A;  2XRI A;  1NGF A;  2Z1I A;  1S1V A;  1ZBS A;  1SL0 A;  3V1R A;  1ASV A;  3ATV A;  3VQB A;  4BRA A;  1J5O A;  1U48 A;  4DTO A;  2D0C A;  2WFB A;  5C24 A;  1T3V A;  3MDQ A;  5TKY A;  4BE1 A;  3VGL A;  4CGG A;  2A42 A;  5TKW A;  3P5J A;  1BCO A;  4DHY A;  4BVO A;  4E7I A;  1O1W A;  3L4I A;  3PIO L;  3VER A;  1V4T A;  1FW6 A;  3QET A;  4QOZ B;  3IFR A;  3KK2 A;  3CCJ N;  2ZWH A;  3P4I A;  3K58 A;  1RT4 A;  3S5T A;  1SZ2 A;  1SKS A;  4K8Z A;  3SQ0 A;  1BIZ A;  3KD5 E;  4MDA A;  3MEE A;  1NJI O;  3T69 A;  3WQT A;  4KHS A;  2QK9 A;  4B9L A;  5F2R A;  3MCP A;  4CZK A;  1ZC6 A;  1BIU A;  2HHU A;  4AM7 A;  3A5M C;  3IKM A;  4CHN A;  1C0F A;  3RSE A;  3I55 N;  2HF3 A;  4BC3 A;  4JKB A;  2NRV A;  5J2N A;  4KRF A;  4CZE A;  2BGG A;  3LL3 A;  2E8A A;  4W5Q A;  1NGI A;  5M1Q A;  3T1A A;  1HPZ A;  1WB9 A;  5JIC A;  2KTQ A;  2HMI A;  4FPA A;  4NCG A;  3DLK A;  3VEX A;  5HP1 A;  2P9I B;  4B1U B;  3NF6 A;  4C8K A;  3IAY A;  1BGX T;  1D5A A;  2DFF A;  4IJN A;  2XY7 A;  1L3U A;  2D4W A;  5HRO A;  1IKX A;  4NCA A;  1VK0 A;  1HYS A;  4BY9 C;  3ASM A;  3TI0 A;  4BRQ A;  2QA4 N;  3HVT A;  4IEE A;  1U6Z A;  4CFC A;  4FWP A;  4DTN A;  3V9X A;  3VF6 A;  3I56 N;  5HRR A;  2IGI A;  1NGE A;  3ZSW A;  4DV2 K;  5DMR A;  1YUW A;  3LDO A;  1X9S A;  4B9Q A;  4DLE A;  4CEA A;  2QXF A;  1SKW A;  2AA4 A;  4HUE A;  3H1Q A;  1VSM A;  4A57 A;  2D1K A;  4IG3 A;  3V6D A;  5AQL A;  4EHT A;  4KPY A;  2FSJ A;  2I7N A;  1NJY A;  5KGX A;  4CJR A;  1WAJ A;  3AVC A;  1EX4 A;  4A5A A;  1JLQ A;  5CHI A;  4DKW A;  1NGA A;  3CFP A;  2P51 A;  3VMF B;  4W5O A;  4AHR A;  3O3H A;  4G9Z A;  3NF7 A;  1X1P A;  2O8F A;  5DM6 L;  5GAD P;  4YOY A;  2OPP A;  2RPI A;  4RW9 A;  4CD3 A;  3VGM A;  2P9P B;  1DLO A;  4I6M B;  1GLJ O;  4FLW A;  3QIO A;  3OYB A;  2Q31 A;  4I2Q A;  2OCE A;  2VWK A;  3L2V A;  1KLN A;  1K9M O;  5BRH A;  3SV4 A;  2ZJR L;  1OKJ A;  4FWO A;  5CY4 A;  3DLE A;  1IV0 A;  3CPW M;  4DR5 K;  3HYF A;  2VG6 A;  4JI6 K;  4HCC A;  3NVM A;  4NYF A;  2Q97 A;  3L0Q A;  2HBL A;  2HNZ A;  2C1I A;  1YIJ N;  5KQ8 A;  4IOC L;  2X78 A;  5KGW A;  1BA0 A;  3KK3 A;  3LP0 A;  4CEO A;  3FE1 A;  4AM6 A;  1FJG K;  4CZL A;  4O0J A;  3ZT1 A;  2VWJ A;  3TAP A;  4BRM A;  1NGC A;  5EOY A;  1KLM A;  4W5T A;  4CJL A;  3ALY A;  3ZLJ A;  3AGR A;  1SV5 A;  2P9S A;  3ZSV A;  5CYQ A;  1NK5 A;  4JD2 B;  2GEL A;  1BI4 A;  1BWF O;  1T03 A;  4B3M K;  4DMN A;  2NZT A;  3C94 A;  1J5E K;  2O4G A;  3MXM A;  1KAY A;  3NH2 A;  2VG7 A;  5IT9 O;  3SQ4 A;  3SK3 A;  2FC0 A;  3BZK A;  1TYQ B;  3ZT2 A;  4AHV A;  4DU4 A;  3I8B A;  4ZTJ A;  5AZI B;  3ZCM A;  2VGN A;  5EU7 A;  1VQK N;  2B4J A;  2B6A A;  2WUS A;  4XH1 A;  1S9E A;  4CJ4 A;  1NGD A;  4FOE A;  4CEB A;  4BR5 A;  3KD1 E;  1KXP A;  3QLH A;  4WE1 A;  3EZW A;  4CK1 A;  1XHZ A;  4AIL C;  4LC9 B;  4PL8 A;  5FDL A;  3U3Y A;  4JI5 K;  4DFP A;  5BPM A;  1RNH A;  3O1B A;  3BZC A;  3O9U A;  5B8H A;  2VQF K;  1IBL K;  1ZXO A;  3TAE A;  2P9K B;  2G8V A;  1SKR A;  3N4P A;  1RBT A;  4CFB A;  2E1Z A;  1NJX A;  2E2P A;  3UKU A;  1UA1 A;  3UE5 A;  4DV5 K;  3ZT3 A;  4DUY K;  3K9J A;  4IBN A;  3SUO A;  4MFB A;  3K57 A;  4A5B A;  2O8E B;  3LWM A;  5JS2 A;  4DV6 K;  3QBX A;  2YI1 A;  4FWL A;  4YOV A;  4JI4 K;  3AO3 A;  1V4S A;  4FLX A;  3MXI A;  4Z4E A;  2YNH A;  3P1G A;  4M3Y A;  3VF4 A;  3I33 A;  3GBT A;  2HBK A;  3FZK A;  4KHY A;  4O5B A;  4CJK A;  3HTV A;  2JWK A;  2GBZ A;  1TK8 A;  1BHL A;  3IDH A;  5M1N A;  5GIO A;  3RRG A;  2IC3 A;  1WSJ A;  1RT5 A;  3G25 A;  1BG3 A;  2UUB K;  4DR4 K;  5GAG P;  5I3U A;  1FKP A;  3THW B;  3TAB A;  3DI6 A;  2KQ2 A;  4B1Y B;  4EIA A;  1IJJ A;  4B1Z A;  3TR8 A;  3CC4 N;  3MEC A;  3CCM N;  2DFE A;  4HHT A;  4BEB A;  1ITG A;  5BPL A;  1N32 K;  3SUN A;  1XUP O;  4FCY A;  4YOW A;  1HNX K;  3WUH A;  1RCH A;  3PY8 A;  2R7Y A;  2KFZ A;  1S22 A;  2F4V K;  5KQD A;  2A41 A;  4JK8 A;  2P1J A;  4IFV A;  1WUA A;  3TTF A;  2OTJ N;  3VET A;  1EO1 A;  3FZF A;  1TV6 A;  1ZBF A;  4JLH A;  2F9W A;  1C0M A;  2D0P A;  2NRZ A;  5FPM A;  4EHU A;  5AQR A;  1SL1 A;  3LPU A;  4J2B A;  3L3V A;  4M45 A;  3GL1 A;  3KK1 A;  3VA3 A;  3OBY A;  3HZ6 A;  3WXK A;  3OS2 A;  4KI6 A;  4DS4 A;  1FK9 A;  1U2V B;  3D0P A;  3SUQ A;  1DT9 A;  4LFB K;  3C6A A;  3KZB A;  2W00 A;  4Z4I A;  5FLX O;  4CZF A;  4CJ7 A;  4A2B A;  1N6Q A;  1B9D A;  3MCA B;  5AFU A;  1HMV A;  1TKT A;  4BR2 A;  4E7K A;  1RTD A;  3T1Y K;  4JKC A;  4DUZ K;  1RDD A;  3LM9 A;  3I0R A;  4E72 A;  1GOA A;  2ZE2 A;  3F2K A;  4AF1 A;  2YJE A;  3DLG A;  4ISF A;  3AVF A;  4DU3 A;  1X9W A;  3Q7B A;  3FZL A;  4K0K K;  3QEP A;  3R3L A;  3RWU A;  4JAX A;  4JKE A;  2H3G X;  3MMV A;  3PX6 A;  2D0O A;  3A8Y A;  3LP3 A;  5C42 A;  2BUP A;  4BC2 A;  1HJO A;  4E19 A;  4ZTF A;  2G8W A;  3KKR A;  5M1F A;  2OPQ A;  1QSL A;  4FJJ A;  4ELT A;  3DAW A;  2P9I A;  3O6W A;  3CJ9 A;  3P83 D;  4OPK A;  3S3O A;  4M3R A;  3FR0 A;  4FJG A;  2F8S A;  3M6G A;  3EE9 A;  1TL3 A;  2FBY A;  1VQ9 N;  3W0L A;  4F4K A;  3ZEU B;  3CXC M;  2P9N B;  2QKB A;  4BE7 B;  1NU0 A;  4CGJ A;  1OH8 A;  3FGU A;  1REV A;  3L2Q A;  1Q82 O;  4CIG A;  4M3W A;  4KH4 A;  2F7T A;  3K0S A;  2RHK A;  2YNG A;  3L4Q A;  3PV8 A;  3AVJ A;  2F8T A;  3VPZ A;  3K9K A;  1EP4 A;  4LFC K;  2GEM A;  1RBS A;  4WQ5 C;  3O9Q A;  3TAG A;  4WFB L;  1QVG M;  3TAQ A;  4KAZ A;  4QCL A;  2E5L K;  1M1K O;  2BE2 A;  4DR1 K;  2O4I A;  3C0B A;  5M1K A;  4UQG A;  2QWP A;  3FZM A;  1WAF A;  5AQT A;  1EXQ A;  3RMC A;  2FLO A;  4FW1 A;  2OPS A;  1Q9X A;  1GOB A;  2ZJQ L;  2GX9 A;  4MDB A;  1NK4 A;  3SQ1 A;  3J8A A;  4CK3 A;  1WBB A;  1YHQ N;  3HBT A;  4AHS A;  1A5V A;  3AV9 A;  4DV1 K;  3EN9 A;  1T8E A;  2IS3 A;  3CCL N;  4I6M A;  4DQ8 A;  3VEN A;  4JI2 K;  4XIU A;  1NKB A;  2ZGY A;  3MX2 A;  2CH5 A;  3G71 N;  4CHQ A;  3NH1 A;  1RGI A;  1Q86 O;  2I7P A;  4FO0 A;  1T44 A;  3THX B;  4B3S K;  2YHA A;  4GY2 B;  2HB5 A;  1S72 N;  1LV5 A;  1LCU A;  5FRN A;  1XHX A;  3MN5 A;  2O8C B;  3DWL A;  2E88 A;  4BDZ A;  1NMN A;  5KPT A;  2HHX A;  3HM9 A;  4H0T B;  4FJ8 A;  3CJC A;  3H3N O;  5J2P A;  3M1F A;  4J8F A;  4FWS A;  1JKH A;  4BR7 A;  4BEC A;  4E89 A;  1HYZ A;  3MX5 A;  3O9T A;  2QKK A;  2A5X A;  5EVZ A;  3PLA A;  3JSM A;  3CI5 A;  1QSS A;  5AQG A;  4Z94 A;  2YHW A;  4Z4G A;  5C2D A;  4JD2 A;  4CJ5 A;  4GKJ K;  4G1Q A;  3D2F B;  3IS9 A;  1ZBH A;  3J7Z O;  3AVN A;  4CZI A;  3DYA A;  3M5R A;  3NFA A;  3O5B A;  5AQX A;  2IVN A;  3CQY A;  4LF8 K;  2E6M A;  4YHH K;  4DFJ A;  2PY5 A;  1TYQ A;  5CZ1 A;  5AZI A;  1VQ5 N;  3SNN A;  3RRH A;  3BP8 A;  1QSY A;  1LAW A;  4DTJ A;  1KC8 O;  1B9F A;  4WFN L;  1ZBU A;  2VCP A;  4ISG A;  4H4M A;  1WBD A;  5C25 A;  4MO4 A;  2D5R A;  3D45 A;  4JHD B;  2KZM A;  3ZX0 A;  3A5N C;  4IOX A;  3EYZ A;  1NK0 A;  1UA0 A;  1VQM N;  2YCH A;  3VA0 A;  3A0I X;  4BRD A;  1C1A A;  5CE3 A;  3L8B A;  2P9K A;  4C8N A;  2C1G A;  4H0Y B;  4CGD A;  4CW7 B;  3SCX A;  1BDG A;  1ESV A;  4WQ5 A;  3CPE A;  4CEE A;  5HL7 L;  4MLH A;  3HOT A;  2IDO A;  3B8A X;  1GLA G;  3CYG A;  4FLV A;  3VQE A;  3F9M A;  4B3R K;  2P9L B;  1JCG A;  3V81 A;  3VEO A;  2PZS A;  4CI6 A;  1ATS A;  3E9P A;  1H1V A;  3VEZ A;  3CYM A;  3AO2 A;  3ISN C;  3DLH A;  3N4Q A;  4H5W A;  4YFU A;  2XY6 A;  3DXK B;  1RTJ A;  4CZJ A;  1JL1 A;  4OPA A;  2QEX N;  3QNO A;  1GLE G;  4YOR A;  1VSK A;  3SI6 A;  1TK5 A;  5E84 A;  4YNQ A;  4FZY A;  4BRI A;  3VGK A;  3SYZ A;  4N5S A;  5HLF A;  5T7B A;  3NCI A;  4LF7 K;  4N76 A;  4KBO A;  2NRW A;  3THW A;  1W97 L;  3GOI A;  2X6N A;  3LDN A;  5ELZ A;  4KTQ A;  3UIQ A;  4FWQ A;  4H5T A;  3VEY A;  1RDU A;  1ATR A;  4C1N I;  3O4N A;  3U9Z A;  4ID1 A;  5GAH P;  1HQE A;  4BVP A;  4M3Z A;  3ZT0 A;  1GLL O;  4H5R A;  1C0T A;  3KWG A;  2UUC K;  1Z05 A;  4U7B A;  1D8Y A;  1ZBI A;  4IWV A;  1GLC G;  4RG8 A;  1NMD A;  1NKE A;  1Y64 A;  1HYV A;  1S6P A;  3ENO A;  3TSU A;  2HHS A;  2VGM A;  1YT3 A;  3FFK B;  3ID8 A;  4Q0B A;  1K8K B;  4I2P A;  1KRP A;  4CJE A;  1QE1 A;  5BRF A;  3MEG A;  1W9H A;  3QEX A;  1XMQ K;  1QHA A;  3O1W A;  3CG7 A;  4DU1 A;  5LY3 A;  1C1C A;  4CJT A;  2NLX A;  4LSN A;  4CGH A;  3MXJ A;  1Q9Y A;  3AA5 X;  3BF3 A;  4CF1 A;  4E3S A;  4TSX A;  4J2E A;  5AQZ A;  3SMS A;  1HRH A;  5AQQ A;  3AO5 A;  2X6S A;  4IO8 A;  4CFD A;  3LP2 A;  4OGE A;  3KLG A;  4B9T A;  4GMJ B;  4JKH A;  2LSN A;  4QS9 A;  4CJW A;  3QML A;  1T6C A;  1N36 K;  1KSP A;  1RT2 A;  4ELU A;  4O5F A;  4JS4 A;  5AQK A;  3KVG A;  3CER A;  3PSF A;  4X64 K;  4K42 A;  5SWM A;  1VQ8 N;  1N5Y A;  1O13 A;  1S5J A;  4DCH A;  4KB1 A;  3LZJ A;  3QNN A;  4FZZ A;  4CFA A;  1TKZ A;  3V9Z A;  4F2S A;  4GNI A;  3QB0 A;  4BR4 A;  5H1S Q;  3O3G A;  3BUZ B;  3QEI A;  5AZJ B;  4B9U A;  3DLB A;  3NDK A;  3VEV A;  4CJV A;  3R1X A;  3CF5 L;  5JLF A;  3ZEU A;  2VG5 A;  2ZF5 O;  2P9N A;  4ZHR A;  3HSC A;  1IO2 A;  3QFP A;  3PSI A;  1RT1 A;  5LJV A;  3HL8 A;  2QWN A;  2UUA K;  4CIF A;  4FWK A;  3MWT A;  1I3A A;  4CF2 A;  5BRD A;  4UY8 O;  1IG8 A;  1EET A;  4IG0 A;  1NM1 A;  3J7Y P;  1W7A A;  3VTI A;  4DS5 A;  2P5G A;  3WT0 A;  1YJN N;  1XC9 A;  3VQD A;  5KTQ A;  5AR0 A;  5CYM A;  1HJR A;  5AQH A;  4FPB A;  3VQ5 A;  2UXD K;  2UYT A;  4FVU A;  3NGY A;  3OS1 A;  3ENB A;  2FF6 A;  3VF2 A;  3VQ6 A;  3CCE N;  4OJR A;  4OKK A;  1QQC A;  3C95 A;  4O0I A;  3HP6 A;  1JCF A;  4IDH A;  4JKG B;  4BC5 A;  3RR8 A;  1U49 A;  1BU6 O;  1VAZ A;  3PIP L;  4FXD A;  4JI7 K;  4F3O A;  2HOE A;  1E3M A;  1NK8 A;  3VOV A;  3MK6 A;  1T7P A;  2E1Y A;  4CEC A;  2NRX A;  1D9F A;  3U4L A;  4W5R A;  1HQU A;  2OYQ A;  4HCB A;  3HST B;  4KV8 A;  5HBM A;  2XHB A;  1NOY A;  1JXE A;  1F21 A;  4W5N A;  2KKZ A;  1RDB A;  3G0Z A;  2YV0 X;  5LJW A;  5MLC Q;  1LW0 A;  3LP1 A;  3SBT A;  3ATU A;  4DR7 K;  1ZYQ A;  2JWL A;  4CJF A;  4DSK A;  4DG1 A;  2DFH A;  3KKS A;  3DRR A;  2O8C A;  3AY9 A;  3S3N A;  2CH6 A;  3DJC A;  3ZET B;  1RDW X;  4JRQ A;  2O8B B;  4H0P A;  1QTM A;  3SJH A;  4LFA K;  5ADX H;  2O8D B;  1QZ5 A;  4NO7 A;  4Y1D A;  3EE8 A;  4Z4H A;  1NWK A;  2HMP A;  1RT3 A;  4M3T A;  3CC7 N;  2ZQB A;  5FPE A;  4FJ5 A;  1IH7 A;  2FBT A;  4BGB A;  3AVM A;  2VWB A;  3OS0 A;  4B8C A;  3AA2 A;  3W3D A;  4EZ6 A;  1X3M A;  2HBM A;  2QWR A;  4FM0 A;  3D2F A;  3VQ8 A;  2J4R A;  1VQP N;  1T05 A;  2ITM A;  3CJ1 A;  3CIP A;  4BG8 A;  2WBN A;  2W6L A;  1NBW A;  3PO4 A;  2GWK A;  3VTH A;  5ADX A;  4YOX A;  4WQ4 C;  3RVC A;  1JLA A;  1A5X A;  4Y0W A;  3AVB A;  3P31 A;  3C6U A;  2QWO A;  3M8S A;  3MWP A;  3JAM O;  4H5V A;  5FPD A;  5F1X A;  4JHD A;  1Y97 A;  3L3U A;  1NG9 A;  4FLT A;  3LAM A;  4IFY A;  1W0H A;  2D0B A;  2NRH A;  5J1E A;  4DSE A;  3BF1 A;  4KHW A;  4KI4 A;  3ENH A;  1KD1 O;  2ATQ A;  3L6Q A;  3M8R A;  4CEF A;  4FJL A;  2DY4 A;  4ILG B;  2A40 A;  3DM2 A;  3EL2 A;  4JN4 A;  3WXI A;  3C6H A;  2OZM A;  3H08 A;  1YIT N;  3LAK A;  4E1J A;  3GDQ A;  1U45 A;  2E6L A;  1MDU B;  1VSL A;  2DPN A;  2YKN A;  4DLG A;  3DXM B;  1NK7 A;  2P9L A;  1YTA A;  4DR6 K;  1L3T A;  4CE9 A;  4DFK A;  4I9L A;  5SZT A;  2HHT A;  4DWI A;  1HUX A;  4KFB A;  3CD6 N;  4ILJ A;  3OYG A;  1QQO A;  2QM1 A;  1HNV A;  4ID5 A;  4JYA K;  3DXK A;  3MN7 A;  1IKW A;  3F73 A;  3KK7 A;  4PKI A;  3J7A P;  4IJA A;  4OGC A;  1XNQ K;  3TPQ A;  3T19 A;  3SAH A;  4CHZ A;  1XMO K;  3VQP A;  3G4S N;  1RT7 A;  2YKM A;  3HPO A;  3VQ4 A;  4BQL A;  2W42 A;  3VQQ A;  1WSE A;  4E7J A;  4M42 A;  2HBJ A;  4BDY A;  5GAE P;  4RWT A;  5C12 A;  4M7Y A;  4RW8 A;  2CGL A;  4B3T K;  1RTH A;  3V1Q A;  1VQ7 N;  1GOC A;  2WTU A;  2FSN A;  3CQX A;  1RIL A;  4B9M A;  5AJ3 K;  1ASU A;  3KLF A;  2EWS A;  2KW4 A;  3FLC O;  1YF5 L;  3LDP A;  4CZG A;  2NNW A;  2BAN A;  5EX5 A;  4I9Q A;  3WNF A;  3LDS A;  4B8A B;  4FOI A;  2Q3S A;  4OLA A;  4NLC A;  1KFS A;  2Z1G A;  2VQE K;  4FL9 A;  1TAU A;  5AQN A;  1K8K A;  3TSQ A;  3C7N B;  5F0X A;  4U67 L;  3OYL A;  4BGA A;  1BCM A;  3V9W A;  1NJZ A;  5KPR A;  3G6E N;  4WCE L;  1OH7 A;  5M1P A;  3QER A;  3WEE B;  4H0O A;  4RCH A;  2WON A;  3M3Z A;  4JKA A;  4B1V A;  3D7E O;  1L3V A;  1KFD A;  1RFQ A;  2I5J A;  3O80 A;  2YNI A;  2OA8 A;  2P9U B;  3CCS N;  1NK9 A;  1Q8I A;  1U47 A;  4BR0 A;  4I7F A;  4A61 A;  1S1X A;  4WQ4 A;  2E20 A;  3SPY A;  1QQM A;  2Z1J A;  1HNW K;  1VQN N;  2VYP A;  4O8K A;  3DMJ A;  2G8H A;  1U04 A;  3AAQ A;  1UAX A;  5AQY A;  4KO0 A;  3UKR B;  1P8Z A;  3F9K A;  2E2Q A;  3U9D A;  4JI1 K;  4CER A;  1WNS A;  2E4L A;  2ITG A;  1EKE A;  3CM6 A;  4BRE A;  1S3X A;  3OYH A;  1LOT B;  4MQ3 A;  1TKD A;  2Y1I A;  1A5W A;  2YHY A;  5BR9 A;  4H03 B;  4XJX A;  4DF8 A;  3CCR N;  2P9P A;  3AO1 A;  3ID6 A;  4HTU A;  2JLE A;  2QWQ A;  4CK2 A;  5AQU A;  5AZJ A;  2Q1N A;  3SLC A;  4AQY K;  3ZSY A;  3OHR A;  3HOS A;  3ULD A;  3AVA A;  2Z1H A;  2JGU A;  3SAG A;  4LF9 K;  4CD1 A;  4O55 A;  1TAQ A;  1RBV A;  4B08 A;  3O08 A;  1XNR K;  3M8Q A;  4ICL A;  5C10 A;  1IBM K;  3O3F A;  4CBX A;  4KH5 A;  4N56 A;  1BI4 B;  1EWQ A;  3SMP A;  2RN2 A;  3RMA A;  4JEP A;  4FK2 A;  4WF9 L;  1RT6 A;  5JS1 A;  3ZSR A;  3CCV N;  3DLL L;  1UOC A;  1J6Z A;  3HRG A;  2HHQ A;  1RBU A;  4F8R A;  5HRS A;  3KIO A;  3OYC A;  2V51 B;  4X65 K;  3WNG A;  4FJK A;  3K5N A;  1RBR A;  1WSI A;  1JLC A;  3H3O B;  2EHG A;  3E66 A;  4AHC A;  1KVC A;  4JI3 K;  3I0S A;  1ASW A;  4OKE A;  2BH1 A;  1GLF O;  4V19 S;  2PAV A;  2W40 A;  4BR9 A;  3NGI A;  3R6M A;  4FJX A;  2GWJ A;  4H8K A;  3QES A;  4K43 A;  4JKG A;  5C0Y A; 
#chains in the Genus database with same CATH homology
 5AZI B;  3ENO A;  3TSU A;  2VGN A;  1VQK N;  2VGM A;  1NGJ A;  1P90 A;  3FFK B;  3ID8 A;  2KHO A;  3KWI A;  3R8E A;  2WUS A;  1HPM A;  3E9O A;  4XH1 A;  1NGD A;  4FOE A;  1K8K B;  3MN6 A;  4BC4 A;  3BEX A;  3GG4 A;  3TSP A;  4BR5 A;  3AAR A;  5BRF A;  1KXP A;  4BRH A;  3ZX3 A;  1QHA A;  3O1W A;  2QWL A;  4M7X A;  2YHX A;  3EZW A;  5LY3 A;  4EFH A;  4H0V B;  2NLX A;  4FWR A;  4LC9 B;  4PL8 A;  2QXL A;  3BF3 A;  3E9L A;  5BPM A;  3O1B A;  1SAZ A;  5AQZ A;  3O9U A;  3SMS A;  3ULE A;  4BRP A;  4BRK A;  5B8H A;  1MA9 B;  1ZXO A;  5FPN A;  4YOU A;  5AQQ A;  4IO8 A;  4F9O A;  2P9K B;  3VEW A;  3CME N;  3N4P A;  4IZ9 A;  3QIC A;  4IEI A;  4JKH A;  1CZA N;  4QS9 A;  3ZET A;  2YX6 A;  2FXU A;  1QQN A;  5JVH L;  2E1Z A;  3QML A;  1T6C A;  4CBU A;  4BRL A;  2E2P A;  3UKU A;  3UE5 A;  1TUU A;  3O4W A;  4H0X B;  3CC2 N;  3HM8 A;  4O5F A;  2HST A;  3K9J A;  3LM2 A;  5AQK A;  4QS7 A;  3KVG A;  4A5B A;  3CER A;  3EO3 A;  1Z6R A;  1HKB A;  4K42 A;  3EKS A;  4DB3 A;  1VQ8 N;  4JK7 A;  4ILH A;  3QBX A;  1O13 A;  2YI1 A;  3NMU A;  4FWL A;  2ZJP L;  4DCH A;  4YOV A;  1V4S A;  3D2E B;  3CCQ N;  4BG9 A;  5AQJ A;  4GVE A;  4GNI A;  2PFU A;  1YAG A;  3QB0 A;  5AQI A;  3VF4 A;  4BR4 A;  5KPZ A;  5H1S Q;  3BUZ B;  2QW9 A;  3I33 A;  3GBT A;  1WOQ A;  2HBK A;  3FZK A;  5AZJ B;  2GUP A;  3VEV A;  2F9T A;  3R1X A;  5M1O A;  3CF5 L;  2ASP A;  5AQV A;  3ZEU A;  3HTV A;  2ZF5 O;  5JLF A;  3CHW A;  2P9N A;  2JWK A;  3HSC A;  3CET A;  4PKG A;  3QFP A;  1VQ6 N;  3IDH A;  1HLU A;  5M1N A;  5GIO A;  5C2F A;  4HWI A;  5EXW A;  5LJV A;  5DM7 L;  4YOT A;  3G25 A;  3Q7C A;  1BG3 A;  2QWN A;  1BUP A;  4FWK A;  3MWT A;  5GAG P;  4B1Y B;  4EIA A;  1IJJ A;  2HF4 A;  4YDU A;  4B1Z A;  5BRD A;  4UY8 O;  1IG8 A;  3CC4 N;  3CCM N;  4MLE A;  1NM1 A;  3O8M A;  2BTF A;  2KLA A;  4BEB A;  2P9S B;  4PHT X;  3VTI A;  5BPL A;  1NLV A;  2E2N A;  3WT0 A;  1YJN N;  1XUP O;  4BRC A;  5AQH A;  5AR0 A;  4O8U A;  3CJB A;  3OA9 A;  4FPB A;  4JKF A;  4M63 C;  3WUH A;  1NGB A;  2UYT A;  4YOW A;  4FVU A;  1XC3 A;  1S22 A;  3ENB A;  1HKG A;  2FF6 A;  2A41 A;  4JK8 A;  5E26 A;  3VF2 A;  5KQD A;  3WXJ A;  4H5N A;  4K25 A;  3CCE N;  1WUA A;  3TTF A;  1TUY A;  2OTJ N;  5AQP A;  3VET A;  5BN8 A;  1EO1 A;  3FZF A;  4XH4 A;  1JCF A;  2QWM A;  4IDH A;  2F9W A;  1JCE A;  4JKG B;  5FPM A;  2D0P A;  2NRZ A;  2V7Z A;  4BC5 A;  4EHU A;  4OO1 J;  5BN9 A;  1YI2 N;  1BU6 O;  1C0G A;  1VAZ A;  4GV6 A;  5AQR A;  3PIP L;  4CZM A;  3KHY A;  2HOE A;  1GLB G;  3GL1 A;  4XEI A;  3TU5 A;  1MWM A;  3OBY A;  3HZ6 A;  3VOV A;  3WXK A;  3MK6 A;  2E1Y A;  1U2V B;  1DT9 A;  2NRX A;  4QS8 A;  3DXM A;  3U4L A;  3D6R A;  3C6A A;  3KZB A;  1N8R O;  2W00 A;  1BA1 A;  2RE2 A;  4CZF A;  1ILY A;  3QFU A;  4CJ7 A;  4A2B A;  2CGK A;  3MCA B;  4K41 A;  1KAZ A;  3SAF A;  3ULE B;  1JJ2 M;  2KKZ A;  3MN9 A;  5AFU A;  5LJW A;  5MLC Q;  3SBT A;  1DGK N;  3ATU A;  2JWL A;  4BR2 A;  4R79 A;  3NVK A;  1U2V A;  2WC9 A;  4JKC A;  4OPH A;  4FWN A;  3AY9 A;  3R9P A;  2CH6 A;  3DJC A;  3LM9 A;  1RDW X;  3ZET B;  3ZYY X;  4H0P A;  2A6A A;  3F2K A;  5AQF A;  3SJH A;  2YJE A;  1QZ5 A;  3JXU A;  4ISF A;  4AF1 A;  5ADX H;  4NO7 A;  3IUC A;  5C15 A;  3E1Y A;  3EE8 A;  3Q7B A;  3UKU B;  3FZL A;  4CBW A;  5GIN A;  1G99 A;  3R3L A;  1NWK A;  3LDQ A;  2HMP A;  4JAX A;  4JKE A;  2H3G X;  1W2B M;  2Q0R A;  3MMV A;  3QDK A;  2IVP A;  2D0O A;  3A8Y A;  5FPE A;  3CC7 N;  2BUP A;  1R59 O;  1HJO A;  3TTD A;  4BC2 A;  4GV9 A;  4A62 A;  3O9S A;  5M1F A;  3HI0 A;  4BGB A;  1X3N A;  2VWB A;  2FF3 B;  4BRO A;  4JK9 A;  2Q0U A;  3CJ7 A;  3TTC A;  3W3D A;  3DAW A;  2P9I A;  2QI2 A;  3O6W A;  1X3M A;  3CJ9 A;  4BRG A;  1KQS M;  2HBM A;  2QWR A;  2A3Z A;  3D2F A;  1DEJ A;  3FR0 A;  3M6G A;  3EE9 A;  2W41 A;  4IO9 L;  3CMA N;  2J4R A;  1VQP N;  3W0L A;  1VQ9 N;  4IFE A;  4GV3 A;  3ZEU B;  1HX1 A;  5I9E B;  3CXC M;  2P9N B;  2ITM A;  4BE7 B;  3CJ1 A;  3CIP A;  4MO5 A;  4BG8 A;  2WBN A;  1VQ4 N;  3FGU A;  3IMX A;  3LDL A;  1QZ6 A;  1HKC A;  1NGH A;  1Q82 O;  3H46 O;  3CCU N;  3WXM B;  1NBW A;  4KH4 A;  2F7T A;  3A5L C;  1SQK A;  2RHK A;  2GWK A;  3L4Q A;  3VTH A;  5ADX A;  4YOX A;  4WQ4 C;  4JNE A;  4NB4 A;  3RVC A;  3VPZ A;  3OBW A;  3K9K A;  1D4X A;  2GEM A;  4WQ5 C;  3C7N A;  4Y0W A;  3P31 A;  5AQW A;  3O9Q A;  2Q2R A;  2QWO A;  1KAX A;  4WFB L;  1QVG M;  4A2A A;  3C65 A;  3MWP A;  4H5V A;  1NGF A;  2IVO A;  5FPD A;  1M1K O;  1ZBS A;  3ATV A;  4BRA A;  5F1X A;  4JHD A;  3WEE A;  3C0B A;  5M1K A;  2GTD A;  2QWP A;  2WFB A;  3FZM A;  1T3V A;  3MDQ A;  5TKY A;  3VGL A;  2NRH A;  2A42 A;  3BF1 A;  5TKW A;  5AQT A;  4HTL A;  3ENH A;  1KD1 O;  2FLO A;  3L6Q A;  4DHY A;  2ZJQ L;  2FSK A;  2GX9 A;  2P9U A;  2ASO A;  3WQU A;  4MDB A;  4BVO A;  4ILG B;  2A40 A;  1K8A O;  3J8A A;  3L4I A;  3EL2 A;  3PIO L;  3VER A;  3HBT A;  4JN4 A;  3WXI A;  1V4T A;  3C6H A;  1YHQ N;  3EN9 A;  3IFR A;  4B1W B;  1YIT N;  4E1J A;  3GDQ A;  2ZWH A;  3AGK A;  3P4I A;  4I6M A;  3UKR A;  3VEN A;  4DQ8 A;  3CCJ N;  1MDU B;  3CCL N;  1SZ2 A;  2DPN A;  3U8X A;  2YJF A;  2ZGY A;  1T6D A;  1OVY A;  2P9L A;  3DXM B;  3MX2 A;  4MDA A;  2CH5 A;  3T69 A;  3WQT A;  3G71 N;  2NRR A;  1Q86 O;  1RGI A;  3O9R A;  5F2R A;  2I7P A;  1Q18 A;  3MCP A;  4FO0 A;  4CZK A;  3T7Z A;  1ZC6 A;  1HUX A;  3CD6 N;  1T44 A;  2V52 B;  4AM7 A;  3A5M C;  4ILJ A;  3IKM A;  4GY2 B;  1QQO A;  2QM1 A;  2V7Y A;  3DXK A;  1C0F A;  4CZH A;  1S72 N;  3ZX2 A;  3MN7 A;  3KK7 A;  4PKI A;  1LCU A;  5CR4 A;  3RSE A;  3I55 N;  4IJA A;  3MN5 A;  4FSV A;  2HF3 A;  3DWL A;  2E88 A;  4BC3 A;  3TPQ A;  3SAH A;  1K73 O;  4JKB A;  2NRV A;  2AP1 A;  5KPT A;  4C1N K;  1GLD G;  3H45 C;  4CZE A;  4H0T B;  3CJC A;  3LL3 A;  3H3N O;  1M90 O;  3G4S N;  2E8A A;  2NRT A;  3M1F A;  4J8F A;  4FWS A;  2E2O A;  4BQL A;  1NGI A;  5M1Q A;  4BR7 A;  4BEC A;  2HBJ A;  3MX5 A;  5JIC A;  3AAP A;  3O9T A;  5JVG L;  5GAE P;  3FZH A;  2A5X A;  5EVZ A;  3SBG A;  1BOT O;  1YXQ A;  4A59 A;  5C12 A;  4RTF D;  4M7Y A;  4RWT A;  3PLA A;  2CGL A;  3CI5 A;  5HOO A;  1MWK A;  4FPA A;  3QBW A;  5AQG A;  3VEX A;  4Z94 A;  2YHW A;  2P9I B;  1VQ7 N;  4B1U B;  5C2D A;  4JD2 A;  2FSN A;  4IJN A;  3CQX A;  4BRN A;  2D4W A;  3D2F B;  5AQS A;  3J7Z O;  4CZI A;  3M5R A;  4BY9 C;  2OAN A;  4EAH D;  3O5B A;  5AQX A;  2IVN A;  3CQY A;  2EWS A;  3FLC O;  4BRQ A;  1YF5 L;  3LDP A;  4CZG A;  2NNW A;  2QA4 N;  4IEE A;  1QVF M;  1TYQ A;  5EX5 A;  1U6Z A;  1E4F T;  2QTD A;  5JMV A;  4FWP A;  4FOI A;  5AZI A;  1VQ5 N;  4NLC A;  1VQO N;  3VF6 A;  3I56 N;  1NGE A;  1Q7Y O;  3EKU A;  3BP8 A;  4PL7 A;  1YUW A;  3LDO A;  1NGG A;  4FL9 A;  4B9Q A;  1KC8 O;  5AQN A;  1K8K A;  3TSQ A;  4WFN L;  3C7N B;  5BPN A;  2VCP A;  2AA4 A;  5AQO A;  4U67 L;  4ISG A;  5F0X A;  4BGA A;  5KPR A;  3H1Q A;  4MO4 A;  3G6E N;  5JLH A;  4PKH A;  4A57 A;  4NLB A;  2D1K A;  4WCE L;  4B1X B;  1X9J A;  5AQL A;  5M1P A;  4C23 A;  4JHD B;  3WEE B;  3ZX0 A;  3A5N C;  4H0O A;  4IOX A;  2FSJ A;  2IIR A;  4RCH A;  3M3Z A;  4JKA A;  4EHT A;  4BRF A;  2I7N A;  4B1V A;  1VQM N;  3D7E O;  1RFQ A;  3P39 A;  2YCH A;  4A5A A;  5EY4 A;  1BO5 O;  3A0I X;  3O80 A;  4BRD A;  5CHI A;  4DKW A;  1NGA A;  5CE3 A;  2P9K A;  2P9U B;  3VMF B;  4FWM A;  3S41 A;  3CCS N;  4G9Z A;  4BR0 A;  2C1G A;  4H0Y B;  4A61 A;  5DM6 L;  4WQ4 A;  2E20 A;  5GAD P;  1BDG A;  2CGJ A;  1QQM A;  4YOY A;  1VQN N;  2VYP A;  4CD3 A;  1ESV A;  4WQ5 A;  3CPE A;  4O8K A;  1YJ9 N;  3VGM A;  2P9P B;  4MLH A;  5HL7 L;  3HOT A;  3AAQ A;  3B8A X;  5AQY A;  1GLA G;  4I6M B;  3UKR B;  1GLJ O;  1P8Z A;  5BRE A;  3F9M A;  4JKD A;  2E2Q A;  3OW2 M;  3U9D A;  2P9L B;  1JCG A;  2Q31 A;  3VEO A;  4BRE A;  1S3X A;  4CI6 A;  3H6E A;  1ATS A;  1K9M O;  5BRH A;  3E9P A;  3A5O C;  1H1V A;  1LOT B;  3VEZ A;  1OKJ A;  4FWO A;  3WXL A;  2ZJR L;  1ATN A;  3D2E A;  4YDU C;  4XJX A;  2YHY A;  5BR9 A;  3N4Q A;  4H03 B;  4H5W A;  3CCR N;  2P9P A;  4IXC A;  3CPW M;  3ID6 A;  4L3Q A;  3UB5 A;  3DXK B;  4CZJ A;  2Q36 A;  3NVM A;  2QWQ A;  1DKG D;  5GIP A;  2Q97 A;  4OPA A;  5AQU A;  5AZJ A;  2QEX N;  3L0Q A;  2Q1N A;  2HBL A;  1GLE G;  3SLC A;  4YOR A;  3RSE B;  3OHR A;  3HOS A;  2C1I A;  5E84 A;  3VES A;  1YIJ N;  3SAG A;  2ZGZ A;  5KQ8 A;  4CD1 A;  5AQM A;  4BRI A;  4IOC L;  1BA0 A;  3O08 A;  1EQY A;  5C10 A;  3GE1 A;  5AFU H;  3FE1 A;  4KH5 A;  4AM6 A;  4CBX A;  3SMP A;  3VGK A;  4CZL A;  4JEP A;  1VQL N;  4BQZ A;  4WF9 L;  1NJI O;  4KBO A;  4BRM A;  1NGC A;  5EOY A;  2NRW A;  4WFA L;  3CCV N;  1W97 L;  3GOI A;  3DLL L;  3LDN A;  5ELZ A;  1J6Z A;  2ASM A;  3HRG A;  4FWQ A;  4H5T A;  3P38 A;  3VEY A;  1RDU A;  1YVN A;  3AGR A;  1ATR A;  4C1N I;  2P9S A;  2V51 B;  3U9Z A;  3H1V X;  5GAH P;  1Q81 O;  4ISE A;  4BVP A;  4IOA L;  4JD2 B;  2GEL A;  1BWF O;  4XH5 A;  3JS6 A;  1GLL O;  2NZT A;  3E66 A;  3F5T A;  3H3O B;  4KH6 A;  4H5R A;  4WYB A;  3CJA A;  1YJW N;  1KAY A;  3KWG A;  2BH1 A;  1Z05 A;  3SK3 A;  1GLF O;  1XQS C;  4U7B A;  2PAV A;  1SS6 A;  2W40 A;  4IWV A;  4BR9 A;  1GLC G;  2PBD A;  1NMD A;  3R6M A;  1E4G T;  1TYQ B;  2GWJ A;  2OTL N;  1Y64 A;  4K43 A;  4JKG A;  3I8B A;  5C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...