1XR5A

Crystal structure of the rna-dependent rna polymerase 3d from human rhinovirus serotype 14
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
460
structure length
460
Chain Sequence
b'GQVIARHKVREFNINPVNTPTKSKLHPSVFYDVFPGDKEPAVLSDNDPRLEVKLTESLFSKYKGNVNTEPTENMLVAVDHYAGQLLSLDIPTSELTLKEALYGVDGLEPIDITTSAGFPYVSLGIKKRDILNKETQDTEKMKFYLDKYGIDLPLVTYIKDELRSVDKVRLGKSRLIEASSLNDSVNMRMKLGNLYKAFHQNPGVLTGSAVGCDPDVFWSVIPCLMDGHLMAFDYSNFDASLSPVWFVCLEKVLTKLGFAGSSLIQSICNTHHIFRDEIYVVEGGMPSGCSGTSIFNSMINNIIIRTLILDAYKGIDLDKLKILAYGDDLIVSYPYELDPQVLATLGKNYGLTITPPDKSETFTKMTWENLTFLKRYFKPDQQFPFLVHPVMPMKDIHESIRWTKDPKNTQDHVRSLCMLAWHSGEKEYNEFIQKIRTTDIGKCLILPEYSVLRRRWLDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Transferase
total genus 117
structure length 460
sequence length 460
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1xr5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xr5A02
2BRKA 1LW0A 1GX6A 1REVA 4I2PA 3DLGB 3V4IB 3CO9A 4I7FA 1LWEB 1JLQA 4R5PB 3QIPB 4JV0A 2WOMB 5KFRA 2ASDA 4B3OA 1S48A 4ZVEA 5KFXA 5L1IA 4IRDA 1C0UA 1S6QB 4ZVGA 4YMEA 2BQUA 3QGGA 3QO9B 4LSNA 4IR9A 4JV1A 1N6QB 3G6VA 1T05A 2VG7B 2C2DA 4RW7A 2OPPB 1TVRB 3MR2A 3IG1A 1DLOA 4G1QB 4LSLA 2WRMA 1QE1A 3DI6A 2FVSA 3OHBA 1MU2B 4F4ZA 1JLEB 5J2MB 4RU9A 3GQCA 1RAJA 4PWDA 3MEEA 2R8GA 2V0NA 4RNHA 2BE2B 1TKTB 4ZVHA 3KK1B 1FK9A 2AGQA 4MK7A 3PZPA 3RB0A 4ZPBA 2HNYB 5F8HA 5J2PB 4ZP7A 5KFSA 1JLGB 4ZP9A 1S1WB 3KLVA 4J9NA 1C0TA 4ICLA 4ECXA 3PVXA 4J9SA 3CDEA 4ZHRB 1RT5B 1LW2A 4H4MA 4Q44A 2XCAA 3V6DB 2AU0A 2YNHB 4URGA 3V6HA 5L1KA 1BQMB 2ZE2B 3FRZA 5C24B 5KFMA 1EP4A 1N5YB 4QWBA 4O4RA 3V6KA 4NCGB 2B6AA 4K4VA 5KT3A 4J9LA 5KG2A 1SH2A 1R0AA 3H2LA 4EBEA 3QZ7A 1TQLA 4NLSA 4TLRA 1MMLA 1RTDA 4ECZA 1K1SA 3KNAA 3H5XA 4NLPA 2IAJA 5D3GB 1D1UA 1EETA 3KHLA 4ZVFA 2WHOA 1IKVA 1S9EA 4H4OB 4NLWA 1K1QA 1RT3A 5KFTA 3UDLA 3QZ8A 4F50A 4ED0A 4EBDA 4RUAA 3OSNA 3KLHB 3FFIB 3KHRA 2C28A 1RT4A 2UVUA 2AGPA 2XI3A 3ICLA 5F8NA 4KFBA 3CJ3A 1IKXA 5KFNA 4Y2AA 2ZKUA 4TN2A 4WZQA 2BRLA 1TKXB 4WFXA 5F8GA 4K4UA 2AGOA 5KFQA 5DLGA 5DG7A 2V9WA 1RTHB 5JUMA 1TL3B 2VG5A 3ITHA 1Z4UA 3GIKA 2JEFA 4PUOB 1TV6A 5K14A 3JYTB 5JXSA 3NAHA 3BR9A 2RF2B 3NBPB 1N4LA 1HPZA 4MH8A 2HWHA 5CYMB 4IQXA 4EO8A 3GIJA 1S1UB 3IGVA 3DOLB 1DTTB 3Q8QB 1S1XB 5KFGA 4WFZA 4ZMMA 5J1EB 2IM3A 2E9TA 2VG6A 4J9RA 3KLEA 3QGIA 4K4XA 5HROB 2XCPA 3LAMA 1IKWA 4GC6A 4IH7A 4IR1A 3DYAA 4MIAA 3UPFA 1T03B 1VRTB 5HP1A 2FVCA 2XGQA 2YKMB 2YNFA 4JUZA 3T5KA 3HVTB 3LP1A 3KOAA 4R8UA 3DLKB 3DLEB 4IDKB 5HBMB 2AWZA 4QWEA 2J6SA 4O3SA 4NLGA 4IKAA 1RTJA 5KFYA 5F9NA 5KFPA 2BANA 1HQUA 3DDKA 1CSJA 1JLFB 2IJNA 3N6LA 4RW6A 4ED3A 3PW0A 3UQSA 5L9XA 2ILZA 1FKPA 5KG5A 2J6TA 3C6TA 3CIZA 1LW0B 1S6PA 1SV5B 4PQUA 2W9BA 4DL3A 4WYLA 3C6UB 3I5BA 5KG4A 1SUQA 1RT6B 2W8LA 1UWBA 3MECA 4F4XA 3TQ1A 5FDLB 5L1LA 3KK3A 1C0UB 1JLAA 4URSA 3HKWA 4XPCA 4RW8B 3KJVA 2ASJA 1TKZB 2IBKA 1HNVA 2EC0A 2J6UA 3DRSB 1S1VA 3QLHB 1BQNA 4RW7B 3LAKA 2AX0A 3RBEA 3OSPA 3OLBA 1JLCB 1SH3A 5I42B 5I3UB 2JEIA 1S0OA 1RT1A 4WZMA 1QE1B 3KLIB 4IFVB 4IH6A 3DI6B 2W8KA 2ALZA 4MKBA 3QIDA 2IC3A 5KFLA 2W7PA 4PWDB 3MEEB 3VQSA 3Q8RB 4ECTA 3LP2B 3LP0B 1IM4A 3PW2A 4NLVA 1FK9B 3ISNC 3T19A 3PR4A 3KLGA 3H59A 1JLBA 1XR5A 3GIIA 4YR3A 3NL0A 4TY8B 2ASLA 1XR6A 2C22A 3RB3A 1C0TB 5C25A 5C42A 2FJXA 3HVAA 2I1RA 4LQ3A 4U7CA 1LW2B 3PHEA 4H4MB 4FBTA 4TQSA 4RNFA 1LWFA 4ZPCA 4RNOA 1DTQA 2JEJA 4O4GA 3DMJB 5KFDA 4RZRA 3RAXA 1S0MA 3OL6A 1EP4B 1S1TB 3E01A 3H5SA 2F8EX 3SFUA 2B6AB 5KG0A 5KT2A 4QWAA 4FS1A 2IA6A 3MEDA 3DOKA 3FQLA 5KFWA 3IGNA 2R8IA 2IM1A 1RTDB 2HNZA 4KO0A 2IMWP 2GIQA 3BSCA 2IAJB 2AQ4A 4EO6A 4MK8A 3T1AA 1WNEA 1EETB 3MFHA 4R0EA 3KK2A 2FVRA 3TAMB 1IKYA 4KB7A 2WTFA 1IKVB 3GV7B 4FS2A 5DLFA 2QV6A 3H5YA 4KV8B 4IOBA 5KFJA 4Q45A 2FLLA 3OL8A 5EDWA 3I0SA 1JKHB 2W9AA 4KFBB 2OPRA 1IKXB 3MEGB 5KFEA 3H4DA 1N56A 4TY9A 4EYHB 3D28A 3H40A 4J9KA 2OPSA 3N6NA 2IJFA 4ED8A 1HQEB 2C2EA 4MFBA 3N6MA 4ZPAA 4F4WA 2WCXA 1S9GB 2FLPA 1KLMA 1HPZB 4ZPDA 3CJ2A 4U6PA 3I0RA 4XO0A 5KFIA 1HNIB 2YKNA 3BGRA 4XPEA 2WONB 2VG6B 3DLGA 3KMSA 3KLEB 1T3NA 1C2PA 1LWEA 1IKWB 4X2BA 2FVQA 2WOMA 3BSAA 3DYAB 5KFKA 4DG1A 2VA3A 2CKWA 1S6QA 3V81A 4NLDA 4LQ9A 4ECYA 1ZTWA 2ATLA 4R8UB 3OL7A 2HWIA 3EZUA 3T5LA 3RB6A 2BANB 2HMIA 2OPPA 4RW6B 1TVRA 4J9OA 4IG3A 4ED6A 1HMVA 2RDIA 4O44A 4KKOA 3CDUA 4I2QA 3DRRA 3MR6A 3C6TB 4ZP8A 2W9CA 3G6XA 1T94A 2UVRA 4PQUB 2W9BB 4NLRA 5DQIA 1RTIB 1TP7A 1SUQB 4RW9A 1TL1A 1HYSA 3FQKA 5KT4A 1JLAB 4JV2A 2OPQB 2HNYA 4MK9A 1HNVB 2GIRA 1JLGA 4EYIB 1BQNB 4IH5A 2R2UA 3M8QA 2BQRA 4NRTA 2YNHA 1NNDA 4J9MA 4DL7A 2R2TA 1FKOA 3SFGA 4ZP6A 1BQMA 2ZD1B 3CJ5A 2C2RA 4NLTA 5EWFA 2V4RA 3FDSA 3H5UA 5EUHA 2UVWA 4TXSA 5DG9A 3KLGB 4YQWA 1C1BB 4Y3CA 2RDJA 3IN5A 4FBUA 2HAIA 1JLBB 3CJ0A 3PJXA 3T5JA 1REVB 4QW8A 3JSMA 4I2PB 3PW7A 5D3GA 2HNDA 3DRPA 4YR0A 4I7FB 1GX5A 3TVKA 1JLQB 4TYAA 5J2QA 2DPJA 5C25B 2FVPA 4H4OA 3MTKA 4B3OB 3QGHA 3M9NB 1N48A 5EWGA 1LWFB 2XWYA 1U09A 1DTQB 2UUTA 4NLXA 4NYZA 4LSNB 4O4GB 3I5CA 5DG8A 1T05B 3RBDA 3CWJA 5KFVA 3NGDA 3KLHA 1S49A 3OL9A 4K4SA 3IG1B 1DLOB 3MEDB 4EBCA 5EWEA 4LSLB 1LWCA 4WE1A 1TKXA 4ECSA 2IM2A 4MKAA 5KT5A 1RTHA 1TL3A 3KK2B 4F4YA 4ECWA 2W7OA 4H54A 3JYTA 3M8PA 2D3ZA 2RF2A 1RT2A 1JIHA 4ECUA 4O3RA 5CYMA 4GC7A 4IG0A 3UR0A 4KAIA 2XC9A 2R8JA 4Q0BA 1S1UA 3DOLA 1DTTA 3I0SB 1S1XA 3KLFA 5J1EA 4ECVA 3BSNA 4HKQA 4ICLB 5KG7A 2E9RX 3I5AA 1T03A 1VRTA 5CYQA 4O3QA 2RKIA 5T14A 5L1JA 3RAQA 4Y2CA 4K4ZA 3IS9A 4DL5A 1J5OA 3HVTA 3Q8SB 3DLEA 4IDKA 1S9FA 4IRKA 2B5JA 3CDWA 3Q8PB 3OLAA 1R0AB 1KLMB 3MR5A 3SI8A 4YP3A 2WB4A 4ID5A 3BGRB 2YKNB 3FSIA 5J2NA 2YNIA 1SV5A 4G3IA 2O5DA 3C6UA 1S9EB 4NLUA 1RT7A 3EPIA 2OH2A 1RT3B 1S97A 1C1CA 1RT6A 2I5JA 4DG1B 4MIBA 5FDLA 4ECQA 1RYSA 3V81B 4RW4A 4RNMA 4RW8A 4M95A 1TKZA 1RT4B 2YNGA 3DRSA 1NHVA 3QLHA 3DM2A 2BR0A 4DL6A 3MR3A 2HMIB 5KT7A 4ED2A 4Y34A 5F8LA 1JLCA 1QAIA 5I42A 4IG3B 4NZ0A 3D5MA 4IFYA 5I3UA 1HMVB 4O44B 4KKOB 3KLIA 3DRRB 4I2QB 4IFVA 5HLFA 2W9CB 1VRUA 3M9OB 3PW4A 2VG5B 3ITHB 5F8MA 4TQRA 3EPGA 2R8HA 1TV6B 3NMAA 5K14B 3LP2A 4RW9B 3LP0A 4J9PA 3BQ1A 1TL1B 1HYSB 4KSEB 5DQHA 4HYKA 3IRXA 4YR2A 1D0EA 1RDRA 2B43A 4ECRA 4O3PA 2JC0A 2CJQA 4RNNA 3V6JA 4Q8EA 5KG3A 4TY8A 1XR7A 3V4IA 4J9QA 4KHRA 4R5PA 3QIPA 1RYRA 4M94A 3M8QB 3CVKA 3GV8B 5HP1B 4URQU 4KHMA 3NKYA 3PW5A 2YNFB 3LALA 1FKOB 1HARA 4K4YA 3LP1B 2JLEA 3DMJA 3QO9A 1N6QA 5KFHA 1S1TA 5KG6A 1RTJB 2VG7A 2UUWA 1HQUB 4G1QA 5KFAA 2VA2A 1FKPB 5KFCA 5DGAA 3KHGA 1S6PB 1I6JA 1MU2A 1JLEA 3JSMB 5J2MA 2HNDB 3DRPB 4QW9A 4O3OA 1ZTTA 3MF5A 2BQ3A 2FJVA 5J2QB 3TAMA 3BQ2A 2BE2A 1TKTA 1UWBB 3ISND 3KK1A 3MECB 4KV8A 3KK3B 2E9ZA 5KFOA 3RB4A 3BREA 2ILYA 4K4TA 3KJVB 4O3NA 3BQ0A 1W25A 5J2PA 5F9LA 1S1WA 1S1VB 3NAIA 3HHKA 1JKHA 1KHVA 4ZHRA 1RT5A 1RT1B 1S0NA 3MEGA 4EEYA 3V6DA 1LWCB 4WE1B 2XI2A 4K4WA 4Q43A 2IC3B 2ZE2A 5C24A 5C5JA 1N5YA 1HQEA 4NLQA 4NCGA 3GIMA 2AX1A 3M8PB 1S9GA 3KHHA 1NHUA 1QAJA 1RT2B 5KFFA 3GYNA 3H98A 1RA7A 1OS5A 4Q0BB 4IG0B 4QPXA 1HNIA 1JX4A 2IM0A 2GC8A 1SH0A 3KLFB 2JEGA 4WXOA 2D41A 2WONA 5C42B 2QE5A 3M9MB 2D7SA 5CYQB 4OL8A 2RKIB 4TYBA 3IS9B 1J5OB 4KE5A 3E01B 3LANA 5KFBA 2R2SA 2FJWA 3FFIA 2V4QA 3H4BA 3G6YA 4ED7A 2B5JB 4Q8FA 2JC1A 3E51A 4WXWA 5KFZA 1YVFA 4WFYA 2WK4A 1S4FA 3CJ4A 3DOKB 3QYYA 5KT6A 4DL4A 2HNZB 4KO0B 4ID5B 4DEZA 4RUCA 4QWDA 5J2NB 2YNIB 3KMQA 2FLNA 1IKYB 4PUOA 3G86A 1QUVA 1RT7B 1RTIA 1ZETA 2D3UA 1C1CB 2I5JB 3NBPA 1KHWA 3HVWA 2OPQA 4RW4B 3BSOA 3GILA 5DGBA 4NLOA 4NRUA 3PJWA 3PR5B 2YNGB 4DL2A 4ED1A 3DM2B 5F8IA 5HROA 4WYWA 3GV5B 2OPRB 3MFIA 4IFYB 5KFUA 3BJYA 4QWCA 1S10A 2UVVA 2YKMA 5HLFB 2OPSB 1VRUB 5KG1A 4K50A 5HBMA 5DQGA 4NLYA 3DLKA 3OHAA 2ZD1A 4KBIA 2DPIA 4MFBB 3T5HA 2XGPA 2R8KA 1RA6A 4IRCA 1JLFA 1JXLA 3IRXB 3I0RB 1C1BA 2R2RA 5F8JA
chains in the Genus database with same CATH superfamily
1MN7A 3ENQA 1N36J 3W2VA 2MKHA 2VOOA 3PV8A 2F63A 3MWBA 3IM8A 1VQKS 2WRMA 1MU2B 2BX6A 2BA9A 5LSRA 3B4DA 1QUPA 4ICLA 4ECXA 4H4MA 1UA0A 3AX3A 1X5OA 2CDQA 3OJUA 4BHQA 2JL9A 1O51A 5D3GB 1AT1B 5AXKA 1P8GA 4H4OB 5KFTA 5LSOA 3ZTSA 1RBLA 2ZKTA 3AXKA 4X4NA 4Q5VA 2C28A 5D8HB 4CTAB 1MN9A 5L9NA 1X4EA 3Q23A 1K0TA 2GZOA 4WPAA 1UL3A 1VC0A 2F8MA 4OHYA 3FMWA 3NRBA 4BWMA 1PJ6A 1R89A 4GC6A 4IH7A 5BR8F 1T03B 1VRTB 2NS1B 3KOAA 3LH2S 1T3OA 1HQUA 1OMSA 3CO0P 5CD4A 3N6LA 2VFSA 3IBWA 4F3MA 3ZTPA 3EGNA 2CJKA 3MM7A 3H20A 2EFNA 2ZBCA 4Y6IA 2IC3A 2J8SA 4X4SA 4DR7F 3LP0B 5E3RA 3TO8A 3ISNC 1SKUB 1KOOA 2ROEA 3NL0A 1CLFA 4IUFA 2B7CB 4TQSA 1SC3B 4M5KA 1S0MA 4FS1A 3R5DA 4QWAA 5KT2A 3BGLA 1BC6A 2L9WA 4UT4A 4OLOA 4MK8A 2WTFA 1IKVB 2CQ3A 4LF9F 4DV5F 4U96A 1MLAA 4IO9Q 4YB7A 2RUSA 5KFEA 2DEJA 3CCRS 2OPSA 2GQ2A 2OIHA 4ZPAA 2DY9A 4ZPDA 4GMKA 3OTEA 3WBZA 1M5SA 2UUCJ 3DYAB 4I64A 1WKJA 2MQQA 4G1PA 1VR6A 3SSRA 3PKYA 1X5TA 3K17A 4CLZA 2IRYA 4C7QA 1Y3KA 1KSPA 2W4DA 2Y1IA 4UOCA 1PC5A 4DMZA 2YWKA 1HNZJ 2A18A 2V4JA 5T41A 4GKKJ 1WOSA 2J7KA 3CJ5A 1NH8A 3H5UA 1ZYQA 1HBNB 1F9EB 1C1BB 2CJ9A 1VQYA 4OHVA 1JLBB 3RZAA 4DQSA 5GADU 3C15A 1REVB 4ER8A 2B4VA 1M5PC 4O0IA 3TVKA 1GX5A 3RRKA 1NJWA 1JLQB 5J2QA 2J9EA 2V1TA 2I6WA 1PC4A 5DDQC 2L48A 1LWCA 2CWKA 2GVZB 3CCZA 1VJQA 5CYMA 3UR0A 3HHDA 4NL5A 1A6LA 1EIYB 2C42A 3A8EA 3CCTA 4EU0A 2J7UA 1NCLA 1MSWD 3CDWA 2CQCA 4IQMA 2DNGA 5AE1A 2GMHA 3W60A 4QR0A 2ZH5A 1K44A 2PMHA 1F5AA 3HFVA 4M95A 3EM1A 1RT4B 4TKTA 1IBMJ 5DQHA 3HM9A 1AZSB 4CNZA 2B43A 3TP2A 4J9QA 3CVKA 2UXBF 5HP1B 1U47A 1FD8A 3LP1B 3B82A 3K8WA 3VHQA 2V1SA 5C2GA 5DGAA 4F3OA 1S6PB 3PRVA 5KTQA 3M6WA 4O3OA 3CCQS 5KFOA 5F9LA 5BJRA 4TVAB 3HHKA 3F73A 2RHQB 1RT5A 4U9RA 4N41A 3WIUA 2KZMA 2XMAA 2VQFF 4HR2A 4NCGA 3DN9A 4KYZA 3CD7A 5DDRC 3PX4A 2K8GA 5SUHA 3P5BP 3RTVA 4A8KA 4NA1A 2QMWA 2GV1A 3PFEA 2YPZA 2HZVA 1UFLA 1UTAA 2UU9J 2I5JB 1UPPA 4OHXA 2OPQA 3J7YI 4ED1A 2E5LF 3PX0A 3ZZUA 2ZD1A 3MCMA 2ZUAA 1WKKA 3OVAA 2V50A 5FLXU 4WJBA 3V4IB 3CO9A 4X62F 1RWUA 2ASDA 5KFXA 3MM5B 1GXUA 4U8YA 1WC6A 2RNEA 4ZVQB 1YJTA 8AT1B 2KG1A 1UEKA 4DQQA 4W90B 2VL1A 1U1KA 3D1OA 5A8KA 2GHPA 4BS2A 1UP1A 3VGUA 3BKTA 1VLYA 3CJKA 3HMJG 1NEEA 5KFMA 3DKDA 1N54B 3V5RA 4I4BA 4J9LA 1E6VB 2VBXA 4EBEA 3OR1B 1F3FA 3NNAA 2HFUA 1RE1B 1KEKA 4ED0A 2DIUA 3DXBA 3Q22A 2Z57B 4LR8A 3KLHB 3S01A 3GSDA 5JUMA 2O66A 4F0KA 1RWNB 1NDCA 2E5HA 1JJ4A 4EO8A 2HVHA 4EI2A 3Q8QB 4R0JA 1NMEB 2UUBJ 5HBMB 4QWEA 1U1NA 3NNCA 2IJNA 4E8UA 1R8CA 2HK2A 4OI1A 4C3MA 3NGUA 3I5BA 3W2VB 5D15A 4X65F 3ETOA 1RUSA 2PA3A 3MOZA 4X4OA 1RT1A 3UVJB 3KLIB 1LKZA 3RYLA 5JMNA 4EUVA 4BC7A 2B0GA 3UR3C 2DNLA 3HHLB 3M8WA 5L38A 3GWCA 5C42A 4U95A 4H4MB 4RNOA 2JEJA 3D6TB 4TU7A 3VWSA 3GP9A 1SB6A 3DDIA 2IA6A 3I82A 5KFWA 4F04B 3UN5A 1VJWA 4MYUA 2GIQA 3BSCA 4DZ6A 3R5CA 2BOPA 2MTLA 4YDXA 3AD8C 3PKMA 3H42A 4OZ2A 1IBLJ 3D0GE 4PCQA 4TU9A 3TJAA 2AYGA 1KN6A 1OIAA 3C14A 2YH1A 1VOMA 4XO0A 3TANA 4DX6A 4DR3F 4XDCA 5EX3A 3T5LA 3CCLS 4O44A 3MR6A 2A0FB 3MPVA 4P2MA 2QLXA 3MM7B 3M8YA 2OEMA 1NKBA 3D4JA 3A3NB 2HHUA 2E7XA 4BBYA 2IFXA 2O3DA 5EWFA 2IRUA 4F0MA 1P1LA 3NGRA 3EX7B 1RHUB 1XJWB 2UXDF 4AFFA 3KNGA 5DDOC 3TI0A 4NXNF 2I38A 5E0OA 3SCKE 5FIIA 2AD9A 1TMJA 3CSKA 2KO1A 3OR2B 2M52A 4O23A 4WE1A 2ZUGA 4DUZJ 1TU0B 3D1QA 2RUGA 4CT9A 2FIUA 3SCIE 1F5CA 4C97A 2OD6A 3DOLA 2UXCF 4F7VA 3FVYA 4UZCA 3Q89A 2ZDPA 1H7XA 1X0PA 1P27B 2HHPA 1YBTA 3K7RA 2OO4A 3NCQA 3D2WA 5AJ3F 4OZNA 4RW8A 3ZZRA 3DRSA 2BEFA 1QAIA 1YDLA 4MIWA 1SKSA 2CAJA 3J7Z5 4ECRA 4CO5A 2YWHA 2CJQA 2LQJA 3UO0A 4KHRA 1VRQC 5HQMA 3PW5A 1RAGB 1N6QA 2LCWA 2AEMA 3I4HX 5KFAA 1RU2A 5J2MA 4OYBA 2C2MB 2HQDA 5J2QB 5K8MA 1ITPA 1LK7A 2DGWA 3AJDA 3BS9A 3MEGA 4EEYA 1LWCB 2I8EA 1AROP 2IJRA 3G8TA 1KVIA 3LA0A 2V94A 2M0GB 1QVFR 4QPXA 1HNIA 2XSJA 2XLJA 3GJRB 2HLTA 2D41A 2WONA 3MGJA 5HN0A 4GVLA 4YDDB 3EUNA 3FK4A 2D1CA 3HX9A 5KT6A 3KMQA 2A6MA 4PUOA 4QOTA 4GKJF 1TR0A 3HVWA 3OV7A 1TL5A 1FI4A 3IFEA 4ZN1A 4WYWA 2OPRB 4OYXA 3MFIA 2XMMA 1N88A 2HBQB 3UI3A 1ZBTA 2WSFC 5HJXA 2LXUA 1W2BR 5IC6B 4ZVGA 3RJMB 2BQUA 4DPWA 2FPHX 4RJVA 3K8VA 1TVRB 3MR2A 2CQHA 4LSLA 4DDFA 3FZBA 1HFEL 2RRBA 2AGQA 2V8HA 2ERRA 1F5BA 4FF3A 1GTHA 3CDEA 1RT5B 1T9TA 1CC8A 9ATCB 3LGMA 1FEHA 4NASA 4DR2F 2E29A 2GAGC 4O4RA 5AT1B 4NCGB 1M5KC 3M2RB 2J9DE 3GE9A 3B6BA 3CCJS 3OSNA 2OLWA 2EFOA 3J80U 2QSFA 2DJWA 3CJ3A 2ZKUA 1TKXB 1H6KX 2CRLA 3QWUA 2VG5A 4NXMJ 1FESA 1Z4UA 4X66J 2CIMA 1U1OA 4IQXA 2DIVA 3SXLA 4CYUA 2EK1A 4K4XA 2ZITA 3T5KA 2MKSA 3VV2B 2CZ9A 4LF7F 3G82A 2NXUA 1XQIA 4NA2A 2KM8C 3K5NA 4XK8C 2UV8A 2V34A 5FDLB 2W2MP 1BQNA 4Y00A 1VQ4S 4FPIA 2W8KA 4DWIA 4MKBA 2HW3A 4DQRA 1IN0A 3RBZA 4FPRA 2JDJA 4IOAQ 2HBRB 4OJGA 1FTRA 2PD1A 2QA2A 2V2VA 5IWAJ 4RWXA 1CJTA 4F3QA 4X84A 2MLXA 1WJ9A 2GHVC 3IBFB 3SQGB 3MM8A 3H90A 2MZRA 3BEGB 4KO0A 4JI0J 3G2XA 4PKDB 1UUJA 2CQ4A 3D67A 3MAHA 1OSDA 3I0SA 5DZ7A 3O8WA 3TJ8A 1TFYA 1BMQB 2C2EA 1ZA2B 1CJUB 1S9GB 2KT5A 2XTJP 4DX7A 2OSQA 4A8MP 5K20B 3H0PA 1HMVA 4FP9A 3ILIA 4RW9A 2HFOA 1HI1A 1RKIA 4IOCQ 5KT4A 3SBMA 1HW9A 4HT5A 2HNYA 2KT3A 3HSZA 4JI6F 4OYAA 4N47A 2PN6A 2V67A 4UY8T 1NNDA 1FKOA 1CULA 3CMQA 4HL9A 4DX5A 2MKCA 3TWZA 3DU5A 1QAYA 2CVIA 2K3KA 5B09A 4I7FB 1YZ6A 4HH0A 3CJRA 4NLXA 2J0QD 3I5CA 3B78A 1AB8A 3W63A 1LWXA 3R5JB 3NS5A 2B4UA 3BH7B 2HQ3A 3BGFA 2LMIA 1XBWA 3UFCX 3NS7B 2EWHA 5KG7A 3C16A 3I5AA 3DLEA 1KTVA 2MJNA 3ELHA 2JVRA 2JJ4D 2O5DA 3C6UA 5IM0B 3VAKA 4DCOB 4K8RA 1KDNA 1RYSA 3HJFA 1NM2A 2ZH2A 5LT5A 4AL5A 1KONA 3MR3A 4OYPA 4O44B 5K14B 1RDRA 4JI4F 4O3PA 2CQIA 1NK9A 2G2YA 1PILA 4LF5J 3DCAA 4PXCA 2YNFB 4ZS6A 2QFIA 3CUNA 2R7UA 1NJXA 2BE2A 1UWBB 2KFYA 4KRWA 3KK3B 1UKUA 2F8HA 4P72A 5EGYA 1S1VB 1D9FA 2QA4G 1FHTA 4WE1B 4Q43A 4BWJA 2HGLA 2NXNA 2VFTA 5M2UA 3QBCA 3H98A 2G4BA 4X4UA 1JX4A 2JEGA 3QT5A 4OI6A 5CCLA 2J0WA 2WVBA 3LANA 2V4QA 2BVZA 3CCES 5KFZA 2CPXA 1HD1A 3HHNB 4PZVA 4HTIA 2HHSA 5ETQA 4FF2A 4NLOA 4DL2A 2D9OA 2B7BB 2C1EB 3JQKA 3UD3P 1XNRF 5FLXY 4KBIA 3IAM9 1D9AA 2W25A 2H9ZA 4A8XA 1RAIB 3BO3A 4ZVTB 4ES3A 4JV1A 1N6QB 2RDDA 1O8BA 5GAHU 2OPPB 2M8DB 2PMZD 1RHJB 5J2MB 2KXHA 2BW2A 3TW0A 1MW7A 3RB0A 3U1MA 1Q7YT 4ZPBA 2KRRA 4J9VA 4FKXA 2HHTA 4Q44A 3M2UA 4WTOB 2Z30B 5GMKa 2F1FA 1UW4A 4FYWB 2J5AA 4S0MA 3H2LA 3UCZP 1M0SA 5E3AA 3U27A 1S9EA 3UDLA 3GMGA 4UQTA 4OX7A 3B54A 2IVFB 4ZJQA 2AGPA 2BRLA 1RTHB 1TL3B 4PUOB 1XEZA 2HS4A 2RF2B 1DFDA 2VG6A 2LXFA 3KLEA 4LF6F 1T9YA 3R97A 2LQ9A 1GMVA 3EVWA 4F2RA 4RBUA 4NLGA 1P6TA 2MLZA 1RT6B 1HNZF 2D3OR 2FHJA 1JLAA 3AD7C 4GKKF 1P9YA 1SIZA 2XTDA 3LAKA 2AX0A 3LWLA 3W65A 4ECTA 3Q8RB 4X64J 2HGMA 2KI2A 3IR6B 3EJMA 1LQ9A 3CCMS 2W2PP 3WHIA 1DY3A 3JSBA 3DOMA 1CJVA 2G0CA 3IGNA 2LQ8A 3MUVP 5LL6d 3TAMB 2QFJA 1KFSA 4F36A 4ZCMA 3ENVA 3D28A 4QZVB 4ED8A 4YFUA 1KLMA 2MQ8A 1HI0P 4CYUB 1KTQA 1LWEA 4OZ3A 1NK4A 4OHWA 1EQ0A 2VPZB 1IBMF 4KTQA 4IG3A 3G82B 2VD3A 1ZZFA 2NYIA 1RI7A 1TP7A 3FQKA 5JVHQ 2OAUA 2XWXA 2LKZA 1BQNB 3M8QA 1TK5A 2CVEA 1HBUB 4TU8A 4FXVA 2V4RA 3SV3A 2Z8QA 2VU5A 2HAIA 1WWHA 2KYZA 2CPYA 4YR0A 4HACA 2VFRA 4KHPJ 3NGDA 2R7QA 2G2OA 2BOAA 5BXIA 2BE9B 4M63A 3KLFA 2X51A 3I0SB 4PG7A 1BGXT 4NX9A 5T14A 3Q8SB 2G9OA 2UU9F 3AH6A 2VV5A 4AXJA 3SI8A 4DR6F 4ID5A 4FNIA 1PO6A 5J2NA 1ELOA 3MPWA 1OPIA 1C1CA 1IVZA 1S7HA 2AKWB 2RQCA 2VBWA 1HMVB 4ANDA 4J9UE 3Q8YA 3LP2A 4GO5X 4RW9B 4CLTA 4OV6A 2ZC4A 3QJLA 3UN3A 1KLNA 1NB7A 3V6JA 2ZBPA 1OJ4A 1REGX 2DGOA 4OYWA 4DZDA 1FKOB 5KFHA 1CULB 5HMXA 3QRPA 2UUWA 3QT7A 4OYIA 4Q2LA 3KHGA 4QW9A 2F9DA 1YRTA 4WKYA 2MY7A 1YGYA 4OQJA 4CLPA 1S0NA 2CNKB 2DHXA 4PPDA 2ZE2A 3A8JA 1HNWF 4WP9A 1VQOS 1HQEA 2GJIA 5A2QU 3GIMA 1QAJA 3DLJA 4B3MF 1U26A 5DM6Q 2QE5A 1X60A 6FDRA 4DPOA 2FJWA 4EK2A 2D3O1 4DL4A 2HNZB 1NDLA 2D69A 2ZM6F 2CJYB 3FBBA 2FD2A 2UUBF 2ZHOA 2QX0A 3BSOA 5B0DA 3PYFA 3ZNJ1 1K47A 4NRUA 2MKJA 2IVMA 3HD1A 5A8RA 3TUZC 4A46A 1XK8A 1S10A 1WC3A 4ZLLA 3R6GB 1NHKL 1RHQB 2XGPA 2QLBB 4LRAA 4KGKA 1RSCA 3DLGB 5KFRA 4DUTA 1UAWA 3W2WA 2CPIA 1Y4ZB 2VIHA 1T05A 1UW9A 2YY3A 2P9GA 2ZWPA 1RAJA 4WK3A 2R8GA 2R7XA 4RNHA 2BE2B 4OZJA 2LA4A 1NU4A 3HI9A 4CLKA 4ZP9A 3KLVA 2KKHA 2VBYA 4OX9F 4J9SA 2QEXS 2SXLA 3C3LA 1HWIA 3CC7S 1U1PA 3VZHA 3GJSB 3FCVA 1IBLF 5AXMA 3J80Y 2UUAJ 4U8VA 5LSLA 2JFKA 2XI3A 3ICLA 5F8NA 3EZOA 5BYQA 2V9WA 5KFQA 5DLGA 3RBXA 4WP3A 1U6FA 3GCXP 3JYTB 3DDNA 3JS9A 2CQPA 2IM3A 2KJVA 4IR1A 1WUUA 5AXNA 2FVCA 4PXDA 2NCKL 4O3SA 4PWWA 3AJ2A 5F0WA 3AOCA 1Y10A 5KG4A 1F3VA 3HKWA 1I51B 5B7WA 2IBKA 4DFKA 2P6TA 2LLZA 1T95A 1Q81T 1N5QA 1OY6A 2F7VA 2GMLA 1FX4A 1S6OA 4YR3A 4EZ6A 5LMNF 4TY8B 1IXKA 3RGIA 4CP5A 2Y9HA 2VUGA 4DUZF 2DT9A 2FYXA 3H5SA 3D66A 3UCGA 1O0PA 1ROFA 2UVRA 3UD4P 1IKYA 4Z7CA 4KV8B 2K7KA 5C7PA 3P96A 4FF4A 1ULRA 2DCUB 5EDWA 1EHWA 3PRBA 1Q8LA 3OBIA 3VAGA 2B4PA 1N56A 1YSJA 3H40A 4N77A 1EJ7L 3N6NA 5CA5A 2MYFA 1WDDA 1JWWA 5HJYA 2RVJA 2VG6B 3KLEB 2DRAA 3HXMA 3VTIA 2K2PA 1KQFB 1G7CB 4LQ9A 1ZTWA 2ATLA 2R7WA 3OT9A 1OY9A 1OM2A 2LQBA 2F65A 1T94A 3FCHA 2QLJB 1VK3A 5MAOA 1JLAB 1H2VZ 4ZVPB 1SJRA 2CG8A 2GIRA 3D6HB 2MGZA 3OFGA 1GAOA 2VQEF 4J9MA 2BACA 2OSRA 2RRNA 5M2RA 4TXSA 3M6VA 3SSQA 5IZHA 2EFQA 2GS8A 2F4VJ 4F0HA 4B3OB 2XULA 2H65B 1SVDA 3KG4A 3UNGC 3IO1A 3CWJA 3A8KA 1WI6A 5ETTA 2YWFA 3DOMB 1CJVB 4ZVUB 3D6FB 3W8PA 5HATA 2O67A 4F4YA 3W64A 1WDTA 5G0RA 2C3MA 4FVMA 1RAEB 1DTTA 3NGTA 1YI2S 3JQMA 3KG1A 5CYQA 5DM7Q 1UCNA 5ETKA 2K1RB 3AX2A 3DGPA 2GJFA 4NMXA 3RW7A 2KJWA 4KR0B 1KLMB 3MR5A 1IJFB 7FD1A 2YNIA 2X1BA 2VKRA 2GA7A 4ECQA 2IPOB 5F8LA 3KYLA 5A8WA 4IG3B 2CQBA 3R9LA 2FZGB 3HD2A 4HHHA 2WBRA 7AT1B 4Q8EA 3FSYA 4CIOA 2C3OA 2PSZA 3M8QB 3W5YA 3NKYA 4WBFA 3DMJA 5HK4A 1FKPB 3ZNUA 1U4BA 2HK3A 2ZZMA 1SL2A 3ISND 1WD6A 4DX8H 1H0HB 1S1WA 2OHDA 3NAIA 2M88A 4L72B 9RUBA 2HQFA 2AJQA 5GAHI 2N3LA 2DVIA 4JP8A 3EGZA 4C98A 2GC8A 3KLFB 2Z4PA 4PR6A 2B9YA 5IS2A 1RJJA 4DV7J 1UVIA 2MZQA 4OL8A 4TYBA 4USMA 1PAUB 2GO8A 4X66F 3WC2A 3DOKB 4ID5B 4RUCA 2HHVA 5J2NB 1FERA 1SKWA 4OI4A 1RTIA 2HHWA 2GVDA 1C1CB 3NBPA 2CG4A 2W24A 2DEIA 3GILA 3PR5B 3ZC4A 4QYZJ 2NPIA 1YJVA 3BJYA 2YVSA 1Q53A 3OHAA 1G4CA 2QRRA 3MM6A 3OUYA 4LFBJ 1VQLS 2HFSA 1RBAA 1HWLA 4DUYJ 3SYZA 1TFWA 1RABB 5D4NA 1S5ZA 3TOQA 2WBMA 5IWAF 3O1LA 3ENWA 3LGHA 3W66A 2XHWA 4DV0F 1BQXA 1F2HA 1VBYA 2HLUA 1N33J 2H5IB 4JI0F 2ZE2B 5KAKA 2B6AA 3JXOA 5KT3A 1R27B 1R0AA 5CAAA 1WACA 3M30A 1FRHA 1K1SA 3KHLA 1RQ0A 1RT3A 2MZ1A 1FNOA 2PA8D 4ITSA 3KHRA 2HIQA 1IKXA 4Y2AA 5F8GA 3GLJA 2ZVIA 1YBAA 2QO3A 5KFGA 3QPIA 3FBEA 2U1AA 4ZIVA 3T9ZA 3QNWB 5A8RB 5CXTA 2JZ5A 2ASLA 1UA1A 2W9BA 1JJHA 3CNQP 4MKYA 3ILJA 3W2WB 4URSA 5L8RC 3KJVA 3R7NB 1SJ4P 3OLBA 3T3FA 3K5MA 1NKEA 4RWWA 4UUWA 3KLGA 1CQMA 1RB0A 3BGUA 2LEPA 3VAMA 2WAQD 1DTQA 4O4GA 2XYGB 2MB0B 5HVHA 1S1TB 3JTOA 4LBIA 1F1BB 2G13A 1APSA 2J0XA 4DCJB 4R0EA 4NI2A 2IDLA 2V8GA 1X5SA 2W9AA 4KT0C 4QJVA 4J9KA 4B9UA 2CPJA 3QJJA 3LWMA 2BMBA 2RIJA 3VZIA 3NG8A 1R0BG 3I0RA 3JB9k 2DNRA 2V69A 3OL7A 2HWIA 1WOOA 2PMWA 4WFNQ 3PXGa 1Z1ZA 4V1Ak 4XAKA 4I2QA 2OMOA 3TZYA 4LF5F 5DQIA 5D4OA 4QYZK 1NJZA 3F0NA 2N3OA 2PI4A 3FDSA 2MXYA 2E1AA 4LF4F 4DV3J 3CDBA 4YQWA 2RDJA 2PT0A 3IN5A 4FBUA 4JI8J 3T5JA 4I2PB 5D3GA 2HNDA 2DPJA 4OI0A 4H4OA 3BO2A 2EXUA 1DLOB 1LNQA 1G3OA 1L5UA 5D77A 1FWPA 3DNCA 1T9VA 1V3SA 2CNNB 2XC9A 5AE2A 2HS3A 3P4UB 1T03A 4LRBA 1VRTA 2XY6A 3THPA 2KH9A 4KQZA 1MROB 3KWMA 4YP3A 4ID8A 3NOGA 1DQAA 4G3IA 1D9DA 4Z7YA 2OH2A 2LVWA 2O1PA 2DNKA 1GXTA 4K0KJ 2H1YA 4NZ0A 2W2QP 1CJKA 2ZJPQ 3M9OB 5F8MA 1XERA 3LP0A 4C8ZA 3IRXA 3OVSA 4DSJA 1NK8A 4LBHA 1LFPA 4HEA9 3PEJA 1BE4A 2MGZB 2JRSA 4RBTA 2V63A 4HH1A 4DS4A 5LOQA 1A7GE 1GMUA 1JLEA 3HF5A 1T8EA 4C8LA 3BREA 4PAAA 3OQ2A 2RRAA 1KHVA 1DZ5A 5A2QY 4DV6J 3QWPA 5HANA 4CRJA 4NLQA 5G0RB 1XNQF 1PBAA 4DOZA 3MD1A 3OXGA 2E66A 4WXOA 4PXBA 3GU0A 3PEHA 1NDPA 3AQPA 5CYQB 3L09A 3HT0A 3VGTA 3DGPB 4DFJA 3R5AA 3TUPA 4JYAJ 3CJ4A 2YNIB 4AE5A 3EVOA 3OFHA 3ET6A 2DCLA 1CBKA 3CDAA 3US5A 1N5SA 5KG1A 2YQ3A 3T5HA 3MPDA 4IRCA 2HVDA 1HBNA 1C1BA 1REVA 3R8YA 1JLQA 4JV0A 4E98A 3BGOP 5HAOA 1C0UA 4AQYJ 3H8YA 3NP5A 3WIVA 1FJCA 3A4TA 2LXIA 1HNXJ 3DXSX 2HFVA 4ZCKA 4CLWA 3SDEB 2AJ4A 1S1WB 4J9NA 2PEHA 2ZBIA 2YNHB 3RG6A 2K06A 3R7SB 5KG2A 1RTDA 2QYCA 4ZVFA 2HQCA 1CVJA 4CLUA 5I3PA 5CH7B 4YN3B 3A1YG 1RT4A 2UVUA 3IR5B 1VYAA 1PJ5A 3FBCA 4TN2A 2H3EB 2V9KA 2XMVA 3NBPB 1U1QA 1RWXB 1HPZA 1Q4RA 3GIJA 5G4DA 3I56S 1R8HA 1N32F 3CB4A 3D68A 2EBEA 2HEKA 5HP1A 4G6VB 2FJDB 3LP1A 1B64A 1CC7A 5F9NA 1NDKA 3MM6B 1S6PA 4F25A 3OUYB 4EMDA 3BKUA 3GR0A 4F4XA 2BE7D 5L1LA 4OZLA 2FC8A 3QLHB 3KTQA 3RBEA 5I42B 4WZMA 1KVJA 2W2OP 4YEAA 5B0AA 3PYEA 1KBRA 3CJQA 1FD2A 4AT1B 4A8QA 3RB3A 1U8SA 5IFMA 3NCRA 2HAFA 4DF4A 4ZIWA 1MMDA 4DLGA 2YKPA 4UOHA 2B6AB 3M30B 3JQJA 5CZVA 1WNEA 4KB7A 2FY1A 5KFJA 3VAHA 5GAGI 4CCHA 2MQPA 1JKHB 1IKXB 2IY5B 2KTQA 4KH0B 2F3JA 1YJRA 4DFMA 2NQPA 1FRIA 5KFIA 2XG8A 3S1TA 3OPKA 1T3NA 4CH1A 3T41A 3R27A 4QU7A 1T0TV 4JI5J 5ETOA 1S4EA 2H4YB 2A10A 4OMFG 2W9BB 2B9WA 1FJEB 4RUBA 3KFWX 4BDPA 2DKOB 3PO4A 2R7VA 3W7BA 4TLQA 2J76E 2C2RA 1RHMB 4NLTA 4N76A 1FKAF 2UVWA 1E6VA 1EB0A 3KLGB 3IWNC 1VDHA 1YJUA 1S76D 1U09A 1DTQB 4LSNB 3JTNA 4O4GB 2DITA 2RT3A 1PJ7A 1X7VA 5IT9U 4P2FA 3KLHA 4KC5A 4DN9A 1QAXA 5GMEA 2NXEA 1I3OB 4LBPA 4ILLA 4ECUA 3SEOA 1DARA 1H2TZ 2DGSA 4C8NA 3M05A 4O3QA 5E3QA 1WTBA 2HRUA 3F41A 3T1YJ 4QU6A 4C0OC 2MZTA 1Q8KA 4W98A 3UE2A 1RT7A 5A6PA 1FRJA 2BR0A 4A4JA 3VGSA 4IFYA 3ZZYA 3UVJA 3KLIA 4I2QB 1TUWA 4KGZB 3NMAA 4NMLA 3HHLA 3OXLA 1OWXA 3FZ2A 3GR1A 3Q0AA 3FCWA 1N34F 1FVSA 1IQZA 2APOA 3MURP 1RTJB 1Q7LB 5E2QA 4G1QA 2JWNA 1I6JA 1GTEA 2HNDB 2Z2MA 2FZKB 1TKTA 2FC9A 4ETXA 3HFZB 4LFAJ 2Q6BA 2DR6A 1FT8A 2V2QA 1F0XA 4LF2A 2AX1A 4A8OA 5KFFA 1QSYA 1SH0A 2FQQB 4WU3A 3M9MB 1Q1KA 4LRDA 4HTJA 2DB1A 4KE5A 3FFIA 1U1RA 4Q8FA 4P75A 2VODA 3O6QA 1UJ6A 3T9NA 1AXQA 2KYXA 2MPUA 4DXLA 5DGBA 4I0WA 1WC0A 1QTMA 1RWKB 1T02A 5H9EK 1CJKB 5DQGA 1NB2A 2QL7B 3TVZA 4M5HA 3LGNA 3KUGA 1FVQA 3UDCA 3IRXB 3ZTOA 1JXLA 5DS7A 2VOPA 4X4RA 1M90T 1T11A 3AY0A 3OR2A 1QE1A 5CD4H 2XM3A 3MPUB 1JLEB 2DTJA 2WVCA 4PWDA 2FJEB 4MK7A 3G87A 2PC6A 2HBZB 4M5DB 4ED4A 2QA4S 3MR7A 3W1YC 1NK5A 1EP4A 3UWTA 2Y1RI 2L9NA 5K8OA 3H5XA 3QZ8A 2Z2LA 1T9WA 2FGCA 2WW4A 4WZQA 4K4UA 3L7UA 3IBCB 1J5EF 4YOEA 1S1UB 4DFPA 5J1EB 3ET6B 3AHPA 1Q78A 3LAMA 2OUGA 3CW2C 3JSRA 1TTHB 4IKAA 2YX1A 1EARA 1JJCB 2L3MA 3CIZA 5BYSA 1SV5B 4WYLA 4L6V3 2F40A 2ZWOA 1C0UB 2QA1A 1H3DA 5D78A 5ETLA 1HNVA 1WHXA 3CJTA 2FB0A 1FDAA 1NPKA 2QLWA 2J6UA 2VZ9A 4Z2XA 4DPUA 2F4VF 1PYOB 4IH6A 2IMOA 4JBCA 1XR5A 4FF1A 1HL6A 3MAQA 2W1BA 3TRGA 2Y1JA 4OLPA 2WVEA 1WI8A 3R3TA 2UXBJ 3M6UA 3V2UC 1RTDB 4ILMA 2AQ4A 2XMKA 3R2CJ 3L7OA 2E1RA 3PY8A 2IDEA 4F26A 3IWLA 5HQLA 2GQQA 1NJYA 3H4DA 2OPRA 3EDQB 2RILA 4F4WA 1OY8A 3HKZD 1LV5A 2WCXA 2FLPA 1HPZB 3CJ2A 1U6ZA 1AUSL 2YKNA 1MG7A 4XPEA 5ETSA 3GFXA 2QSWA 2VA3A 2KFZA 2XS5A 1WC4A 3TUIC 4B17A 4DV2J 2YQ0A 1TVRA 4NPOA 2HHHJ 2H51B 3QMQA 2CWXA 4NLRA 3B8HA 2VPWB 1XWLA 4JV2A 4BC9A 2BV3A 1HWJA 4ZN3A 4CO0A 4U7UK 4OV1A 1HBMA 4A47A 1RCXB 3SFGA 2OTLS 3MMCA 2J7WA 1RHKB 3I55S 2PFFB 4DSIA 2DXDA 3DRYA 1VFJA 3M2RA 1FE4A 5HMYA 5EWGA 2KRBA 2RB7A 1S72S 2A3JA 1SJQA 2WW8A 4UUXA 1ZM2A 4X4QA 1TKXA 3N01A 3M8PA 2D3ZA 4DV7F 2ZZNA 4E2FB 1VQ5S 1PIEA 1SCJB 4USKA 4X4VA 3G6ES 3L9ZA 1SC6A 5E41A 4J5OA 3TA2A 1R7IA 2UP1A 4EFAC 2VPYB 1RADB 5FDLA 4RW4A 4RL1A 3PFOA 4RR5A 1UEVA 3CMES 4YY3J 3C46A 5HLFA 4LFBF 2Q66A 1XR7A 2HZCA 2LFVA 3R7BB 2M2BA 3QT6A 4G1IA 4B3SJ 3D1HA 2CJXB 3R5BA 2Y0SD 2XNRA 3SQGA 4AUKA 3M8RA 3W62A 1VGYA 4PQAA 3KK1A 3T1HJ 1N33F 1RHRB 1L3TA 4ENOA 1AUDA 1DQ9A 2DNOA 4DPXA 4R25A 4X65J 4ILRA 3V6DA 1CG2A 4RLEA 3PCOB 4LIWA 2ZOMA 2X1GA 4CH0S 1CJUA 1S9GA 1NHUA 3VVTA 3UDEA 4X4PA 2XYHB 3CGIA 1TAUA 2VONA 1RXOB 4FYVB 3VAIA 4B3TF 4EWTA 2KXFA 3DRXA 5LM7E 1RT7B 1H38A 4M5LA 1K73T 1TKDA 3G4SS 3HHLC 1NSQA 4IFYB 4DBQA 4DN0A 5HVFA 4MFBB 2I0XA 2C2ZB 1RA6A 4USVA 5KFYA 1GX6A 1CEZA 2AP6A 2ROGA 4I7FA 4CM2A 3VGVA 4ZVEA 3PG9A 4IR9A 1HQ2A 1F9FA 3ZZZA 4ZK7M 4G1QB 4ZVRB 3N0VA 2GHWA 4DV1J 5A0YA 1UETA 4UF4A 1TKTB 1MWZA 1GNKA 3PZPA 2QG9B 2OMLA 1JLGB 2Y8WA 2MHEA 3V6HA 3LQVA 1BQMB 2DH7A 1RAOA 2E1CA 2P6SA 1B3TA 1ZAVA 3AODA 2Q79A 4QR1A 4NWBA 3R6LB 1YKWA 1H72C 1RAHB 5IM0A 4F50A 2KG0A 3CD0A 2UXDJ 3FFIB 4LRFA 1KFDA 4NXNJ 2AJ0A 4M1KA 5DG7A 4ZLPA 5K14A 3NAHA 3PDNA 3D3BJ 3BR9A 3BF4A 1S99A 2BJ3A 2E9TA 3B4MA 4LIRA 1Y5LB 3QGIA 2KN4A 4L3KA 4DU8A 1IKWA 3I9V9 1QY7A 2YNFA 3IMQJ 4IDKB 3MDFA 3WQPA 1UZDA 4PYDA 4ELUA 1B99A 4LR7A 5FJ4A 4PQUA 2GW8A 2CUYA 3HDSA 1CPZA 1UWBA 3HSGA 3TYTA 3PYDA 3KK3A 3BPDA 4CWBA 1TKZB 3QSYB 1S1VA 2LU2A 4FDFA 3EMTA 5DJBA 2PIIA 2EFVA 3M4XA 1JLCB 4RUHA 2PGCA 4KH1B 1KC8T 1QE1B 2AEFA 1GT8A 2W7PA 4PWDB 1O6XA 2Y1LB 5DDPC 1TZ0A 4LQ3A 4U7CA 1FWLA 1EP4B 2F8EX 2XMJA 4NA3A 1IR1A 3K5PA 4RKUC 4ZLJA 2R8IA 1D09B 1QDUB 2K7JA 3U1LA 2BKOA 2C3PA 2G1HA 1BUXA 3GCWP 2FJBB 2E1MC 4TY9A 2P5VA 3P8BB 1NXIA 2VH7A 4DQIA 4JI2J 4WTYA 2ZJRQ 1S6UA 1FE0A 3BGRA 4L75A 3KMSA 2JOQA 4K0KF 3J7YU 3BSAA 4WIQA 2BJ1A 3M8ZA 1JMTA 2OPPA 1SJ3P 3PM9A 1SQGA 2DR8A 2B9XA 2H54B 5T7LA 3NWRA 1G6BA 1VQ7S 1HNVB 3DLBA 1UFKA 6AT1B 3K58A 4M8LA 4CO1A 3KDNA 3ONQA 1FXRA 1H2UX 1RWWB 1RWPB 4Y2MA 4Y3CA 4QW8A 3PW7A 3DRPA 4TYAA 5IT9Y 1ZH5A 1U2FA 4QCLA 3HVRA 3TNVA 1R6VA 3RU0A 1S49A 2AJFE 3OL9A 3VF0B 2GCFA 4GO7X 2IM2A 3FJ2A 3UDVA 1RTHA 1TL3A 2DNPA 4DR1J 2AF6A 1FDNA 2E5GA 2RF2A 2ABYA 3U1NA 2XLIA 4JYAF 4NOHA 1S9FA 4OYOA 3EYZA 4OZ5A 3CCSS 3ISZA 2YKNB 1B7FA 4DR2J 4ATNA 2DNNA 5H9FJ 1RT6A 3MM9A 5ETVA 3L95X 4CI0B 1NHVA 3J7A1 4USTA 2HG4A 2CZ4A 3ITHB 4TQRA 4QR2A 1KNZA 4CLYA 4ZA1A 4AQYF 2PDAA 4QIWD 3LW5C 2W2NP 1RYRA 1HBMB 3H25A 1HNXF 2QIFA 3MMCB 1PCAA 4OZ0A 3CD5A 1FDDA 4X4TA 1IR2A 3FSXA 3AOBA 5KFCA 2BKNA 4C4WA 3OJSA 2H5EA 3TAMA 3IAS9 1RWVB 2ZHBA 2M70A 4J90A 3DGVA 4ANCA 2H48B 3E3XA 4CLLA 1OO0B 2XNQA 3CPWR 4DR5F 3M8PB 4A8SA 2AT1B 1U0SA 2HGNA 1U0HB 3E01B 4C6AA 4DU7A 4J91A 2NSBA 3E51A 4WXWA 2Z2ZA 3HFKA 4ZVSB 4WFAQ 2ADBA 4LF8J 1NPPA 2LEAA 1KHWA 4RW4B 2CQ0A 4HDHA 2EC2A 1HBUA 5HLFB 2OP5A 2FHJD 2DPIA 4P52A 3O2IA 4D3GA 4NYPA 1NH7A 3A3PB 2CA9A 3O3LA 1FA0A 2WOMB 1OPZA 1FF2A 2XMUA 5L1IA 4YMEA 1ZPWX 2FUG9 5JVGQ 3BV8A 1M1GA 3THTA 4RW7A 5F3ZA 1U2RA 2HPUA 2KVQE 5K9FA 3T6JA 3KK1B 2FLOA 5GADI 3KUEA 1U02A 4KGMA 3GFZA 1UVKA 3V6DB 4URGA 3MUTP 5L1KA 2KU7A 4B3RF 2F5GA 2NYHA 4JI6J 5IV3A 3V6KA 2VFVA 2LDIA 4K4VA 4DI6A 5B0EA 3W5ZA 4I68A 2VC1A 2IAJA 1QTNB 2JX2A 4MMOA 3AX5A 1V5IB 4KFBA 3MMBA 2IIHA 4WFXA 3MAAA 2DH9A 2Q3PA 4WK1A 1N4LA 1D3WA 4MH8A 4JI5F 2HWHA 3E2EA 3R1HA 1S1XB 4J9RA 3BH6B 2W01A 1PYSB 1M1KT 4YHHJ 2D68A 3HVTB 1PKUA 3DDKA 3PRDA 2ILZA 2J6TA 3KDOA 3C6TA 5H9FK 3R2DJ 2ASJA 1V3RA 2BM0A 1FNXH 2PE8A 3TJ9A 1SH3A 4I56A 2R7TA 5A0YB 1WF0A 5KFLA 4WIIA 3PYGA 3RR8A 3H59A 3IP0A 1A9NB 3HVAA 2RHSB 5F3TA 1GK8A 5D4PA 4JI4J 1U49A 1TK0A 5E33A 1WC1A 3N5FA 1DBDA 3RRHA 1T9UA 3NOCA 3FQLA 4JB8B 3WC0A 3WZ0A 2DHSA 1VBZA 2HNZA 2DH8A 3KK2A 2FVRA 2M5YA 2QV6A 4Q45A 5HVGA 2R7RA 2MLYA 1VBXA 2JFDA 1A0OB 3T1YF 1UJ4A 4U67Q 2HBYB 1N36F 2HWTA 2XO6A 3ZZPA 1I94J 4W4MA 2BJ9A 2XMTA 1KD1T 2GIFA 3DLGA 3ENAA 1IKWB 2ZNYA 2CKWA 1LXJA 3V81A 3QFWA 4OJ1A 2MY8A 4LUBA 4C8MA 4ZJOA 4ED6A 8RUCA 3C8YA 3CDUA 1R31A 4ZP8A 4PQUB 3QQCD 3J7AN 2BYCA 2GO9A 4P2SA 4EYIB 2W4CA 2BQRA 3VALA 4NRTA 3TA1A 4DL7A 3AJ1A 4ZP6A 5L46A 2ZEJA 5HMZA 2POKA 3QGPA 3CJ0A 4N5SA 3JSMA 1WC5A 1XNRJ 4LFAF 3MTKA 1SBRA 2UUTA 4P7TA 1V5VA 3IG1B 4BCAA 3AAWB 3CXCR 4ECSA 4MKAA 4FXWA 2YXLA 4K5RA 2W7OA 3JYTA 2MHNA 5JJBA 2ACMA 2XS2A 2LYVA 4O3RA 1D8ZA 4ECVA 4HKQA 2GFFA 2FDNA 4K4ZA 1RU1A 2C2OB 4ERDA 1YLXA 3BGRB 2DNQA 2HVZA 4FYDA 1J2VA 2E7VA 4V19X 3R5GA 4MAKA 3DM2A 4NE9C 2MKKA 1BY9A 2WSCC 3FBFA 2BKPA 1TV6B 3GIRA 3DFEA 5T7LB 4HYKA 2CQ2A 2Q6CA 4TY8A 1B4SA 4URQU 2XO7A 2JLEA 2DGQA 4LF6J 1GQEA 1VQMS 3AB4B 1G2EA 2U2FA 3GONA 3JTPA 1L3UA 3DRPB 1AW0A 2EEYA 3MECB 4KV8A 2XY5A 3J7ZT 4K4TA 1IWAA 1NO8A 2EFPA 2UUCF 2HQGA 2ZBRA 4F4AA 4WF9Q 3HP6A 2IM0A 1RWMB 3TEHB 3K5LA 4F8RA 2VDHA 4PPZA 1CS4B 4IYQA 2JC1A 5D6GA 3KG0A 3C66A 2FLNA 4ZKAA 2P9EA 1YJWS 3MM9B 2DY1A 1XC9A 5HROA 4QWCA 1RAFB 1ZM3A 1H7WA 1LW0A 1KR4A 3G71S 2L41A 2F4FA 4B3OA 1S6QB 1UJ5A 1ZOTA 4OYZA 3EWGA 2QC3A 1F60B 3DHWC 4B9MA 3MI7X 4ZCLA 4C11A 2COLA 1BLUA 2BDPA 1B7YB 3QAUA 2OJ3A 3E8OA 4QQBA 1FK9A 1RBOB 4ZP7A 5KFSA 5B0CA 1EQMA 1WSRA 5DETA 1OQ3A 3MD3A 1KVKA 3FRZA 2K1RA 3BR8A 3IA0A 2QMXA 3OD2A 1K1QA 3Q2SC 1SXLA 2R7OA 3RR7A 4RUAA 3C2PA 2RAQA 4UZBA 3AOAA 3PJ9A 5ETRA 2ZNZA 3GG1A 1Y9OA 5DZ6A 4B9LA 1B0PA 3QFHA 3ZTRA 1MWYA 4DV2F 4MT1A 1Q95G 2HHHF 4JUZA 3HZGA 2BANA 4ED3A 3PW0A 1FKPA 4OIXA 3ULHA 3VAJA 3CCVS 1X4AA 2HS0A 1AFJA 4DR6J 1FFGB 1WEXA 1VQ6S 4RW7B 5I3UB 1S0OA 4IFVB 4V19J 2D9PA 3PW2A 1YK9A 4UOGA 4WKRA 3A12A 1I1GA 3ZXWA 1XR6A 2RJZA 2BBEA 3DOKA 4LMZA 2IAJB 3MFHA 1UVMA 1FXLA 3J81U 2P9CA 4IOBA 4OX8A 5IV4A 1S12A 1XMQJ 4KFBB 3MMBB 3MAAB 1HLWA 2RQMA 7FDRA 1HNWJ 4UY85 5EHHA 1Y7PA 4DS5A 4YY3F 2WSEC 1UWAA 4DG1A 2XHCA 2HVIA 4B3MJ 1HKAA 2ALYB 4OYMA 4KKOA 3G6XA 3DRRA 3C6TB 2CDRB 2QMUB 4CO2A 2C3YA 1TL1A 3CD6S 1HYSA 4B3SF 4DF8A 3M7VA 1KWMA 2X1AA 2LP4A 2ZM6J 1C4AA 3TVYA 4PG8A 3CCUS 5LXYA 1PBUA 4YS2A 2CXEA 1YG0A 2LA6A 3T1HF 2YWGA 1SC1B 4I6WA 3Q8UA 4DJBA 2RSQA 5F41A 3D0IE 1NUEA 3RBDA 3QSIA 2RU9A 5EWEA 2BABA 3EGWB 3POTA 3NEKA 4DR4J 3KK2B 4ECWA 4Q7AA 3S6EA 3RRGA 1RLCL 1RT2A 5FD1A 2NXJA 2N7YA 3OTOJ 4ICLB 1D8YA 1VQ9S 5L1JA 4DL5A 2BM1A 2ZBQA 4OX9J 3I96A 3TX0A 2V2ZA 2V68A 2ZH9A 3NS6A 1M5HA 2AZ3A 4F02A 4MIBA 3V81B 3TAPA 3KJQB 2DR9A 4QYRA 2YWEA 5KT7A 4Y34A 1L3KA 4ZPTR 2CPFA 2DNMA 3TZWA 2KFNA 3EPGA 1UVNA 4UW2A 5KOWA 2H4WB 4L74A 2EBGA 1HA1A 5KG3A 1NZ8A 4D3HA 4R5PA 3MZIA 4TNOA 4DV1F 1IQTA 4K4YA 1S1TA 2VG7A 1HQUB 2VA2A 5M2PA 3JSMB 2V8PA 3VR1A 1YJ9S 1ZTTA 5CHCB 3BQ2A 1B70B 2ILYA 4KY3A 2CPZA 3Q83A 4DSLA 1VQ8S 2XI2A 2ADCA 2IC3B 5C24A 2ZC3A 4PRFA 2KHCA 1OS5A 4ELTA 2EPIA 4ZLNA 3FEYB 2VJVA 5KFBA 5LMNJ 4C0BA 1AA1B 3FRYA 1RTZA 4QWDA 2ZH1A 2YKQA 4P7VA 3EVMA 2UV8G 3OTCA 1FTCA 2R4FA 3DM2B 4CNYA 3GPAA 2ATCB 2CZVC 2L08A 1Q16B 2OPSB 2AHOB 3ZTQA 4HI2A 2R9LA 2R8KA 3THVA 4I2PA 3LUYA 1S48A 4JV5J 2BXJA 2QGFB 3QGGA 4FZVA 3L4BC 1VMBA 4QIGA 4P74A 1DLOA 1Y5NB 1HD0A 2DHAA 4EGLA 5CCMA 4LRCA 2HKEA 2JLFA 2OFHX 1W2IA 2CQ1A 4JI7J 1U6BA 2AU0A 2V4JB 4QWBA 1IM6A 2C2NA 1MROA 1BWEA 2EFGA 3QZ7A 1MMLA 2VQEJ 4ECZA 3KNAA 3C15B 2AW0A 4P6QA 1EETA 3GB0A 3JAMU 2J0SD 3N9UC 3I31A 5D0RA 3RUBL 4JI2F 1NRKA 3MEKA 1UMJA 5ITHA 5I3QA 3CIMA 2WVFA 2JSXA 1I5OB 2JEFA 5CYMB 2PO4A 3AXMA 4ZMMA 1YHQS 1C4CA 5HROB 2XCPA 4MIAA 2AWZA 1XMOJ 5KFPA 1CSJA 3K0JA 2O01C 3UQSA 4WFBQ 3MCSA 1LW0B 3FUYA 1U1MA 1NK0A 4DL0C 1UFWA 5LMUJ 3IC1A 1ZS6A 3LF0A 4C11B 5E3PA 2N82B 3LPYA 3ILOA 2A6OA 2ALZA 1URRA 4CO3A 1YQHA 1FK9B 1RACB 4I1TA 4L76A 5E7OB 2DHGA 1JNRB 2Z0GA 4OJ3A 4DLEA 4DR1F 3SFUA 1U8WA 5KG0A 3PACA 2HYIB 3AB2B 2ZH4A 4PEOA 5DLFA 2B8QA 3KJFB 3D9BA 1ZAWA 2DO0A 4K59A 3QT8A 1Z2LA 3EXCX 3TR5A 1DQ8A 3N79A 1U7LA 3FC9A 1FCAA 3P3DA 5KFKA 4LF1A 2FHOB 2HRTA 1W26A 2EKNA 1TELA 1BWVA 2H5JB 1K0VA 4M5JA 4DV4J 1YX2A 2BANB 2W9CA 2BJEA 1SJ1A 4U7UD 3MPYA 4GVBA 2OPQB 2DGTA 3SDEA 4MK9A 1X9SA 3RW6A 2YNHA 2ZD1B 3U7JA 2VASA 3T6BA 2ZDOA 3V4MA 1FWKA 1YJNS 3K89A 2FVPA 3D7SB 4QPTA 3QGHA 2XWYA 1R6YA 4FXDA 5DG8A 1U48A 4NXMF 2CPDA 4JI1J 2KM8B 4K4SA 4DPYA 4EBCA 5MLCV 3TZXA 4Y0FA 5A8KB 1LXNA 1HHTP 1S57A 4Q0BA 1R0CB 4LVNP 1HR0J 3I9ZA 3CJKB 2JHEA 2E9RX 4RBVA 3RAQA 4LF8F 4Y2CA 4IRKA 2KVIA 4DV0J 2I2YA 1PAEX 4NCAA 1DAXA 4DG1B 1S0VA 3Q2TC 1BXNA 4NZ6A 2MKIA 1HI8A 1NLKL 4I6AA 3QLHA 4DL6A 5I42A 4BLGA 4KKOB 3DRRB 1VRUA 4DSFA 3PW4A 4I6YA 2MQOA 3BQ1A 1G1XA 1TL1B 4K7QA 1HYSB 4KSEB 4PYAA 4RNNA 2XZTB 3PO5A 4FYXB 5HSPA 4KHMA 4B02A 3CTRA 3QO9A 2XTEA 8ATCB 2WB1D 3DHXA 5HMWA 3CULA 2BQ3A 2FJVA 2CNLB 4EZ9A 1N8RT 4HHJA 4WU2A 1IR0A 3BYPA 1JKHA 2KT2A 2YKAA 2QLFB 2FZCB 1RT1B 4K4WA 2DD8S 4M5IA 3POTB 5C5JA 4ELVA 1O5JA 1RT2B 1X4GA 4DCPB 1VC5A 5C42B 2HIYA 2CQDA 4ZOSA 2GNKA 4ED7A 1WSVA 1QD1A 2GGPA 2WK4A 4IO1A 4KPCA 2PEBA 3G86A 5CABA 2B9EA 3P6YC 1QSSA 5IQQA 4YHHF 1OYEA 1NK6A 1GFWB 1WEZA 3BB5A 4OJHA 1UZHA 3C14B 2Q1LA 2BJDA 1FRMA 4KGVB 2EG2A 4JOUA 4R5PB 1IJEB 1Q5YA 1Y00A 4USUA 2V5HG 4LSNA 2VG7B 5LJ5Y 2IA0A 2DHHA 1NPRA 4F4ZA 3GQCA 3ZZTA 4A48A 2D74B 5GAEU 3FGVA 1Y0HA 4WP8A 3IXQA 1C0TA 3PVXA 5GVQA 1LW2A 2XCAA 3W8GA 1RLDA 5C24B 3A13A 5AXLA 4NLSA 4HI1A 1KKHA 4A8FA 4NLPA 1GMWD 3ZZOA 4YUDA 2WHOA 1X4BA 4LF4J 4C3LA 2C2KB 3K2YA 2BW7A 1I94F 3A3OB 4OX6A 3GFHA 2GAHC 3BZQA 4L3NA 4DSEA 3BYRA 3GIKA 1YRUA 2XB2D 3M6XA 5JXSA 2FHKA 3EE3A 3DOLB 4WFZA 4PG6A 5B0BA 4LFCJ 2MDAA 3NGSA 1K8AT 3QJPA 4N8NA 1KRPA 2MZSA 4R8UA 2GJ2A 1RTJA 4RW6A 2Y0BB 4USIA 4M5GA 4F67A 2HURA 2R3VA 1EKSA 1SUQA 2EVZA 2ZJQQ 2KZZA 4B08A 4XPCA 2DNZA 4RW8B 2BZ2A 1JXVA 3DRSB 4Z37A 5IOLA 2LQ5A 3UNYA 2MSTA 2FJAB 2VHGA 3CC2S 4ES1A 4NLVA 2W4PA 3AT1B 3GIIA 1Q8BA 3X3UA 1DJ0A 2AJ1A 2C22A 5C25A 2I1RA 2Z56B 1L3SA 3VCDA 2B3TB 4O0NA 2KHDA 1TMMA 3OL6A 3CF5Q 2MEWA 1IBCB 2RE1A 3CE8A 3J81Y 1YBUA 2OFGX 3N5BA 1EETB 4KGXB 3AWRA 2A1BA 1RWOB 3MEGB 4PG5A 2G2ZA 1PGZA 2MJUA 3W9JA 1HNIB 2XSJB 2WONB 1X5PA 1DRZA 1C2PA 1H73A 3WDOA 1XNQJ 1MMNA 3BKFA 3HHLD 4HVZA 4PABA 1FFSB 5IQ6A 3OVBA 2HMIA 1HBOA 3KJNB 4J9OA 1W7WA 4LJMA 1N0UA 3SZ2A 2MQNA 1X4DA 2RH3A 2IVYA 1VQPS 3SSSA 3RAMA 1KQSR 2R2UA 1VCTA 4M5DA 1CQNA 4AL6A 3NLCA 5EUHA 3MXHP 1X4FA 5DG9A 1UVJA 4JI3J 4C3KA 2RU3A 3M9NB 3EZ5A 1L3VA 2LECA 4RO0A 1XMBA 1N52B 5KFVA 4MKVA 1ZM4A 2KXNB 1HW8A 3BN4A 4LSLB 2AIRB 1E6YA 1FRKA 2BUNA 3MTJA 1JIHA 5A6WA 4GC7A 1S1UA 2YPYA 5J1EA 2DO4A 3BSNA 1VQSA 4LSZB 1F6TA 4FN5A 5AE3A 2RKIA 3IS9A 1J5OA 1TL7A 2M7SA 4CT8A 2IHR1 3EICA 2DISA 2HFNA 2J9DA 4HHUA 5CYJA 4B9VA 5IXUA 5ETNA 3FSIA 2HSEB 1SV5A 3HJVA 1U25A 4NLUA 2QT7A 2RS8A 4ETZA 4G65A 3ZFVA 1IUJA 3LOUA 4FYYB 3I4PA 4X64F 2W9CB 2VG5B 1SKRA 1TUGB 4J9PA 2E7WA 5B08A 4GVBB 3DLHA 2JC0A 1HIYA 3GZ7A 1ACMB 4XIUA 3GV8B 1R8AA 1T9XA 4UQGA 3UCUP 1IBKJ 2YTCA 5KG6A 1N32J 3G96A 2VICA 2Y8YA 4USWA 2G1DA 5IT4A 1V3ZA 3G8SA 5J2PA 3FNNA 4ZHRA 1YTYA 4B9NA 1Y5IB 3AFGA 1NKCA 2CPEA 3TAQA 2OELA 4Q0BB 5J1PA 1KQKA 3DC2A 2N4CA 2NR0A 1CJTB 3GJQB 5EN1A 2Q43A 3OW2R 4ZDNA 1S4FA 3MM8B 3OFEA 3QYYA 5C2CA 4KO0B 1URNA 3MCNA 2XZDB 1QUVA 2D3UA 2XY7A 2ZOFA 4ZCIA 3BN7A 3HULA 5LJ3Y 3ZO7A 2GX8A 2N7CA 2MQLA 2YKMA 1VRUB 4K50A 2DNYA 1JLFA 4I69A 2R2RA 4KHPF 2OD4A 1WG4A 4LVOP 3KXDA 3QO9B 2FTRA 3ZZ0A 1VS3A 1ZA1B 3DI6A 3OHBA 3H2UB 2V0NA 2XYPB 4ZVHA 4F4KA 2HNYB 2HHQA 4OI3A 1Z2ZA 1XTZA 2RS2A 5E5NA 1JB0C 1GMWA 6FD1A 1KQGB 2IRXA 2CYYA 4NYOA 5H9EJ 3C19A 5K8PA 3JAMY 1JNZB 2ZVSA 1MWQA 1XN9A 4TLRA 3MMAA 1FJGJ 1XMQF 2E44A 2ACYA 4NLWA 1U2CA 4F2SA 4P9SA 4EBDA 5A76A 1U1LA 3HLUA 4NZ7A 2GGPB 4P10A 3SCLE 2AGOA 4J37A 3D0HE 2X7IA 3LTOA 2V8VA 3IM9A 5ETMA 1FRXA 1XIQA 1BHNA 1RCOB 1DURA 3C16B 3UPFA 2XGQA 2EW9A 1S77D 4DQPA 3SQOP 3DLEB 3CMAS 5L9XA 5KG5A 2OTJS 2BJ7A 5B0FA 1H98A 3C6UB 1EZZB 1PYTA 2JNJA 3ILLA 3FMBA 2JEIA 2DK2A 3BBBA 3VQSA 5EX0A 3T19A 2ZH8A 3DU6A 2YX7A 1C0TB 2DR5A 4CQ1A 1LW2B 4E0DA 3D6MB 1Q8IA 4DR4F 5KFDA 3RAXA 4RZRA 2HFZA 2I9SA 2CPHA 2GQCA 3LO3A 3JSYA 1FDBA 1X31C 3MEDA 4J7CA 1JK9B 4Y28C 2IM1A 2AV5A 1N34J 3OTOF 3GV7B 3D3CJ 1DHMA 2EI5A 5KOXA 2FLLA 3OL8A 4MYTA 1TK8A 1VIOA 4CM0A 3AA8A 4FVCA 4EYHB 4LR9A 1LEOA 4MFBA 3N6MA 2DRDA 1RGVA 4C0HA 4U6PA 4NEYA 2DR7A 3HPOA 2DRBA 3SIPB 2VJUA 1JQGA 4X2BA 3GG0A 4N56A 4R8UB 2KB2A 3EZUA 3RB6A 4RW6B 3EGVA 5BR8J 1ICEB 3F44A 2GMJA 1YWXA 3I32A 1SUQB 4KJIA 2M8HA 3D54A 4YB1P 2DBBA 1JLGA 1X9WA 4IH5A 1YIJS 1WKLA 4OI2A 1SI9A 5K8NA 1BQMA 1WEYA 2UUAF 4P71A 1SQFA 3MCOA 1YZ7A 4DR7J 5C25B 1IWGA 3J81j 5IC4B 4NYZA 2BJ8A 4DPTA 1N5VA 1HWKA 3N28A 4PWUA 3QATA 2OKQA 1P1TA 2NLWA 1YITS 2ASYA 3W61A 3M2UB 4DV5J 4LF9J 4CDIA 4IDKA 5GMDA 3L7PA 2XQCA 2G0JA 1WF1A 1S9EB 3P45B 2HZAA 1S97A 4NCBA 1TKZA 2YNGA 1MNEA 2HMIB 1HBOB 2DGXA 2YWWA 1JLCA 1RP5A 3D5MA 4ALZA 4PG4A 4ZPWR 3HZEA 2R8HA 4QIFA 2JH3A 1FJ7A 2ZH7A 4JV5F 1S59A 1J5EJ 4Y2IA 2KL8A 3QIPA 1J27A 3TA0A 3PIOQ 4C8KA 3LALA 1HARA 4ZPVR 2NREA 1X0FA 1NBEB 2Z58B 3MF5A 4JI7F 4Q2MA 2R7SA 3HK2A 3BQ0A 4O3NA 1W25A 1JXEA 2NZ4A 2VKZG 2V6AA 3BM7A 1E6YB 2DXEA 1N5YA 1VIXA 2XZ2A 3W5XA 2YX4A 5GAGU 2FGOA 2W7AA 5GAEI 1X4HA 2CFXA 3F56A 2D7SA 2RKIB 4FNHA 3BDEA 3IS9B 1J5OB 1TL7B 3G9CA 2X3GA 2WVDA 1SJFA 2FHMA 3K57A 4DEZA 3HHEA 4HDGA 1WOPA 1XMOF 1K9MT 1RK8A 2B51A 3CEDA 4NLYA 3DLKA 1VLOA 3GFYA 5LXRA 2J9CA 5LMUF 1UEUA 3KUHA 1T7PA 4M5MA 2K3IA 1LWEB 3O5TB 4IRDA 1EX8A 2E5JA 1NK7A 1Q5VA 2C2DA 5K5MA 2CQGA 1VC6A 3ADAC 4GRSA 2FVSA 3MEEA 2A2CA 5HI7A 2NZCA 4QIEA 1JJ2R 2QN6B 5F8HA 5J2PB 2LEBA 2AJ2A 4ZHRB 1F9HA 3BPSP 3G8QA 1GXLA 1VK8A 4RPFA 1D1UA 3HSDA 4HACB 2VQFJ 3NNHA 1SIWB 2YH0A 2VC0A 5ETPA 5KFNA 4XDDA 2B4OA 4ANEA 4L73A 3ITHA 5HQ8A 2MSSA 2DXFA 1X4CA 3CJSA 2XSFA 1TAQA 1VBKA 4DV4F 4I67A 2AMCB 3AD9C 2YKMB 5H1SV 4B9SA 3QRRA 4YB6A 3GJTB 2CNOB 1JLFB 1LK5A 2E5LJ 3NMRA 2MKYA 5E3CA 2VPXB 3MHYA 2W8LA 1ZAXA 4C48A 3CCWA 4CLFA 5HO4A 3W9HA 3OSPA 4X62J 2IYGA 3NGKA 3DI6B 3QIDA 4DHVA 1M5OC 2ZFHA 3M1VA 2OI2A 2QYGA 3VQTA 3LP2B 2OGUA 3QAEA 1VQNS 3M2VA 5F0UA 4C8YA 4JI1F 2FJXA 1N0VC 4FBTA 4RNFA 1LWFA 1X9MA 4ZPCA 3W9IA 1U0HA 3E01A 2V2KA 2EG1A 2RQ4A 1SC4B 1EKRA 1WHYA 3MMAB 1HR0F 2JVOA 2IMWP 4EO6A 1Q82T 4FS2A 3H5YA 3OXFA 2IYIA 2XLKA 1KS2A 1FXDA 1HQEB 4C9DA 5L39A 4DUYF 2MMYA 2R42A 3PX6A 2WOMA 3TUJC 1OQ6A 4NLDA 1V6HA 1WG5A 4KIAA 4AXIA 5ADZA 3HO1A 4B3TJ 3VVUA 4K2JA 3S7RA 5RUBA 3BDPA 2R2TA 1QM9A 1NSPA 3HT3A 1OYDA 1VHFA 3LPEA 4AD6A 3EDRB 2ZH3A 1R3NA 1N48A 3R1LA 2XS7A 1T05B 3GYGA 1B0VA 3MEDB 4WWSA 3SV4A 1UPMB 4A8YA 2DNHA 4H54A 1RZMA 4IG0A 1PG5B 4WCEQ 1S1XA 3Q24A 2LDYA 3PIPQ 3HVTA 1OSCA 2P2CB 4ZJLA 3M32A 2B5JA 3MOJB 3Q8PB 3QRQA 3X1LB 3EPIA 2DGVA 4CO4A 2QZ8A 4RNMA 2EK6A 2HHXA 2QJ3A 4ED2A 1F2GA 3IR7B 2YKOA 1U45A 3HSJA 4DR3J 1VI7A 4ES2A 4QBUA 5BYRA 1U24A 4HLBA 1QVGR 4H4KA 1VISA 2L9DA 4USHA 3CJ8A 3TX8A 4M94A 1V9OA 1HHSA 2ZHAA 1GEHA 1R8PA 2NXCA 2WZ1A 3GYXB 1Q0NA 2CADA 1MU2A 3AA9A 2Z2YB 1TL4A 2G0IA 1SL0A 3PNIA 3CC4S 2E9ZA 2XBPA 3L3CA 2J8AA 1NSAA 2VDIA 4C8OA 2VFUA 3KHHA 3GYNA 1RA7A 2QL5B 1KP6A 2RMLA 2RD5C 2AYEA 5DO2A 2ZH6A 2PFDA 2UXCJ 2AYMA 4CTAA 1YVFA 3GSIA 2DGUA 4C2MA 1IKYB 1WHWA 1ZETA 4LFCF 5D0EA 4XTTA 2NPFA 5CQGA 3W3SA 2YNGB 4N8OA 5B0GA 3GV5B 4DV3F 1EAYC 5KFUA 4JI8F 1FEEA 1SQEA 2UVVA 3CT9A 5AJ3J 1RAAB 4QIVA 1AFIA 2VBZA 2AZ1A 5CZXA 2BRKA 2FY8A 3QIPB 3O44A 2YQ1A 2HVEA 1ZPVA 3NXZA 2C3UA 2IBOA 4K5SA 3G6VA 2MZJA 3WX4A 3IG1A 3EXYA 2ZZTA 3A8IA 1YRXA 2YBVA 3SMZA 4RU9A 2XZWA 3UN2A 3FEZA 1BD6A 1ZZNA 4RX6A 2M3DA 3M8SA 1SL1A 2HRYA 1M5VC 3VAFA 1N5YB 2XMWA 3I6PA 2JLGA 1SH2A 3ETMA 3TZZA 1TQLA 3DLLQ 2LU1A 2B56A 3IWXA 3PHTA 1IKVA 1B0TA 1S79A 2UZAA 2P8IA 3GTYX 4ZITA 4MTPA 4Y65A 4LT6A 4PXEA 1TV6A 2A2DA 1GH8A 3IGVA 2VB6A 1DTTB 3P49B 2V8DA 5DRKA 3DYAA 2NUUG 4GKJJ 4NEZA 2E5IA 3DLKB 2J6SA 2XTCA 5THWA 4CLSA 4DL3A 3MMJA 4CH7A 3Q86A 3K59A 4W92B 3MECA 4DV6F 3TQ1A 3MUMP 4Y2KA 2EC0A 3NY0A 5A8WB 4JI3F 4M5NA 3MEEB 1IM4A 4KPYA 3K5OA 3PR4A 3AQOA 4MJKA 1JLBA 2B8PA 2XEXA 1RISA 1QLNA 2AYBA 1P9QC 1NJIT 3PHEA 1QSLA 1CS4A 3DMJB 3FKBA 4OFZA 3SCJE 1R8BA 3T1AA 3TARA 2GVZA 3H2VE 3IRWP 1NSKL 3UW1A 2IJFA 2PI5A 4YB5A 2X3DA 2F9JA 3S8SA 4UOFA 4DR5J 1FNMA 2FVQA 1S6QA 4ECYA 1NZAA 2NSCA 2RDIA 1WF2A 2OEJA 1RTIB 2GVDB 1M1HA 3UD5A 1AZSA 2VF3A 1IBKF 4LF7J 2RQKA 3I87A 1Q86T 4HT7A 3KKFA 5J1NA 1SPBP 1FO1A 1KOHA 3M1VB 2QTWA 1AYEA 3M2VB 3PJXA 1FRLA 2ZOGA 1LWFB 4ZVOB 3NWGA 4DSKA 3TEGA 1X8DA 4FKYA 2OEKA 5KT5A 1WG1A 2DYAA 1LFWA 2CJBA 3BBFA 1UVLA 4KAIA 2R8JA 3TQEA 1R43A 1LOUA 5SZTA 4UTGA 2KDOA 3OLAA 1HHQA 1R0AB 3N4WA 4A8WA 5D0HA 1WHVA 2WB4A 1RKJA 3H7HB 2HQIA 4B3RJ 1H74A 4B9TA 1RT3B 2I5JA 4P73A 3BO4A 2MQMA 2N4DA 1TUVA 4OHZA 5I3UA 4IFVA 2X1FA 2M4MA 3P5TL 4YR2A 1D0EA 3PTWA 3V4IA 3OTDA 1YJ7A 1NAQA 2QL9B 3MM5A 3NCPA 5HL7Q 3Q8VA 1S7IA 1FFWB 2EKYA 4CZCA 5I4MA 1ZM9A 4OZ1A 4RU2A 5IT0A 2NUHA 3RB4A 1FX2A 3KJVB 1PSDA 1FJGF 1WORA 2M9KA 1Y3JA 2Y3YA 4IG0B 3OFFA 3OR1A 4AYBD 4AL7A 4ED5A 4N7TA 2E1PA 1Y11A 1HWUA 2R2SA 3H4BA 3G6YA 3M32B 2B5JB 2AEJA 4WFYA 4P2XA 1WELA 3BBCA 4USJC 4NI2B 3U02A 4LREA 1QJHA 3PJWA 1N5TA 1WTFA 2CJAA 4H4KC 5F8IA 3OTBA 3WX8A 5HBMA 4K2XA 5U47A 1Q79A 3HCXA 5D4LA 5D0GA 1VHIA 3I0RB 3FEXB 2ROPA 5F8JA
chains in the Genus database with same CATH topology
1GX6A 2BJDA 1FRMA 1CEZA 3ENQA 3DLGB 2EG2A 2AP6A 2ROGA 4I7FA 4JOUA 4R5PB 1IJEB 5KFRA 3W2VA 1Y00A 4ZVEA 1UAWA 3W2WA 2MKHA 2VOOA 2CPIA 2V5HG 1Y4ZB 4LSNA 4IR9A 1T05A 1F9FA 3PV8A 2VG7B 5LJ5Y 3ZZZA 3MWBA 2YY3A 2IA0A 4ZK7M 2P9GA 4G1QB 1VQKS 2WRMA 3N0VA 2GHWA 5A0YA 1UETA 1MU2B 4F4ZA 3GQCA 1RAJA 4WK3A 2R8GA 2R7XA 3ZZTA 4RNHA 2BE2B 1TKTB 2BA9A 1MWZA 4OZJA 4A48A 1GNKA 2LA4A 5LSRA 3B4DA 3PZPA 1QUPA 1NU4A 2D74B 5GAEU 3HI9A 3FGVA 2OMLA 1Y0HA 1JLGB 4ZP9A 3KLVA 3IXQA 2KKHA 2VBYA 1C0TA 4ICLA 4OX9F 4ECXA 3PVXA 4J9SA 5GVQA 1LW2A 4H4MA 1UA0A 2QEXS 2XCAA 2SXLA 2MHEA 3V6HA 3LQVA 1BQMB 5C24B 2DH7A 3C3LA 1X5OA 2CDQA 2P6SA 2E1CA 1HWIA 3OJUA 1U1PA 3CC7S 3VZHA 5AXLA 4NLSA 4BHQA 1ZAVA 4HI1A 2Q79A 4QR1A 4NWBA 4A8FA 2JL9A 1O51A 4NLPA 5D3GB 5AXKA 3ZZOA 4YUDA 1P8GA 2WHOA 1IBLF 1X4BA 4H4OB 5AXMA 5IM0A 5KFTA 4F50A 2KG0A 3CD0A 5LSOA 3J80Y 4C3LA 2ZKTA 4X4NA 4Q5VA 3FFIB 3K2YA 5LSLA 2C28A 2JFKA 5D8HB 2XI3A 3ICLA 1KFDA 5F8NA 4CTAB 1I94F 5L9NA 2AJ0A 4M1KA 1X4EA 4OX6A 5BYQA 3GFHA 3BZQA 5DLGA 5KFQA 4ZLPA 4L3NA 5DG7A 2V9WA 3Q23A 4DSEA 1U6FA 1K0TA 3GIKA 1YRUA 3JYTB 5K14A 3M6XA 5JXSA 3NAHA 3PDNA 2XB2D 3BR9A 1UL3A 3DDNA 3BF4A 1S99A 2FHKA 1VC0A 2F8MA 4OHYA 3DOLB 2CQPA 3FMWA 4WFZA 3NRBA 4BWMA 2IM3A 2E9TA 2KJVA 1R89A 1Y5LB 3B4MA 3QGIA 2KN4A 4LIRA 4GC6A 4PG6A 1IKWA 4IR1A 4IH7A 5B0BA 5BR8F 2MDAA 3I9V9 5AXNA 1T03B 1VRTB 1K8AT 2FVCA 4PXDA 2NS1B 3QJPA 1QY7A 2YNFA 4N8NA 1KRPA 2MZSA 3KOAA 4R8UA 4IDKB 2GJ2A 3LH2S 4O3SA 1T3OA 1RTJA 3AJ2A 1HQUA 3MDFA 4RW6A 4USIA 3N6LA 2VFSA 5F0WA 4ELUA 4F67A 5FJ4A 4PQUA 2GW8A 3IBWA 3HDSA 5KG4A 1SUQA 2EVZA 4F3MA 1CPZA 1UWBA 3TYTA 2ZJQQ 3KK3A 2KZZA 3EGNA 3HKWA 4B08A 4XPCA 2DNZA 4RW8B 5B7WA 1TKZB 2BZ2A 2CJKA 2IBKA 4DFKA 3MM7A 3DRSB 1S1VA 2LU2A 4Z37A 5DJBA 2P6TA 2PIIA 3H20A 3M4XA 1JLCB 2EFNA 2LLZA 2LQ5A 2PGCA 2EFVA 4RUHA 1T95A 1Q81T 1N5QA 1KC8T 1QE1B 2MSTA 2FJAB