1XREA

Crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 69
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xreA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xreA02
2ADQB 2CDYA 3KKYA 3CEIA 3DC5A 3MDSA 1GN3A 1QNMA 1XUQA 3OT7A 4YIOA 2RCVA 1XDCA 1PM9A 4X9QA 2ADPA 4BR6A 1EN4A 1B06A 1N0JA 1WB8A 1VEWA 1LUWA 4GUNA 4F6EA 1BT8A 1SZXA 4JYYA 1ZUQA 1BS3A 2GDSA 5AG2A 3DC6A 1IXBA 3AK3A 2P4KA 3IC9A 1JA8A 1MSDA 1ZTEA 1AR5A 3QVNA 1XREA 1AR4A 1JR9A 3RN4A 3AK1A 1VARA 3C3TA 1GN2A 4E4EA 1BSMA 1I08A 1GN6A 1AVMA 1LUVA 2AW9A 1EN6A 1D5NA 1IX9A 1ZLZA 1IDSA 2QKCA 1AP5A 4C7UA 1P7GA 3EVKA 1MA1A 1ZSPA 1MNGA 1GN4A 2CE4A 4JZGA 1WB7A 3AK2A 1KKCA 1MMMA 2QKAA 4YIPA 1N0NA 1EM1A 1Y67A 1EN5A 3C3SA 5A9GA 1XILA 3K9SA 4FFKA 3LSUA 3BFRA 4JZ2A 1AP6A 3TJTA 1I0HA 1PL4A
chains in the Genus database with same CATH superfamily
1KMIZ 2HKOA 1VP7A 3JD3A 2P7TC 4ZI7B 2QGNA 1NS1A 3LDDA 4DV4O 4MVUA 3SGIA 4BWAA 2E75B 3SJCC 2V4DA 2LO1A 5HFMA 2YIBA 4UB6Z 1OV9A 2LGWA 1NTMH 1VQPV 4JI6O 1I5YA 4E2LA 1X59A 3TCUA 3SYQA 5LYJB 1G6UA 3ZS8C 5LBQA 1PD3A 5DM6V 3J80N 4DV1O 5IJ9B 3ETEA 1HNZO 2ZE8A 4JI7O 3KG2A 3CC7V 1H8EG 2PY5A 1BZKA 2P22C 3OAAG 4HBNA 4LF5B 2YEVA 1M57C 1K5QA 1L0LH 1FJGB 2UUBB 4K0KO 3HKEB 5KHKA 4UV9A 4TT3G 3DXRB 1JVMA 2AW9A 3K5MA 4B08A 3B2EE 2DYRC 1QLEB 3UKMA 1N8RW 3UQ8A 1VF6C 3MHHC 2F4VB 1FAFA 3CD6V 1ZAUA 2DOSA 3ABLB 4X64O 2QWOB 2BSKA 4FFKA 4LF6B 1G8MA 1B3QA 1BHBA 2ZCEA 5FNVA 1JPXA 3JATB 4O4JA 2FL4A 2CDYA 4QIWF 2RNBA 3MDSA 4YJ3B 4PELA 3JD0A 1N4CA 2IU3A 3W7SA 4B3RB 4CC5A 5L3EA 4DV3B 3ABTA 1KP3A 1M9NA 4LF5O 1Q6UA 2QWNB 1FFXB 4K35A 4KP4A 1FJGO 2UUBO 1NBMG 1JJ2U 1K5SA 3E89A 4I9WA 5KMGB 3CWBH 3CSXA 4IYHA 4O4HB 3JAMN 4GZRB 5JVDB 4O2BB 1XI1A 2Y0IA 5FL7G 3IAYA 3THOA 1YZBA 1SZTA 3E35A 5JCOA 5F2VO 4PA4A 3T1CA 4MTXA 2HVJC 5B1BB 4FZ1A 2GV9A 3AK3A 3ETGA 2JGUA 5IY5C 1H2LA 4CH4A 1DTOA 3T1YB 3JD4A 2F4VO 1S5LZ 3JSLA 4FM2A 2QE7G 4FJCC 1JFFB 4WF9V 3OMNB 5IJ0A 2BE3A 4EB6B 3G67A 1TGOA 1N34B 4LF6O 4IHJA 4PA9A 5IYDO 2EILB 5KAIZ 5GONA 3JARB 3K0DA 3WG7C 1TVKB 1ENVA 2KB1A 4LR3A 5LHGA 1ZX3A 5B1AC 3AG4C 5EBMC 1L1FA 1F23A 2QDOA 3NR7A 4B3RO 3KDRA 5LP6C 3L70H 1MMMA 3JCZA 2X6AA 2LJ2A 4OGQB 5CBGA 2PYJA 3I56V 4OXSA 2YI9A 1QHTA 1V9PA 3A8TA 4EEQA 2OT5A 2HFEC 1I0HA 2ADQB 4DV7B 4WBNA 3ZBHA 4UUJC 3E22B 3LNMB 2DWEC 3KCYA 2QKSA 1KB9F 2W0FC 2E5LB 3HKCB 3P3NA 1F4MA 3OD4A 3FYEB 4LF4B 1S76D 4BR6A 1HWYA 3JCUZ 1CPYA 3STLC 2QA4V 1N34O 4ASUG 1K9MW 1MZFA 2DWDC 5EZYA 3QF7A 3K5OA 3C90A 3QG5A 3ABUA 4Z1VA 1ROPA 1ZL8A 4X20B 5LA6A 3CCLV 1BS3A 1H2KA 4O2AB 1NJIW 2OIEA 2YIBD 4U7OA 4TWKA 3CE2A 4JAVA 2P90A 2ZE7A 3SJQC 2PYLA 4O4IA 1SQPH 3CB2A 5BZBA 1YJNV 2GHYA 1AR5A 3SYCA 1Z5WA 2OYQA 2GUZB 5KX5B 2K9PA 3GVMA 4XDJA 2NN4A 4UCTA 4QE7A 2M6YA 3ZMSA 3G6EV 3B8MA 5LHHA 3T1HB 4WCEV 4DUYB 4FLZA 3OEEG 3ZHVA 3J81N 3S3WA 4A5UB 4HNAA 1AP5A 4PA3A 4MW3A 1SA0A 2E5LO 3CMAV 2Q69A 3FD9A 3G6BA 2QM8A 4QNHB 4JI0B 1TA8A 3ZRWA 3CJHA 4LF4O 4LH7A 5BMVB 1ZWIC 3TETA 1Q6HA 1P49A 3C3SA 1I94B 1NR7A 4X62B 2CAZC 3VQXA 3F7VC 4JZ2A 3ETQA 3ZMVA 4DV0B 2ZD9A 4J7KA 1UPGA 4H44B 3B09A 3OUSA 5CA0B 4PDMA 4I0XB 2WLIA 2XAGA 4QGPA 3HB3B 4OX9B 1Z2GA 2HEPA 5DECA 5EBWC 1PKXA 2EINC 5JH7A 2A0LA 2XNDG 3H01A 4TOIA 1QR9A 4LNUB 2ZE6A 5GTIZ 3JASB 5LGNA 3U11A 3ASNC 3JD1A 5KHHA 3T1HO 2LFRA 1FXKC 2BOCC 3A0BZ 3SPIA 4DUYO 1H2GA 5KHGA 1IURA 4LCUC 4LFCB 1JJOA 5KA6A 1M57B 1GRJA 4KXRA 5E79Z 3EFFK 1GM9A 4DUZB 4JI0O 2YC0A 1Z5VA 1JA8A 1SKVA 4JAAA 3RYHB 5KLVH 4I4TB 3M99B 4TQDA 3CP1A 4TV9A 4UVCA 4GYCB 4JI8B 2DYRB 1I94O 2F43G 4X62O 3ZN0A 5HFLA 1R3JC 1AVMA 4DV0O 2UUAB 5IYZA 5FLXN 3K59A 3WFVA 3T4DA 1P7GA 4XDLA 3ABKC 4OX9O 3EHBB 3OR6C 1YEWA 4X1KB 3K3WA 3B4SA 4PA7A 5GW7A 2XAJA 1FD9A 1HNXB 2B9ZA 4L87A 3VOUA 3VBBA 1AJPA 3SJAC 5FPOA 3N2GA 1AP6A 5CA3A 2Z5UA 1K4DC 2P4VA 1RP3B 4LFCO 2JGDB 3E8FA 1YTFD 2E74B 3CHXA 4DUZO 3JALB 1FYJA 4JASA 2DYSC 3LDCA 4J11A 3STZC 2FB5A 2A7WA 3E2EA 2IM9A 1Y74A 1AR1B 4JI8O 2BCCH 2BTOA 4D7SA 3MAQA 4RAIA 5BR8B 3OR7C 2UUAO 3FX7A 5IY5B 4JV5B 3ML0A 3CYOA 4J41A 2Q73A 4JI3B 4JPRA 2QWRB 4P9OA 2DMXA 2ZDIA 3ZEDA 4FLVA 3CCEV 3WG7B 1HNXO 2Y4TA 3FKSG 5B1AB 2QR4A 4OPHA 4WFEA 3AG4B 3C3TA 2ETNA 3J7AU 4GKJB 3FFQA 5LOVB 4MVOA 5LP6B 2Q9LA 1B6QA 3ZRSA 1PPJH 4CS2A 4N21A 2R9AA 2YUAA 1ZLZA 3GWOA 2VQEB 1Q90D 2OIGA 4NKGB 2CE4A 3E86A 4I55A 4JZGA 2AZ0A 1WB7A 1KKCA 4UCUA 2PZSA 1IBMB 3CXCU 2QKAA 4K8XA 1L0NH 3G80A 5KHJA 1AI6A 1FKAO 1EN5A 5A9GA 1XILA 5BR8O 2X6CA 4FM1A 1FXKA 2NNUA 4NR1A 1BGYH 5JCOC 1NI8A 3OFNG 1S77D 4JV5O 2R70A 3SPGA 4IIJA 1YCIA 4ZKIA 2YXYA 3D3QA 3QNEA 4LWSA 4U7NA 4JI3O 2ZKOA 1XUQA 3TXQA 5K1PA 2KG7A 5LXTA 1V55C 3P32A 2RCVA 3Q4HB 3DGEA 3BY6A 2YICA 2E76B 4PV1B 5J2UA 2DE0X 3MD0A 2GSMB 5ITZB 2FTKA 2DQ3A 4O4LA 4NVPA 1EN4A 2LW7A 2QTSA 1O9GA 5IYCO 4FMTA 4GKJO 5DN6G 2BTQB 1VIBA 2N04A 1BL8A 4CH3A 5JQGB 1JMKC 3ETDA 3ZN1A 3SR2C 1IZ3A 4IGGA 2VQEO 1S5JA 2ZINA 1JNBA 2EULA 5IE9A 2MW2B 2XAFA 4TV8B 1IBMO 1R3IC 3WB2A 1ZTEA 1BQ0A 3CPWU 2YDEA 4UCRA 1BHAA 1GK9A 3T4ZA 1XREA 2HLDG 5LHIA 4X1YA 4B3TB 4KUMA 2ILMA 2BOBC 5LL6Y 1KC8W 1R1BA 1XMQB 3E8BA 5LGTA 4MTGA 1NTKH 1OCRC 2LFSA 4C7UA 3RT3C 2IJHA 4FIPC 2WLLA 3WB0A 1WAZA 4TUYB 2UXNA 1HDJA 4DYLA 5BXZA 1OCOC 3L73H 2W0XA 4MVSA 1R6NA 4TSFG 2MK3A 2IBZH 1YSCA 2ZT9B 3RGBA 2JJ1G 2X0LA 5B5EZ 3BABA 5IWAB 4CBCA 2EINB 1B04A 1WP8A 1PL4A 1Y76B 3RYIA 1VF7A 1QR8A 3AG2C 1WLEA 2R72A 1QNMA 2JEUA 1JOYA 4NYKA 5IYBO 1P4RA 4ZHQA 3ASNB 2ODMA 2Y69C 1WN7A 3W7UA 1KQSU 4PDVA 3JAWB 4F4LA 4MW8A 4DK0A 4EKWA 1URFA 4B3TO 2UU9B 3OGCC 1K4CC 3IJ4A 3WB1A 1XMQO 2P5OA 1XBLA 3FB5C 1KYOF 5EK0A 3APQA 5CBHA 4FK5C 5B1OA 3SPJA 3RVZA 4YXWG 1TUBB 2QM7A 2Q67A 3CCRV 4FZ0A 3FAVA 3ZJZA 3E83A 3OTOB 5H6QA 1PNMA 4F6RA 4PHZA 2OTJV 3K04A 2RJZA 1BMFG 3WU2Z 2KSDA 3ABKB 1XL4A 3CRCA 5IWAO 1PP9H 2WA4A 2PUSA 4YHHB 3HKDA 1Y4MA 4ABMA 2W6JG 4J42A 4AQYB 3O9OA 3FB7C 4J9YB 4H33A 4DR6B 4DR7B 3ICXA 3HKBA 3BVOA 3GB7C 1U97A 4PI2A 3K57A 5DEDA 1F4NA 1G4YB 1XHXA 4JYCA 2HJDA 2L35A 4DK1A 2F23A 1XHZA 4FFBA 2UU9O 1YXBA 1YJ9V 4LF7B 2DYSB 2YEVB 3BCCH 4G28B 1J5EB 3ZRXA 3W7XA 5CBFA 1OHHG 1Y66A 4X1IA 1OJHA 4J7JA 3KKYA 1D5AA 5EYPA 4DV3O 3A0HZ 1K33A 2CTWA 2WWWA 1NKDA 2WA3A 4X8AA 1EBOA 2IH1C 3OTOO 2FMLA 2ZR3A 1Q6IA 2OTLV 1XEQA 4LFAB 4RUEA 3QO5A 2Q7EA 2ATKC 3LNNA 4RO2A 3K03A 4WFGA 4QPKA 3RYFA 4FLWA 1NU1H 4F6EA 4YHHO 5J2TA 4AQYO 2BSKB 4FPPA 4B7KA 4DR4B 3BPZA 3T1YO 4GT1A 5FNVB 1NT2B 4DR7O 1XMOB 4O4JB 1N36B 4JTDB 3H1LH 4BW9A 4NTYA 1DK1A 3RWRD 3AK1A 1L8DA 1XQ8A 4U3JA 3R65A 1GN2A 4LF7O 2EIJC 5JJNB 1M1KW 1J5EO 2VRZA 4P2ZA 1SQBH 3CRAA 2EX3A 3ZMZA 3ZHUA 2DN9A 2WSSG 2A79B 1P84F 4W4KA 3RW0A 2OCHA 4IYIA 1MNGA 5IDJA 4U3FH 1NZ6A 3L75H 1K3EA 3CX5F 1RSOA 1K7DA 1GKFA 3I5DA 4LFAO 3LSQA 2Q0OC 5TISZ 3K58A 2VS0A 3CS5A 4NB5A 4JTAB 4GLXA 1K92A 3E8GA 4ZOLA 2GTAA 2Q0AA 3LSUA 5CA1A 3I55V 4DV7O 1V55B 5IJ0B 2HP8A 2CGOA 1AB3A 5B3SC 3KCXA 4IHJB 1DF4A 4NTWA 2ZDIC 1M56C 2QWQB 3DTUB 1H2SB 2WLKA 5GONB 1XMOO 2Q4PA 1YF2A 3AG1C 1QVGU 1N36O 4LF8B 4Q6GA 2LP7A 2ADPA 2FKXA 3W7WA 5LMNB 4YJ2A 3VQWA 2ITDC 1NTZH 1J95A 3X2QC 3OMIB 3L71H 4I50A 1YVWA 2HG5C 3IGAC 2LGQA 2JGDA 1YTFB 1DGSA 1HP8A 1QBZA 1KUQA 5C8YA 1VQ8V 4R7CA 2Z0AA 3OE7G 1A32A 3PN1A 1PL0A 3DC6A 3CCQV 3AG3C 4NTXA 3T2MA 1M5IA 1K97A 2X7RB 4R6ZA 3BAAA 4WBNB 3UT5A 1MOFA 2Q5ZA 2Q8VA 5CN0A 1JR9A 3D8CA 1BSMA 2B1GA 1I08A 5KAFZ 4UV8A 5L3BA 3K5LA 2PF4E 2ZM6B 4DW1A 4HZ3A 2YSUB 2CH7A 3CC4V 1OCOB 3IFXA 4FLUA 2D3OW 2IW5A 4UVAA 3JSNA 5EZYB 2HR3A 3S3XA 1H8HG 4LF8O 1ZL8B 5LA6B 1FXHA 2IJKA 1QLNA 3RYCA 5LMNO 2O57A 4HYOA 1VMGA 1Q82W 2EZOA 2WLMA 1SESA 3N2KA 4ZIBA 3AG2B 2Y0PA 3JAKA 4GX0A 4O4IB 2EIMC 1SC5B 1BCCH 4RWUA 3JD2A 2Y69B 4XBFA 5EBLC 3UO2A 1EZVH 2F66C 4FLTA 1GO3F 3APOA 1KKDA 1WA8A 4HNAB 4DR3B 1LR1A 1SA0B 2YIAA 1W2BU 3ZRWB 3CJHB 3R66A 2IJJA 2PI4A 1LUWA 1K73W 3CRQA 2ZM6O 1NVPB 1SETA 5CB4A 1R3LC 4ZBMA 3FB6C 2G38A 5LMUB 1AROP 4GX5A 2GDSA 4DRXA 1NR1A 2WLIB 1VQNV 1JCHA 3RBZA 2WLHA 5GTHZ 1K34A 3BEHA 1FOUA 1FXVA 3ABMC 1F51A 2ZR2A 1QVFU 3A2FA 5JH7B 1GN6A 4BIUA 1LUVA 3TGUH 4ZI7A 1AJNA 4LP8A 2QWPB 2X6BA 2AHYA 1EN6A 1R6TA 3L74H 1OZ0A 4Z2WA 1NH2D 2ZXWC 5IT9N 1M4UA 3EVKA 1ZSPA 1GN4A 3AK2A 3LSSA 3H1KH 5LGUA 4NXNB 3OGIB 1GM8A 1N0NA 4DR3O 1XNQB 1VQ4V 4PD4F 1W0KG 1W0JG 1P7BA 4MTOA 1EM1A 5LYJA 3GWKC 2RN9A 1THZA 4Z1MG 2QM4A 4WFAV 5IJ9A 2UXXA 3BRCA 3AG7A 4TV9B 3G71V 2V1DA 1V54C 2ZE5A 2XHBA 4PJ0Z 4BIOA 4WFBV 5LMUO 1GAXA 2XTAA 4AILC 3K9AA 3W7TA 4EFBA 3OT7A 3B8NA 4YIOA 5IYZB 4LF9B 1IXMA 2C2AA 1AI7A 3HKEA 1COWG 3DXRA 4MVQA 4B3MB 2E3CA 3OW2U 1UFIA 3U10A 2A06H 2IH3C 1WP7A 2WLNA 1IBKB 4PDRA 1Q7YW 4CS4A 1WNSA 4GUNA 4CH6A 1Q5OA 1NVPD 5K1XA 4GCZA 1ORQC 2XAQA 2QTOA 2XUMA 1IBLB 2AXTZ 1HR0B 3N2GB 5AG2A 2Q68A 1YI2V 5JWPA 2B1IA 3OTFA 4NXNO 1VQ9V 1XNQO 2EIJB 3JATA 4KFMA 4UCOA 2V7QG 3H9VA 3K08A 1M93A 4I9QA 4YJ3A 1OCZC 2OCCC 1GH6A 3JYCA 4LBEC 4DR5B 1Y74B 5KUKA 1AJQA 1BE3H 3P30A 2XT9A 3M7MX 3BHPA 1W59A 1HW7A 1FFTB 1FFXA 4PDLA 1MABG 1YJWV 3ZX6A 4LF9O 5KMGA 4O4HA 2HVKC 1GMGA 3D36A 4B3MO 1Y67A 5JVDA 4O2BA 1R3KC 2ITCC 4ICGA 5JJJB 5C93A 4JI5B 5B3SB 4R8CA 1IBKO 3DSQA 1M56B 2YXLA 4X89A 1X4TA 1XNRB 3D3IA 4MTFA 3AG1B 4X64B 3B40A 3K06A 3TJTA 3VQVA 2H3OA 5D5QA 3ZRVA 1XOUA 4BIZA 4X88A 2EBOA 1IBLO 3X2QB 1HR0O 1JFFA 3SPHA 4EB6A 3FYIB 1FPOA 3FB8C 2XOKG 1PM9A 1SQGA 2YI8A 4D6TH 2LW1A 4B3SB 3JARA 5A2QN 4IT5A 1TVKA 4I55B 3AG3B 4JTCB 4DR5O 4JAUA 2P67A 1BT8A 4DV6B 2HJFC 2ZIMA 2JJ2G 4BAYA 4FLXA 2JS5A 2ZQMA 1S5HC 3F5WC 1XL6A 5B1NA 2PTMA 1YITV 1KU9A 4QE9A 1FXKB 1IXBA 4H0LB 4R50A 3IC9A 2YIDA 1KP2A 4IIJB 4LWSB 2DJVA 2KG7B 4UFZA 4JI5O 4K8ZA 5LXTB 2F93B 4E4EA 3E22A 1XNRO 5J2UB 4WFHA 4MSWC 3HKCA 4O4LB 2H8PC 2N05A 1SERA 1BQZA 2QKCA 2KQXA 3MHSC 2JK5C 1VQOV 3OEHG 3CRMA 1RM1C 1I7FA 5B66Z 3KZIZ 1GM7A 1VQMV 2L6LA 1QCEA 4TQFA 2EIMB 4B3SO 2CK3G 4JI2B 1WPXA 4BW5A 4X20A 1QQCA 3K9SA 1JX9A 4IL6Z 4O2AA 1EFRG 5KHIA 2EIKC 5E1AC 4DV6O 1Q3EA 4D7TA 4GKKB 4KHPB 2W6IG 4X1YB 1YDXA 1TAEA 2ARHA 3CEIA 1JQ0A 4X66B 1SQVH 2GUZA 5KX5A 1XDCA 1R6KA 1SS3A 2DW4A 1KBHA 4P30A 4DR2B 1RPOA 3OUFA 5L3GA 3TK1A 2JRIA 2EZPA 2WLLB 4JGSA 1E1RG 1H2MA 4W4LA 3G4SV 4H13B 4DR1B 4P9PA 1S0VA 3M8AA 5BMVA 3ABMB 3ASOC 2RQ6A 1US6A 1G1XB 4L8JA 3RYIB 1DLBA 1E1QG 4RQEA 2P06A 1AR4A 4JI2O 5H9CA 2VQFB 5CA0A 4CH5A 4I0XA 1VARA 2ZXWB 2R9RB 4ZHQB 1TUEB 4GX1A 4J10A 2DQ0A 4G2KA 2JDIG 3QO7A 2AZ2A 4RQFA 4GKKO 4KHPO 4DR6O 2ZNJA 4I7ZB 2M7WA 1WJZA 1VF5B 2K1EA 3CCSV 4X66O 3OM3B 3H1JH 4LNUA 2OWOA 2Q7GA 2N74A 5EC1C 1OCCC 3JASA 2D2CB 1V54B 4Q20A 4UB8Z 4J9ZB 4DR2O 3H1HH 1VQ5V 1AI5A 4LFBB 3FAVB 1R73A 3UM7A 4DW0A 1SQQH 1N32B 4F6RB 3B77A 4DR1O 4AHCA 3RYHA 4UCSA 2AHZA 4I4TA 1IJGA 4LH6A 3ZCCA 1GN3A 3CMEV 4EFEA 3HKDB 5EIBD 1GTOA 3CCUV 1UJWB 2VWJA 2VQFO 2F95B 1VF6A 2CUGA 3HKBB 1CEZA 1WPBA 4MT8A 4CZZA 2NR5A 1VQKV 4DR4O 2JEXA 1N33B 1SZXA 2XASA 4DV5B 3CCVV 4X1KA 3SJBC 4KL1A 4FFBB 2UXCB 3QTCA 2EJ7A 2P4KA 2PGGA 4UXNA 2A9HA 3F7YC 3A0RA 1OCZB 2OCCB 1T5EA 2FYUH 4X1IB 5EYPB 2XAHA 1S3JA 5H5NA 1IVSA 4LFBO 1EZJA 5J9PC 3E8HA 4NXMB 1K8AW 1N32O 3JALA 3CRRA 5L3FA 3ZHSA 2ZIOA 1D5NA 3UCSC 1IDSA 2PI5A 3P3PA 3RYFB 3VQYA 2WPDG 1VQ7V 4JF3A 1H5WA 2WLJA 2UXDB 1PNLA 3RVYA 1OCRB 1I5XA 5J2TB 4UVBA 1AI4A 2Y48A 4RUFA 5H6RA 1PNKA 4PI0A 1SF9A 1LNQA 4N23A 1Q86W 2UXBB 1QLEC 1DF5A 2RDCA 1Q81W 1D2DA 2IJIA 1NH2B 3AEIA 1N33O 3UO3A 4DV5O 3ABLC 2AGAA 2UXCO 4U3JB 4JYBA 4MVRA 4OPAA 1SRYA 3TXSA 1F7YA 2JS3A 2ZNIA 3CCJV 1KD1W 5LOVA 5LP6A 3SPCA 4CC6A 1RPRA 4B7EA 1RSOB 2KKWA 3RFRA 3ZHRA 4NXMO 4DV2B 3F5TA 1VEWA 3SDLA 1VQ6V 5H2FZ 1ZUQA 4ZOLB 4QPJA 5CA1B 3D36C 2UXDO 1MSDA 4X65B 1CP9A 2B5UA 1HNWB 5L3DA 4G27B 2CTQA 3QVNA 5EIBC 2UXBO 5D5PA 3BA9A 3LUTB 5B1BC 3RN4A 1YHQV 4QJFB 3U0ZA 4JI4B 5JJEB 3SYAA 4MVMA 4MVZA 4YJ2B 1RM1B 3NXSA 2NLJC 4AI8A 1M90W 4GX2A 3Q4HA 2Q6AA 2GTSA 2F1MA 2HHHB 1YIJV 3ZMTA 4I50B 5ITZA 1QU7A 1VQLV 2Z3YA 2EILC 4FM0A 5C8YB 4JI1B 4JYAB 5KUMA 2BTQA 2EIKB 2Y4UA 4YY3B 1S72V 5JQGA 5KA5A 3ZHTA 2JIZG 4DV2O 3UT5B 1H38A 3LDEA 4TV8A 4H37A 4CS3A 2EJRA 3OMAB 2R9IA 4HAMA 1PV0A 3N27A 2UUCB 3DC5A 4J80A 2WAMA 3QO8A 4J7ZA 4X65O 1AILA 1KECA 1HNWO 3CXHF 4X9QA 2CH7B 3K79A 2CTRA 1B06A 2JVDA 2CGNA 1N0JA 5FPRA 4FLYA 2A3QA 2QSAA 4JI4O 3BA8A 1WB8A 3RYCB 3ASOB 2P6JA 4K3AA 1E79G 3N2KB 4JYYA 2HHHO 4TUYA 3JAKB 3HR0A 2CTPA 4LC1A 4DXWA 1SQFA 2IU0A 4FVMA 4DV4B 4JI1O 4JYAO 3L72H 4I5SA 2GBOA 4YY3O 3ZHQA 3CC2V 4XDKA 5L3CA 4DO2A 3ZIAG 1Y6XA 3K5NA 1Y76A 1NQTA 4JI6B 3K0GA 4MS2A 2LQTA 1WA8B 3SYOA 1OCCB 3HPLC 4PA6A 3PJSK 1IX9A 1MZEA 4DV1B 2UUCO 1H2NA 1O9HA 1HNZB 2YS8A 2YXHA 1MA1A 3EXAA 4JI7B 3JAWA 1U96A 3O65A 3H1IH 5CMUA 1Q43A 4YIPA 2H94A 5CB4B 1RFYA 4WFFA 2QJ1A 2VWKA 4DRXB 3ZMUA 3IC7A 1MSWD 2RMKB 3SYPA 1CXZB 5BY1A 2Q7HA 5EC2C 4UCVA 4K0KB 1SQXH 1FS0G 3BFRA 2QEXV 1MG1A 1Q8IA 3CCMV 1TUBA 3L9DA
chains in the Genus database with same CATH topology
2ADQB 2CDYA 3KKYA 3CEIA 3DC5A 3MDSA 1GN3A 1QNMA 1XUQA 3OT7A 4YIOA 2RCVA 1XDCA 1PM9A 4X9QA 2ADPA 4BR6A 1EN4A 1B06A 1N0JA 1WB8A 1VEWA 1LUWA 4GUNA 4F6EA 1BT8A 1SZXA 4JYYA 1ZUQA 1BS3A 2GDSA 5AG2A 3DC6A 1IXBA 3AK3A 2P4KA 3IC9A 1JA8A 1MSDA 1ZTEA 1AR5A 3QVNA 1XREA 1AR4A 1JR9A 3RN4A 3AK1A 1VARA 3C3TA 1GN2A 4E4EA 1BSMA 1I08A 1GN6A 1AVMA 1LUVA 2AW9A 1EN6A 1D5NA 1IX9A 1ZLZA 1IDSA 2QKCA 1AP5A 4C7UA 1P7GA 3EVKA 1MA1A 1ZSPA 1MNGA 3KDRA 1GN4A 2CE4A 4JZGA 1WB7A 3AK2A 1KKCA 1MMMA 2QKAA 4YIPA 1N0NA 1EM1A 1Y67A 1EN5A 3C3SA 5A9GA 1XILA 3K9SA 4FFKA 3LSUA 3BFRA 4JZ2A 1AP6A 3TJTA 1I0HA 1PL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADQ B;  2CDY A;  3KKY A;  3CEI A;  3DC5 A;  3MDS A;  1GN3 A;  1QNM A;  1XUQ A;  3OT7 A;  4YIO A;  2RCV A;  1XDC A;  1PM9 A;  4X9Q A;  2ADP A;  4BR6 A;  1EN4 A;  1B06 A;  1N0J A;  1WB8 A;  1VEW A;  1LUW A;  4GUN A;  4F6E A;  1BT8 A;  1SZX A;  4JYY A;  1ZUQ A;  1BS3 A;  2GDS A;  5AG2 A;  3DC6 A;  1IXB A;  3AK3 A;  2P4K A;  3IC9 A;  1JA8 A;  1MSD A;  1ZTE A;  1AR5 A;  3QVN A;  1XRE A;  1AR4 A;  1JR9 A;  3RN4 A;  3AK1 A;  1VAR A;  3C3T A;  1GN2 A;  4E4E A;  1BSM A;  1I08 A;  1GN6 A;  1AVM A;  1LUV A;  2AW9 A;  1EN6 A;  1D5N A;  1IX9 A;  1ZLZ A;  1IDS A;  2QKC A;  1AP5 A;  4C7U A;  1P7G A;  3EVK A;  1MA1 A;  1ZSP A;  1MNG A;  1GN4 A;  2CE4 A;  4JZG A;  1WB7 A;  3AK2 A;  1KKC A;  1MMM A;  2QKA A;  4YIP A;  1N0N A;  1EM1 A;  1Y67 A;  1EN5 A;  3C3S A;  5A9G A;  1XIL A;  3K9S A;  4FFK A;  3LSU A;  3BFR A;  4JZ2 A;  1AP6 A;  3TJT A;  1I0H A;  1PL4 A; 
#chains in the Genus database with same CATH topology
 1KMI Z;  2HKO A;  1VP7 A;  3JD3 A;  2P7T C;  4ZI7 B;  2QGN A;  1NS1 A;  3LDD A;  4DV4 O;  4MVU A;  3SGI A;  4BWA A;  2E75 B;  3SJC C;  2V4D A;  2LO1 A;  5HFM A;  2YIB A;  4UB6 Z;  1OV9 A;  2LGW A;  1NTM H;  1VQP V;  4JI6 O;  1I5Y A;  4E2L A;  1X59 A;  3TCU A;  3SYQ A;  5LYJ B;  1G6U A;  3ZS8 C;  5LBQ A;  1PD3 A;  5DM6 V;  3J80 N;  4DV1 O;  5IJ9 B;  3ETE A;  1HNZ O;  2ZE8 A;  4JI7 O;  3KG2 A;  3CC7 V;  1H8E G;  2PY5 A;  1BZK A;  2P22 C;  3OAA G;  4HBN A;  4LF5 B;  2YEV A;  1M57 C;  1K5Q A;  1L0L H;  1FJG B;  2UUB B;  4K0K O;  3HKE B;  5KHK A;  4UV9 A;  4TT3 G;  3DXR B;  1JVM A;  2AW9 A;  3K5M A;  4B08 A;  3B2E E;  2DYR C;  1QLE B;  3UKM A;  1N8R W;  3UQ8 A;  1VF6 C;  3MHH C;  2F4V B;  1FAF A;  3CD6 V;  1ZAU A;  2DOS A;  3ABL B;  4X64 O;  2QWO B;  2BSK A;  4FFK A;  4LF6 B;  1G8M A;  1B3Q A;  1BHB A;  2ZCE A;  5FNV A;  1JPX A;  3JAT B;  4O4J A;  2FL4 A;  2CDY A;  4QIW F;  2RNB A;  3MDS A;  4YJ3 B;  4PEL A;  3JD0 A;  1N4C A;  2IU3 A;  3W7S A;  4B3R B;  4CC5 A;  5L3E A;  4DV3 B;  3ABT A;  1KP3 A;  1M9N A;  4LF5 O;  1Q6U A;  2QWN B;  1FFX B;  4K35 A;  4KP4 A;  1FJG O;  2UUB O;  1NBM G;  1JJ2 U;  1K5S A;  3E89 A;  4I9W A;  5KMG B;  3CWB H;  3CSX A;  4IYH A;  4O4H B;  3JAM N;  4GZR B;  5JVD B;  4O2B B;  1XI1 A;  2Y0I A;  5FL7 G;  3IAY A;  3THO A;  1YZB A;  1SZT A;  3E35 A;  5JCO A;  5F2V O;  4PA4 A;  3T1C A;  4MTX A;  2HVJ C;  5B1B B;  4FZ1 A;  2GV9 A;  3AK3 A;  3ETG A;  2JGU A;  5IY5 C;  1H2L A;  4CH4 A;  1DTO A;  3T1Y B;  3JD4 A;  2F4V O;  1S5L Z;  3JSL A;  4FM2 A;  2QE7 G;  4FJC C;  1JFF B;  4WF9 V;  3OMN B;  5IJ0 A;  2BE3 A;  4EB6 B;  3G67 A;  1TGO A;  1N34 B;  4LF6 O;  4IHJ A;  4PA9 A;  5IYD O;  2EIL B;  5KAI Z;  5GON A;  3JAR B;  3K0D A;  3WG7 C;  1TVK B;  1ENV A;  2KB1 A;  4LR3 A;  5LHG A;  1ZX3 A;  5B1A C;  3AG4 C;  5EBM C;  1L1F A;  1F23 A;  2QDO A;  3NR7 A;  4B3R O;  3KDR A;  5LP6 C;  3L70 H;  1MMM A;  3JCZ A;  2X6A A;  2LJ2 A;  4OGQ B;  5CBG A;  2PYJ A;  3I56 V;  4OXS A;  2YI9 A;  1QHT A;  1V9P A;  3A8T A;  4EEQ A;  2OT5 A;  2HFE C;  1I0H A;  2ADQ B;  4DV7 B;  4WBN A;  3ZBH A;  4UUJ C;  3E22 B;  3LNM B;  2DWE C;  3KCY A;  2QKS A;  1KB9 F;  2W0F C;  2E5L B;  3HKC B;  3P3N A;  1F4M A;  3OD4 A;  3FYE B;  4LF4 B;  1S76 D;  4BR6 A;  1HWY A;  3JCU Z;  1CPY A;  3STL C;  2QA4 V;  1N34 O;  4ASU G;  1K9M W;  1MZF A;  2DWD C;  5EZY A;  3QF7 A;  3K5O A;  3C90 A;  3QG5 A;  3ABU A;  4Z1V A;  1ROP A;  1ZL8 A;  4X20 B;  5LA6 A;  3CCL V;  1BS3 A;  1H2K A;  4O2A B;  1NJI W;  2OIE A;  2YIB D;  4U7O A;  4TWK A;  3CE2 A;  4JAV A;  2P90 A;  2ZE7 A;  3SJQ C;  2PYL A;  4O4I A;  1SQP H;  3CB2 A;  5BZB A;  1YJN V;  2GHY A;  1AR5 A;  3SYC A;  1Z5W A;  2OYQ A;  2GUZ B;  5KX5 B;  2K9P A;  3GVM A;  4XDJ A;  2NN4 A;  4UCT A;  4QE7 A;  2M6Y A;  3ZMS A;  3G6E V;  3B8M A;  5LHH A;  3T1H B;  4WCE V;  4DUY B;  4FLZ A;  3OEE G;  3ZHV A;  3J81 N;  3S3W A;  4A5U B;  4HNA A;  1AP5 A;  4PA3 A;  4MW3 A;  1SA0 A;  2E5L O;  3CMA V;  2Q69 A;  3FD9 A;  3G6B A;  2QM8 A;  4QNH B;  4JI0 B;  1TA8 A;  3ZRW A;  3CJH A;  4LF4 O;  4LH7 A;  5BMV B;  1ZWI C;  3TET A;  1Q6H A;  1P49 A;  3C3S A;  1I94 B;  1NR7 A;  4X62 B;  2CAZ C;  3VQX A;  3F7V C;  4JZ2 A;  3ETQ A;  3ZMV A;  4DV0 B;  2ZD9 A;  4J7K A;  1UPG A;  4H44 B;  3B09 A;  3OUS A;  5CA0 B;  4PDM A;  4I0X B;  2WLI A;  2XAG A;  4QGP A;  3HB3 B;  4OX9 B;  1Z2G A;  2HEP A;  5DEC A;  5EBW C;  1PKX A;  2EIN C;  5JH7 A;  2A0L A;  2XND G;  3H01 A;  4TOI A;  1QR9 A;  4LNU B;  2ZE6 A;  5GTI Z;  3JAS B;  5LGN A;  3U11 A;  3ASN C;  3JD1 A;  5KHH A;  3T1H O;  2LFR A;  1FXK C;  2BOC C;  3A0B Z;  3SPI A;  4DUY O;  1H2G A;  5KHG A;  1IUR A;  4LCU C;  4LFC B;  1JJO A;  5KA6 A;  1M57 B;  1GRJ A;  4KXR A;  5E79 Z;  3EFF K;  1GM9 A;  4DUZ B;  4JI0 O;  2YC0 A;  1Z5V A;  1JA8 A;  1SKV A;  4JAA A;  3RYH B;  5KLV H;  4I4T B;  3M99 B;  4TQD A;  3CP1 A;  4TV9 A;  4UVC A;  4GYC B;  4JI8 B;  2DYR B;  1I94 O;  2F43 G;  4X62 O;  3ZN0 A;  5HFL A;  1R3J C;  1AVM A;  4DV0 O;  2UUA B;  5IYZ A;  5FLX N;  3K59 A;  3WFV A;  3T4D A;  1P7G A;  4XDL A;  3ABK C;  4OX9 O;  3EHB B;  3OR6 C;  1YEW A;  4X1K B;  3K3W A;  3B4S A;  4PA7 A;  5GW7 A;  2XAJ A;  1FD9 A;  1HNX B;  2B9Z A;  4L87 A;  3VOU A;  3VBB A;  1AJP A;  3SJA C;  5FPO A;  3N2G A;  1AP6 A;  5CA3 A;  2Z5U A;  1K4D C;  2P4V A;  1RP3 B;  4LFC O;  2JGD B;  3E8F A;  1YTF D;  2E74 B;  3CHX A;  4DUZ O;  3JAL B;  1FYJ A;  4JAS A;  2DYS C;  3LDC A;  4J11 A;  3STZ C;  2FB5 A;  2A7W A;  3E2E A;  2IM9 A;  1Y74 A;  1AR1 B;  4JI8 O;  2BCC H;  2BTO A;  4D7S A;  3MAQ A;  4RAI A;  5BR8 B;  3OR7 C;  2UUA O;  3FX7 A;  5IY5 B;  4JV5 B;  3ML0 A;  3CYO A;  4J41 A;  2Q73 A;  4JI3 B;  4JPR A;  2QWR B;  4P9O A;  2DMX A;  2ZDI A;  3ZED A;  4FLV A;  3CCE V;  3WG7 B;  1HNX O;  2Y4T A;  3FKS G;  5B1A B;  2QR4 A;  4OPH A;  4WFE A;  3AG4 B;  3C3T A;  2ETN A;  3J7A U;  4GKJ B;  3FFQ A;  5LOV B;  4MVO A;  5LP6 B;  2Q9L A;  1B6Q A;  3ZRS A;  1PPJ H;  4CS2 A;  4N21 A;  2R9A A;  2YUA A;  1ZLZ A;  3GWO A;  2VQE B;  1Q90 D;  2OIG A;  4NKG B;  2CE4 A;  3E86 A;  4I55 A;  4JZG A;  2AZ0 A;  1WB7 A;  1KKC A;  4UCU A;  2PZS A;  1IBM B;  3CXC U;  2QKA A;  4K8X A;  1L0N H;  3G80 A;  5KHJ A;  1AI6 A;  1FKA O;  1EN5 A;  5A9G A;  1XIL A;  5BR8 O;  2X6C A;  4FM1 A;  1FXK A;  2NNU A;  4NR1 A;  1BGY H;  5JCO C;  1NI8 A;  3OFN G;  1S77 D;  4JV5 O;  2R70 A;  3SPG A;  4IIJ A;  1YCI A;  4ZKI A;  2YXY A;  3D3Q A;  3QNE A;  4LWS A;  4U7N A;  4JI3 O;  2ZKO A;  1XUQ A;  3TXQ A;  5K1P A;  2KG7 A;  5LXT A;  1V55 C;  3P32 A;  2RCV A;  3Q4H B;  3DGE A;  3BY6 A;  2YIC A;  2E76 B;  4PV1 B;  5J2U A;  2DE0 X;  3MD0 A;  2GSM B;  5ITZ B;  2FTK A;  2DQ3 A;  4O4L A;  4NVP A;  1EN4 A;  2LW7 A;  2QTS A;  1O9G A;  5IYC O;  4FMT A;  4GKJ O;  5DN6 G;  2BTQ B;  1VIB A;  2N04 A;  1BL8 A;  4CH3 A;  5JQG B;  1JMK C;  3ETD A;  3ZN1 A;  3SR2 C;  1IZ3 A;  4IGG A;  2VQE O;  1S5J A;  2ZIN A;  1JNB A;  2EUL A;  5IE9 A;  2MW2 B;  2XAF A;  4TV8 B;  1IBM O;  1R3I C;  3WB2 A;  1ZTE A;  1BQ0 A;  3CPW U;  2YDE A;  4UCR A;  1BHA A;  1GK9 A;  3T4Z A;  1XRE A;  2HLD G;  5LHI A;  4X1Y A;  4B3T B;  4KUM A;  2ILM A;  2BOB C;  5LL6 Y;  1KC8 W;  1R1B A;  1XMQ B;  3E8B A;  5LGT A;  4MTG A;  1NTK H;  1OCR C;  2LFS A;  4C7U A;  3RT3 C;  2IJH A;  4FIP C;  2WLL A;  3WB0 A;  1WAZ A;  4TUY B;  2UXN A;  1HDJ A;  4DYL A;  5BXZ A;  1OCO C;  3L73 H;  2W0X A;  4MVS A;  1R6N A;  4TSF G;  2MK3 A;  2IBZ H;  1YSC A;  2ZT9 B;  3RGB A;  2JJ1 G;  2X0L A;  5B5E Z;  3BAB A;  5IWA B;  4CBC A;  2EIN B;  1B04 A;  1WP8 A;  1PL4 A;  1Y76 B;  3RYI A;  1VF7 A;  1QR8 A;  3AG2 C;  1WLE A;  2R72 A;  1QNM A;  2JEU A;  1JOY A;  4NYK A;  5IYB O;  1P4R A;  4ZHQ A;  3ASN B;  2ODM A;  2Y69 C;  1WN7 A;  3W7U A;  1KQS U;  4PDV A;  3JAW B;  4F4L A;  4MW8 A;  4DK0 A;  4EKW A;  1URF A;  4B3T O;  2UU9 B;  3OGC C;  1K4C C;  3IJ4 A;  3WB1 A;  1XMQ O;  2P5O A;  1XBL A;  3FB5 C;  1KYO F;  5EK0 A;  3APQ A;  5CBH A;  4FK5 C;  5B1O A;  3SPJ A;  3RVZ A;  4YXW G;  1TUB B;  2QM7 A;  2Q67 A;  3CCR V;  4FZ0 A;  3FAV A;  3ZJZ A;  3E83 A;  3OTO B;  5H6Q A;  1PNM A;  4F6R A;  4PHZ A;  2OTJ V;  3K04 A;  2RJZ A;  1BMF G;  3WU2 Z;  2KSD A;  3ABK B;  1XL4 A;  3CRC A;  5IWA O;  1PP9 H;  2WA4 A;  2PUS A;  4YHH B;  3HKD A;  1Y4M A;  4ABM A;  2W6J G;  4J42 A;  4AQY B;  3O9O A;  3FB7 C;  4J9Y B;  4H33 A;  4DR6 B;  4DR7 B;  3ICX A;  3HKB A;  3BVO A;  3GB7 C;  1U97 A;  4PI2 A;  3K57 A;  5DED A;  1F4N A;  1G4Y B;  1XHX A;  4JYC A;  2HJD A;  2L35 A;  4DK1 A;  2F23 A;  1XHZ A;  4FFB A;  2UU9 O;  1YXB A;  1YJ9 V;  4LF7 B;  2DYS B;  2YEV B;  3BCC H;  4G28 B;  1J5E B;  3ZRX A;  3W7X A;  5CBF A;  1OHH G;  1Y66 A;  4X1I A;  1OJH A;  4J7J A;  3KKY A;  1D5A A;  5EYP A;  4DV3 O;  3A0H Z;  1K33 A;  2CTW A;  2WWW A;  1NKD A;  2WA3 A;  4X8A A;  1EBO A;  2IH1 C;  3OTO O;  2FML A;  2ZR3 A;  1Q6I A;  2OTL V;  1XEQ A;  4LFA B;  4RUE A;  3QO5 A;  2Q7E A;  2ATK C;  3LNN A;  4RO2 A;  3K03 A;  4WFG A;  4QPK A;  3RYF A;  4FLW A;  1NU1 H;  4F6E A;  4YHH O;  5J2T A;  4AQY O;  2BSK B;  4FPP A;  4B7K A;  4DR4 B;  3BPZ A;  3T1Y O;  4GT1 A;  5FNV B;  1NT2 B;  4DR7 O;  1XMO B;  4O4J B;  1N36 B;  4JTD B;  3H1L H;  4BW9 A;  4NTY A;  1DK1 A;  3RWR D;  3AK1 A;  1L8D A;  1XQ8 A;  4U3J A;  3R65 A;  1GN2 A;  4LF7 O;  2EIJ C;  5JJN B;  1M1K W;  1J5E O;  2VRZ A;  4P2Z A;  1SQB H;  3CRA A;  2EX3 A;  3ZMZ A;  3ZHU A;  2DN9 A;  2WSS G;  2A79 B;  1P84 F;  4W4K A;  3RW0 A;  2OCH A;  4IYI A;  1MNG A;  5IDJ A;  4U3F H;  1NZ6 A;  3L75 H;  1K3E A;  3CX5 F;  1RSO A;  1K7D A;  1GKF A;  3I5D A;  4LFA O;  3LSQ A;  2Q0O C;  5TIS Z;  3K58 A;  2VS0 A;  3CS5 A;  4NB5 A;  4JTA B;  4GLX A;  1K92 A;  3E8G A;  4ZOL A;  2GTA A;  2Q0A A;  3LSU A;  5CA1 A;  3I55 V;  4DV7 O;  1V55 B;  5IJ0 B;  2HP8 A;  2CGO A;  1AB3 A;  5B3S C;  3KCX A;  4IHJ B;  1DF4 A;  4NTW A;  2ZDI C;  1M56 C;  2QWQ B;  3DTU B;  1H2S B;  2WLK A;  5GON B;  1XMO O;  2Q4P A;  1YF2 A;  3AG1 C;  1QVG U;  1N36 O;  4LF8 B;  4Q6G A;  2LP7 A;  2ADP A;  2FKX A;  3W7W A;  5LMN B;  4YJ2 A;  3VQW A;  2ITD C;  1NTZ H;  1J95 A;  3X2Q C;  3OMI B;  3L71 H;  4I50 A;  1YVW A;  2HG5 C;  3IGA C;  2LGQ A;  2JGD A;  1YTF B;  1DGS A;  1HP8 A;  1QBZ A;  1KUQ A;  5C8Y A;  1VQ8 V;  4R7C A;  2Z0A A;  3OE7 G;  1A32 A;  3PN1 A;  1PL0 A;  3DC6 A;  3CCQ V;  3AG3 C;  4NTX A;  3T2M A;  1M5I A;  1K97 A;  2X7R B;  4R6Z A;  3BAA A;  4WBN B;  3UT5 A;  1MOF A;  2Q5Z A;  2Q8V A;  5CN0 A;  1JR9 A;  3D8C A;  1BSM A;  2B1G A;  1I08 A;  5KAF Z;  4UV8 A;  5L3B A;  3K5L A;  2PF4 E;  2ZM6 B;  4DW1 A;  4HZ3 A;  2YSU B;  2CH7 A;  3CC4 V;  1OCO B;  3IFX A;  4FLU A;  2D3O W;  2IW5 A;  4UVA A;  3JSN A;  5EZY B;  2HR3 A;  3S3X A;  1H8H G;  4LF8 O;  1ZL8 B;  5LA6 B;  1FXH A;  2IJK A;  1QLN A;  3RYC A;  5LMN O;  2O57 A;  4HYO A;  1VMG A;  1Q82 W;  2EZO A;  2WLM A;  1SES A;  3N2K A;  4ZIB A;  3AG2 B;  2Y0P A;  3JAK A;  4GX0 A;  4O4I B;  2EIM C;  1SC5 B;  1BCC H;  4RWU A;  3JD2 A;  2Y69 B;  4XBF A;  5EBL C;  3UO2 A;  1EZV H;  2F66 C;  4FLT A;  1GO3 F;  3APO A;  1KKD A;  1WA8 A;  4HNA B;  4DR3 B;  1LR1 A;  1SA0 B;  2YIA A;  1W2B U;  3ZRW B;  3CJH B;  3R66 A;  2IJJ A;  2PI4 A;  1LUW A;  1K73 W;  3CRQ A;  2ZM6 O;  1NVP B;  1SET A;  5CB4 A;  1R3L C;  4ZBM A;  3FB6 C;  2G38 A;  5LMU B;  1ARO P;  4GX5 A;  2GDS A;  4DRX A;  1NR1 A;  2WLI B;  1VQN V;  1JCH A;  3RBZ A;  2WLH A;  5GTH Z;  1K34 A;  3BEH A;  1FOU A;  1FXV A;  3ABM C;  1F51 A;  2ZR2 A;  1QVF U;  3A2F A;  5JH7 B;  1GN6 A;  4BIU A;  1LUV A;  3TGU H;  4ZI7 A;  1AJN A;  4LP8 A;  2QWP B;  2X6B A;  2AHY A;  1EN6 A;  1R6T A;  3L74 H;  1OZ0 A;  4Z2W A;  1NH2 D;  2ZXW C;  5IT9 N;  1M4U A;  3EVK A;  1ZSP A;  1GN4 A;  3AK2 A;  3LSS A;  3H1K H;  5LGU A;  4NXN B;  3OGI B;  1GM8 A;  1N0N A;  4DR3 O;  1XNQ B;  1VQ4 V;  4PD4 F;  1W0K G;  1W0J G;  1P7B A;  4MTO A;  1EM1 A;  5LYJ A;  3GWK C;  2RN9 A;  1THZ A;  4Z1M G;  2QM4 A;  4WFA V;  5IJ9 A;  2UXX A;  3BRC A;  3AG7 A;  4TV9 B;  3G71 V;  2V1D A;  1V54 C;  2ZE5 A;  2XHB A;  4PJ0 Z;  4BIO A;  4WFB V;  5LMU O;  1GAX A;  2XTA A;  4AIL C;  3K9A A;  3W7T A;  4EFB A;  3OT7 A;  3B8N A;  4YIO A;  5IYZ B;  4LF9 B;  1IXM A;  2C2A A;  1AI7 A;  3HKE A;  1COW G;  3DXR A;  4MVQ A;  4B3M B;  2E3C A;  3OW2 U;  1UFI A;  3U10 A;  2A06 H;  2IH3 C;  1WP7 A;  2WLN A;  1IBK B;  4PDR A;  1Q7Y W;  4CS4 A;  1WNS A;  4GUN A;  4CH6 A;  1Q5O A;  1NVP D;  5K1X A;  4GCZ A;  1ORQ C;  2XAQ A;  2QTO A;  2XUM A;  1IBL B;  2AXT Z;  1HR0 B;  3N2G B;  5AG2 A;  2Q68 A;  1YI2 V;  5JWP A;  2B1I A;  3OTF A;  4NXN O;  1VQ9 V;  1XNQ O;  2EIJ B;  3JAT A;  4KFM A;  4UCO A;  2V7Q G;  3H9V A;  3K08 A;  1M93 A;  4I9Q A;  4YJ3 A;  1OCZ C;  2OCC C;  1GH6 A;  3JYC A;  4LBE C;  4DR5 B;  1Y74 B;  5KUK A;  1AJQ A;  1BE3 H;  3P30 A;  2XT9 A;  3M7M X;  3BHP A;  1W59 A;  1HW7 A;  1FFT B;  1FFX A;  4PDL A;  1MAB G;  1YJW V;  3ZX6 A;  4LF9 O;  5KMG A;  4O4H A;  2HVK C;  1GMG A;  3D36 A;  4B3M O;  1Y67 A;  5JVD A;  4O2B A;  1R3K C;  2ITC C;  4ICG A;  5JJJ B;  5C93 A;  4JI5 B;  5B3S B;  4R8C A;  1IBK O;  3DSQ A;  1M56 B;  2YXL A;  4X89 A;  1X4T A;  1XNR B;  3D3I A;  4MTF A;  3AG1 B;  4X64 B;  3B40 A;  3K06 A;  3TJT A;  3VQV A;  2H3O A;  5D5Q A;  3ZRV A;  1XOU A;  4BIZ A;  4X88 A;  2EBO A;  1IBL O;  3X2Q B;  1HR0 O;  1JFF A;  3SPH A;  4EB6 A;  3FYI B;  1FPO A;  3FB8 C;  2XOK G;  1PM9 A;  1SQG A;  2YI8 A;  4D6T H;  2LW1 A;  4B3S B;  3JAR A;  5A2Q N;  4IT5 A;  1TVK A;  4I55 B;  3AG3 B;  4JTC B;  4DR5 O;  4JAU A;  2P67 A;  1BT8 A;  4DV6 B;  2HJF C;  2ZIM A;  2JJ2 G;  4BAY A;  4FLX A;  2JS5 A;  2ZQM A;  1S5H C;  3F5W C;  1XL6 A;  5B1N A;  2PTM A;  1YIT V;  1KU9 A;  4QE9 A;  1FXK B;  1IXB A;  4H0L B;  4R50 A;  3IC9 A;  2YID A;  1KP2 A;  4IIJ B;  4LWS B;  2DJV A;  2KG7 B;  4UFZ A;  4JI5 O;  4K8Z A;  5LXT B;  2F93 B;  4E4E A;  3E22 A;  1XNR O;  5J2U B;  4WFH A;  4MSW C;  3HKC A;  4O4L B;  2H8P C;  2N05 A;  1SER A;  1BQZ A;  2QKC A;  2KQX A;  3MHS C;  2JK5 C;  1VQO V;  3OEH G;  3CRM A;  1RM1 C;  1I7F A;  5B66 Z;  3KZI Z;  1GM7 A;  1VQM V;  2L6L A;  1QCE A;  4TQF A;  2EIM B;  4B3S O;  2CK3 G;  4JI2 B;  1WPX A;  4BW5 A;  4X20 A;  1QQC A;  3K9S A;  1JX9 A;  4IL6 Z;  4O2A A;  1EFR G;  5KHI A;  2EIK C;  5E1A C;  4DV6 O;  1Q3E A;  4D7T A;  4GKK B;  4KHP B;  2W6I G;  4X1Y B;  1YDX A;  1TAE A;  2ARH A;  3CEI A;  1JQ0 A;  4X66 B;  1SQV H;  2GUZ A;  5KX5 A;  1XDC A;  1R6K A;  1SS3 A;  2DW4 A;  1KBH A;  4P30 A;  4DR2 B;  1RPO A;  3OUF A;  5L3G A;  3TK1 A;  2JRI A;  2EZP A;  2WLL B;  4JGS A;  1E1R G;  1H2M A;  4W4L A;  3G4S V;  4H13 B;  4DR1 B;  4P9P A;  1S0V A;  3M8A A;  5BMV A;  3ABM B;  3ASO C;  2RQ6 A;  1US6 A;  1G1X B;  4L8J A;  3RYI B;  1DLB A;  1E1Q G;  4RQE A;  2P06 A;  1AR4 A;  4JI2 O;  5H9C A;  2VQF B;  5CA0 A;  4CH5 A;  4I0X A;  1VAR A;  2ZXW B;  2R9R B;  4ZHQ B;  1TUE B;  4GX1 A;  4J10 A;  2DQ0 A;  4G2K A;  2JDI G;  3QO7 A;  2AZ2 A;  4RQF A;  4GKK O;  4KHP O;  4DR6 O;  2ZNJ A;  4I7Z B;  2M7W A;  1WJZ A;  1VF5 B;  2K1E A;  3CCS V;  4X66 O;  3OM3 B;  3H1J H;  4LNU A;  2OWO A;  2Q7G A;  2N74 A;  5EC1 C;  1OCC C;  3JAS A;  2D2C B;  1V54 B;  4Q20 A;  4UB8 Z;  4J9Z B;  4DR2 O;  3H1H H;  1VQ5 V;  1AI5 A;  4LFB B;  3FAV B;  1R73 A;  3UM7 A;  4DW0 A;  1SQQ H;  1N32 B;  4F6R B;  3B77 A;  4DR1 O;  4AHC A;  3RYH A;  4UCS A;  2AHZ A;  4I4T A;  1IJG A;  4LH6 A;  3ZCC A;  1GN3 A;  3CME V;  4EFE A;  3HKD B;  5EIB D;  1GTO A;  3CCU V;  1UJW B;  2VWJ A;  2VQF O;  2F95 B;  1VF6 A;  2CUG A;  3HKB B;  1CEZ A;  1WPB A;  4MT8 A;  4CZZ A;  2NR5 A;  1VQK V;  4DR4 O;  2JEX A;  1N33 B;  1SZX A;  2XAS A;  4DV5 B;  3CCV V;  4X1K A;  3SJB C;  4KL1 A;  4FFB B;  2UXC B;  3QTC A;  2EJ7 A;  2P4K A;  2PGG A;  4UXN A;  2A9H A;  3F7Y C;  3A0R A;  1OCZ B;  2OCC B;  1T5E A;  2FYU H;  4X1I B;  5EYP B;  2XAH A;  1S3J A;  5H5N A;  1IVS A;  4LFB O;  1EZJ A;  5J9P C;  3E8H A;  4NXM B;  1K8A W;  1N32 O;  3JAL A;  3CRR A;  5L3F A;  3ZHS A;  2ZIO A;  1D5N A;  3UCS C;  1IDS A;  2PI5 A;  3P3P A;  3RYF B;  3VQY A;  2WPD G;  1VQ7 V;  4JF3 A;  1H5W A;  2WLJ A;  2UXD B;  1PNL A;  3RVY A;  1OCR B;  1I5X A;  5J2T B;  4UVB A;  1AI4 A;  2Y48 A;  4RUF A;  5H6R A;  1PNK A;  4PI0 A;  1SF9 A;  1LNQ A;  4N23 A;  1Q86 W;  2UXB B;  1QLE C;  1DF5 A;  2RDC A;  1Q81 W;  1D2D A;  2IJI A;  1NH2 B;  3AEI A;  1N33 O;  3UO3 A;  4DV5 O;  3ABL C;  2AGA A;  2UXC O;  4U3J B;  4JYB A;  4MVR A;  4OPA A;  1SRY A;  3TXS A;  1F7Y A;  2JS3 A;  2ZNI A;  3CCJ V;  1KD1 W;  5LOV A;  5LP6 A;  3SPC A;  4CC6 A;  1RPR A;  4B7E A;  1RSO B;  2KKW A;  3RFR A;  3ZHR A;  4NXM O;  4DV2 B;  3F5T A;  1VEW A;  3SDL A;  1VQ6 V;  5H2F Z;  1ZUQ A;  4ZOL B;  4QPJ A;  5CA1 B;  3D36 C;  2UXD O;  1MSD A;  4X65 B;  1CP9 A;  2B5U A;  1HNW B;  5L3D A;  4G27 B;  2CTQ A;  3QVN A;  5EIB C;  2UXB O;  5D5P A;  3BA9 A;  3LUT B;  5B1B C;  3RN4 A;  1YHQ V;  4QJF B;  3U0Z A;  4JI4 B;  5JJE B;  3SYA A;  4MVM A;  4MVZ A;  4YJ2 B;  1RM1 B;  3NXS A;  2NLJ C;  4AI8 A;  1M90 W;  4GX2 A;  3Q4H A;  2Q6A A;  2GTS A;  2F1M A;  2HHH B;  1YIJ V;  3ZMT A;  4I50 B;  5ITZ A;  1QU7 A;  1VQL V;  2Z3Y A;  2EIL C;  4FM0 A;  5C8Y B;  4JI1 B;  4JYA B;  5KUM A;  2BTQ A;  2EIK B;  2Y4U A;  4YY3 B;  1S72 V;  5JQG A;  5KA5 A;  3ZHT A;  2JIZ G;  4DV2 O;  3UT5 B;  1H38 A;  3LDE A;  4TV8 A;  4H37 A;  4CS3 A;  2EJR A;  3OMA B;  2R9I A;  4HAM A;  1PV0 A;  3N27 A;  2UUC B;  3DC5 A;  4J80 A;  2WAM A;  3QO8 A;  4J7Z A;  4X65 O;  1AIL A;  1KEC A;  1HNW O;  3CXH F;  4X9Q A;  2CH7 B;  3K79 A;  2CTR A;  1B06 A;  2JVD A;  2CGN A;  1N0J A;  5FPR A;  4FLY A;  2A3Q A;  2QSA A;  4JI4 O;  3BA8 A;  1WB8 A;  3RYC B;  3ASO B;  2P6J A;  4K3A A;  1E79 G;  3N2K B;  4JYY A;  2HHH O;  4TUY A;  3JAK B;  3HR0 A;  2CTP A;  4LC1 A;  4DXW A;  1SQF A;  2IU0 A;  4FVM A;  4DV4 B;  4JI1 O;  4JYA O;  3L72 H;  4I5S A;  2GBO A;  4YY3 O;  3ZHQ A;  3CC2 V;  4XDK A;  5L3C A;  4DO2 A;  3ZIA G;  1Y6X A;  3K5N A;  1Y76 A;  1NQT A;  4JI6 B;  3K0G A;  4MS2 A;  2LQT A;  1WA8 B;  3SYO A;  1OCC B;  3HPL C;  4PA6 A;  3PJS K;  1IX9 A;  1MZE A;  4DV1 B;  2UUC O;  1H2N A;  1O9H A;  1HNZ B;  2YS8 A;  2YXH A;  1MA1 A;  3EXA A;  4JI7 B;  3JAW A;  1U96 A;  3O65 A;  3H1I H;  5CMU A;  1Q43 A;  4YIP A;  2H94 A;  5CB4 B;  1RFY A;  4WFF A;  2QJ1 A;  2VWK A;  4DRX B;  3ZMU A;  3IC7 A;  1MSW D;  2RMK B;  3SYP A;  1CXZ B;  5BY1 A;  2Q7H A;  5EC2 C;  4UCV A;  4K0K B;  1SQX H;  1FS0 G;  3BFR A;  2QEX V;  1MG1 A;  1Q8I A;  3CCM V;  1TUB A;  3L9D A; 
#chains in the Genus database with same CATH homology
 2ADQ B;  2CDY A;  3KKY A;  3CEI A;  3DC5 A;  3MDS A;  1GN3 A;  1QNM A;  1XUQ A;  3OT7 A;  4YIO A;  2RCV A;  1XDC A;  1PM9 A;  4X9Q A;  2ADP A;  4BR6 A;  1EN4 A;  1B06 A;  1N0J A;  1WB8 A;  1VEW A;  1LUW A;  4GUN A;  4F6E A;  1BT8 A;  1SZX A;  4JYY A;  1ZUQ A;  1BS3 A;  2GDS A;  5AG2 A;  3DC6 A;  1IXB A;  3AK3 A;  2P4K A;  3IC9 A;  1JA8 A;  1MSD A;  1ZTE A;  1AR5 A;  3QVN A;  1XRE A;  1AR4 A;  1JR9 A;  3RN4 A;  3AK1 A;  1VAR A;  3C3T A;  1GN2 A;  4E4E A;  1BSM A;  1I08 A;  1GN6 A;  1AVM A;  1LUV A;  2AW9 A;  1EN6 A;  1D5N A;  1IX9 A;  1ZLZ A;  1IDS A;  2QKC A;  1AP5 A;  4C7U A;  1P7G A;  3EVK A;  1MA1 A;  1ZSP A;  1MNG A;  3KDR A;  1GN4 A;  2CE4 A;  4JZG A;  1WB7 A;  3AK2 A;  1KKC A;  1MMM A;  2QKA A;  4YIP A;  1N0N A;  1EM1 A;  1Y67 A;  1EN5 A;  3C3S A;  5A9G A;  1XIL A;  3K9S A;  4FFK A;  3LSU A;  3BFR A;  4JZ2 A;  1AP6 A;  3TJT A;  1I0H A;  1PL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...