1XREA

Crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
b'SFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 69
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xreA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xreA02
3OT7A 1LUWA 2P4KA 3LSUA 1KKCA 1GN4A 3C3TA 4YIPA 3QVNA 3IC9A 2RCVA 1JA8A 3BFRA 1I08A 4JZ2A 4JYYA 1EN5A 1ZTEA 1SZXA 1PM9A 1P7GA 1GN6A 1MMMA 1AP5A 1N0JA 1LUVA 1XILA 1ZUQA 1AR5A 1GN3A 4X9QA 1EN6A 1IDSA 1XREA 1D5NA 3C3SA 4YIOA 1BS3A 1B06A 1AP6A 4F6EA 4GUNA 1WB7A 3CEIA 2CDYA 1MA1A 3KKYA 5AG2A 2CE4A 2GDSA 1ZSPA 1AVMA 2QKAA 4JZGA 1Y67A 1GN2A 1I0HA 1MNGA 3DC6A 1N0NA 1EN4A 1VARA 4C7UA 1JR9A 1AR4A 2AW9A 1IXBA 3EVKA 3RN4A 1BSMA 3K9SA 1WB8A 5A9GA 2ADQB 1BT8A 3AK3A 4FFKA 4BR6A 1XDCA 1QNMA 1ZLZA 2QKCA 1PL4A 2ADPA 3MDSA 1MSDA 1EM1A 3TJTA 3AK2A 1IX9A 3DC5A 3AK1A 1VEWA 1XUQA 4E4EA
chains in the Genus database with same CATH superfamily
2QM4A 1OJHA 2W0FC 4J7ZA 1AJQA 4LH6A 3ZS8C 1RPRA 4LF5O 2K9PA 1KKCA 1GTOA 1KB9F 3MD0A 4B08A 3CRRA 3AG4B 4UV9A 1H8EG 5DEDA 1K73W 2BCCH 3ZN1A 4G2KA 1V54B 2WPDG 3RGBA 3HPLC 4U3JA 4BW5A 2LFRA 3H1HH 3ZMTA 4I7ZB 1IZ3A 1KP2A 2RQ6A 4O2AA 4B3SO 1XQ8A 4PD4F 1L0NH 1GRJA 1DLBA 2DYSB 4FLVA 1HNXB 3K59A 1VQ8V 3CC4V 4LF6B 4MVZA 1M9NA 3E89A 1YHQV 4GKJB 4MSWC 1K5QA 2JJ2G 3N2KA 4FIPC 2WSSG 4J9YB 1XNQO 1IJGA 1ZAUA 3M99B 1VP7A 5IJ0A 5IWAO 1D5NA 3C3SA 4KHPB 4NKGB 3K5LA 1QR9A 4F6EA 2GV9A 4NXNB 4ASUG 4YXWG 1DF4A 3FYEB 2BOBC 1YEWA 4LR3A 1TVKA 3KCXA 2OCCC 4DW1A 1XL4A 2EJRA 5KHHA 2AHZA 1Q7YW 4XDLA 5L3DA 2OTLV 1Y74B 1SERA 5EC2C 2WLKA 4UCRA 1JJ2U 4U7NA 4A5UB 1W59A 3B09A 1M56C 3F7VC 1JFFA 2AW9A 2CH7A 4R6ZA 2X6AA 1WB8A 1P49A 5GONB 5LYJB 2WLNA 4ZOLB 5EBWC 4YJ2B 3BAAA 5CA0A 3ZN0A 1K4CC 4LF4B 4JI7O 1S77D 1RPOA 3LDDA 4CH4A 2OCCB 4X1IA 3OTOO 3ABMC 4XDKA 2CUGA 1J5EB 2BE3A 3OT7A 1AB3A 4RWUA 3E8GA 4NYKA 1FJGB 4TV8A 2GHYA 4MVOA 1FXKC 5LA6B 4JAVA 2YIDA 4L87A 1SQBH 1RFYA 3ETDA 1M56B 2XOKG 2BTQB 2N04A 1CP9A 1R3LC 5BMVB 3R66A 4PDMA 1KU9A 1KMIZ 2Q9LA 5KLVH 5LMUO 2VWJA 4FZ1A 4I0XA 5KHIA 2P22C 2GBOA 4PDVA 3SYQA 1I5YA 4X20B 4K35A 2HLDG 3ABMB 1WAZA 2ZD9A 3C90A 3Q4HA 4LC1A 1DK1A 5FNVA 2YIBD 3RYFA 4LF8B 3D3IA 3ZHQA 4ZHQB 1FXKB 4IYIA 5EK0A 4GUNA 4HNAA 3OTFA 3B40A 5TISZ 1J95A 1F23A 4EFEA 2CE4A 2UUCO 3FAVB 4DV3O 4I50A 3CCLV 4IIJB 3KDRA 1Q5OA 4D7SA 2R70A 4JI2O 5FPOA 2UUBO 2N05A 1S3JA 3FD9A 4MVMA 1N32O 3K03A 5IJ9A 1M1KW 2ITDC 4N21A 3JATA 2GUZB 4JI1B 2Q7HA 2KQXA 3K5MA 1KP3A 1ZLZA 1PL4A 3A2FA 3K04A 4PI0A 2QTSA 4GCZA 5LBQA 3OR6C 5H6RA 3THOA 4WFHA 3G6EV 4X1YA 1V55C 4CC5A 1JMKC 3OMAB 3CB2A 1CPYA 3D8CA 1TUEB 3IC9A 1N36O 2PYLA 2PTMA 4G28B 3ZMUA 4PA3A 1Y76B 4DR1B 1HNWO 4IT5A 1Q86W 4RUEA 4ZKIA 1YTFB 4EKWA 1MMMA 2RNBA 2UXNA 3ZHTA 3WU2Z 4O4LA 1ZUQA 1DTOA 1Q81W 1BMFG 3U0ZA 1XMOB 1O9GA 1S5HC 1Z5WA 2G38A 2CTPA 3TGUH 1AP6A 4X65O 3G71V 3IFXA 2IM9A 2K1EA 1LNQA 1WB7A 3H1LH 3I55V 1TUBB 3KKYA 4DV6O 1RM1C 4O4HB 1AVMA 5LMNO 2XAJA 2DQ0A 1HNXO 1SKVA 4C7UA 3FX7A 4GKJO 2CTRA 4H37A 3OGIB 3RYHB 1WA8A 1VQ9V 3VQVA 1NVPB 1OCCC 3HKBA 2X7RB 2GSMB 2DW4A 4QPKA 4KHPO 2XAFA 2RJZA 2CGOA 2Q0AA 2QKCA 1PP9H 3UT5B 3OE7G 4HBNA 4LF5B 2IU0A 1RM1B 2IH1C 1GK9A 1R1BA 1MOFA 4X64O 2P4KA 3SJAC 2YXYA 4YHHB 5CBHA 2NLJC 1YI2V 5BR8B 1K3EA 4BAYA 1LR1A 1OCCB 5FL7G 4GX0A 3NXSA 1H8HG 1THZA 5L3FA 1P7GA 2H8PC 1XNQB 3JCUZ 4U3JB 2ZIMA 5IWAB 1SQPH 2HJDA 3SGIA 3E8HA 4O2AB 4DRXA 2FB5A 1J5EO 3HKDA 4B7EA 1S72V 1VQ5V 1R6NA 3WB0A 1ROPA 3OR7C 2XUMA 1XREA 2BOCC 3OM3B 3IGAC 1QVFU 2P5OA 2UXBO 4DK1A 3NR7A 3K5NA 3RFRA 1W0KG 3N2KB 3OFNG 4GLXA 4K0KO 4AQYO 2BSKA 2JS3A 4MVSA 5IJ0B 4W4LA 3W7SA 4XDJA 3D36C 4QPJA 5K1XA 3CEIA 2HKOA 1QLEC 2A06H 4JI3B 2YXHA 4FM1A 3L74H 3JAKA 1Q6UA 4LP8A 4UUJC 1H2KA 2QKAA 1TVKB 3DC6A 1NTMH 1TGOA 5ITZA 4LFBB 1IVSA 4LFAB 4DXWA 4FLWA 3B77A 4N23A 2JGUA 1EZVH 3E35A 4LF8O 4MVUA 3AG2B 4JI7B 1F51A 1Q43A 1JFFB 3AK3A 3CC7V 1PPJH 2CH7B 5JCOC 3F5WC 3OTOB 1QNMA 2CAZC 1L0LH 3KCYA 5L3BA 2B5UA 1M57B 2QWOB 3FYIB 2FMLA 3AK1A 2OTJV 1VF6A 2DWEC 3PJSK 1QLEB 4FFBA 1UPGA 3K79A 2IJHA 4G27B 4J42A 5CA0B 4OPAA 4QIWF 4U3FH 1IBMO 5B1OA 5JQGA 4X1IB 4KXRA 5J2UA 3O9OA 2RMKB 4CS4A 3BFRA 1I08A 3MHHC 2M6YA 5LMUB 1L8DA 4TV8B 3OUSA 4WCEV 1VQNV 1ZTEA 4P9OA 4JI1O 5B1NA 1KQSU 2DOSA 1I7FA 1K92A 1JNBA 5EIBC 3CCSV 1AP5A 4DUYO 5D5QA 3PN1A 2FL4A 4I0XB 5GTHZ 4DW0A 2Q0OC 2AGAA 1MSWD 2KG7A 5HFLA 3QO7A 2D2CB 1G6UA 1YF2A 2UUCB 5KAFZ 4LH7A 3Q4HB 3S3WA 5FNVB 3RYFB 3E83A 2KSDA 4UXNA 3K58A 2WLIA 5CB4A 3FB5C 4HNAB 4JI2B 4DR2B 2UUBB 4YY3B 2EIKB 1N32B 2A9HA 3JSNA 4RO2A 4EB6A 3T1CA 2GTAA 3P30A 3QG5A 3QO8A 4I50B 4OXSA 4X62O 2F4VO 1XI1A 1M4UA 3EXAA 3BABA 4X89A 3ZBHA 1SQGA 5IJ9B 2JIZG 3JATB 4IL6Z 4H33A 3H01A 4DR3B 5DECA 5CN0A 2P6JA 1V54C 1OHHG 1N36B 1AROP 3JASA 1LUWA 1QCEA 1BHBA 2QGNA 4JYAO 1BE3H 4H13B 4X1YB 1HNWB 4BIZA 2DYSC 2YIBA 3TXSA 3QNEA 1WP8A 1WPBA 4OX9O 1SZXA 3JYCA 4BIOA 1PNKA 3BEHA 2VRZA 4MTGA 4FJCC 3ASNB 3K0GA 1I94B 1VQ7V 4CH5A 2Q4PA 2IJJA 1P84F 4JYBA 4BWAA 3STZC 4X65B 1F7YA 1EN6A 4JV5O 2PYJA 4O4LB 2ZNJA 1FKAO 4YHHO 2LP7A 2IH3C 5LXTA 2H3OA 4DV6B 4DO2A 5BR8O 1NS1A 2H94A 2OIGA 5LMNB 2CDYA 2DQ3A 1MA1A 2RN9A 5AG2A 4KL1A 2PY5A 4J7JA 1ZSPA 3GWKC 2JEXA 4JI6O 3L71H 1K7DA 1FFXA 2WLHA 2ZE8A 3B8NA 4JAAA 4Q6GA 1TAEA 3RVZA 2UU9O 1Q8IA 1AR4A 3P3PA 1COWG 2OYQA 4JTDB 1Q90D 5J2TA 3U10A 1WA8B 2EIJC 4TOIA 4I4TA 3HKBB 2GTSA 1K4DC 3LDCA 2Q6AA 3T4DA 3CRAA 1EM1A 5LGTA 4JI3O 3J7AU 4GZRB 4X64B 1E1QG 1NJIW 4UB6Z 2KKWA 4E4EA 2WA3A 5EZYA 3SYCA 1VF7A 3ZRSA 1M90W 4PDRA 4LFBO 1IXMA 4LFAO 1SQXH 1AILA 4ZI7A 4TT3G 1SF9A 1YXBA 4RAIA 3ZCCA 4ABMA 4Z1VA 4FLTA 1XEQA 2RDCA 2EIJB 3OD4A 5BXZA 5CA1A 1PNMA 1N0JA 4B3RB 2Q7GA 1H2SB 3RVYA 2DMXA 3HR0A 2UXBB 1B6QA 1XILA 4J10A 1JCHA 1R3KC 1DGSA 2XNDG 4LWSA 4K0KB 1P4RA 4AQYB 2V7QG 5EBMC 3L75H 1E79G 1BS3A 4DRXB 4XBFA 3HKDB 4CBCA 3SPCA 1N33O 1VQ6V 3ASOC 2HR3A 3B4SA 2Q7EA 1XBLA 3O65A 3APOA 4R50A 5IY5C 4LFCO 1QU7A 4I5SA 1NTKH 3J80N 2BSKB 4JF3A 3CMEV 1VF6C 3SYOA 1SRYA 1MNGA 1BQ0A 2R9AA 1XMQO 2ZE7A 3CPWU 1KD1W 2NR5A 2ILMA 4JI8O 3JAKB 5H6QA 3SJBC 1NBMG 2QWRB 2JVDA 4J80A 2E3CA 5ITZB 4JTCB 3CC2V 1CEZA 2WLMA 2LW1A 5A9GA 3DSQA 1FFTB 3JAWA 1Q3EA 2PI5A 5EYPA 1YVWA 3MDSA 5BY1A 1TA8A 3ZRWB 5LHIA 2Y4TA 3ASOB 1MG1A 3T1HO 2DN9A 3VQXA 3FFQA 3FKSG 3QF7A 1IBMB 5K1PA 5IY5B 4DR2O 4PI2A 4YY3O 3UCSC 4EEQA 4IYHA 4TV9A 5GTIZ 5L3GA 2Z3YA 3RYCA 4FFBB 1YJNV 4YIPA 2Q69A 3TETA 4FM2A 1MABG 2XASA 4LBEC 4JGSA 3AG7A 1HNZO 2Y48A 2IJKA 4DUYB 1K8AW 1PM9A 3LDEA 5JQGB 5KX5A 4O4JA 3ZEDA 2LFSA 3UM7A 5J2UB 4TQDA 1K34A 1FXHA 3ZMSA 1KUQA 3RW0A 4WFBV 4NTXA 2YI9A 4DR3O 1YJWV 5L3EA 4J7KA 4NTYA 2R9IA 2F43G 4X9QA 4TSFG 2F23A 3LSQA 4DK0A 1VMGA 3TCUA 2AZ0A 3A0HZ 3DTUB 1A32A 4LF9O 1K97A 1XNRO 1B04A 1NTZH 2KG7B 4UCTA 3DGEA 1Q82W 3BHPA 2B1GA 4FM0A 5KA5A 2F95B 1K33A 4ZIBA 1K5SA 1SESA 1I94O 2YUAA 3KG2A 5LHHA 1EN4A 1QR8A 2F1MA 2AXTZ 4X62B 1EBOA 4MW3A 2WLIB 5CB4B 2F4VB 2YC0A 3ZJZA 3FB6C 1ORQC 3EFFK 2FYUH 3VBBA 5IYDO 3RWRD 4FVMA 4J41A 3CCVV 4DV0O 2JK5C 3OGCC 2Q8VA 2JEUA 1WN7A 4EB6B 2F66C 3A0RA 3ABLC 3W7WA 3M8AA 4JYAB 4MS2A 4CH6A 2P4VA 3ETQA 3OEHG 1R73A 5H9CA 1X4TA 3LUTB 4OX9B 3BRCA 2LO1A 3C3TA 4DR5O 1KECA 1MZFA 1VF5B 3JASB 1WP7A 2CTQA 1QHTA 2L6LA 5FPRA 4UFZA 2HHHB 3D3QA 3K3WA 1US6A 5LHGA 4K3AA 1X59A 2QWPB 4JV5B 1NKDA 3ABLB 5J9PC 2YDEA 3MAQA 2D3OW 1GN3A 5KUKA 5KA6A 2PGGA 3E22A 1ZL8A 1OV9A 2V1DA 3WB1A 3M7MX 1VQPV 2LGWA 3SDLA 2Z5UA 2A0LA 4P2ZA 1QVGU 1SQFA 2EINC 4X66O 2YICA 1IBKO 4JI6B 5LXTB 2Z0AA 1PL0A 2JDIG 5EIBD 2UU9B 1R3JC 4B3RO 4NVPA 4WFAV 3AG2C 2ZR3A 1NH2D 4UB8Z 4OPHA 1JJOA 5B3SC 2ARHA 1M57C 1NU1H 3K9SA 4JI5O 1FFXB 2QA4V 1U97A 3W7UA 4PDLA 1EZJA 1SC5B 3LNMB 5FLXN 3J81N 5J2TB 2ADPA 4F6RA 2QM8A 2Q5ZA 3AK2A 4JYCA 4DV2O 4K8XA 2B9ZA 1KYOF 3CRMA 3JALA 4I4TB 2EINB 5KUMA 3CCRV 1OCZC 2L35A 1N34O 3TXQA 3BCCH 3IC7A 4TUYA 4Z1MG 5EZYB 1EFRG 3RYIA 1AI4A 2ZXWC 4JASA 3E2EA 4O2BA 4UVAA 5B3SB 3CP1A 3H9VA 4ZI7B 3L70H 4UVCA 3CJHA 1GN6A 4PV1B 2QR4A 4DR4B 1VQMV 5F2VO 4J9ZB 4CS3A 2EZPA 4FZ0A 3UKMA 4ICGA 4UCVA 2LGQA 1YJ9V 3LNNA 5CA1B 3STLC 3DXRA 1N33B 1QBZA 3JD1A 4UCUA 2QTOA 2ZR2A 1OCZB 1W0JG 5LOVA 4QGPA 4PJ0Z 4LF7O 5LGUA 1SA0A 2W6JG 2EBOA 4RQEA 4LFCB 2JGDA 2EIKC 4LWSB 4TWKA 2LW7A 1F4MA 4NXMO 2YSUB 4PHZA 4DV5O 2ZXWB 2Y69C 1XMQB 1S5JA 3IAYA 2QKSA 4GX2A 3WG7C 2IW5A 5IYCO 4FLZA 4JI8B 1FOUA 1Y67A 4O4IA 3SYPA 1I0HA 2YXLA 1Z2GA 2ATKC 1N4CA 4Z2WA 4WFGA 3ABUA 1NR7A 1WLEA 2ZNIA 5CMUA 2CGNA 1IXBA 2LQTA 1GAXA 1Y6XA 1BSMA 2XAQA 3FB8C 1XHZA 4UCOA 4MT8A 2PUSA 3T1HB 4X88A 3OMIB 1KKDA 2HEPA 4MVQA 1IX9A 3JAWB 2Y69B 4KUMA 5EYPB 1R6KA 2DJVA 3WG7B 1SETA 1U96A 4L8JA 1HNZB 2NN4A 2YS8A 3ASNC 4Q20A 5E1AC 1IURA 4K8ZA 4JZ2A 1ENVA 4TV9B 2B1IA 3E8FA 3RYCB 3E8BA 2UUAO 3KZIZ 4I9WA 2VQFO 4PA4A 1XHXA 1YCIA 3A8TA 1BGYH 3X2QC 2R9RB 2WLJA 5KX5B 4O4JB 1UJWB 3QTCA 4FPPA 1L1FA 5LP6A 4DV7O 4NB5A 1YZBA 4LF9B 1URFA 4DR6O 1XNRB 4QJFB 5JJEB 3I56V 1G1XB 5DM6V 2QE7G 4JI0B 4IHJA 3CS5A 5IYBO 4I55A 3WB2A 3SPHA 2F93B 1IBLO 2XHBA 2HHHO 4F4LA 3MHSC 1XL6A 2UXXA 2CK3G 2QDOA 1MZEA 1GN2A 1FD9A 3JARA 2HP8A 1N0NA 1VQ4V 1QLNA 3X2QB 3SJCC 1VIBA 4DV0B 3UO2A 2E75B 1GM9A 4I9QA 4OGQB 1PNLA 3E86A 4AILC 2FKXA 1AI6A 3VOUA 3T1YO 1JPXA 1PV0A 3SR2C 1Q6IA 3U11A 2O57A 4D6TH 2E76B 4DR5B 2AHYA 1GMGA 3JD2A 5JH7A 4QE9A 1GKFA 4FLYA 1OCOC 1GO3F 4JYYA 5B66Z 1NZ6A 3HKCA 2ZDIA 1AR1B 3JSLA 1GM7A 4DR7O 2ZCEA 1KBHA 4JI4O 3K0DA 4RQFA 1FXVA 3K57A 1H2MA 3ETGA 3JAMN 5B5EZ 2EULA 4CS2A 2WLLA 3TK1A 1IDSA 1SZTA 2MW2B 3SPGA 4X66B 5H2FZ 1IBKB 4J11A 1YTFD 1M5IA 1JOYA 4B7KA 2P7TC 3SPJA 3OW2U 2X6BA 1OCOB 3G6BA 4MTOA 3E22B 5LL6Y 1RSOA 5KHJA 1ZL8B 2A79B 1YIJV 3HKEA 3D36A 5H5NA 4X1KA 1YSCA 5C93A 1GH6A 4PA6A 4DR4O 2Q73A 4JZGA 3K5OA 3SYAA 5KMGA 2YEVA 4JI5B 2WWWA 3HB3B 3AEIA 1PD3A 3RN4A 1HDJA 3EVKA 3ZHSA 4H0LB 3JD3A 1B3QA 2AZ2A 1G4YB 3ZHVA 4DV2B 4DV1O 2VQEB 3ZMVA 3G67A 3G80A 1NR1A 2HVKC 5JCOA 2W6IG 1N34B 1AI7A 1NVPD 4W4KA 4LCUC 3APQA 1PKXA 1G8MA 4F6RB 4FMTA 4B3MB 3JCZA 2ZQMA 3JALB 3JD4A 5IDJA 2E5LO 3QVNA 2UXDO 1FAFA 5DN6G 3IJ4A 4NTWA 4R8CA 5JVDA 1H5WA 4TUYB 4WFFA 4AI8A 1T5EA 4DYLA 3RYIB 4JAUA 2WAMA 2UXCO 2E74B 4O2BB 3UQ8A 4BW9A 5IE9A 2Y4UA 3CJHB 4MVRA 2MK3A 4LF7B 1RP3B 1SQVH 2CTWA 2NNUA 2C2AA 5CBGA 4JPRA 3ZIAG 4QNHB 3A0BZ 4NXMB 3FB7C 3CWBH 4EFBA 4DV5B 1B06A 1FPOA 4YJ3A 3DXRB 3LSSA 1AI5A 5C8YA 4DV4O 5LOVB 2W0XA 4D7TA 1SA0B 2IBZH 3AG3C 2KB1A 1OCRC 3H1IH 1GM8A 2JGDB 4QE7A 2QSAA 1XOUA 3T2MA 3B8MA 4LNUA 4WBNA 5IYZA 1JR9A 3ZRVA 4BIUA 5JWPA 3CXCU 4FLXA 3CCQV 3K06A 4O4IB 3RBZA 4P30A 2YIAA 2DE0X 3N2GA 2ZE5A 5A2QN 2ADQB 2LJ2A 4DUZO 3ZMZA 1OZ0A 4JI0O 4BR6A 4GKKO 3OMNB 1HR0B 1HP8A 1NI8A 1Z5VA 3G4SV 1D2DA 5HFMA 1XUQA 2ZINA 4U7OA 3AG3B 1OCRB 2N74A 2A7WA 3CRCA 2R72A 1NQTA 5LP6C 2ETNA 3BA9A 4PELA 3ABKC 4FK5C 5B1AC 5CBFA 2VS0A 2UUAB 2VQFB 3BA8A 1F4NA 1V55B 1Q6HA 3CX5F 1SS3A 1K9MW 3ZRXA 4DV7B 3RT3C 1LUVA 4DR6B 1DF5A 2QJ1A 4CH3A 5IT9N 3H1JH 1H2NA 2EZOA 3BVOA 2FTKA 2PZSA 1CXZB 1H38A 4LF6O 4CC6A 3CCMV 3BY6A 3ABTA 1BHAA 3OAAG 1IBLB 5LP6B 4MTFA 2ZM6B 3ABKB 4B3TB 4HZ3A 5B1AB 1Y74A 1UFIA 2OWOA 4NXNO 4TQFA 1HW7A 2OIEA 4IHJB 2GDSA 4I55B 3ZX6A 1S76D 3F7YC 2YI8A 1Y66A 2HJFC 2Q68A 4PA9A 5GONA 1I5XA 4JTAB 5LYJA 4ZOLA 1ZX3A 2QWNB 1QQCA 2PF4E 3JARB 4YJ2A 3T1YB 2EIMC 3CMAV 2V4DA 4FLUA 2XAGA 5L3CA 1BT8A 2JRIA 3CXHF 2ZDIC 4B3SB 4UVBA 3ML0A 3DC5A 3CYOA 3VQWA 1WNSA 4PA7A 5LA6A 3CHXA 3OUFA 2XAHA 4E2LA 4LF4O 2BTQA 4KFMA 3N27A 5KHGA 5BMVA 2VWKA 3LSUA 1R6TA 1GN4A 2X6CA 3BPZA 4DR7B 2RCVA 1JA8A 4HYOA 4UV8A 1FJGO 3AG1C 2JJ1G 2QEXV 5JH7B 4JI4B 5JJNB 2EIMB 2VQEO 2QWQB 3CCJV 3VQYA 2P90A 4X20A 1M93A 3GVMA 1H2LA 3HKCB 4CZZA 3SPIA 5EC1C 3L72H 5KAIZ 3OEEG 4ZHQA 2A3QA 4B3MO 1FXKA 1D5AA 3W7TA 4YIOA 2WA4A 2Y0IA 1W2BU 3ZHRA 2WLLB 4HAMA 2BTOA 1JQ0A 3FAVA 5JJJB 3F5TA 2XT9A 3GWOA 2HVJC 3CCEV 5B1BC 2Q67A 3ZRWA 4R7CA 4IIJA 2P67A 1BCCH 1SQQH 3AG1B 2HFEC 3WFVA 1E1RG 3CE2A 1RSOB 1ZWIC 1BL8A 5GW7A 2ZKOA 1S0VA 3CCUV 3HKEB 2GUZA 5EBLC 3ETEA 4X1KB 4DV1B 1FYJA 1BZKA 1WJZA 5KMGB 3ZHUA 2YEVB 1H2GA 3JD0A 1YITV 3B2EE 5KHKA 1XDCA 2ODMA 2JS5A 3CSXA 2IJIA 1MSDA 3TJTA 1BQZA 3GB7C 4ZBMA 3CD6V 5BZBA 3P3NA 5B1BB 1VQLV 4IGGA 2E5LB 4P9PA 3EHBB 2UXDB 2ITCC 2M7WA 4GYCB 1N8RW 1Y76A 2HG5C 2ZE6A 4MTXA 1AJPA 4WF9V 2QM7A 1P7BA 2EJ7A 2UXCB 1EN5A 4GX1A 2EILC 3P32A 1V9PA 2X0LA 4GT1A 2IU3A 4UCSA 4DV3B 4DR1O 1HR0O 2XTAA 5JVDB 4AHCA 1O9HA 3H1KH 4RUFA 1JX9A 1AR5A 3SJQC 3I5DA 4KP4A 4DV4B 4NR1A 1TUBA 1HWYA 3S3XA 3UO3A 1NH2B 4O4HA 2Y0PA 4WFEA 3QO5A 1XMOO 1AJNA 1S5LZ 2DWDC 2DYRC 4MW8A 5LGNA 1JVMA 3ICXA 4GX5A 4H44B 1NT2B 4YJ3B 3R65A 3RYHA 1VQKV 2EILB 2OCHA 1FS0G 1KC8W 3L9DA 5C8YB 1R3IC 2ZIOA 2OT5A 3AG4C 1VARA 5E79Z 3K9AA 5CA3A 3T4ZA 2P06A 4DUZB 1YDXA 1WPXA 2PI4A 4LNUB 4WBNB 5IYZB 4GKKB 3UT5A 3CRQA 1Y4MA 2ZM6O 3K08A 4X8AA 4B3TO 4FFKA 2ZT9B 3N2GB 2DYRB 3L73H 5D5PA 1VQOV 3W7XA 1VEWA 2EX3A
chains in the Genus database with same CATH topology
3OT7A 1LUWA 2P4KA 3LSUA 1KKCA 1GN4A 3C3TA 4YIPA 3QVNA 3IC9A 2RCVA 1JA8A 3BFRA 1I08A 4JZ2A 4JYYA 1EN5A 1ZTEA 1SZXA 1PM9A 1P7GA 1GN6A 1MMMA 1AP5A 1N0JA 1LUVA 1XILA 1ZUQA 1AR5A 1GN3A 4X9QA 1EN6A 1IDSA 1XREA 1D5NA 3C3SA 4YIOA 1BS3A 1B06A 1AP6A 4F6EA 4GUNA 1WB7A 3CEIA 2CDYA 1MA1A 3KKYA 5AG2A 2CE4A 2GDSA 1ZSPA 1AVMA 2QKAA 4JZGA 1Y67A 1GN2A 1I0HA 1MNGA 3DC6A 1N0NA 1EN4A 3KDRA 1VARA 4C7UA 1JR9A 1AR4A 2AW9A 1IXBA 3EVKA 3RN4A 1BSMA 3K9SA 1WB8A 5A9GA 2ADQB 1BT8A 3AK3A 4FFKA 4BR6A 1XDCA 1QNMA 1ZLZA 2QKCA 1PL4A 2ADPA 3MDSA 1MSDA 1EM1A 3TJTA 3AK2A 1IX9A 3DC5A 3AK1A 1VEWA 1XUQA 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT7 A;  1LUW A;  2P4K A;  3LSU A;  1KKC A;  1GN4 A;  3C3T A;  4YIP A;  3QVN A;  3IC9 A;  2RCV A;  1JA8 A;  3BFR A;  1I08 A;  4JZ2 A;  4JYY A;  1EN5 A;  1ZTE A;  1SZX A;  1PM9 A;  1P7G A;  1GN6 A;  1MMM A;  1AP5 A;  1N0J A;  1LUV A;  1XIL A;  1ZUQ A;  1AR5 A;  1GN3 A;  4X9Q A;  1EN6 A;  1IDS A;  1XRE A;  1D5N A;  3C3S A;  4YIO A;  1BS3 A;  1B06 A;  1AP6 A;  4F6E A;  4GUN A;  1WB7 A;  3CEI A;  2CDY A;  1MA1 A;  3KKY A;  5AG2 A;  2CE4 A;  2GDS A;  1ZSP A;  1AVM A;  2QKA A;  4JZG A;  1Y67 A;  1GN2 A;  1I0H A;  1MNG A;  3DC6 A;  1N0N A;  1EN4 A;  1VAR A;  4C7U A;  1JR9 A;  1AR4 A;  2AW9 A;  1IXB A;  3EVK A;  3RN4 A;  1BSM A;  3K9S A;  1WB8 A;  5A9G A;  2ADQ B;  1BT8 A;  3AK3 A;  4FFK A;  4BR6 A;  1XDC A;  1QNM A;  1ZLZ A;  2QKC A;  1PL4 A;  2ADP A;  3MDS A;  1MSD A;  1EM1 A;  3TJT A;  3AK2 A;  1IX9 A;  3DC5 A;  3AK1 A;  1VEW A;  1XUQ A;  4E4E A; 
#chains in the Genus database with same CATH topology
 2QM4 A;  1OJH A;  2W0F C;  4J7Z A;  1AJQ A;  4LH6 A;  3ZS8 C;  1RPR A;  4LF5 O;  2K9P A;  1KKC A;  1GTO A;  1KB9 F;  3MD0 A;  4B08 A;  3CRR A;  3AG4 B;  4UV9 A;  1H8E G;  5DED A;  1K73 W;  2BCC H;  3ZN1 A;  4G2K A;  1V54 B;  2WPD G;  3RGB A;  3HPL C;  4U3J A;  4BW5 A;  2LFR A;  3H1H H;  3ZMT A;  4I7Z B;  1IZ3 A;  1KP2 A;  2RQ6 A;  4O2A A;  4B3S O;  1XQ8 A;  4PD4 F;  1L0N H;  1GRJ A;  1DLB A;  2DYS B;  4FLV A;  1HNX B;  3K59 A;  1VQ8 V;  3CC4 V;  4LF6 B;  4MVZ A;  1M9N A;  3E89 A;  1YHQ V;  4GKJ B;  4MSW C;  1K5Q A;  2JJ2 G;  3N2K A;  4FIP C;  2WSS G;  4J9Y B;  1XNQ O;  1IJG A;  1ZAU A;  3M99 B;  1VP7 A;  5IJ0 A;  5IWA O;  1D5N A;  3C3S A;  4KHP B;  4NKG B;  3K5L A;  1QR9 A;  4F6E A;  2GV9 A;  4NXN B;  4ASU G;  4YXW G;  1DF4 A;  3FYE B;  2BOB C;  1YEW A;  4LR3 A;  1TVK A;  3KCX A;  2OCC C;  4DW1 A;  1XL4 A;  2EJR A;  5KHH A;  2AHZ A;  1Q7Y W;  4XDL A;  5L3D A;  2OTL V;  1Y74 B;  1SER A;  5EC2 C;  2WLK A;  4UCR A;  1JJ2 U;  4U7N A;  4A5U B;  1W59 A;  3B09 A;  1M56 C;  3F7V C;  1JFF A;  2AW9 A;  2CH7 A;  4R6Z A;  2X6A A;  1WB8 A;  1P49 A;  5GON B;  5LYJ B;  2WLN A;  4ZOL B;  5EBW C;  4YJ2 B;  3BAA A;  5CA0 A;  3ZN0 A;  1K4C C;  4LF4 B;  4JI7 O;  1S77 D;  1RPO A;  3LDD A;  4CH4 A;  2OCC B;  4X1I A;  3OTO O;  3ABM C;  4XDK A;  2CUG A;  1J5E B;  2BE3 A;  3OT7 A;  1AB3 A;  4RWU A;  3E8G A;  4NYK A;  1FJG B;  4TV8 A;  2GHY A;  4MVO A;  1FXK C;  5LA6 B;  4JAV A;  2YID A;  4L87 A;  1SQB H;  1RFY A;  3ETD A;  1M56 B;  2XOK G;  2BTQ B;  2N04 A;  1CP9 A;  1R3L C;  5BMV B;  3R66 A;  4PDM A;  1KU9 A;  1KMI Z;  2Q9L A;  5KLV H;  5LMU O;  2VWJ A;  4FZ1 A;  4I0X A;  5KHI A;  2P22 C;  2GBO A;  4PDV A;  3SYQ A;  1I5Y A;  4X20 B;  4K35 A;  2HLD G;  3ABM B;  1WAZ A;  2ZD9 A;  3C90 A;  3Q4H A;  4LC1 A;  1DK1 A;  5FNV A;  2YIB D;  3RYF A;  4LF8 B;  3D3I A;  3ZHQ A;  4ZHQ B;  1FXK B;  4IYI A;  5EK0 A;  4GUN A;  4HNA A;  3OTF A;  3B40 A;  5TIS Z;  1J95 A;  1F23 A;  4EFE A;  2CE4 A;  2UUC O;  3FAV B;  4DV3 O;  4I50 A;  3CCL V;  4IIJ B;  3KDR A;  1Q5O A;  4D7S A;  2R70 A;  4JI2 O;  5FPO A;  2UUB O;  2N05 A;  1S3J A;  3FD9 A;  4MVM A;  1N32 O;  3K03 A;  5IJ9 A;  1M1K W;  2ITD C;  4N21 A;  3JAT A;  2GUZ B;  4JI1 B;  2Q7H A;  2KQX A;  3K5M A;  1KP3 A;  1ZLZ A;  1PL4 A;  3A2F A;  3K04 A;  4PI0 A;  2QTS A;  4GCZ A;  5LBQ A;  3OR6 C;  5H6R A;  3THO A;  4WFH A;  3G6E V;  4X1Y A;  1V55 C;  4CC5 A;  1JMK C;  3OMA B;  3CB2 A;  1CPY A;  3D8C A;  1TUE B;  3IC9 A;  1N36 O;  2PYL A;  2PTM A;  4G28 B;  3ZMU A;  4PA3 A;  1Y76 B;  4DR1 B;  1HNW O;  4IT5 A;  1Q86 W;  4RUE A;  4ZKI A;  1YTF B;  4EKW A;  1MMM A;  2RNB A;  2UXN A;  3ZHT A;  3WU2 Z;  4O4L A;  1ZUQ A;  1DTO A;  1Q81 W;  1BMF G;  3U0Z A;  1XMO B;  1O9G A;  1S5H C;  1Z5W A;  2G38 A;  2CTP A;  3TGU H;  1AP6 A;  4X65 O;  3G71 V;  3IFX A;  2IM9 A;  2K1E A;  1LNQ A;  1WB7 A;  3H1L H;  3I55 V;  1TUB B;  3KKY A;  4DV6 O;  1RM1 C;  4O4H B;  1AVM A;  5LMN O;  2XAJ A;  2DQ0 A;  1HNX O;  1SKV A;  4C7U A;  3FX7 A;  4GKJ O;  2CTR A;  4H37 A;  3OGI B;  3RYH B;  1WA8 A;  1VQ9 V;  3VQV A;  1NVP B;  1OCC C;  3HKB A;  2X7R B;  2GSM B;  2DW4 A;  4QPK A;  4KHP O;  2XAF A;  2RJZ A;  2CGO A;  2Q0A A;  2QKC A;  1PP9 H;  3UT5 B;  3OE7 G;  4HBN A;  4LF5 B;  2IU0 A;  1RM1 B;  2IH1 C;  1GK9 A;  1R1B A;  1MOF A;  4X64 O;  2P4K A;  3SJA C;  2YXY A;  4YHH B;  5CBH A;  2NLJ C;  1YI2 V;  5BR8 B;  1K3E A;  4BAY A;  1LR1 A;  1OCC B;  5FL7 G;  4GX0 A;  3NXS A;  1H8H G;  1THZ A;  5L3F A;  1P7G A;  2H8P C;  1XNQ B;  3JCU Z;  4U3J B;  2ZIM A;  5IWA B;  1SQP H;  2HJD A;  3SGI A;  3E8H A;  4O2A B;  4DRX A;  2FB5 A;  1J5E O;  3HKD A;  4B7E A;  1S72 V;  1VQ5 V;  1R6N A;  3WB0 A;  1ROP A;  3OR7 C;  2XUM A;  1XRE A;  2BOC C;  3OM3 B;  3IGA C;  1QVF U;  2P5O A;  2UXB O;  4DK1 A;  3NR7 A;  3K5N A;  3RFR A;  1W0K G;  3N2K B;  3OFN G;  4GLX A;  4K0K O;  4AQY O;  2BSK A;  2JS3 A;  4MVS A;  5IJ0 B;  4W4L A;  3W7S A;  4XDJ A;  3D36 C;  4QPJ A;  5K1X A;  3CEI A;  2HKO A;  1QLE C;  2A06 H;  4JI3 B;  2YXH A;  4FM1 A;  3L74 H;  3JAK A;  1Q6U A;  4LP8 A;  4UUJ C;  1H2K A;  2QKA A;  1TVK B;  3DC6 A;  1NTM H;  1TGO A;  5ITZ A;  4LFB B;  1IVS A;  4LFA B;  4DXW A;  4FLW A;  3B77 A;  4N23 A;  2JGU A;  1EZV H;  3E35 A;  4LF8 O;  4MVU A;  3AG2 B;  4JI7 B;  1F51 A;  1Q43 A;  1JFF B;  3AK3 A;  3CC7 V;  1PPJ H;  2CH7 B;  5JCO C;  3F5W C;  3OTO B;  1QNM A;  2CAZ C;  1L0L H;  3KCY A;  5L3B A;  2B5U A;  1M57 B;  2QWO B;  3FYI B;  2FML A;  3AK1 A;  2OTJ V;  1VF6 A;  2DWE C;  3PJS K;  1QLE B;  4FFB A;  1UPG A;  3K79 A;  2IJH A;  4G27 B;  4J42 A;  5CA0 B;  4OPA A;  4QIW F;  4U3F H;  1IBM O;  5B1O A;  5JQG A;  4X1I B;  4KXR A;  5J2U A;  3O9O A;  2RMK B;  4CS4 A;  3BFR A;  1I08 A;  3MHH C;  2M6Y A;  5LMU B;  1L8D A;  4TV8 B;  3OUS A;  4WCE V;  1VQN V;  1ZTE A;  4P9O A;  4JI1 O;  5B1N A;  1KQS U;  2DOS A;  1I7F A;  1K92 A;  1JNB A;  5EIB C;  3CCS V;  1AP5 A;  4DUY O;  5D5Q A;  3PN1 A;  2FL4 A;  4I0X B;  5GTH Z;  4DW0 A;  2Q0O C;  2AGA A;  1MSW D;  2KG7 A;  5HFL A;  3QO7 A;  2D2C B;  1G6U A;  1YF2 A;  2UUC B;  5KAF Z;  4LH7 A;  3Q4H B;  3S3W A;  5FNV B;  3RYF B;  3E83 A;  2KSD A;  4UXN A;  3K58 A;  2WLI A;  5CB4 A;  3FB5 C;  4HNA B;  4JI2 B;  4DR2 B;  2UUB B;  4YY3 B;  2EIK B;  1N32 B;  2A9H A;  3JSN A;  4RO2 A;  4EB6 A;  3T1C A;  2GTA A;  3P30 A;  3QG5 A;  3QO8 A;  4I50 B;  4OXS A;  4X62 O;  2F4V O;  1XI1 A;  1M4U A;  3EXA A;  3BAB A;  4X89 A;  3ZBH A;  1SQG A;  5IJ9 B;  2JIZ G;  3JAT B;  4IL6 Z;  4H33 A;  3H01 A;  4DR3 B;  5DEC A;  5CN0 A;  2P6J A;  1V54 C;  1OHH G;  1N36 B;  1ARO P;  3JAS A;  1LUW A;  1QCE A;  1BHB A;  2QGN A;  4JYA O;  1BE3 H;  4H13 B;  4X1Y B;  1HNW B;  4BIZ A;  2DYS C;  2YIB A;  3TXS A;  3QNE A;  1WP8 A;  1WPB A;  4OX9 O;  1SZX A;  3JYC A;  4BIO A;  1PNK A;  3BEH A;  2VRZ A;  4MTG A;  4FJC C;  3ASN B;  3K0G A;  1I94 B;  1VQ7 V;  4CH5 A;  2Q4P A;  2IJJ A;  1P84 F;  4JYB A;  4BWA A;  3STZ C;  4X65 B;  1F7Y A;  1EN6 A;  4JV5 O;  2PYJ A;  4O4L B;  2ZNJ A;  1FKA O;  4YHH O;  2LP7 A;  2IH3 C;  5LXT A;  2H3O A;  4DV6 B;  4DO2 A;  5BR8 O;  1NS1 A;  2H94 A;  2OIG A;  5LMN B;  2CDY A;  2DQ3 A;  1MA1 A;  2RN9 A;  5AG2 A;  4KL1 A;  2PY5 A;  4J7J A;  1ZSP A;  3GWK C;  2JEX A;  4JI6 O;  3L71 H;  1K7D A;  1FFX A;  2WLH A;  2ZE8 A;  3B8N A;  4JAA A;  4Q6G A;  1TAE A;  3RVZ A;  2UU9 O;  1Q8I A;  1AR4 A;  3P3P A;  1COW G;  2OYQ A;  4JTD B;  1Q90 D;  5J2T A;  3U10 A;  1WA8 B;  2EIJ C;  4TOI A;  4I4T A;  3HKB B;  2GTS A;  1K4D C;  3LDC A;  2Q6A A;  3T4D A;  3CRA A;  1EM1 A;  5LGT A;  4JI3 O;  3J7A U;  4GZR B;  4X64 B;  1E1Q G;  1NJI W;  4UB6 Z;  2KKW A;  4E4E A;  2WA3 A;  5EZY A;  3SYC A;  1VF7 A;  3ZRS A;  1M90 W;  4PDR A;  4LFB O;  1IXM A;  4LFA O;  1SQX H;  1AIL A;  4ZI7 A;  4TT3 G;  1SF9 A;  1YXB A;  4RAI A;  3ZCC A;  4ABM A;  4Z1V A;  4FLT A;  1XEQ A;  2RDC A;  2EIJ B;  3OD4 A;  5BXZ A;  5CA1 A;  1PNM A;  1N0J A;  4B3R B;  2Q7G A;  1H2S B;  3RVY A;  2DMX A;  3HR0 A;  2UXB B;  1B6Q A;  1XIL A;  4J10 A;  1JCH A;  1R3K C;  1DGS A;  2XND G;  4LWS A;  4K0K B;  1P4R A;  4AQY B;  2V7Q G;  5EBM C;  3L75 H;  1E79 G;  1BS3 A;  4DRX B;  4XBF A;  3HKD B;  4CBC A;  3SPC A;  1N33 O;  1VQ6 V;  3ASO C;  2HR3 A;  3B4S A;  2Q7E A;  1XBL A;  3O65 A;  3APO A;  4R50 A;  5IY5 C;  4LFC O;  1QU7 A;  4I5S A;  1NTK H;  3J80 N;  2BSK B;  4JF3 A;  3CME V;  1VF6 C;  3SYO A;  1SRY A;  1MNG A;  1BQ0 A;  2R9A A;  1XMQ O;  2ZE7 A;  3CPW U;  1KD1 W;  2NR5 A;  2ILM A;  4JI8 O;  3JAK B;  5H6Q A;  3SJB C;  1NBM G;  2QWR B;  2JVD A;  4J80 A;  2E3C A;  5ITZ B;  4JTC B;  3CC2 V;  1CEZ A;  2WLM A;  2LW1 A;  5A9G A;  3DSQ A;  1FFT B;  3JAW A;  1Q3E A;  2PI5 A;  5EYP A;  1YVW A;  3MDS A;  5BY1 A;  1TA8 A;  3ZRW B;  5LHI A;  2Y4T A;  3ASO B;  1MG1 A;  3T1H O;  2DN9 A;  3VQX A;  3FFQ A;  3FKS G;  3QF7 A;  1IBM B;  5K1P A;  5IY5 B;  4DR2 O;  4PI2 A;  4YY3 O;  3UCS C;  4EEQ A;  4IYH A;  4TV9 A;  5GTI Z;  5L3G A;  2Z3Y A;  3RYC A;  4FFB B;  1YJN V;  4YIP A;  2Q69 A;  3TET A;  4FM2 A;  1MAB G;  2XAS A;  4LBE C;  4JGS A;  3AG7 A;  1HNZ O;  2Y48 A;  2IJK A;  4DUY B;  1K8A W;  1PM9 A;  3LDE A;  5JQG B;  5KX5 A;  4O4J A;  3ZED A;  2LFS A;  3UM7 A;  5J2U B;  4TQD A;  1K34 A;  1FXH A;  3ZMS A;  1KUQ A;  3RW0 A;  4WFB V;  4NTX A;  2YI9 A;  4DR3 O;  1YJW V;  5L3E A;  4J7K A;  4NTY A;  2R9I A;  2F43 G;  4X9Q A;  4TSF G;  2F23 A;  3LSQ A;  4DK0 A;  1VMG A;  3TCU A;  2AZ0 A;  3A0H Z;  3DTU B;  1A32 A;  4LF9 O;  1K97 A;  1XNR O;  1B04 A;  1NTZ H;  2KG7 B;  4UCT A;  3DGE A;  1Q82 W;  3BHP A;  2B1G A;  4FM0 A;  5KA5 A;  2F95 B;  1K33 A;  4ZIB A;  1K5S A;  1SES A;  1I94 O;  2YUA A;  3KG2 A;  5LHH A;  1EN4 A;  1QR8 A;  2F1M A;  2AXT Z;  4X62 B;  1EBO A;  4MW3 A;  2WLI B;  5CB4 B;  2F4V B;  2YC0 A;  3ZJZ A;  3FB6 C;  1ORQ C;  3EFF K;  2FYU H;  3VBB A;  5IYD O;  3RWR D;  4FVM A;  4J41 A;  3CCV V;  4DV0 O;  2JK5 C;  3OGC C;  2Q8V A;  2JEU A;  1WN7 A;  4EB6 B;  2F66 C;  3A0R A;  3ABL C;  3W7W A;  3M8A A;  4JYA B;  4MS2 A;  4CH6 A;  2P4V A;  3ETQ A;  3OEH G;  1R73 A;  5H9C A;  1X4T A;  3LUT B;  4OX9 B;  3BRC A;  2LO1 A;  3C3T A;  4DR5 O;  1KEC A;  1MZF A;  1VF5 B;  3JAS B;  1WP7 A;  2CTQ A;  1QHT A;  2L6L A;  5FPR A;  4UFZ A;  2HHH B;  3D3Q A;  3K3W A;  1US6 A;  5LHG A;  4K3A A;  1X59 A;  2QWP B;  4JV5 B;  1NKD A;  3ABL B;  5J9P C;  2YDE A;  3MAQ A;  2D3O W;  1GN3 A;  5KUK A;  5KA6 A;  2PGG A;  3E22 A;  1ZL8 A;  1OV9 A;  2V1D A;  3WB1 A;  3M7M X;  1VQP V;  2LGW A;  3SDL A;  2Z5U A;  2A0L A;  4P2Z A;  1QVG U;  1SQF A;  2EIN C;  4X66 O;  2YIC A;  1IBK O;  4JI6 B;  5LXT B;  2Z0A A;  1PL0 A;  2JDI G;  5EIB D;  2UU9 B;  1R3J C;  4B3R O;  4NVP A;  4WFA V;  3AG2 C;  2ZR3 A;  1NH2 D;  4UB8 Z;  4OPH A;  1JJO A;  5B3S C;  2ARH A;  1M57 C;  1NU1 H;  3K9S A;  4JI5 O;  1FFX B;  2QA4 V;  1U97 A;  3W7U A;  4PDL A;  1EZJ A;  1SC5 B;  3LNM B;  5FLX N;  3J81 N;  5J2T B;  2ADP A;  4F6R A;  2QM8 A;  2Q5Z A;  3AK2 A;  4JYC A;  4DV2 O;  4K8X A;  2B9Z A;  1KYO F;  3CRM A;  3JAL A;  4I4T B;  2EIN B;  5KUM A;  3CCR V;  1OCZ C;  2L35 A;  1N34 O;  3TXQ A;  3BCC H;  3IC7 A;  4TUY A;  4Z1M G;  5EZY B;  1EFR G;  3RYI A;  1AI4 A;  2ZXW C;  4JAS A;  3E2E A;  4O2B A;  4UVA A;  5B3S B;  3CP1 A;  3H9V A;  4ZI7 B;  3L70 H;  4UVC A;  3CJH A;  1GN6 A;  4PV1 B;  2QR4 A;  4DR4 B;  1VQM V;  5F2V O;  4J9Z B;  4CS3 A;  2EZP A;  4FZ0 A;  3UKM A;  4ICG A;  4UCV A;  2LGQ A;  1YJ9 V;  3LNN A;  5CA1 B;  3STL C;  3DXR A;  1N33 B;  1QBZ A;  3JD1 A;  4UCU A;  2QTO A;  2ZR2 A;  1OCZ B;  1W0J G;  5LOV A;  4QGP A;  4PJ0 Z;  4LF7 O;  5LGU A;  1SA0 A;  2W6J G;  2EBO A;  4RQE A;  4LFC B;  2JGD A;  2EIK C;  4LWS B;  4TWK A;  2LW7 A;  1F4M A;  4NXM O;  2YSU B;  4PHZ A;  4DV5 O;  2ZXW B;  2Y69 C;  1XMQ B;  1S5J A;  3IAY A;  2QKS A;  4GX2 A;  3WG7 C;  2IW5 A;  5IYC O;  4FLZ A;  4JI8 B;  1FOU A;  1Y67 A;  4O4I A;  3SYP A;  1I0H A;  2YXL A;  1Z2G A;  2ATK C;  1N4C A;  4Z2W A;  4WFG A;  3ABU A;  1NR7 A;  1WLE A;  2ZNI A;  5CMU A;  2CGN A;  1IXB A;  2LQT A;  1GAX A;  1Y6X A;  1BSM A;  2XAQ A;  3FB8 C;  1XHZ A;  4UCO A;  4MT8 A;  2PUS A;  3T1H B;  4X88 A;  3OMI B;  1KKD A;  2HEP A;  4MVQ A;  1IX9 A;  3JAW B;  2Y69 B;  4KUM A;  5EYP B;  1R6K A;  2DJV A;  3WG7 B;  1SET A;  1U96 A;  4L8J A;  1HNZ B;  2NN4 A;  2YS8 A;  3ASN C;  4Q20 A;  5E1A C;  1IUR A;  4K8Z A;  4JZ2 A;  1ENV A;  4TV9 B;  2B1I A;  3E8F A;  3RYC B;  3E8B A;  2UUA O;  3KZI Z;  4I9W A;  2VQF O;  4PA4 A;  1XHX A;  1YCI A;  3A8T A;  1BGY H;  3X2Q C;  2R9R B;  2WLJ A;  5KX5 B;  4O4J B;  1UJW B;  3QTC A;  4FPP A;  1L1F A;  5LP6 A;  4DV7 O;  4NB5 A;  1YZB A;  4LF9 B;  1URF A;  4DR6 O;  1XNR B;  4QJF B;  5JJE B;  3I56 V;  1G1X B;  5DM6 V;  2QE7 G;  4JI0 B;  4IHJ A;  3CS5 A;  5IYB O;  4I55 A;  3WB2 A;  3SPH A;  2F93 B;  1IBL O;  2XHB A;  2HHH O;  4F4L A;  3MHS C;  1XL6 A;  2UXX A;  2CK3 G;  2QDO A;  1MZE A;  1GN2 A;  1FD9 A;  3JAR A;  2HP8 A;  1N0N A;  1VQ4 V;  1QLN A;  3X2Q B;  3SJC C;  1VIB A;  4DV0 B;  3UO2 A;  2E75 B;  1GM9 A;  4I9Q A;  4OGQ B;  1PNL A;  3E86 A;  4AIL C;  2FKX A;  1AI6 A;  3VOU A;  3T1Y O;  1JPX A;  1PV0 A;  3SR2 C;  1Q6I A;  3U11 A;  2O57 A;  4D6T H;  2E76 B;  4DR5 B;  2AHY A;  1GMG A;  3JD2 A;  5JH7 A;  4QE9 A;  1GKF A;  4FLY A;  1OCO C;  1GO3 F;  4JYY A;  5B66 Z;  1NZ6 A;  3HKC A;  2ZDI A;  1AR1 B;  3JSL A;  1GM7 A;  4DR7 O;  2ZCE A;  1KBH A;  4JI4 O;  3K0D A;  4RQF A;  1FXV A;  3K57 A;  1H2M A;  3ETG A;  3JAM N;  5B5E Z;  2EUL A;  4CS2 A;  2WLL A;  3TK1 A;  1IDS A;  1SZT A;  2MW2 B;  3SPG A;  4X66 B;  5H2F Z;  1IBK B;  4J11 A;  1YTF D;  1M5I A;  1JOY A;  4B7K A;  2P7T C;  3SPJ A;  3OW2 U;  2X6B A;  1OCO B;  3G6B A;  4MTO A;  3E22 B;  5LL6 Y;  1RSO A;  5KHJ A;  1ZL8 B;  2A79 B;  1YIJ V;  3HKE A;  3D36 A;  5H5N A;  4X1K A;  1YSC A;  5C93 A;  1GH6 A;  4PA6 A;  4DR4 O;  2Q73 A;  4JZG A;  3K5O A;  3SYA A;  5KMG A;  2YEV A;  4JI5 B;  2WWW A;  3HB3 B;  3AEI A;  1PD3 A;  3RN4 A;  1HDJ A;  3EVK A;  3ZHS A;  4H0L B;  3JD3 A;  1B3Q A;  2AZ2 A;  1G4Y B;  3ZHV A;  4DV2 B;  4DV1 O;  2VQE B;  3ZMV A;  3G67 A;  3G80 A;  1NR1 A;  2HVK C;  5JCO A;  2W6I G;  1N34 B;  1AI7 A;  1NVP D;  4W4K A;  4LCU C;  3APQ A;  1PKX A;  1G8M A;  4F6R B;  4FMT A;  4B3M B;  3JCZ A;  2ZQM A;  3JAL B;  3JD4 A;  5IDJ A;  2E5L O;  3QVN A;  2UXD O;  1FAF A;  5DN6 G;  3IJ4 A;  4NTW A;  4R8C A;  5JVD A;  1H5W A;  4TUY B;  4WFF A;  4AI8 A;  1T5E A;  4DYL A;  3RYI B;  4JAU A;  2WAM A;  2UXC O;  2E74 B;  4O2B B;  3UQ8 A;  4BW9 A;  5IE9 A;  2Y4U A;  3CJH B;  4MVR A;  2MK3 A;  4LF7 B;  1RP3 B;  1SQV H;  2CTW A;  2NNU A;  2C2A A;  5CBG A;  4JPR A;  3ZIA G;  4QNH B;  3A0B Z;  4NXM B;  3FB7 C;  3CWB H;  4EFB A;  4DV5 B;  1B06 A;  1FPO A;  4YJ3 A;  3DXR B;  3LSS A;  1AI5 A;  5C8Y A;  4DV4 O;  5LOV B;  2W0X A;  4D7T A;  1SA0 B;  2IBZ H;  3AG3 C;  2KB1 A;  1OCR C;  3H1I H;  1GM8 A;  2JGD B;  4QE7 A;  2QSA A;  1XOU A;  3T2M A;  3B8M A;  4LNU A;  4WBN A;  5IYZ A;  1JR9 A;  3ZRV A;  4BIU A;  5JWP A;  3CXC U;  4FLX A;  3CCQ V;  3K06 A;  4O4I B;  3RBZ A;  4P30 A;  2YIA A;  2DE0 X;  3N2G A;  2ZE5 A;  5A2Q N;  2ADQ B;  2LJ2 A;  4DUZ O;  3ZMZ A;  1OZ0 A;  4JI0 O;  4BR6 A;  4GKK O;  3OMN B;  1HR0 B;  1HP8 A;  1NI8 A;  1Z5V A;  3G4S V;  1D2D A;  5HFM A;  1XUQ A;  2ZIN A;  4U7O A;  3AG3 B;  1OCR B;  2N74 A;  2A7W A;  3CRC A;  2R72 A;  1NQT A;  5LP6 C;  2ETN A;  3BA9 A;  4PEL A;  3ABK C;  4FK5 C;  5B1A C;  5CBF A;  2VS0 A;  2UUA B;  2VQF B;  3BA8 A;  1F4N A;  1V55 B;  1Q6H A;  3CX5 F;  1SS3 A;  1K9M W;  3ZRX A;  4DV7 B;  3RT3 C;  1LUV A;  4DR6 B;  1DF5 A;  2QJ1 A;  4CH3 A;  5IT9 N;  3H1J H;  1H2N A;  2EZO A;  3BVO A;  2FTK A;  2PZS A;  1CXZ B;  1H38 A;  4LF6 O;  4CC6 A;  3CCM V;  3BY6 A;  3ABT A;  1BHA A;  3OAA G;  1IBL B;  5LP6 B;  4MTF A;  2ZM6 B;  3ABK B;  4B3T B;  4HZ3 A;  5B1A B;  1Y74 A;  1UFI A;  2OWO A;  4NXN O;  4TQF A;  1HW7 A;  2OIE A;  4IHJ B;  2GDS A;  4I55 B;  3ZX6 A;  1S76 D;  3F7Y C;  2YI8 A;  1Y66 A;  2HJF C;  2Q68 A;  4PA9 A;  5GON A;  1I5X A;  4JTA B;  5LYJ A;  4ZOL A;  1ZX3 A;  2QWN B;  1QQC A;  2PF4 E;  3JAR B;  4YJ2 A;  3T1Y B;  2EIM C;  3CMA V;  2V4D A;  4FLU A;  2XAG A;  5L3C A;  1BT8 A;  2JRI A;  3CXH F;  2ZDI C;  4B3S B;  4UVB A;  3ML0 A;  3DC5 A;  3CYO A;  3VQW A;  1WNS A;  4PA7 A;  5LA6 A;  3CHX A;  3OUF A;  2XAH A;  4E2L A;  4LF4 O;  2BTQ A;  4KFM A;  3N27 A;  5KHG A;  5BMV A;  2VWK A;  3LSU A;  1R6T A;  1GN4 A;  2X6C A;  3BPZ A;  4DR7 B;  2RCV A;  1JA8 A;  4HYO A;  4UV8 A;  1FJG O;  3AG1 C;  2JJ1 G;  2QEX V;  5JH7 B;  4JI4 B;  5JJN B;  2EIM B;  2VQE O;  2QWQ B;  3CCJ V;  3VQY A;  2P90 A;  4X20 A;  1M93 A;  3GVM A;  1H2L A;  3HKC B;  4CZZ A;  3SPI A;  5EC1 C;  3L72 H;  5KAI Z;  3OEE G;  4ZHQ A;  2A3Q A;  4B3M O;  1FXK A;  1D5A A;  3W7T A;  4YIO A;  2WA4 A;  2Y0I A;  1W2B U;  3ZHR A;  2WLL B;  4HAM A;  2BTO A;  1JQ0 A;  3FAV A;  5JJJ B;  3F5T A;  2XT9 A;  3GWO A;  2HVJ C;  3CCE V;  5B1B C;  2Q67 A;  3ZRW A;  4R7C A;  4IIJ A;  2P67 A;  1BCC H;  1SQQ H;  3AG1 B;  2HFE C;  3WFV A;  1E1R G;  3CE2 A;  1RSO B;  1ZWI C;  1BL8 A;  5GW7 A;  2ZKO A;  1S0V A;  3CCU V;  3HKE B;  2GUZ A;  5EBL C;  3ETE A;  4X1K B;  4DV1 B;  1FYJ A;  1BZK A;  1WJZ A;  5KMG B;  3ZHU A;  2YEV B;  1H2G A;  3JD0 A;  1YIT V;  3B2E E;  5KHK A;  1XDC A;  2ODM A;  2JS5 A;  3CSX A;  2IJI A;  1MSD A;  3TJT A;  1BQZ A;  3GB7 C;  4ZBM A;  3CD6 V;  5BZB A;  3P3N A;  5B1B B;  1VQL V;  4IGG A;  2E5L B;  4P9P A;  3EHB B;  2UXD B;  2ITC C;  2M7W A;  4GYC B;  1N8R W;  1Y76 A;  2HG5 C;  2ZE6 A;  4MTX A;  1AJP A;  4WF9 V;  2QM7 A;  1P7B A;  2EJ7 A;  2UXC B;  1EN5 A;  4GX1 A;  2EIL C;  3P32 A;  1V9P A;  2X0L A;  4GT1 A;  2IU3 A;  4UCS A;  4DV3 B;  4DR1 O;  1HR0 O;  2XTA A;  5JVD B;  4AHC A;  1O9H A;  3H1K H;  4RUF A;  1JX9 A;  1AR5 A;  3SJQ C;  3I5D A;  4KP4 A;  4DV4 B;  4NR1 A;  1TUB A;  1HWY A;  3S3X A;  3UO3 A;  1NH2 B;  4O4H A;  2Y0P A;  4WFE A;  3QO5 A;  1XMO O;  1AJN A;  1S5L Z;  2DWD C;  2DYR C;  4MW8 A;  5LGN A;  1JVM A;  3ICX A;  4GX5 A;  4H44 B;  1NT2 B;  4YJ3 B;  3R65 A;  3RYH A;  1VQK V;  2EIL B;  2OCH A;  1FS0 G;  1KC8 W;  3L9D A;  5C8Y B;  1R3I C;  2ZIO A;  2OT5 A;  3AG4 C;  1VAR A;  5E79 Z;  3K9A A;  5CA3 A;  3T4Z A;  2P06 A;  4DUZ B;  1YDX A;  1WPX A;  2PI4 A;  4LNU B;  4WBN B;  5IYZ B;  4GKK B;  3UT5 A;  3CRQ A;  1Y4M A;  2ZM6 O;  3K08 A;  4X8A A;  4B3T O;  4FFK A;  2ZT9 B;  3N2G B;  2DYR B;  3L73 H;  5D5P A;  1VQO V;  3W7X A;  1VEW A;  2EX3 A; 
#chains in the Genus database with same CATH homology
 3OT7 A;  1LUW A;  2P4K A;  3LSU A;  1KKC A;  1GN4 A;  3C3T A;  4YIP A;  3QVN A;  3IC9 A;  2RCV A;  1JA8 A;  3BFR A;  1I08 A;  4JZ2 A;  4JYY A;  1EN5 A;  1ZTE A;  1SZX A;  1PM9 A;  1P7G A;  1GN6 A;  1MMM A;  1AP5 A;  1N0J A;  1LUV A;  1XIL A;  1ZUQ A;  1AR5 A;  1GN3 A;  4X9Q A;  1EN6 A;  1IDS A;  1XRE A;  1D5N A;  3C3S A;  4YIO A;  1BS3 A;  1B06 A;  1AP6 A;  4F6E A;  4GUN A;  1WB7 A;  3CEI A;  2CDY A;  1MA1 A;  3KKY A;  5AG2 A;  2CE4 A;  2GDS A;  1ZSP A;  1AVM A;  2QKA A;  4JZG A;  1Y67 A;  1GN2 A;  1I0H A;  1MNG A;  3DC6 A;  1N0N A;  1EN4 A;  3KDR A;  1VAR A;  4C7U A;  1JR9 A;  1AR4 A;  2AW9 A;  1IXB A;  3EVK A;  3RN4 A;  1BSM A;  3K9S A;  1WB8 A;  5A9G A;  2ADQ B;  1BT8 A;  3AK3 A;  4FFK A;  4BR6 A;  1XDC A;  1QNM A;  1ZLZ A;  2QKC A;  1PL4 A;  2ADP A;  3MDS A;  1MSD A;  1EM1 A;  3TJT A;  3AK2 A;  1IX9 A;  3DC5 A;  3AK1 A;  1VEW A;  1XUQ A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...