1XREA

Crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
SFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQDTPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 69
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xreA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xreA02
2P4KA 4FFKA 4YIOA 4YIPA 1I08A 3BFRA 1IX9A 4F6EA 1VEWA 1LUVA 4E4EA 1AVMA 3LSUA 1GN6A 1QNMA 1EN5A 1I0HA 1GN4A 3OT7A 4JYYA 3DC5A 2CE4A 1XDCA 4GUNA 4C7UA 1D5NA 1MMMA 1ZLZA 1JA8A 1KKCA 3C3TA 1XUQA 2GDSA 1WB7A 3RN4A 1XILA 1PM9A 3CEIA 3K9SA 4JZ2A 4X9QA 1BS3A 1SZXA 1EN4A 2ADQB 1AP6A 1B06A 2QKAA 2RCVA 3C3SA 1EM1A 3EVKA 1XREA 2QKCA 5A9GA 1MA1A 1Y67A 3AK2A 3MDSA 2CDYA 1EN6A 1AR5A 1VARA 1MSDA 1LUWA 4BR6A 5AG2A 1N0NA 1BT8A 1N0JA 3QVNA 3TJTA 1ZSPA 3DC6A 1GN2A 1PL4A 1JR9A 1MNGA 3KKYA 1AR4A 1GN3A 3AK3A 1WB8A 1AP5A 4JZGA 1IXBA 1ZTEA 2ADPA 1IDSA 2AW9A 3AK1A 1BSMA 3IC9A 1ZUQA 1P7GA
chains in the Genus database with same CATH superfamily
1WPXA 2Q69A 4NTYA 2WLKA 2EIJC 4UFZA 4XDLA 1Z2GA 4FPPA 3WG7C 3HB3B 4AQYB 2XOKG 1S0VA 3L9DA 3N27A 4FFBA 1U97A 2IH1C 1NKDA 4FLXA 2VQEB 3TGUH 4FK5C 3BRCA 2N04A 4JI8O 3E35A 3JALB 3T1YO 3DXRB 1A32A 2VQFO 3JD4A 2Q0OC 1BHBA 1Z5WA 5GTIZ 1ZL8B 1HR0B 4LWSA 1P49A 2EIKC 5J9PC 5J2UA 4JAUA 1KKDA 2B1IA 3CX5F 3BCCH 3SYCA 1XHZA 3B09A 3H1JH 4K0KO 2HHHO 1JVMA 3CCVV 4DYLA 4G28B 4IHJB 4FVMA 4WFFA 5KHJA 3H1LH 4PELA 3RYHB 2EIMB 3EXAA 4LNUA 4X66O 3QG5A 2ODMA 2XASA 2ZE6A 1GM7A 3RYIB 5BMVA 1JOYA 1IXMA 1G1XB 4LFAO 3CRQA 3E83A 1DF5A 2IW5A 1EZJA 2YICA 3AG3C 1G6UA 2Q73A 4B3RO 4O4IB 4PDLA 1YDXA 2YSUB 4FLTA 3ZRWA 3ZN1A 5LMNB 4O2AB 1NVPB 1TUBB 1V54C 5B3SB 2WA4A 3HKCB 3AK1A 1XQ8A 3QNEA 2PTMA 4YHHO 2P6JA 3JAKB 3CMEV 4RQFA 2OCCC 3HR0A 4PA3A 2DW4A 5FPOA 3PN1A 3HKEA 1VQ5V 1K7DA 1SF9A 2DMXA 1HNXO 2QM4A 2DYRB 1HNWB 4I0XA 1VQLV 1COWG 2LGQA 4JYAB 4LFCO 2KKWA 4JF3A 2BSKA 2HP8A 4LH7A 4JI0B 4AHCA 4X64B 1M56C 3MHHC 5GTHZ 3CCLV 4L87A 4MTGA 1RPRA 5JQGB 5LOVB 1SZTA 2CK3G 4PA9A 4F6RB 1R3KC 4UV9A 1VF6C 1KUQA 3GWKC 4JI6O 1KP3A 1SQBH 1FAFA 1VQMV 1EM1A 3RW0A 1I7FA 4DV7B 3BVOA 3OR7C 3ABKB 1FFTB 5EIBC 2WLIB 1NBMG 5DECA 4NXMB 1HP8A 3B8MA 4GKKB 2CH7B 4TQFA 4A5UB 4DW1A 4PA6A 4RO2A 4U3FH 1VQOV 3LUTB 2O57A 4CS2A 4MW8A 3SYPA 4CS3A 3FAVB 1HWYA 4BIUA 4B3MB 2OYQA 4HAMA 4J7JA 1NI8A 3OD4A 1JR9A 4DV5O 1F4NA 3P32A 2DQ3A 1ZL8A 1H8EG 4O4LA 5JWPA 1H2GA 2ZM6B 4B3SB 1IXBA 3KG2A 2DJVA 2YS8A 2ADPA 1FXVA 4ZKIA 2W0XA 5IJ9B 2ZNIA 4YY3O 4UCVA 1HNZB 2DE0X 5KUMA 3BEHA 3RYHA 2ITCC 3E8BA 1PL0A 2QSAA 1VEWA 3UT5A 4R50A 4HNAB 2QWPB 1N36O 1M5IA 3K0GA 1GN6A 5LA6B 2D2CB 4DR3B 2F4VO 3ZHUA 4JI7O 4WFAV 2E76B 1GK9A 3OEEG 4LF7O 3C3TA 3JATB 5LHGA 1VQ6V 2UUAB 1WLEA 3HKDA 1AROP 5CA1B 3SPIA 1H2KA 1Y76B 4OX9O 1TUBA 5IE9A 3HKCA 3FD9A 2ITDC 3JSLA 3DTUB 1M93A 5L3CA 4QJFB 2ZXWB 3OMIB 3AG2C 1BE3H 1NZ6A 2PUSA 3CYOA 3JD2A 4X1YA 1SA0B 3Q4HB 3A0HZ 4B7KA 1YITV 3K5LA 2UUCO 5TISZ 4MSWC 3VQVA 1WNSA 4MVQA 3BABA 4PDRA 3APOA 1M4UA 2YXYA 2YEVB 1QCEA 3ZRXA 5J2TB 1KD1W 4I4TA 3CXHF 4DV6B 3MHSC 2JS3A 5CB4B 1MABG 1H2LA 4QPKA 2GUZA 3SYOA 2A0LA 3P3NA 4PD4F 1VF7A 5GONB 3TK1A 5KLVH 2LFSA 4TV9B 3DSQA 4TT3G 3CC4V 5B1BB 1QVFU 1R6TA 3FAVA 2ZE7A 1NQTA 4DR4B 1FS0G 1FXKC 4DR6O 1MMMA 1JA8A 1N34B 3IAYA 1Q82W 1L0NH 2JK5C 5LYJA 1PM9A 2UXCO 3SPGA 1Q6IA 5IT9N 3CJHB 1OHHG 1SQVH 2Y4TA 4X20B 4DR1B 1XMQO 4Z1VA 3P3PA 3J7AU 2RDCA 4E2LA 1B6QA 3E8FA 3OTOO 4GX1A 4IGGA 4JAAA 4KHPB 2C2AA 4K35A 1XNRB 4LF5B 1W0JG 4O4HB 1FYJA 5BXZA 3F7VC 2EULA 4DUZB 3JATA 3MAQA 5BR8B 1BHAA 1PKXA 3IJ4A 4GKJO 3K9AA 2XHBA 3RGBA 4DV2B 1AJNA 3VBBA 1NJIW 1Y76A 4FIPC 1QU7A 1JQ0A 2QEXV 1AP5A 1US6A 1M1KW 2F66C 4WFHA 3T1HO 1VQPV 2QM8A 5EBMC 1N32O 2MK3A 2AGAA 4FFBB 4JI3B 1SS3A 1M57B 3CRRA 1EZVH 2DOSA 2ZE8A 2P4KA 1WP8A 1H2SB 5B66Z 2ATKC 2V4DA 2KG7A 1BL8A 2MW2B 2W0FC 2IU0A 2E75B 2PGGA 2W6JG 1JCHA 3CHXA 4PDVA 4MVZA 1R6NA 4LWSB 1SRYA 5J2UB 2Q7GA 3AG1C 1QBZA 2CUGA 2W6IG 2H3OA 4LF6O 4HBNA 4X9QA 2ZD9A 2JEXA 3N2KA 1BQZA 5GONA 3F5TA 1SQPH 3H9VA 5K1PA 4LNUB 2A9HA 2YC0A 1YEWA 2R70A 3TCUA 1BZKA 1F23A 1XBLA 1BCCH 2ZINA 4PHZA 4JI1O 1VF6A 5F2VO 3LDDA 4J9ZB 1JJOA 2Y69C 3W7XA 2ETNA 4XDKA 5B1AB 3ZHTA 3ASNC 3JARA 1LUWA 3D3IA 3ZRWB 3OE7G 1S3JA 1QHTA 4I7ZB 4J9YB 3TJTA 5LP6C 3VQWA 3QO8A 1OCCC 1KECA 2HEPA 2GSMB 2DQ0A 5H6RA 5KHIA 3ZEDA 5EC2C 1MG1A 4D6TH 3D3QA 1GN3A 2R9IA 3VOUA 2XAFA 4DV4O 3JCUZ 1K73W 1I5YA 1P4RA 5EYPA 3HKEB 5KHKA 3WFVA 3B4SA 2DYSB 5B1OA 5JCOA 4I0XB 4QGPA 1OCOB 3CRAA 1VMGA 3G71V 2PY5A 4JI4B 3OGCC 3CE2A 2BSKB 1B3QA 1XEQA 4CH6A 5EZYA 4E4EA 1W2BU 3BHPA 2GTSA 4FLZA 1VQ9V 3ZHVA 2L6LA 3E2EA 1N8RW 4OXSA 3ETEA 1Y6XA 3KCXA 2QJ1A 3RYFA 1IBLO 3GB7C 3DC5A 1YSCA 2RMKB 3SR2C 5DEDA 3THOA 4X89A 3ICXA 4U7OA 2HHHB 4TSFG 5JJJB 4UCUA 1ZX3A 1OCZC 1L1FA 3ABLB 1B06A 4J10A 4DR2B 3CC7V 1JPXA 3GWOA 1P7BA 1MOFA 2GBOA 2P22C 1VP7A 3HPLC 3CCEV 5KA5A 1XHXA 2Q0AA 2VS0A 4X65B 1NTKH 2M6YA 3E22A 4O4LB 4DO2A 3BAAA 3K04A 1Y66A 5ITZB 4LFBO 1ENVA 4F4LA 1NS1A 3UO2A 1HW7A 2K1EA 4DV1B 4JASA 1V55C 4WFEA 5IYDO 2P06A 1YTFD 1PP9H 1XNQB 1B04A 3UT5B 3OW2U 4NVPA 4H33A 3JYCA 3OEHG 4J11A 1JNBA 1P7GA 2NN4A 2DWDC 1Q81W 1EBOA 5HFLA 4PA4A 4AQYO 4JV5B 4MVRA 4YIOA 2WWWA 2OT5A 3W7WA 3ABMB 1JJ2U 2FKXA 3HKDB 4DUYB 4RWUA 5KAFZ 3K57A 2JDIG 3AG4C 2JEUA 1AR1B 4H37A 4CH3A 2IU3A 5LBQA 4JYYA 1WN7A 2CE4A 1OZ0A 2EBOA 4J41A 3SJCC 1E1RG 2QWNB 3OGIB 4BAYA 4PDMA 2BOCC 1H5WA 5D5QA 4X88A 1V9PA 1HR0O 3FX7A 1SZXA 1THZA 4X1YB 1O9HA 1YXBA 4DK0A 1SESA 1F4MA 5E1AC 2HR3A 3B40A 4KFMA 1FKAO 1UFIA 3QTCA 4XBFA 3D36C 4WF9V 1SERA 4PA7A 1MA1A 1Y67A 2R72A 3KZIZ 4DR7B 4TWKA 2WLHA 2XAJA 4I4TB 1MSWD 3CC2V 1NH2D 4LF4B 3ZMSA 3L71H 5IY5B 2PYLA 1SC5B 4QE9A 3CWBH 4ASUG 2GUZB 1H2NA 4GX5A 4GX2A 1GN2A 1G4YB 2RN9A 4ZIBA 1X59A 1K97A 2AZ2A 1TA8A 4LF9B 2RNBA 2Q6AA 5LMNO 3RFRA 2M7WA 3KCYA 3EFFK 4JI5B 2QWQB 1ZTEA 3VQYA 2FMLA 4NTXA 2EINC 2UU9B 4ZI7A 2EIJB 4K8ZA 2KQXA 2P5OA 2HVJC 3L74H 3WG7B 3S3XA 4UUJC 4NXNB 1IBKB 2WSSG 3WB0A 3FYIB 4UCOA 1I08A 1HNWO 1RP3B 1FOUA 1RM1C 5LYJB 4FZ0A 1Q6UA 1PV0A 1IJGA 1SQFA 4JYAO 2UUBB 1Q86W 1I0HA 2E5LB 1N33B 5LL6Y 4JI0O 5E79Z 5ITZA 2D3OW 1R1BA 4X64O 2NR5A 4FJCC 1BQ0A 2XAQA 2GDSA 4JYCA 1LNQA 2Q5ZA 2Q8VA 2EIKB 1K3EA 1QLEC 1JX9A 2R9RB 2BTOA 3I55V 3WU2Z 3IFXA 2Y0IA 2WLJA 1Y4MA 4GZRB 4DV7O 2GTAA 3OFNG 4B7EA 3ZCCA 5JVDA 4NXMO 4WBNA 5A9GA 1RFYA 4GKKO 5LHIA 3BY6A 2PI4A 2R9AA 1DGSA 4FM0A 1YF2A 1UJWB 3J81N 4J42A 4EKWA 4RAIA 2RJZA 2F43G 1E79G 1VARA 3SPJA 1SETA 4B3MO 1Q6HA 1S5LZ 3AG3B 3C90A 2WLLA 3B77A 4NB5A 2QM7A 2LFRA 3QVNA 3ZIAG 2ZT9B 2CAZC 1IZ3A 2ZM6O 4B3SO 1V54B 2B5UA 3JASB 1PD3A 4DV0O 2OCCB 5CA0A 1IDSA 2KG7B 1HNZO 2AW9A 4DR5B 1CXZB 5GW7A 2CTQA 1GO3F 4I55A 2LW7A 3FB6C 4DR6B 2FB5A 5KX5A 1KMIZ 4R6ZA 2EX3A 4F6EA 4DW0A 3E8HA 2KB1A 2UXDB 3B8NA 3K58A 1QNMA 3O9OA 3JD1A 1YHQV 1M56B 1WPBA 3N2KB 2UUAO 1NVPD 3OUFA 2F95B 4C7UA 1URFA 2EILC 5EBWC 5B1NA 5IJ0A 4LR3A 4IYIA 5EC1C 2UXBB 3STLC 4MS2A 1KYOF 3PJSK 5KHGA 4KUMA 1SQGA 1VQKV 3K3WA 5LGTA 4MTOA 1AP6A 4I50A 3JARB 4L8JA 3M99B 1I94B 1OCRC 3TXSA 4B3TB 2NLJC 4LF8B 3UCSC 2X6BA 3K5MA 3EVKA 1KP2A 3ZHSA 2X7RB 4HZ3A 4MVMA 2Z5UA 4OPAA 4IL6Z 2QWOB 4YXWG 5L3EA 3JD3A 4DRXA 3ZRVA 5EYPB 4Q20A 3OTFA 3T1HB 4YJ3A 1Y74B 3AEIA 4DV6O 2AHZA 1XOUA 4CZZA 4ICGA 1MNGA 1AR4A 3AK3A 3FB7C 1TUEB 4MW3A 1NU1H 2YIAA 1SKVA 3L75H 4B08A 3ETGA 3T4DA 3RT3C 5EZYB 1QQCA 2FYUH 5LMUB 3A0RA 1S77D 3ZBHA 3K03A 1X4TA 1MZFA 3G6EV 1GH6A 4R8CA 3A0BZ 4IIJA 3RYFB 4U3JA 2IM9A 4RUEA 1OJHA 1I5XA 3G6BA 4JI2B 4I9QA 3FB8C 3ZMZA 2HG5C 5CN0A 3K06A 4EFEA 1WJZA 1N34O 1GN4A 4X1KB 4YJ2A 2A3QA 1NTMH 3L72H 1D5NA 3P30A 2A7WA 4X62B 1WB7A 3EHBB 3JASA 4DR1O 1XILA 2P67A 1MZEA 4X8AA 4Z2WA 1YTFB 1N4CA 4CS4A 1DK1A 2CGOA 5EK0A 3ZHRA 2PZSA 2IJJA 1K9MW 1GKFA 1SQXH 4X1IA 2V7QG 3AG2B 5BZBA 1VF5B 5LGNA 3SJBC 2OTLV 2QKAA 3QF7A 2OIGA 3E22B 1YIJV 4JTDB 4UCTA 2H8PC 5IWAB 2JS5A 2Z3YA 1XNRO 1M9NA 4LF5O 3JCZA 2GV9A 4UCRA 3CS5A 2G38A 1JFFA 4DUZO 1O9GA 2EZOA 2X0LA 5BR8O 4DV4B 4BR6A 1YJ9V 3SPCA 1L0LH 1N0NA 1FJGB 3ZX6A 2HJFC 4DV2O 1J5EB 1W59A 4DV3B 2HKOA 2EIMC 1S72V 2ZKOA 5DM6V 4O2BA 2JIZG 1FFXB 2IH3C 5FL7G 1HDJA 4J7KA 5D5PA 4NYKA 2XAGA 1UPGA 2OTJV 1GM8A 2XAHA 4JI3O 4UVCA 4N23A 1KB9F 1M90W 1CEZA 3SJQC 1IBMB 1XMOO 2GHYA 2JGUA 4FLYA 1FD9A 1IBLB 2KSDA 5B3SC 2VWJA 4EB6A 4FFKA 4O4JB 1IX9A 1OCRB 1FXKB 5CBGA 3LDCA 1YCIA 3OM3B 4CH5A 4JTAB 2AHYA 4MT8A 2ZDIC 1Y74A 5H2FZ 2PI5A 1XL6A 5KA6A 2DYRC 3QO7A 1ZLZA 1XUQA 1S5HC 1L8DA 1QLNA 2IJIA 3IGAC 3QO5A 3UO3A 4JI8B 1WAZA 2CTRA 3T1YB 2ADQB 2VQFB 3JAMN 1K4DC 2ZQMA 4MTXA 2PF4E 3C3SA 3SYQA 2CTWA 2LGWA 3TETA 2YXLA 2AXTZ 5H6QA 4MVOA 2ILMA 2WAMA 1CP9A 1Z5VA 2FL4A 1P84F 4LFBB 5IYZB 3K5OA 3W7TA 4K0KB 1AI4A 3D8CA 1QR8A 1WA8A 1GTOA 4X1KA 3ABKC 3FYEB 2LJ2A 5IDJA 5L3GA 3RYCB 2Q67A 4JAVA 3CCRV 4X66B 4UV8A 4ZI7B 3CMAV 5KHHA 1D5AA 2LQTA 1K5QA 5KAIZ 4K3AA 1AI5A 3CCMV 4EFBA 2P7TC 2L35A 4LFAB 3N2GA 5IYCO 4UXNA 2NNUA 3K0DA 4D7SA 5JJEB 1KQSU 1K8AW 1LR1A 4B3RB 5JH7A 1YI2V 2Q7HA 4CC6A 4JI4O 5DN6G 1J95A 4BW9A 4NTWA 2JVDA 1QVGU 2JGDA 2ZNJA 3FB5C 4YHHB 3T1CA 5FLXN 5IYBO 3IC7A 4YIPA 1FPOA 5KMGA 5FPRA 1R73A 3OMNB 2YIBD 3UQ8A 1YJWV 4UVBA 2JJ2G 3AG1B 1NTZH 4LP8A 3T2MA 1HNXB 2AZ0A 2V1DA 3I5DA 3CCSV 2WA3A 2X6AA 4TV8A 1T5EA 1FFXA 4LCUC 1NT2B 4LFCB 3RVYA 3RN4A 4CBCA 3CB2A 5JVDB 5BY1A 4W4LA 4BWAA 4WBNB 2N74A 4MTFA 4JYBA 3K5NA 2BTQA 4OPHA 2VQEO 2H94A 1W0KG 4DR2O 1PPJH 1DLBA 4G27B 4FLWA 2Y69B 3SPHA 1VQ4V 2Q9LA 2UXXA 2OIEA 2WLLB 3H1HH 3ASNB 4JI6B 4O4JA 1RSOB 2QKCA 4X65O 3JSNA 1FXKA 2DWEC 3ABTA 4TUYA 3ML0A 2IJHA 2Q7EA 2ZXWC 3H01A 4G2KA 4WFGA 5LP6B 1TVKA 1MSDA 1OCCB 3NXSA 5LXTA 2BOBC 1YZBA 5CA0B 2ZCEA 2RQ6A 3CRCA 4DV1O 4UVAA 2VWKA 4NKGB 1K4CC 2EJRA 4I55B 2YUAA 3SDLA 1XNQO 4DV5B 5KX5B 1BMFG 4JZGA 2JJ1G 5L3DA 2QA4V 5C93A 4AILC 1Q90D 3ETQA 4JV5O 3A8TA 2XT9A 5IYZA 2OCHA 4YY3B 1S5JA 4DUYO 2F23A 3L70H 5IJ0B 4JTCB 4RQEA 3E8GA 1AVMA 1F51A 4H13B 4ZOLA 1ZAUA 2ZIOA 5KUKA 3LNMB 1EN5A 3RYCA 4H44B 1N36B 4P30A 1GMGA 5B1BC 3RWRD 4I50B 4K8XA 3R65A 3ZMVA 1OCZB 3CSXA 3CXCU 4KL1A 2F4VB 4JI7B 3B2EE 3U11A 1NR7A 4LF7B 4CC5A 3T4ZA 3K9SA 4JZ2A 3WB1A 4QIWF 3A2FA 1NR1A 3I56V 1EN4A 3ETDA 3ZN0A 3GVMA 1KU9A 4WCEV 1XI1A 3W7UA 4OX9B 5HFMA 4DRXB 3JALA 4N21A 3DXRA 5CA3A 4DR7O 4YJ3B 3F5WC 1ZWIC 2B1GA 4LF4O 1XL4A 3MDSA 2YXHA 4J7ZA 4D7TA 3X2QC 3OMAB 1AR5A 5JCOC 3HKBB 4GX0A 2F93B 4FM1A 1KBHA 2QDOA 3U0ZA 2E3CA 4DV0B 3E89A 3J80N 1YJNV 1N0JA 3LSSA 1V55B 2UUCB 5EBLC 1G8MA 1AILA 3JAWB 4LF9O 3OUSA 1AB3A 1RPOA 3K79A 4IHJA 4JI5O 1Q43A 4IIJB 4ZBMA 4U3JB 5CMUA 5FNVB 4IT5A 2UU9O 1SQQH 3U10A 1PNLA 5CBFA 2E74B 3RYIA 1TGOA 4NXNO 3TXQA 1IBKO 3F7YC 1BSMA 1AJQA 3G4SV 3H1KH 1RSOA 3SGIA 3E86A 4P9PA 4R7CA 1QR9A 1D2DA 4YJ2B 4O4IA 3ZRSA 2OWOA 2YI8A 3M8AA 3AG4B 2Y4UA 2XUMA 5LP6A 2UUBO 1M57C 4O2AA 1LUVA 1VQNV 4Z1MG 2E5LO 1DTOA 1N33O 4GT1A 1Q3EA 1AI6A 2QWRB 1FXHA 3CD6V 4I5SA 1PNKA 3JAKA 4X1IB 1U96A 2F1MA 5L3BA 3OT7A 1XDCA 2ZDIA 5L3FA 4GYCB 2DN9A 1TAEA 3RVZA 4HYOA 3CEIA 4Q6GA 4UB8Z 2EJ7A 3BPZA 4LBEC 2UXCB 4DR3O 4U7NA 1JFFB 2N05A 1XMQB 2RCVA 3NR7A 3ZS8C 3R66A 3ASOC 2A79B 4CH4A 1VQ7V 3OTOB 2HLDG 4WFBV 5JQGA 5LOVA 2QR4A 2CDYA 4O2BB 4PI2A 4PI0A 1K92A 3RBZA 4F6RA 1ORQC 2WPDG 2QGNA 2LO1A 3G80A 4ABMA 1E1QG 3W7SA 2B9ZA 2WLNA 4FLVA 4P2ZA 3WB2A 5B1AC 3DC6A 1PL4A 2WLIA 3H1IH 1H38A 2EINB 3AG7A 1VQ8V 2CH7A 4GKJB 4FM2A 1VIBA 4PV1B 4W4KA 2CTPA 4EB6B 4QNHB 1H8HG 4BW5A 1S76D 1WP7A 3BA8A 4KXRA 4MVUA 4QPJA 4DR5O 2P90A 2EZPA 3DGEA 2QKSA 2ARHA 2QTSA 1RM1B 3OR6C 1N32B 3CPWU 2BCCH 2DYSC 3SJAC 2UXDO 3UM7A 3HKBA 3BFRA 1OCOC 3CCUV 3LSUA 3UKMA 2ZR2A 5IJ9A 3KDRA 1IVSA 4ZHQB 1GAXA 3X2QB 3JAWA 4RUFA 2UXBO 3CCJV 1QLEB 4GUNA 5C8YB 3BA9A 2WLMA 3STZC 3APQA 4FLUA 2JRIA 4HNAA 2Y0PA 1KC8W 5FNVA 2VRZA 1CPYA 2A06H 4I9WA 2HVKC 2Q4PA 5LA6A 4LF6B 4DR4O 1I94O 3LDEA 5H5NA 4B3TO 4LF8O 1WA8B 4GLXA 3SYAA 4MVSA 3VQXA 3JD0A 4LC1A 5CA1A 4NR1A 1XREA 3ABLC 3FFQA 3AK2A 4TOIA 5LHHA 5LGUA 4JI1B 2LW1A 1EN6A 2Y48A 3N2GB 4BIZA 2XTAA 1DF4A 2PYJA 2ZR3A 2QTOA 4PJ0Z 3CP1A 1EFRG 3ZMTA 2XNDG 2QE7G 1ROPA 3K59A 4JGSA 5JH7B 2HFEC 1R6KA 3ABUA 4KHPO 2ZE5A 4JPRA 1Q5OA 1SA0A 3Q4HA 1XMOB 2JGDB 3D36A 2IJKA 5LMUO 1AJPA 3K08A 5KMGB 1OV9A 4H0LB 3MD0A 1Q8IA 3IC9A 4OGQB 2YEVA 5J2TA 1Q7YW 4P9OA 4QE7A 5A2QN 4KP4A 4TV8B 4JI2O 1GM9A 5H9CA 3CCQV 3LSQA 1H2MA 5CB4A 2YI9A 3O65A 3OAAG 3ASOB 2Q68A 4UCSA 2EILB 2YDEA 4XDJA 4GCZA 2BTQB 4TQDA 2X6CA 4X62O 1K33A 3ABMC 4TV9A 1KKCA 4AI8A 3FKSG 2Z0AA 5BMVB 2CGNA 4IYHA 4FMTA 3S3WA 1NH2B 2LP7A 1BS3A 1GRJA 2K9PA 4TUYB 5CBHA 2HJDA 1TVKB 5IWAO 5LXTB 2YIDA 3ZMUA 1K5SA 4DK1A 5JJNB 4DXWA 3CJHA 1IURA 4X20A 3L73H 1K34A 1JMKC 1F7YA 4BIOA 2FTKA 2ZIMA 4ZHQA 1BGYH 1FJGO 1J5EO 2UXNA 4DV3O 5AG2A 4UB6Z 5C8YA 1YVWA 1BT8A 2IBZH 3LNNA 3G67A 3ZJZA 5EIBD 1ZSPA 5IY5C 1R3JC 3KKYA 5K1XA 4FZ1A 5B5EZ 2BE3A 4LH6A 1WB8A 4EEQA 4O4HA 1PNMA 3CRMA 1R3IC 1IBMO 3ZHQA 4ZOLB 2P4VA 1ZUQA 3M7MX 2YIBA 1R3LC 1AI7A 4J80A
chains in the Genus database with same CATH topology
2P4KA 4FFKA 4YIOA 4YIPA 1I08A 3BFRA 1IX9A 4F6EA 1VEWA 1LUVA 4E4EA 1AVMA 3LSUA 1GN6A 1QNMA 1EN5A 1I0HA 3KDRA 1GN4A 3OT7A 4JYYA 3DC5A 2CE4A 1XDCA 4GUNA 4C7UA 1D5NA 1MMMA 1ZLZA 1JA8A 1KKCA 3C3TA 1XUQA 2GDSA 1WB7A 3RN4A 1XILA 1PM9A 3CEIA 3K9SA 4JZ2A 4X9QA 1BS3A 1SZXA 1EN4A 2ADQB 1AP6A 1B06A 2QKAA 2RCVA 3C3SA 1EM1A 3EVKA 1XREA 2QKCA 5A9GA 1MA1A 1Y67A 3AK2A 3MDSA 2CDYA 1EN6A 1AR5A 1VARA 1MSDA 1LUWA 4BR6A 5AG2A 1N0NA 1BT8A 1N0JA 3QVNA 3TJTA 1ZSPA 3DC6A 1GN2A 1PL4A 1JR9A 1MNGA 3KKYA 1AR4A 1GN3A 3AK3A 1WB8A 1AP5A 4JZGA 1IXBA 1ZTEA 2ADPA 1IDSA 2AW9A 3AK1A 1BSMA 3IC9A 1ZUQA 1P7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4K A;  4FFK A;  4YIO A;  4YIP A;  1I08 A;  3BFR A;  1IX9 A;  4F6E A;  1VEW A;  1LUV A;  4E4E A;  1AVM A;  3LSU A;  1GN6 A;  1QNM A;  1EN5 A;  1I0H A;  1GN4 A;  3OT7 A;  4JYY A;  3DC5 A;  2CE4 A;  1XDC A;  4GUN A;  4C7U A;  1D5N A;  1MMM A;  1ZLZ A;  1JA8 A;  1KKC A;  3C3T A;  1XUQ A;  2GDS A;  1WB7 A;  3RN4 A;  1XIL A;  1PM9 A;  3CEI A;  3K9S A;  4JZ2 A;  4X9Q A;  1BS3 A;  1SZX A;  1EN4 A;  2ADQ B;  1AP6 A;  1B06 A;  2QKA A;  2RCV A;  3C3S A;  1EM1 A;  3EVK A;  1XRE A;  2QKC A;  5A9G A;  1MA1 A;  1Y67 A;  3AK2 A;  3MDS A;  2CDY A;  1EN6 A;  1AR5 A;  1VAR A;  1MSD A;  1LUW A;  4BR6 A;  5AG2 A;  1N0N A;  1BT8 A;  1N0J A;  3QVN A;  3TJT A;  1ZSP A;  3DC6 A;  1GN2 A;  1PL4 A;  1JR9 A;  1MNG A;  3KKY A;  1AR4 A;  1GN3 A;  3AK3 A;  1WB8 A;  1AP5 A;  4JZG A;  1IXB A;  1ZTE A;  2ADP A;  1IDS A;  2AW9 A;  3AK1 A;  1BSM A;  3IC9 A;  1ZUQ A;  1P7G A; 
#chains in the Genus database with same CATH topology
 1WPX A;  2Q69 A;  4NTY A;  2WLK A;  2EIJ C;  4UFZ A;  4XDL A;  1Z2G A;  4FPP A;  3WG7 C;  3HB3 B;  4AQY B;  2XOK G;  1S0V A;  3L9D A;  3N27 A;  4FFB A;  1U97 A;  2IH1 C;  1NKD A;  4FLX A;  2VQE B;  3TGU H;  4FK5 C;  3BRC A;  2N04 A;  4JI8 O;  3E35 A;  3JAL B;  3T1Y O;  3DXR B;  1A32 A;  2VQF O;  3JD4 A;  2Q0O C;  1BHB A;  1Z5W A;  5GTI Z;  1ZL8 B;  1HR0 B;  4LWS A;  1P49 A;  2EIK C;  5J9P C;  5J2U A;  4JAU A;  1KKD A;  2B1I A;  3CX5 F;  3BCC H;  3SYC A;  1XHZ A;  3B09 A;  3H1J H;  4K0K O;  2HHH O;  1JVM A;  3CCV V;  4DYL A;  4G28 B;  4IHJ B;  4FVM A;  4WFF A;  5KHJ A;  3H1L H;  4PEL A;  3RYH B;  2EIM B;  3EXA A;  4LNU A;  4X66 O;  3QG5 A;  2ODM A;  2XAS A;  2ZE6 A;  1GM7 A;  3RYI B;  5BMV A;  1JOY A;  1IXM A;  1G1X B;  4LFA O;  3CRQ A;  3E83 A;  1DF5 A;  2IW5 A;  1EZJ A;  2YIC A;  3AG3 C;  1G6U A;  2Q73 A;  4B3R O;  4O4I B;  4PDL A;  1YDX A;  2YSU B;  4FLT A;  3ZRW A;  3ZN1 A;  5LMN B;  4O2A B;  1NVP B;  1TUB B;  1V54 C;  5B3S B;  2WA4 A;  3HKC B;  3AK1 A;  1XQ8 A;  3QNE A;  2PTM A;  4YHH O;  2P6J A;  3JAK B;  3CME V;  4RQF A;  2OCC C;  3HR0 A;  4PA3 A;  2DW4 A;  5FPO A;  3PN1 A;  3HKE A;  1VQ5 V;  1K7D A;  1SF9 A;  2DMX A;  1HNX O;  2QM4 A;  2DYR B;  1HNW B;  4I0X A;  1VQL V;  1COW G;  2LGQ A;  4JYA B;  4LFC O;  2KKW A;  4JF3 A;  2BSK A;  2HP8 A;  4LH7 A;  4JI0 B;  4AHC A;  4X64 B;  1M56 C;  3MHH C;  5GTH Z;  3CCL V;  4L87 A;  4MTG A;  1RPR A;  5JQG B;  5LOV B;  1SZT A;  2CK3 G;  4PA9 A;  4F6R B;  1R3K C;  4UV9 A;  1VF6 C;  1KUQ A;  3GWK C;  4JI6 O;  1KP3 A;  1SQB H;  1FAF A;  1VQM V;  1EM1 A;  3RW0 A;  1I7F A;  4DV7 B;  3BVO A;  3OR7 C;  3ABK B;  1FFT B;  5EIB C;  2WLI B;  1NBM G;  5DEC A;  4NXM B;  1HP8 A;  3B8M A;  4GKK B;  2CH7 B;  4TQF A;  4A5U B;  4DW1 A;  4PA6 A;  4RO2 A;  4U3F H;  1VQO V;  3LUT B;  2O57 A;  4CS2 A;  4MW8 A;  3SYP A;  4CS3 A;  3FAV B;  1HWY A;  4BIU A;  4B3M B;  2OYQ A;  4HAM A;  4J7J A;  1NI8 A;  3OD4 A;  1JR9 A;  4DV5 O;  1F4N A;  3P32 A;  2DQ3 A;  1ZL8 A;  1H8E G;  4O4L A;  5JWP A;  1H2G A;  2ZM6 B;  4B3S B;  1IXB A;  3KG2 A;  2DJV A;  2YS8 A;  2ADP A;  1FXV A;  4ZKI A;  2W0X A;  5IJ9 B;  2ZNI A;  4YY3 O;  4UCV A;  1HNZ B;  2DE0 X;  5KUM A;  3BEH A;  3RYH A;  2ITC C;  3E8B A;  1PL0 A;  2QSA A;  1VEW A;  3UT5 A;  4R50 A;  4HNA B;  2QWP B;  1N36 O;  1M5I A;  3K0G A;  1GN6 A;  5LA6 B;  2D2C B;  4DR3 B;  2F4V O;  3ZHU A;  4JI7 O;  4WFA V;  2E76 B;  1GK9 A;  3OEE G;  4LF7 O;  3C3T A;  3JAT B;  5LHG A;  1VQ6 V;  2UUA B;  1WLE A;  3HKD A;  1ARO P;  5CA1 B;  3SPI A;  1H2K A;  1Y76 B;  4OX9 O;  1TUB A;  5IE9 A;  3HKC A;  3FD9 A;  2ITD C;  3JSL A;  3DTU B;  1M93 A;  5L3C A;  4QJF B;  2ZXW B;  3OMI B;  3AG2 C;  1BE3 H;  1NZ6 A;  2PUS A;  3CYO A;  3JD2 A;  4X1Y A;  1SA0 B;  3Q4H B;  3A0H Z;  4B7K A;  1YIT V;  3K5L A;  2UUC O;  5TIS Z;  4MSW C;  3VQV A;  1WNS A;  4MVQ A;  3BAB A;  4PDR A;  3APO A;  1M4U A;  2YXY A;  2YEV B;  1QCE A;  3ZRX A;  5J2T B;  1KD1 W;  4I4T A;  3CXH F;  4DV6 B;  3MHS C;  2JS3 A;  5CB4 B;  1MAB G;  1H2L A;  4QPK A;  2GUZ A;  3SYO A;  2A0L A;  3P3N A;  4PD4 F;  1VF7 A;  5GON B;  3TK1 A;  5KLV H;  2LFS A;  4TV9 B;  3DSQ A;  4TT3 G;  3CC4 V;  5B1B B;  1QVF U;  1R6T A;  3FAV A;  2ZE7 A;  1NQT A;  4DR4 B;  1FS0 G;  1FXK C;  4DR6 O;  1MMM A;  1JA8 A;  1N34 B;  3IAY A;  1Q82 W;  1L0N H;  2JK5 C;  5LYJ A;  1PM9 A;  2UXC O;  3SPG A;  1Q6I A;  5IT9 N;  3CJH B;  1OHH G;  1SQV H;  2Y4T A;  4X20 B;  4DR1 B;  1XMQ O;  4Z1V A;  3P3P A;  3J7A U;  2RDC A;  4E2L A;  1B6Q A;  3E8F A;  3OTO O;  4GX1 A;  4IGG A;  4JAA A;  4KHP B;  2C2A A;  4K35 A;  1XNR B;  4LF5 B;  1W0J G;  4O4H B;  1FYJ A;  5BXZ A;  3F7V C;  2EUL A;  4DUZ B;  3JAT A;  3MAQ A;  5BR8 B;  1BHA A;  1PKX A;  3IJ4 A;  4GKJ O;  3K9A A;  2XHB A;  3RGB A;  4DV2 B;  1AJN A;  3VBB A;  1NJI W;  1Y76 A;  4FIP C;  1QU7 A;  1JQ0 A;  2QEX V;  1AP5 A;  1US6 A;  1M1K W;  2F66 C;  4WFH A;  3T1H O;  1VQP V;  2QM8 A;  5EBM C;  1N32 O;  2MK3 A;  2AGA A;  4FFB B;  4JI3 B;  1SS3 A;  1M57 B;  3CRR A;  1EZV H;  2DOS A;  2ZE8 A;  2P4K A;  1WP8 A;  1H2S B;  5B66 Z;  2ATK C;  2V4D A;  2KG7 A;  1BL8 A;  2MW2 B;  2W0F C;  2IU0 A;  2E75 B;  2PGG A;  2W6J G;  1JCH A;  3CHX A;  4PDV A;  4MVZ A;  1R6N A;  4LWS B;  1SRY A;  5J2U B;  2Q7G A;  3AG1 C;  1QBZ A;  2CUG A;  2W6I G;  2H3O A;  4LF6 O;  4HBN A;  4X9Q A;  2ZD9 A;  2JEX A;  3N2K A;  1BQZ A;  5GON A;  3F5T A;  1SQP H;  3H9V A;  5K1P A;  4LNU B;  2A9H A;  2YC0 A;  1YEW A;  2R70 A;  3TCU A;  1BZK A;  1F23 A;  1XBL A;  1BCC H;  2ZIN A;  4PHZ A;  4JI1 O;  1VF6 A;  5F2V O;  3LDD A;  4J9Z B;  1JJO A;  2Y69 C;  3W7X A;  2ETN A;  4XDK A;  5B1A B;  3ZHT A;  3ASN C;  3JAR A;  1LUW A;  3D3I A;  3ZRW B;  3OE7 G;  1S3J A;  1QHT A;  4I7Z B;  4J9Y B;  3TJT A;  5LP6 C;  3VQW A;  3QO8 A;  1OCC C;  1KEC A;  2HEP A;  2GSM B;  2DQ0 A;  5H6R A;  5KHI A;  3ZED A;  5EC2 C;  1MG1 A;  4D6T H;  3D3Q A;  1GN3 A;  2R9I A;  3VOU A;  2XAF A;  4DV4 O;  3JCU Z;  1K73 W;  1I5Y A;  1P4R A;  5EYP A;  3HKE B;  5KHK A;  3WFV A;  3B4S A;  2DYS B;  5B1O A;  5JCO A;  4I0X B;  4QGP A;  1OCO B;  3CRA A;  1VMG A;  3G71 V;  2PY5 A;  4JI4 B;  3OGC C;  3CE2 A;  2BSK B;  1B3Q A;  1XEQ A;  4CH6 A;  5EZY A;  4E4E A;  1W2B U;  3BHP A;  2GTS A;  4FLZ A;  1VQ9 V;  3ZHV A;  2L6L A;  3E2E A;  1N8R W;  4OXS A;  3ETE A;  1Y6X A;  3KCX A;  2QJ1 A;  3RYF A;  1IBL O;  3GB7 C;  3DC5 A;  1YSC A;  2RMK B;  3SR2 C;  5DED A;  3THO A;  4X89 A;  3ICX A;  4U7O A;  2HHH B;  4TSF G;  5JJJ B;  4UCU A;  1ZX3 A;  1OCZ C;  1L1F A;  3ABL B;  1B06 A;  4J10 A;  4DR2 B;  3CC7 V;  1JPX A;  3GWO A;  1P7B A;  1MOF A;  2GBO A;  2P22 C;  1VP7 A;  3HPL C;  3CCE V;  5KA5 A;  1XHX A;  2Q0A A;  2VS0 A;  4X65 B;  1NTK H;  2M6Y A;  3E22 A;  4O4L B;  4DO2 A;  3BAA A;  3K04 A;  1Y66 A;  5ITZ B;  4LFB O;  1ENV A;  4F4L A;  1NS1 A;  3UO2 A;  1HW7 A;  2K1E A;  4DV1 B;  4JAS A;  1V55 C;  4WFE A;  5IYD O;  2P06 A;  1YTF D;  1PP9 H;  1XNQ B;  1B04 A;  3UT5 B;  3OW2 U;  4NVP A;  4H33 A;  3JYC A;  3OEH G;  4J11 A;  1JNB A;  1P7G A;  2NN4 A;  2DWD C;  1Q81 W;  1EBO A;  5HFL A;  4PA4 A;  4AQY O;  4JV5 B;  4MVR A;  4YIO A;  2WWW A;  2OT5 A;  3W7W A;  3ABM B;  1JJ2 U;  2FKX A;  3HKD B;  4DUY B;  4RWU A;  5KAF Z;  3K57 A;  2JDI G;  3AG4 C;  2JEU A;  1AR1 B;  4H37 A;  4CH3 A;  2IU3 A;  5LBQ A;  4JYY A;  1WN7 A;  2CE4 A;  1OZ0 A;  2EBO A;  4J41 A;  3SJC C;  1E1R G;  2QWN B;  3OGI B;  4BAY A;  4PDM A;  2BOC C;  1H5W A;  5D5Q A;  4X88 A;  1V9P A;  1HR0 O;  3FX7 A;  1SZX A;  1THZ A;  4X1Y B;  1O9H A;  1YXB A;  4DK0 A;  1SES A;  1F4M A;  5E1A C;  2HR3 A;  3B40 A;  4KFM A;  1FKA O;  1UFI A;  3QTC A;  4XBF A;  3D36 C;  4WF9 V;  1SER A;  4PA7 A;  1MA1 A;  1Y67 A;  2R72 A;  3KZI Z;  4DR7 B;  4TWK A;  2WLH A;  2XAJ A;  4I4T B;  1MSW D;  3CC2 V;  1NH2 D;  4LF4 B;  3ZMS A;  3L71 H;  5IY5 B;  2PYL A;  1SC5 B;  4QE9 A;  3CWB H;  4ASU G;  2GUZ B;  1H2N A;  4GX5 A;  4GX2 A;  1GN2 A;  1G4Y B;  2RN9 A;  4ZIB A;  1X59 A;  1K97 A;  2AZ2 A;  1TA8 A;  4LF9 B;  2RNB A;  2Q6A A;  5LMN O;  3RFR A;  2M7W A;  3KCY A;  3EFF K;  4JI5 B;  2QWQ B;  1ZTE A;  3VQY A;  2FML A;  4NTX A;  2EIN C;  2UU9 B;  4ZI7 A;  2EIJ B;  4K8Z A;  2KQX A;  2P5O A;  2HVJ C;  3L74 H;  3WG7 B;  3S3X A;  4UUJ C;  4NXN B;  1IBK B;  2WSS G;  3WB0 A;  3FYI B;  4UCO A;  1I08 A;  1HNW O;  1RP3 B;  1FOU A;  1RM1 C;  5LYJ B;  4FZ0 A;  1Q6U A;  1PV0 A;  1IJG A;  1SQF A;  4JYA O;  2UUB B;  1Q86 W;  1I0H A;  2E5L B;  1N33 B;  5LL6 Y;  4JI0 O;  5E79 Z;  5ITZ A;  2D3O W;  1R1B A;  4X64 O;  2NR5 A;  4FJC C;  1BQ0 A;  2XAQ A;  2GDS A;  4JYC A;  1LNQ A;  2Q5Z A;  2Q8V A;  2EIK B;  1K3E A;  1QLE C;  1JX9 A;  2R9R B;  2BTO A;  3I55 V;  3WU2 Z;  3IFX A;  2Y0I A;  2WLJ A;  1Y4M A;  4GZR B;  4DV7 O;  2GTA A;  3OFN G;  4B7E A;  3ZCC A;  5JVD A;  4NXM O;  4WBN A;  5A9G A;  1RFY A;  4GKK O;  5LHI A;  3BY6 A;  2PI4 A;  2R9A A;  1DGS A;  4FM0 A;  1YF2 A;  1UJW B;  3J81 N;  4J42 A;  4EKW A;  4RAI A;  2RJZ A;  2F43 G;  1E79 G;  1VAR A;  3SPJ A;  1SET A;  4B3M O;  1Q6H A;  1S5L Z;  3AG3 B;  3C90 A;  2WLL A;  3B77 A;  4NB5 A;  2QM7 A;  2LFR A;  3QVN A;  3ZIA G;  2ZT9 B;  2CAZ C;  1IZ3 A;  2ZM6 O;  4B3S O;  1V54 B;  2B5U A;  3JAS B;  1PD3 A;  4DV0 O;  2OCC B;  5CA0 A;  1IDS A;  2KG7 B;  1HNZ O;  2AW9 A;  4DR5 B;  1CXZ B;  5GW7 A;  2CTQ A;  1GO3 F;  4I55 A;  2LW7 A;  3FB6 C;  4DR6 B;  2FB5 A;  5KX5 A;  1KMI Z;  4R6Z A;  2EX3 A;  4F6E A;  4DW0 A;  3E8H A;  2KB1 A;  2UXD B;  3B8N A;  3K58 A;  1QNM A;  3O9O A;  3JD1 A;  1YHQ V;  1M56 B;  1WPB A;  3N2K B;  2UUA O;  1NVP D;  3OUF A;  2F95 B;  4C7U A;  1URF A;  2EIL C;  5EBW C;  5B1N A;  5IJ0 A;  4LR3 A;  4IYI A;  5EC1 C;  2UXB B;  3STL C;  4MS2 A;  1KYO F;  3PJS K;  5KHG A;  4KUM A;  1SQG A;  1VQK V;  3K3W A;  5LGT A;  4MTO A;  1AP6 A;  4I50 A;  3JAR B;  4L8J A;  3M99 B;  1I94 B;  1OCR C;  3TXS A;  4B3T B;  2NLJ C;  4LF8 B;  3UCS C;  2X6B A;  3K5M A;  3EVK A;  1KP2 A;  3ZHS A;  2X7R B;  4HZ3 A;  4MVM A;  2Z5U A;  4OPA A;  4IL6 Z;  2QWO B;  4YXW G;  5L3E A;  3JD3 A;  4DRX A;  3ZRV A;  5EYP B;  4Q20 A;  3OTF A;  3T1H B;  4YJ3 A;  1Y74 B;  3AEI A;  4DV6 O;  2AHZ A;  1XOU A;  4CZZ A;  4ICG A;  1MNG A;  1AR4 A;  3AK3 A;  3FB7 C;  1TUE B;  4MW3 A;  1NU1 H;  2YIA A;  1SKV A;  3L75 H;  4B08 A;  3ETG A;  3T4D A;  3RT3 C;  5EZY B;  1QQC A;  2FYU H;  5LMU B;  3A0R A;  1S77 D;  3ZBH A;  3K03 A;  1X4T A;  1MZF A;  3G6E V;  1GH6 A;  4R8C A;  3A0B Z;  4IIJ A;  3RYF B;  4U3J A;  2IM9 A;  4RUE A;  1OJH A;  1I5X A;  3G6B A;  4JI2 B;  4I9Q A;  3FB8 C;  3ZMZ A;  2HG5 C;  5CN0 A;  3K06 A;  4EFE A;  1WJZ A;  1N34 O;  1GN4 A;  4X1K B;  4YJ2 A;  2A3Q A;  1NTM H;  3L72 H;  1D5N A;  3P30 A;  2A7W A;  4X62 B;  1WB7 A;  3EHB B;  3JAS A;  4DR1 O;  1XIL A;  2P67 A;  1MZE A;  4X8A A;  4Z2W A;  1YTF B;  1N4C A;  4CS4 A;  1DK1 A;  2CGO A;  5EK0 A;  3ZHR A;  2PZS A;  2IJJ A;  1K9M W;  1GKF A;  1SQX H;  4X1I A;  2V7Q G;  3AG2 B;  5BZB A;  1VF5 B;  5LGN A;  3SJB C;  2OTL V;  2QKA A;  3QF7 A;  2OIG A;  3E22 B;  1YIJ V;  4JTD B;  4UCT A;  2H8P C;  5IWA B;  2JS5 A;  2Z3Y A;  1XNR O;  1M9N A;  4LF5 O;  3JCZ A;  2GV9 A;  4UCR A;  3CS5 A;  2G38 A;  1JFF A;  4DUZ O;  1O9G A;  2EZO A;  2X0L A;  5BR8 O;  4DV4 B;  4BR6 A;  1YJ9 V;  3SPC A;  1L0L H;  1N0N A;  1FJG B;  3ZX6 A;  2HJF C;  4DV2 O;  1J5E B;  1W59 A;  4DV3 B;  2HKO A;  2EIM C;  1S72 V;  2ZKO A;  5DM6 V;  4O2B A;  2JIZ G;  1FFX B;  2IH3 C;  5FL7 G;  1HDJ A;  4J7K A;  5D5P A;  4NYK A;  2XAG A;  1UPG A;  2OTJ V;  1GM8 A;  2XAH A;  4JI3 O;  4UVC A;  4N23 A;  1KB9 F;  1M90 W;  1CEZ A;  3SJQ C;  1IBM B;  1XMO O;  2GHY A;  2JGU A;  4FLY A;  1FD9 A;  1IBL B;  2KSD A;  5B3S C;  2VWJ A;  4EB6 A;  4FFK A;  4O4J B;  1IX9 A;  1OCR B;  1FXK B;  5CBG A;  3LDC A;  1YCI A;  3OM3 B;  4CH5 A;  4JTA B;  2AHY A;  4MT8 A;  2ZDI C;  1Y74 A;  5H2F Z;  2PI5 A;  1XL6 A;  5KA6 A;  2DYR C;  3QO7 A;  1ZLZ A;  1XUQ A;  1S5H C;  1L8D A;  1QLN A;  2IJI A;  3IGA C;  3QO5 A;  3UO3 A;  4JI8 B;  1WAZ A;  2CTR A;  3T1Y B;  2ADQ B;  2VQF B;  3JAM N;  1K4D C;  2ZQM A;  4MTX A;  2PF4 E;  3C3S A;  3SYQ A;  2CTW A;  2LGW A;  3TET A;  2YXL A;  2AXT Z;  5H6Q A;  4MVO A;  2ILM A;  2WAM A;  1CP9 A;  1Z5V A;  2FL4 A;  1P84 F;  4LFB B;  5IYZ B;  3K5O A;  3W7T A;  4K0K B;  1AI4 A;  3D8C A;  1QR8 A;  1WA8 A;  1GTO A;  4X1K A;  3ABK C;  3FYE B;  2LJ2 A;  5IDJ A;  5L3G A;  3RYC B;  2Q67 A;  4JAV A;  3CCR V;  4X66 B;  4UV8 A;  4ZI7 B;  3CMA V;  5KHH A;  1D5A A;  2LQT A;  1K5Q A;  5KAI Z;  4K3A A;  1AI5 A;  3CCM V;  4EFB A;  2P7T C;  2L35 A;  4LFA B;  3N2G A;  5IYC O;  4UXN A;  2NNU A;  3K0D A;  4D7S A;  5JJE B;  1KQS U;  1K8A W;  1LR1 A;  4B3R B;  5JH7 A;  1YI2 V;  2Q7H A;  4CC6 A;  4JI4 O;  5DN6 G;  1J95 A;  4BW9 A;  4NTW A;  2JVD A;  1QVG U;  2JGD A;  2ZNJ A;  3FB5 C;  4YHH B;  3T1C A;  5FLX N;  5IYB O;  3IC7 A;  4YIP A;  1FPO A;  5KMG A;  5FPR A;  1R73 A;  3OMN B;  2YIB D;  3UQ8 A;  1YJW V;  4UVB A;  2JJ2 G;  3AG1 B;  1NTZ H;  4LP8 A;  3T2M A;  1HNX B;  2AZ0 A;  2V1D A;  3I5D A;  3CCS V;  2WA3 A;  2X6A A;  4TV8 A;  1T5E A;  1FFX A;  4LCU C;  1NT2 B;  4LFC B;  3RVY A;  3RN4 A;  4CBC A;  3CB2 A;  5JVD B;  5BY1 A;  4W4L A;  4BWA A;  4WBN B;  2N74 A;  4MTF A;  4JYB A;  3K5N A;  2BTQ A;  4OPH A;  2VQE O;  2H94 A;  1W0K G;  4DR2 O;  1PPJ H;  1DLB A;  4G27 B;  4FLW A;  2Y69 B;  3SPH A;  1VQ4 V;  2Q9L A;  2UXX A;  2OIE A;  2WLL B;  3H1H H;  3ASN B;  4JI6 B;  4O4J A;  1RSO B;  2QKC A;  4X65 O;  3JSN A;  1FXK A;  2DWE C;  3ABT A;  4TUY A;  3ML0 A;  2IJH A;  2Q7E A;  2ZXW C;  3H01 A;  4G2K A;  4WFG A;  5LP6 B;  1TVK A;  1MSD A;  1OCC B;  3NXS A;  5LXT A;  2BOB C;  1YZB A;  5CA0 B;  2ZCE A;  2RQ6 A;  3CRC A;  4DV1 O;  4UVA A;  2VWK A;  4NKG B;  1K4C C;  2EJR A;  4I55 B;  2YUA A;  3SDL A;  1XNQ O;  4DV5 B;  5KX5 B;  1BMF G;  4JZG A;  2JJ1 G;  5L3D A;  2QA4 V;  5C93 A;  4AIL C;  1Q90 D;  3ETQ A;  4JV5 O;  3A8T A;  2XT9 A;  5IYZ A;  2OCH A;  4YY3 B;  1S5J A;  4DUY O;  2F23 A;  3L70 H;  5IJ0 B;  4JTC B;  4RQE A;  3E8G A;  1AVM A;  1F51 A;  4H13 B;  4ZOL A;  1ZAU A;  2ZIO A;  5KUK A;  3LNM B;  1EN5 A;  3RYC A;  4H44 B;  1N36 B;  4P30 A;  1GMG A;  5B1B C;  3RWR D;  4I50 B;  4K8X A;  3R65 A;  3ZMV A;  1OCZ B;  3CSX A;  3CXC U;  4KL1 A;  2F4V B;  4JI7 B;  3B2E E;  3U11 A;  1NR7 A;  4LF7 B;  4CC5 A;  3T4Z A;  3K9S A;  4JZ2 A;  3WB1 A;  4QIW F;  3A2F A;  1NR1 A;  3I56 V;  1EN4 A;  3ETD A;  3ZN0 A;  3GVM A;  1KU9 A;  4WCE V;  1XI1 A;  3W7U A;  4OX9 B;  5HFM A;  4DRX B;  3JAL A;  4N21 A;  3DXR A;  5CA3 A;  4DR7 O;  4YJ3 B;  3F5W C;  1ZWI C;  2B1G A;  4LF4 O;  1XL4 A;  3MDS A;  2YXH A;  4J7Z A;  4D7T A;  3X2Q C;  3OMA B;  1AR5 A;  5JCO C;  3HKB B;  4GX0 A;  2F93 B;  4FM1 A;  1KBH A;  2QDO A;  3U0Z A;  2E3C A;  4DV0 B;  3E89 A;  3J80 N;  1YJN V;  1N0J A;  3LSS A;  1V55 B;  2UUC B;  5EBL C;  1G8M A;  1AIL A;  3JAW B;  4LF9 O;  3OUS A;  1AB3 A;  1RPO A;  3K79 A;  4IHJ A;  4JI5 O;  1Q43 A;  4IIJ B;  4ZBM A;  4U3J B;  5CMU A;  5FNV B;  4IT5 A;  2UU9 O;  1SQQ H;  3U10 A;  1PNL A;  5CBF A;  2E74 B;  3RYI A;  1TGO A;  4NXN O;  3TXQ A;  1IBK O;  3F7Y C;  1BSM A;  1AJQ A;  3G4S V;  3H1K H;  1RSO A;  3SGI A;  3E86 A;  4P9P A;  4R7C A;  1QR9 A;  1D2D A;  4YJ2 B;  4O4I A;  3ZRS A;  2OWO A;  2YI8 A;  3M8A A;  3AG4 B;  2Y4U A;  2XUM A;  5LP6 A;  2UUB O;  1M57 C;  4O2A A;  1LUV A;  1VQN V;  4Z1M G;  2E5L O;  1DTO A;  1N33 O;  4GT1 A;  1Q3E A;  1AI6 A;  2QWR B;  1FXH A;  3CD6 V;  4I5S A;  1PNK A;  3JAK A;  4X1I B;  1U96 A;  2F1M A;  5L3B A;  3OT7 A;  1XDC A;  2ZDI A;  5L3F A;  4GYC B;  2DN9 A;  1TAE A;  3RVZ A;  4HYO A;  3CEI A;  4Q6G A;  4UB8 Z;  2EJ7 A;  3BPZ A;  4LBE C;  2UXC B;  4DR3 O;  4U7N A;  1JFF B;  2N05 A;  1XMQ B;  2RCV A;  3NR7 A;  3ZS8 C;  3R66 A;  3ASO C;  2A79 B;  4CH4 A;  1VQ7 V;  3OTO B;  2HLD G;  4WFB V;  5JQG A;  5LOV A;  2QR4 A;  2CDY A;  4O2B B;  4PI2 A;  4PI0 A;  1K92 A;  3RBZ A;  4F6R A;  1ORQ C;  2WPD G;  2QGN A;  2LO1 A;  3G80 A;  4ABM A;  1E1Q G;  3W7S A;  2B9Z A;  2WLN A;  4FLV A;  4P2Z A;  3WB2 A;  5B1A C;  3DC6 A;  1PL4 A;  2WLI A;  3H1I H;  1H38 A;  2EIN B;  3AG7 A;  1VQ8 V;  2CH7 A;  4GKJ B;  4FM2 A;  1VIB A;  4PV1 B;  4W4K A;  2CTP A;  4EB6 B;  4QNH B;  1H8H G;  4BW5 A;  1S76 D;  1WP7 A;  3BA8 A;  4KXR A;  4MVU A;  4QPJ A;  4DR5 O;  2P90 A;  2EZP A;  3DGE A;  2QKS A;  2ARH A;  2QTS A;  1RM1 B;  3OR6 C;  1N32 B;  3CPW U;  2BCC H;  2DYS C;  3SJA C;  2UXD O;  3UM7 A;  3HKB A;  3BFR A;  1OCO C;  3CCU V;  3LSU A;  3UKM A;  2ZR2 A;  5IJ9 A;  3KDR A;  1IVS A;  4ZHQ B;  1GAX A;  3X2Q B;  3JAW A;  4RUF A;  2UXB O;  3CCJ V;  1QLE B;  4GUN A;  5C8Y B;  3BA9 A;  2WLM A;  3STZ C;  3APQ A;  4FLU A;  2JRI A;  4HNA A;  2Y0P A;  1KC8 W;  5FNV A;  2VRZ A;  1CPY A;  2A06 H;  4I9W A;  2HVK C;  2Q4P A;  5LA6 A;  4LF6 B;  4DR4 O;  1I94 O;  3LDE A;  5H5N A;  4B3T O;  4LF8 O;  1WA8 B;  4GLX A;  3SYA A;  4MVS A;  3VQX A;  3JD0 A;  4LC1 A;  5CA1 A;  4NR1 A;  1XRE A;  3ABL C;  3FFQ A;  3AK2 A;  4TOI A;  5LHH A;  5LGU A;  4JI1 B;  2LW1 A;  1EN6 A;  2Y48 A;  3N2G B;  4BIZ A;  2XTA A;  1DF4 A;  2PYJ A;  2ZR3 A;  2QTO A;  4PJ0 Z;  3CP1 A;  1EFR G;  3ZMT A;  2XND G;  2QE7 G;  1ROP A;  3K59 A;  4JGS A;  5JH7 B;  2HFE C;  1R6K A;  3ABU A;  4KHP O;  2ZE5 A;  4JPR A;  1Q5O A;  1SA0 A;  3Q4H A;  1XMO B;  2JGD B;  3D36 A;  2IJK A;  5LMU O;  1AJP A;  3K08 A;  5KMG B;  1OV9 A;  4H0L B;  3MD0 A;  1Q8I A;  3IC9 A;  4OGQ B;  2YEV A;  5J2T A;  1Q7Y W;  4P9O A;  4QE7 A;  5A2Q N;  4KP4 A;  4TV8 B;  4JI2 O;  1GM9 A;  5H9C A;  3CCQ V;  3LSQ A;  1H2M A;  5CB4 A;  2YI9 A;  3O65 A;  3OAA G;  3ASO B;  2Q68 A;  4UCS A;  2EIL B;  2YDE A;  4XDJ A;  4GCZ A;  2BTQ B;  4TQD A;  2X6C A;  4X62 O;  1K33 A;  3ABM C;  4TV9 A;  1KKC A;  4AI8 A;  3FKS G;  2Z0A A;  5BMV B;  2CGN A;  4IYH A;  4FMT A;  3S3W A;  1NH2 B;  2LP7 A;  1BS3 A;  1GRJ A;  2K9P A;  4TUY B;  5CBH A;  2HJD A;  1TVK B;  5IWA O;  5LXT B;  2YID A;  3ZMU A;  1K5S A;  4DK1 A;  5JJN B;  4DXW A;  3CJH A;  1IUR A;  4X20 A;  3L73 H;  1K34 A;  1JMK C;  1F7Y A;  4BIO A;  2FTK A;  2ZIM A;  4ZHQ A;  1BGY H;  1FJG O;  1J5E O;  2UXN A;  4DV3 O;  5AG2 A;  4UB6 Z;  5C8Y A;  1YVW A;  1BT8 A;  2IBZ H;  3LNN A;  3G67 A;  3ZJZ A;  5EIB D;  1ZSP A;  5IY5 C;  1R3J C;  3KKY A;  5K1X A;  4FZ1 A;  5B5E Z;  2BE3 A;  4LH6 A;  1WB8 A;  4EEQ A;  4O4H A;  1PNM A;  3CRM A;  1R3I C;  1IBM O;  3ZHQ A;  4ZOL B;  2P4V A;  1ZUQ A;  3M7M X;  2YIB A;  1R3L C;  1AI7 A;  4J80 A; 
#chains in the Genus database with same CATH homology
 2P4K A;  4FFK A;  4YIO A;  4YIP A;  1I08 A;  3BFR A;  1IX9 A;  4F6E A;  1VEW A;  1LUV A;  4E4E A;  1AVM A;  3LSU A;  1GN6 A;  1QNM A;  1EN5 A;  1I0H A;  3KDR A;  1GN4 A;  3OT7 A;  4JYY A;  3DC5 A;  2CE4 A;  1XDC A;  4GUN A;  4C7U A;  1D5N A;  1MMM A;  1ZLZ A;  1JA8 A;  1KKC A;  3C3T A;  1XUQ A;  2GDS A;  1WB7 A;  3RN4 A;  1XIL A;  1PM9 A;  3CEI A;  3K9S A;  4JZ2 A;  4X9Q A;  1BS3 A;  1SZX A;  1EN4 A;  2ADQ B;  1AP6 A;  1B06 A;  2QKA A;  2RCV A;  3C3S A;  1EM1 A;  3EVK A;  1XRE A;  2QKC A;  5A9G A;  1MA1 A;  1Y67 A;  3AK2 A;  3MDS A;  2CDY A;  1EN6 A;  1AR5 A;  1VAR A;  1MSD A;  1LUW A;  4BR6 A;  5AG2 A;  1N0N A;  1BT8 A;  1N0J A;  3QVN A;  3TJT A;  1ZSP A;  3DC6 A;  1GN2 A;  1PL4 A;  1JR9 A;  1MNG A;  3KKY A;  1AR4 A;  1GN3 A;  3AK3 A;  1WB8 A;  1AP5 A;  4JZG A;  1IXB A;  1ZTE A;  2ADP A;  1IDS A;  2AW9 A;  3AK1 A;  1BSM A;  3IC9 A;  1ZUQ A;  1P7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...