1XRMA

Crystal structure of active site f1-mutant e213q soaked with peptide ala-phe
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNQFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 106
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrmA00
5C7YA 4O08A 5EHXA 3E3AA 2WG1A 1EINA 1KU6A 2I03A 4IH1A 1W4LA 3L1HA 1H2YA 1ZD3A 1R88A 4UBLA 4WY5A 2PSHA 2PM8A 4M0MA 3BF7A 1WOMA 3WJ1A 3A2LA 4KE6A 5HK8A 4BVJA 3TEJA 2HU5A 5JARA 3FLAA 4HRYA 3NGMA 5AI5A 3IUQA 3LIIA 7YASA 3UMJA 5DNWA 3ZWQA 3HJUA 3M81A 1AUOA 5AKKA 1W75A 2PSDA 4QDTA 3BE8A 4BVKA 3HEAA 5HF5A 1Y7IA 3V48A 2QXUA 4QWWA 3D2CA 4BCBA 1ZICA 2JGMA 3D7RA 4QDOA 4S0XA 1DINA 2XMSA 1VE7A 5ALGA 5ALIA 4W9RA 5DNVA 1ORVA 1SCQA 3PUIA 3WK5A 3NOXA 3STVA 3BIXA 2WUDA 2J3QA 4FOLA 1XZDA 4BTLA 2JGEA 1ZGCA 5AHXA 1GXSA 2WHQA 1TCCA 3FYUA 4DNOA 5FXMA 3KWFA 1MN6A 3W9BA 4HAIA 2VJBA 3HRHA 3V1NA 1R1DA 3W04A 1EDEA 5E2IA 1K8QA 3C8HA 4GXNA 3STXA 5DJ5A 3VXKA 1UZAA 5CXUA 4KYVA 2WFZA 4N5HX 2JEYA 4AO6A 5T4EA 2XUQA 5ALUA 1XZMA 2HM7A 4AMYA 1IMJA 4UHEA 2X5XA 3O95A 4DLNA 3A6ZA 3KDAA 3QYJA 3H18A 1YB7A 5EFZA 1W76A 1MNAA 3WA7A 4I19A 5FP0A 5KBYA 4MQLA 1UOOA 2OAEA 3IVMA 1JU4A 2HA2A 3SWWA 2BGRA 1YASA 4AN0A 4KEAA 4G8CA 2DSNA 1UWCA 2EDCA 2HA6A 5CT4A 1N8SA 4EY4A 4WCVA 5AO9A 4Y2VA 5LZ9A 1XROA 1EXWA 4CG3A 2BJHA 3C8DA 2V96A 3WZLA 3I1YA 5IVIA 4A16A 2C0QA 1JMKC 3WYNA 4Q34A 4P93A 5CH3A 4PNZA 1H22A 5ALLA 2WILA 3QH4A 5AKHA 5CXXA 1MAAA 4B7ZA 1A7UA 3R40A 1C4XA 1XZLA 3I6MA 5C81A 1GKKA 3DJYA 4PV7A 5ALTA 3AUKA 1SFRA 4I4CA 2XUOA 4X92A 2YXPX 5C8ZA 3F96A 4OU4A 1XRPA 3D2AA 1XKLA 5EIAA 6YASA 4G8DA 5F4ZA 5ALHA 1WPRA 4MWSA 1VXRA 4M0EA 1F6WA 2OCIA 2VA9A 2WU4A 3KXPA 3WKDA 2PPLA 2VT6A 4KAFA 4OCZA 2OCLA 4WFIA 1XZBA 1CUUA 5HKBA 5EIEA 2P8SA 2PUJA 5K5EA 1QO7A 4WDRA 2BKLA 1I6WA 1VLQA 5CW2A 3C6ZA 5LLSA 3OG9A 4H7FA 2QOEA 3O4IA 5AKEA 3FAKA 3G0GA 4EB0A 4BAZA 4F0JA 1WHSA 2G5TA 4HXFB 1R4ZA 3K9BA 3A2NA 5CMLA 1CUVA 4OB8A 5DYTA 4HXGA 1EVQA 2XUGA 3G8YA 2VATA 1F0NA 3NUZA 4XJVA 2WU3A 3WWDA 5JIBA 1JFRA 5FLKA 3V1KA 1XLUA 3GZJA 4AN1A 1WB4A 3O4GA 3W05A 3SC2A 1K5PA 3IUNA 1YS1X 4TVKA 3DOIA 3R3XA 5JYCA 2WKWA 2HA7A 5FRDA 5JZBA 3H17A 1CUXA 1E3QA 3F8SA 1CR6A 4H7JA 3HZOA 4BATA 3T52A 4EY7A 1CUJA 2WIFA 1VOTA 4IO0A 3F67A 4H7KA 2WHRA 1OILA 4CG2A 4KE9A 4B81A 2B61A 4I3FA 4J0GA 2HU8A 2HDWA 3R3ZA 4LYDA 1XRNA 5ALYA 1HLGA 5ALOA 3CCBA 1ZJ5A 4U2DA 3WLAA 2QKYA 5AI6A 5AK4A 1DWPA 1BEZA 3QMMA 2CMFA 2QJWA 2O7VA 1QIKA 1G42A 2V98A 4HTAA 4Y2YA 4NZZA 1BN7A 4J0CA 3K6KA 1XQYA 3VJKA 4Y2QA 1VA4A 4FFVA 1JI3A 2VSQA 3H2IA 3C43A 4LXGA 2W6CX 3TJMA 1OCEA 2Z5GA 3C87A 4G4IA 3G0BA 3HSSA 2HRRA 4Y7DA 2XMRA 3M83A 4H7HA 5AI0A 4AMZA 3VVLA 1L7QA 4BE4A 2G4LA 3DDUA 3ANTA 2Y2UA 4GBGA 4X6YA 1ORWA 1XZKA 3E1GA 1FSSA 3BF8A 1MT3A 3PI6A 2JF0A 1QIMA 5K3FB 1X2EA 1UFOA 1A8UA 3W9UA 4OYLA 1O6FA 3EQ8A 3MUOA 4J3JA 4ZRDA 1TRHA 5HF8A 4G4GA 4GLBA 4H18A 5JASA 3L1JA 3DEAA 4BDTA 1JMYA 2BCEA 4FBLA 4IHAA 1NU8A 4Z49A 3F98A 1ZD2P 2XMZA 4Y2RA 4X6UA 2OXEA 1PV1A 3CN7A 4AQDA 4AB1A 2H1IA 4MYDA 5AOAA 5KWJA 3PF9A 3KWJA 2WSLA 3ZLVA 1CEXA 4C87A 5IH7A 1CUWA 1IUNA 4BRZA 1SOMA 2NW6A 2GBCA 2FX5A 3FVTA 2XUKA 2VT7A 5C8VA 5FV4A 1VXOA 5K3CA 1SC9A 4KE8A 3WK4A 4ARAA 3BL8A 4KAAA 3OC0A 3DLTA 1CUZA 4N8EA 2PVSA 3WKCA 3W2TA 3BJRA 2LIPA 5HKAA 4Y9SA 2Q0XA 2Z8ZA 4KR0A 1SCIA 2JIDA 1ODTC 3LIPA 3FSGA 1UOQA 4AO7A 4OU5A 1TIBA 1UK9A 4KE7A 5AP9A 3AINA 3ESDA 1DX4A 2V97A 2RONA 3I2JA 4L72A 2R11A 4BZWA 3OURA 2DFPA 1QIDA 2HL6A 1GQRA 4L9AA 1LPSA 1N5RA 4Y2SA 3D4LA 2CKMA 3LP5A 1E8MA 5E4YA 2XUHA 2Y2VA 1J07A 4J7AA 3G7NA 2WIGA 2HA3A 1ZGBA 4FKBA 4UFNA 4QLAA 5LKRA 4ZWNA 2IITA 1ACLA 2WUEA 1Q0RA 4PF1A 1G66A 2J3DA 5I9IA 3AIOA 4MEAA 1MNQA 1FFEA 3GUUA 2BFNA 4YK7A 5HQ3A 1MX5A 1EB8A 4D9JA 4IQ4A 5ALRA 1EB9A 3QPCA 1MTZA 3KD2A 3WK7A 4FBMA 5IKXA 1P0QA 1GQSA 4A5SA 4HRXA 4UBNA 1AZWA 1VE6A 1QGED 5FUMA 5ALZA 5HK9A 4AZ3A 5AM4A 1TKRA 2AJCA 3ESBA 5AKJA 5BOVA 2WLSA 3CN9A 4OPMA 4DTCA 4DSAA 5ALMA 4CG1A 2RHWA 1XZGA 4BRSA 5ALPA 2XQFA 3FVRA 1RWQA 1F0PA 1CUSA 1EH5A 4PQEA 4K6GA 4QNNA 5YASA 5AKYA 5FDFA 5D3KA 5ALVA 2IIVA 1XZCA 3DOHA 4ZV9A 3D2BA 4DIUA 5K3BA 2ECFA 2FUKA 3PF8A 5EI5A 1J06A 2GZSA 1BEEA 1A8QA 4NS4A 4UHFA 1GZ7A 4RE6A 3SX4A 3WK9A 3STTA 4NVRA 1Z68A 2DCMA 2VEOA 2AJLI 5AKZA 1DWQA 3RM3A 5AK5A 1Q83A 3WIOA 4P9NA 1AURA 1AC5A 5ALEA 2B4KA 3R3YA 4UBOA 4JNCA 3A70A 5AIBA 1TAHA 4WFJA 2H9YA 5AM1A 1TCBA 1WCYA 1W52X 2QT9A 5ALQA 3STWA 5K3EA 3FLEA 2GYWA 3WKAA 1C7JA 5A71A 3IUJA 5EGNA 1UK7A 4PO3X 1MJ5A 4K6HA 3I6YA 2WIDA 3QBJA 1YAJA 1BCSA 1QIFA 1UOPA 2O2IA 4QDZA 3RARA 3I1IA 3VKFA 4KRXA 3GA7A 3VDXA 1LLFA 1XKTA 1GPKA 5JADA 4OB7A 2V9ZA 2HRQA 1UT6A 5KWIA 1JJIA 3HYSA 3WL5A 5FPQA 2Z3WA 3VJLA 3IBTA 2OCKA 1BE0A 3IDAA 2IX9A 1H2XA 1QOZA 1DTEA 1GPLA 2XMCA 3CCCA 1T4MA 5IVHA 1BS9A 2ORYA 2OGZA 4DGQA 1QIEA 3H2GA 3DL7A 4W63A 1ZD5A 4EBBA 2XUAA 4IH4A 1JT2A 4BCCA 2XMDA 2Z3ZA 1QIGA 3C70A 4KJXA 2W22A 5BWCA 3LLCA 1ZI6A 4F5ZA 4YASA 1X2BA 4Y2JA 4C6HA 4BZZA 5JD6A 2XDWA 4U2BA 3G9XA 4MEBA 3FYTA 4FFWA 4MYSA 1XLVA 1XQXA 4E11A 1F8UA 4X94A 2OPHA 3KSRA 3QMVA 1XQWA 2CEKA 5HFNA 2VTVA 4QWMA 1CUGA 2J4FA 4BAGA 4U2FA 4ETWA 3IURA 4PSCA 3WL8A 1AGYA 5AK6A 3I2KA 1JJFA 5ISMA 4BCDA 4XVCA 1CQWA 3AIKA 5AM5A 4ZGBA 4X93A 4FLFA 2B20A 3AZQA 4Q3LA 3G0IA 3D59A 3D3NA 4Q1VA 3IB3A 2RIPA 2XMGA 2ZJ6A 1HQDA 1LPOA 4UPDA 5AKLA 1EA5A 4C88A 5LYYA 4DYHA 3STUA 4A23A 2JGJA 3ZI7A 1GPNA 3FOBA 5CT6A 3U0VA 1FFCA 5AM0A 1CUYA 4EY5A 2G63A 3B12A 1EK2A 4N5IX 4DMKA 4B85A 1UKCA 5LIPA 4G4JA 3EQ9A 1IUPA 2WTMA 4HS9A 1DX6A 1ACJA 2OG1A 4JEIA 4F21A 5IVKA 3V1LA 5HF6A 2HFKA 4M0FA 2HHAA 3H0CA 1EHYA 5A6VA 4INZA 1HBJA 3ILSA 4XX1A 1OXMA 2C58A 5K3FA 1R9MA 5K3AA 4X90A 3DD5A 3H1BA 3WA6A 1XQVA 4DMCA 1FJ2A 3KOOA 4ZV7A 1CUBA 4FLEA 3M3DA 3TRDA 2DQZA 5K3DA 1QIJA 4N8SA 5EHQA 5SYMA 5A7HA 4EA6A 3ZLUA 2XB6A 4E46A 2I3ZA 3I2FA 1IVYA 5CTAA 1UKBA 1THTA 3L1IA 2XI4A 3E0XA 4CI9A 4WDQA 1AQLA 2GYVA 3GFFA 2CZQA 1HDEA 1K4YA 2H7YA 3H2JA 5CT5A 5LKAA 1J1IA 1CUHA 3DS8A 4MWTA 1EX9A 5E4JA 4LKOA 4B6GA 1EVEA 3C6YA 4UBJA 3EBLA 1NU6A 3OM8A 3MUNA 1LPAB 1QJ4A 2VAVA 1LPNA 2I3DA 2WUGA 2ONCA 4Q3KA 5DYYA 1U65A 1Y37A 3DYIA 4WFKA 3BXPA 3WKBA 1LBSA 3PDCA 1BCRA 5LZ8A 3WWCA 2QS9A 2WTNA 4K2AA 4CCYA 4UHCA 4BVLA 3I2GA 4EHBA 3BDIA 1UKAA 5ALJA 4FNMA 4V2IA 1MPXA 3FBWA 4GI1A 1ZI8A 1LNSA 4QZVA 4B82A 2H7XA 1CUIA 5LZ2A 4Y2TA 2CB9A 4CIBA 1YAHA 3VISA 4DMHA 3C45A 5LZ4A 1D07A 4FTWA 1DT3A 4J0HA 4GDMA 2ZYHA 3WMRA 4E15A 2J4CA 4B0PA 1GGVA 1UK6A 2DHCA 3O9VA 2PSFA 3D0KA 3P2MA 3NWOA 3ESCA 3C6BA 4PW0A 4UFPA 5LP1A 2ZJFA 1WB6A 1HKHA 4N8DA 3FLBA 4AXBA 4J0JA 3H04A 2C5GA 4GHWA 5JALA 4ROTA 4U2GA 1W6RA 2AJBA 3DQZA 5AOCA 1VKHA 1QIHA 4Y2UA 2JGIA 1HPLA 3FYUB 3D5EA 1VZ2A 1ODSA 4G5XA 2CUTA 5HF9A 2RI6A 1CV2A 1E8NA 5DTJA 4ZXFA 3DNMA 4CFSA 3MGAA 2OQIA 1LZKA 5JANA 2C5FA 3CXUA 2OGTA 2WUFA 4UBKA 2XMBA 3R3WA 1TQHA 1BRTA 1Y7HA 3ED1A 1RYYA 2H7CA 4P08A 3GELA 4QLOA 2RAUA 1ZOIA 5EIHA 3FCYA 3IA2A 5EHNA 2Y6VA 4FLMA 2ZSIA 1T2NA 3ANSA 3K2IA 5CT8A 4IH9A 2UZ0A 1R50A 4DM7A 4FWBA 5IVDA 1CRLA 2YASA 3QVMA 2Y6UA 5KREA 3QZUA 2FJ0A 4QEKA 4RNCA 2XE4A 2HA0A 1H2ZA 3QMWA 5ALWA 1O6GA 2XMQA 2O2GA 1QLWA 5BWBA 3FYUC 4X95A 3PUHA 2ZSHA 5JD4A 1M33A 3H2HA 2X8BA 5AJHA 1XZFA 2OGSA 3DCNA 4UUQA 1WPXA 5AIAA 3MVEA 4JYMA 5C8XA 3OOSA 2EEPA 2HIHA 2OAGA 4GW3A 3WYDA 1LPMA 5DWDA 1EK1A 4QDXA 1CUCA 2JGFA 4BC1A 1W1IA 2WJ6A 1QTRA 2HADA 3GBSA 3HACA 1QFMA 1YCDA 2D5LA 2QJRA 2ACEA 3H1AA 3QPAA 2WHPA 2JEZA 4H7DA 4B0OA 2O7RA 1HL7A 5DLPA 3GROA 2ZYSA 4TGLA 4H0CA 3RKSA 3HXKA 4BYMA 2RHTA 3VVMA 4XWGA 1TCAA 1XRRA 4H77A 1Q84A 2WFMA 1QIIA 1A8SA 4BC0A 5AICA 1JKMA 4LHEA 2PL5A 5CRIA 4BB0A 4RGYA 1DQYA 1J2EA 3WK6A 3AZPA 2WIJA 3WL6A 4Q05A 2QUAA 4Y2XA 5ALKA 4BBZA 4J0DA 4ITVA 2WM2A 4DNPA 5H3HA 4J03A 4U2EA 4G8BA 5HZGA 4YPVA 5JZSA 1U8EA 2BUAA 4P92A 3SK0A 4AO8A 4Y2PA 1U2EA 3WZMA 1EDDA 2O2HA 3R3VA 2XT0A 3O0DA 5AKIA 4DMFA 2DHDA 2XUDA 5HCUA 4WJLA 4WY8A 2ZVDA 3ICWA 1CUFA 5LZ7A 2R8BA 3WWOA 4L3WA 1CIJA 3W06A 3I2HA 4HVTA 5DTIA 5EHZA 4HZGA 2ZYIA 3WWPA 4H7EA 1RP1A 3C5VA 4KAJA 5D7BA 3UUEA 1P0MA 3ICVA 5AH0A 4HXEB 1VA5A 2PBLA 5CT9A 4C4ZA 4LYEA 2PSJA 3QM1A 2BAGA 5AKXA 3RK4A 5AI9A 3QITA 2QTBA 3IIIA 4JYPA 1DU4A 5FPPA 3LCRA 4FDMA 5J3JA 2XQJA 2XUPA 4Q3OA 4BAUA 3A2MA 1XFDA 4UHHA 3DL4A 4NMWA 2PUHA 3IUMA 3H19A 1MX1A 2WHPB 2GBFA 1ZIXA 2HA5A 5AK3A 4RE5A 1E89A 5DYWA 1WB5A 3T4UA 2ROQA 5I8PA 1PJAA 2K2QB 2WFLA 2GBIA 2WIKA 4B84A 5JAOA 5A7GA 1LPBB 1MU0A 2AXEA 3AILA 1MAHA 5AI4A 5A62A 4BDSA 1QONA 3F9CA 1FFDA 3HI4A 4GECA 3EIOA 5CH5A 3ZPXA 4C4YA 4C89A 3WWEA 1G4HA 1XZIA 4W1QA 1MO2A 4W1PA 3HLKA 4XIIA 4CCYB 3BWXA 5AM2A 1KU0A 3G02A 3QPDA 5T4BA 2QRUA 1XRLA 2GBGA 2BGNA 4JUIA 4QE3A 1WHTA 5AM3A 2EDAA 5JAHA 1VJ5A 1U4NA 4BE9A 4H35A 1IZ8A 2XQGA 1USWA 1CPYA 3G0DA 2Z8XA 1CQZA 2XQKA 1FFBA 4DNQA 2XUFA 1ETHA 4OYYA 2JGLA 2OQVA 1DQZA 1X70A 1B6GA 3ZV7A 3PFBA 5FOQA 1H2WA 1ISPA 1FFAA 3DYVA 2VAXA 1LBTA 2QZPA 4AX4A 4ZI5A 3ESAA 3V1MA 1DWOA 5ALSA 1B41A 1DT5A 3H2KA 5JATA 2C0PA 4BP8A 2QXTA 2OLEA 4G1FA 2XUJA 1GKLA 4BTVA 1ZI9A 5HFAA 3JW8A 1BN6A 1ZIYA 2VJCA 3HC7A 1YB6A 1XZEA 1L7AA 3G9ZA 2AJDA 1XRQA 4LXHA 4FNGA 1WM1A 5AI8A 1E5TA 1Q0ZA 4YX9A 3I6ZA 1XZJA 5BV7A 3B3QA 4B9EA 3M82A 1NX9A 2BUBA 4X7BA 3YASA 2X76A 2Y1KA 4J0IA 2QUBA 2XQIA 3BDVA 3PE6A 4CIAA 3HABA 2GZRA 1BU8A 4FMPA 1CVLA 1LPPA 1LZLA 5SYNA 1TK3A 4F60A 3U1TA 3EQ7A 2XLCA 2QVBA 1QO9A 3STYA 2CBGA 1K6EA 3Q8WA 4OB6A 2QM0A 2WJ3A 5ALDA 4CCWA 4PSDA 3IULA 1XZAA 4K5QA 2PSEA 1UXOA 1CUEA 5HQ3B 4KRYA 1EI9A 4EUSA 2QMQA 3G9TA 3O4JA 4ARBA 3S8YA 2WG0A 3FSGD 3OPMA 4AZ0A 1YSCA 3PFCA 4KACA 4UFOA 1R9NA 1AKNA 2BUCA 5ALFA 1JU3A 1ODCA 1N1MA 3I28A 1H23A 2PX6A 3N2ZB 5AKGA 4X71A 2B9VA 3R41A 4B9AA 3JWEA 4DSZA 3I2IA 5JD5A 1XLWA 1P0IA 2DR0A 4OSEA 3UUFA 2RGUA 4UHBA 1K63A 2WQZA 3LS2A 2VQ6A 2YH2A 3C6XA 4K6KA 5ALNA 3AFIA 4QDUA 3FCXA 2E3JA 3WJ2A 4C4XA 1E8DA 3OTQA 4X3CA 1IZ7A 5CBKA 3WQHA 2WG2A 3DKRA 1QZ3A 4X97A 1EDBA 4MXDA 4JH0A 1YA4A 3JYHA 4W1RA 4UHDA 3WK8A 2I78A 1CUAA 3WI7A 2JBWA 3R0VA 3EF3A 3FWHA 1SCKA 4B80A 2XUIA 1BROA 1QE3A 2D0DA 2OCGA 3O4HA 4UBMA 2GYUA 3WKEA 1R3DA 3B5EA 4W1SA 3E4DA 1CFJA 5E4TA 4DNFA 2FJPA 1YA8A 4QA9A 4MQMA 1XZHA 3O9MA 3X3HA 4G9EA 5CH8A 3G0CA 3WL7A 5JAUA 5ALXA 4LXIA 3PICA 5DNUA 1CUDA 1PFQA 2HFJA 1ZD4A 1MX9A 3RLIA 1QTIA 1THGA 2XLBA 1L7RA 1GT6A 1S8OA 3ZLTA 5JAPA 3BIWA 5A7FA 1JJBA 1KEZA 5T4FA 2CJPA 1C7IA 1G5FA 1N5MA 1XRMA 3Q0TA 4MJ3A 4H7IA 4X00A 4EY6A 3DKKA 2VJAA 1VZ3A 2ACKA 3VJMA 5D3ZA 4FHZA 3G9UA 2ZJ7A 1A88A 2VF2A 5FKJA 4RPCA 3AZOA 4TPKA 3N0TA 3V9AA 3BJMA 2AJ8A 5A2GA 4X6XA 2C7BA 3WIBA 4OD0A 2JGKA 4ZREA 4U2CA 4GWLA 3C5WP 3F97A 4EZIA 1QFSA 1UK8A 1CLEA 2PKYX 1IUOA 2PU7A 2YYSA 5I7UA 2PU5A 4Q82A 4J0KA 4LIPD 4GEGA 5CURA 3TGLA 5D6OA 1AX9A 2QR5A 2DHEA 4B83A 1LGYA 3AIMA 1ZJ4A 5T4HA 1P0PA 5AOBA 2ZYRA 4X91A 3FNBA 1YR2A 4EY8A 2G5PA 2ES4A 4G9GA 4PSUA 5LZ5A 2WFLB 4OUKX 4BP9A 2WJ4A 4X85A 4C01A 5JZ9A 3AJAA 4E14A 4UBIA 2VJDA 1E66A 2HA4A 5ESRA 3R3UA 2C4HA 4L0CA 1YS2X 1AMNA 2DQYA 2HU7A 3S2ZA
chains in the Genus database with same CATH superfamily
5EHXA 1G5TA 1RWWA 3BZBA 3PJDA 1SOVA 2RKWA 1EINA 4Y6RA 4RF4A 4HNUA 1W4LA 1XP5A 2P2DA 4I55B 4OXNA 1OIXA 4YQFA 2R8ZA 1DEKA 1H2YA 3GNQA 3UY4A 4WY5A 4MWGA 4ED9A 4MCJA 4C03A 5JOQA 1I7DA 4P82A 4NE7A 2NXCA 2C94A 1U4SA 3OPQA 3L7BA 1WOMA 3H87A 1X14A 3A2LA 3PK0A 1E62A 1SWVA 2P5UA 1NHGA 3NGXA 4LY9A 1W6UA 1Z36A 2G9QA 4TT3A 2HU5A 1KKUA 2FE4A 2C20A 4XSGA 5KVCA 3BA1A 4GPTA 4KGDA 4JLDA 2G36A 4Q3NA 4WOKA 3SF0A 2GTPA 4V03A 1IN7A 1ESZA 1L5ZA 3IUQA 4ZOLA 3NNSA 3LIIA 7YASA 2GEDA 3QBEA 3UJ8A 4CHGA 4LVNA 2JFPA 1W4AA 1MO5A 3IXQA 3UMVA 5B4TA 2GH1A 5HRCA 4ZO8A 1E3SA 2OHIA 1EUYA 4MV0A 2LD4A 3D4BA 3JALB 2XAUA 5TNXA 3ILXA 1PWEA 2J5RA 1M75A 1PEDA 3OFJA 5FFFA 4X6LA 4JJAA 4DG9A 4HEJA 1NWHA 1TO2E 3Q3IA 4R4JA 4AC9A 3V48A 2COUA 1Q0PA 2D7DA 2WAAA 1KQPA 2JAHA 2OT3B 3LJKA 5EGSA 2RGXA 5J63A 3R5HA 2NU9A 1X1QA 2OYSA 4BCBA 3R75A 4TKUA 3GRFA 1TEVA 2I7XA 2G06A 2P90A 1FP7A 4XTCS 2Y77A 4GZMA 3DWGA 1N6PA 2GPBA 1PWZA 3I72A 1YHYA 2QP9X 4XR9A 5KMGB 2ZRAA 2F6RA 2OV1A 1IBSA 1R37A 2JA1A 1SHJA 2ZWPA 1WSWA 2P6UA 4FYXA 1LWOA 3E3MA 2XNDD 4ILKA 4LF8B 4YDQA 1E2QA 3M4XA 2CD7A 4RKQA 5IKPA 5JRZA 2IEZA 3SZRA 3STVA 2WBLC 2FPSA 2VDOB 4PYQA 3M4JA 2V65A 2Y4OA 4IUCS 1KI6B 4TTAA 1K97A 1RPAA 3NTUA 1OTXA 4GZ6A 5HDBB 4BVGA 1XZDA 4RQTA 4WI1A 2H59A 3GDGA 2CFRA 3MFQA 4C30A 4BB5A 4C6RA 4F3TA 1P29A 2JGEA 3ODPA 5AHXA 3SC3A 4LKRA 5C1PA 1S02A 2F9FA 1GXSA 2JAOA 2MHCA 1U3DA 1V1JA 4P4SB 2P6NA 2EBHX 3AEKA 2O14A 3GLRA 2QJOA 4F5YA 5AVXA 4YJHA 4Q4HA 2X8AA 4X7RA 5FXMA 5AVRA 3KWFA 1MN6A 3W9BA 1QG6A 1M6NA 1AUVA 4HAIA 3VR6H 4JI8B 4R16A 5FWNA 4K05A 1RYFA 1Y5MA 1R1DA 2ATEA 3C48A 3GCDA 4MAFA 4RGVA 3V1NA 3W04A 4B75A 4LDRA 1Q22A 1YH3A 3UJCA 4HDMA 5E2IA 4GI5A 4W5QA 3C8HA 2PD6A 2A59A 1FU4A 3I12A 4AY2A 3P9IA 1T13A 3TSOA 4DCGA 3DKVA 5CXUA 2WFZA 4N5HX 3IEVA 2B98A 2H1LA 4AO6A 4J0EA 4DJDC 4PZLA 1BDMA 3IAS1 4K9KA 4OHFA 3VUEA 2ZIEA 4ZT2A 4BO4A 2JZNA 2F3PA 1XZMA 5BMVB 4BEVA 3BCSA 3VC3A 2AZDA 1U7OA 4UHEA 1U0EA 3O95A 3V4OA 1CDDA 5K51A 4DLNA 5LPNA 5FL3A 1J0DA 4N0MA 1VJTA 3A6ZA 2O5EA 3NH9A 3VOSA 3OJWA 1OXVA 3U3RA 2OD7A 1ZRMA 3KDAA 2X19A 1WABA 3QYJA 2Z1DA 5DHPA 3VYVA 1Y9EA 2VF7A 1YB7A 4WW0A 1I3CA 1VYTA 3MBOA 3KALA 4F4FA 3GFBA 1W0KA 2CMGA 2O2ZA 1VFNA 5IUKC 4B35A 3U4CA 3DEFA 3UEOA 4HQRA 5KU7A 3LVFO 3ZBPA 1Z5WA 1I3OA 3ZWKA 1GGHA 4FMCB 4TN1A 1T2UA 3IVMA 3OQIB 4UTOA 3FCOA 4RMGA 2X4LA 1NQWA 3WB1A 4ZT4A 1FS4A 2PVPA 1W9HA 1CB7A 4GT1A 3RSQA 1QHYA 4IAOA 1NW3A 5DX1A 1SWWA 3W8FA 4JCCA 2BR4A 3COPA 1SXQA 1DFGA 4AKIA 2AV6A 4H0FA 2KB0A 5T3YA 4C4RA 1A4XA 1N7GA 5CLGA 1DO8A 1RZRA 1SB8A 3CH5A 5EINA 2OFFA 4KEAA 5AW0A 1JB1A 3HM2A 4NECA 2VK1A 2Z6UA 1HZZA 1IONA 3F6EX 3MQFA 4Y98A 1NVVQ 2AGVA 2ZYVX 3CY6A 3II6X 3R7WB 1QP0A 2IE0A 2WPDA 3FBGA 4ZK6A 2GLXA 2K87A 3BQNB 3HGMA 4P58A 3C1TA 4RIFA 2B4AA 4QSHA 3PX7A 2A9PA 4GF5A 3UFXA 4F4UA 1ZA1A 2WV9A 3IQEA 3ZYZA 3CC8A 5AO9A 3A11A 2AMLA 2VIIA 1XROA 2FMKA 3DEHA 1U1EA 3DZKA 3RJ9A 1F38A 3QFCA 3TQCA 2WE8A 1RM0A 1Q3KA 3DL2A 4DM4A 1QAQA 3WZLA 3GEMA 2QF7A 5HHTA 2C0QA 3OWHA 5EJ4A 1AQYA 3W7AA 1AS0A 3ISTA 4GMKA 3TS1A 2ZRCA 4Q34A 5SY6A 2K7FA 1JT9A 3OLYA 4PLTA 4C7MA 1M2VB 1L7NA 3FE2A 2ZBFA 4GZLA 4IXTA 1H22A 4U1RA 1OZFA 4AUMA 2BTOA 3KTAB 4WSOA 2HJHA 5EUMA 3E6AA 4TM8A 1Q2XA 2ZIVB 3UAYA 2C9MA 3H83A 1MAAA 1O4VA 5AKHA 3P9XA 1A7UA 3R40A 4FSDA 1C4XA 2JAWA 2BHLA 4BMNA 5K8TA 4WJKB 1XZLA 5C81A 2QTHA 3LYAA 2FW6A 5IJWA 2BKVA 4TMZA 1C7RA 2HD4A 3KD3A 2H9IA 4MRMB 4KITB 1I7PA 4KP7A 3EXG2 1OI2A 3QNWA 4NYJR 4Y2GA 3IDSA 4TS1A 1MAUA 3ENVA 5ALTA 3WLPA 5KTRA 2AFRA 2FZCA 3U9LA 3QVWA 2ZE7A 4P84A 5DHUA 1RQLA 1TX4B 4KGZA 5FWXB 5K6AC 2TSYB 2UYCA 3GXBA 4GLJA 3CNNA 3N2KA 4BWYA 1PUXA 1Q7BA 2YS6A 2Q4DA 3LKZA 5IF3A 4RCZA 4G86A 1NUSA 1G17A 3CVJA 2FUG6 5C9ZA 2QMOA 3H2SA 1XDWA 4X44A 5C8ZA 3F96A 3O3OB 1I0LA 3LFUA 2HHLA 2H7VA 1P4RA 4DIKA 3E8MA 4N01A 3SVZA 1GP2A 3D2AA 2HIAA 1RKXA 2VLIA 1TYDE 2ZBDA 1V6CA 2V7XA 5KNDA 3T7RA 4JHXA 1O8BA 3IPXA 2EATA 4BNUA 2VTDA 2FWPA 3DZGA 3DOEA 5ALHA 3ZGYA 5GIOE 2ZJ5A 1L7EA 5B1SA 4EFMA 1I7LA 4D45A 5BSUA 3UMFA 2NUAB 2CJFA 2JLQA 2IF0A 4MI6A 3D7SA 1IU9A 1T1SA 1VXRA 1IB6A 4FFLA 2V45A 4JB2A 5T6MA 2AOUB 3NEYA 3QVTA 5CFPA 1TJPB 2AEMA 2NVBA 2OCIA 2V5VA 2VA9A 4EG5A 1IBKB 2F43A 1KVTA 1UZMA 4OHRA 3B6MA 4K88A 4DR4B 1TIKA 2AOXA 5AHRA 2X58A 4L5YA 4HNTA 4MUYA 3QSYA 4P86A 2NSDA 3E7WA 5JVDA 4WFIA 3I39X 4EELA 1QF9A 3JD3A 4OXYA 4RPJA 5HKBA 3LZCA 1LF5A 2I7VA 2A88A 5P8WA 1I2BA 3HU5A 2N42A 5FR1A 4F8YA 2Y1DA 2PUJA 2X7JA 5HKLA 1E6UA 2B1QA 2HZ7A 1GR0A 5AQ1A 1I6WA 1VLQA 1NPYA 4RFSA 1U1IA 2BWJA 2LZ0A 3P0HA 4QUHA 2YY5A 3T6KA 4BO0A 4KQHA 4Y1RB 3C6ZA 2BGKA 1R4NA 2QOEA 1ENYA 3O4IA 2LRHA 4MLDA 4P0QB 1YVPA 1JHAA 3WYAA 4BAZA 3CX8A 1H5UA 3LCJA 2YXEA 1E1NA 1SVNA 2Z8YM 3COZA 3MERA 3Q1LA 5FPSA 4C7BA 4F0JA 4B2LA 1QB7A 1M2OB 2W0SA 3IT2A 4AJ9A 1LBIA 4NOMA 5CYFA 3JVEA 1P2BA 4U7JA 1X7ZB 3L93A 3QVJA 1TTHA 1Z82A 3LQ1A 3VU1A 1WBDA 3ZDRA 2MWMA 4BEWA 4CV1A 3QW2A 5DYTA 5G40A 3RLFA 3TZLA 2XUGA 3G8YA 1NXSA 4Q39A 5DTEA 3ZCXA 5DM4A 2R6DA 4J90A 2IOYA 3AESA 3WFIA 4YRMA 2QAGA 3THXA 3DWEX 4AMVA 1Y3AA 3MXTA 1XCLA 3DHYA 1ABEA 2JKYA 2JGRA 3G5AA 4X1OA 1K88A 2CF6A 1BSVA 3WWDA 2I55A 2FFAA 2DWCA 1AQ6A 4XGRA 1LD3A 1NL3A 1JFRA 2J3JA 3K8OE 5FWYA 2AYZA 3UO8B 3V1KA 3GHYA 1E6EA 3F6BX 3WLKX 1H3NA 4Q47A 4MW4A 4MULA 1TZCA 2WICA 5E3JA 2X0NA 2JIPA 5EAIA 3WGMA 1XLUA 3GLQA 3BYZA 1WXEA 3GZJA 4IWNA 2QT1A 3RFXA 3ZIDA 1TGYA 3M7IA 4TMYA 1R6BX 2JLBA 2IRWA 3S44A 2B1GA 1MPTA 1XCPA 1IQUA 1XDGA 2QL5A 4QOJA 2JLUA 1VPVA 3PFNA 1MB3A 4TL7A 1WOYA 3OD1A 1U98A 1Z5NA 5FRDA 5KKAA 2NU6A 3H17A 2DZDA 2IHNA 3VSCA 4CQMA 3IP8A 3MWEB 1PT7A 3K92A 4QQRA 5CEJA 5KB3A 1LTKA 2YV1A 2FFJA 3AXSA 2KM1A 4G09A 4O4HA 3T15A 4ZK2A 3LGSA 4FB4A 4B3SB 4OY3A 3IEXA 2RB5A 4PBSA 4QGFA 1MMFB 5CFMA 3GYGA 1US8B 2C88A 3EFOA 5HMMA 5TPWA 3T52A 2YIJA 1WZUA 4Q4AA 1CUJA 3KEQA 1Q57A 4RQBA 5FD8A 2V1UA 3DMHA 1FFXB 2I3GA 2JATA 2YV5A 3NHLA 3VU9A 2IE8A 4HEQA 3ZU6A 4ER3A 1QGYA 2IYWA 3LYHA 2VPTA 1YE8A 3DZCA 2O8BB 3E9NA 2PZBA 3VKUA 2NZVG 2V6JA 4Z3KA 4MAMA 1SVUA 1QGZA 1ZH0A 1Z34A 2DECA 2JCVA 3H9EO 1JSRA 4OJYA 1QGUB 4B81A 2B61A 3ZW8A 5LB4A 1TADA 1QNLA 2JCXA 2YWDA 3N0WA 2O7SA 4QIHA 3TNJA 3GDWA 1X7XB 3THYB 4TKZA 5H4HA 1RWNA 2AOWA 1GD1O 1M8JA 1ZINA 3LLVA 3ABIA 4LTNA 3RBAA 1JHVA 2CFCA 4XM0A 3VTAA 4M1ZA 3D9QX 1TYCA 4B6SA 4WQMA 4DIFA 1GWNA 3ZGXA 4U7WA 2KX7A 3MQ4A 2HQBA 3CA8A 3LMKA 3CW8X 4JVMA 4MQEB 1HFWA 3IOEA 3CCBA 4N5NA 1ZJ5A 5I7WA 4UAGA 2YCLA 5FBZA 3BK1A 3HKCB 5AI6A 2BLNA 1QH8A 1QDEA 1YBAA 4JLAA 4Z9FA 1BEZA 3MJ4A 2IVZA 1LBEA 1U3UA 5AJYA 4TQAA 2CMFA 4AXXA 2VXOA 5A3VA 5CBPA 1QYWA 3W7VA 5GPBA 5TV2A 4NCBA 2O7VA 3EUAA 1QIKA 3MMNA 2B21A 4IIGA 3KE8A 3ZXSA 1J2RA 2ZR0A 4B79A 1XU4A 5B58T 2HPHA 3GXOA 2J33A 3ZHUA 3PSAA 2RHCA 2MT9A 2V98A 1MB4A 1NDQA 1RXUA 2I62A 1OASA 4FDVA 4NZZA 3VPDA 1HTWA 4J0CA 4YEDA 3PVZA 3FYHA 2Q1SA 3VJKA 3FTPA 2P69A 1I4WA 4L4YA 3U6BA 1JI3A 4B3GA 1YR8A 3C43A 1WQ1R 1BWRA 2KQUA 5I9BA 3FNEA 5IN4A 4LE0A 2VRNA 4P98A 4U6NA 1RQGA 3FTNA 3HKCA 1JWBB 4JY7A 5FF9A 1XDUA 3CNBA 5LWQA 4G4IA 4Z4EA 1JJ7A 3NBYC 1VE3A 3FTEA 2ID8A 2BBTA 2JFOA 3DM5A 2GMWA 5C0OE 3M83A 5H3CA 3M6LA 2YUIA 5G0WA 3SYLA 5KYWB 5LMCA 4PAOA 1XWFA 3K4HA 1SMKA 4QPCA 3KCQA 5AI0A 1KDZA 1XL1A 1X94A 1XIVA 1CY1A 3HCFA 4QO7A 4DFDA 3PR3A 1H2BA 4Y0NA 3VVLA 3H9GA 3SS8A 4GG1A 4HJRA 4B6PA 1VRCA 2X0JA 2UV8A 4Q3DA 4B6FA 1FDUA 1R4AA 3ZD8A 3NDJA 1EBFA 3TK1A 4PYMA 3ANTA 3HP1A 2MCFA 3K0BA 3I6QA 2CCKA 4EPTA 3CBQA 5K2OA 1OH8A 2Z4SA 2AFIB 1SVKA 4L73A 2I33A 3G5LA 3SKXA 4M83A 3DDZX 4XB6B 4EKGA 4AKGA 4W7SA 2X13A 3B7WA 2RDMA 4QXOA 1CQIB 4OXXA 5A0FA 5AW5A 2E9SA 1PFYA 4DA9A 4YUYA 4KQ1A 1F6BA 4X6YA 3RVOA 3E1GA 3E9EA 3PI6A 3C0KA 2NOAA 1QIMA 2YJNA 3E05A 3GJXC 3L4EA 3L8ZA 3QU9A 4U6QA 3PC4A 1NN3A 2GCNA 5K3FB 5K8JB 1AIPA 3PZRA 4H6VA 3CZPA 4B87A 5MGNA 4P6VF 4DJFC 2ZRDA 4CQMB 3UUGA 3NASA 4F2DA 1F8XA 1O6FA 1QCYA 4RDCA 4DV0B 1MFPA 1D4AA 3OEYA 2FX3A 3MUOA 4KV9A 3DLHA 1T0IA 4CEIB 2X40A 4Q7JB 3ROXA 5JCJD 1IY9A 3P0IA 5EA2A 1GSOA 4ZD6A 1VHJA 1U5BB 2ZFUA 5AESA 2FVXA 1KFCB 3GAFA 2VHWA 2VWHA 3SHTA 3IMFA 1P1KA 5KJFA 3T1HB 1Q77A 4G4GA 2POQX 3QNUA 4CNBA 1U81A 1N2OA 2A4MA 4H18A 2VZLA 3CV3A 3L1JA 3V8PA 1Y8RA 1XZQA 4XPIB 4CMBA 1O4WA 2NT3A 2V9CA 2XGGA 1G8SA 4IZHA 4UU7A 5DSXA 4PG5A 2RHDA 1SKUA 2R8PA 4P32A 5G0UA 5TF4A 1S6YA 1E7SA 1FYWA 3A1NA 3K1AA 1T9AA 1YJBA 1P18A 2QAGC 3GJ8A 1Z0SA 3NC1C 4MVJH 1K7FB 3KR2A 3TL3A 4F2WA 4PN7A 4WWHA 5HJEA 4IHJF 3UXMA 4YWJA 2OXEA 4FYPA 1E2HA 1RLOA 2BSAA 5CD9A 3WGKA 3CFYA 1X7WB 3R7SA 5GVSA 3NDBB 1J24A 3DEZA 4AQDA 3GI1A 3WDMA 2YHUA 1OB5A 2O7NA 1R5JA 1CZUA 1G18A 2LNDA 4ICIA 3LDUA 1H2HA 2MR6A 4P7KA 4V0ME 2HLDA 4Z9AA 1NTRA 3X1XA 2V3WA 5KHAA 4QUGA 3C3PA 4EI2A 4HN2A 3O8CA 3MW8A 3R9WA 2P9GA 1S8NA 2XBLA 2YZMA 4OVKA 4DMGA 1WW2A 4BWVA 4HBGA 2BI7A 2L19A 3JVDA 4BMVA 3BAFA 1IULA 2F3QA 5BVGA 3MLEA 3N7TA 5BSGA 4LOHA 5F12A 1WA5A 2AOVA 4K6OA 1AF4A 4LNHA 4RMIA 3M34A 3L4KA 2QV7A 1TC2A 2XYRA 4BRZA 2C2MA 1OW3B 4DE5A 4MPDA 2GN6A 3MTAA 1EVJA 3MTEA 3GC6A 2JFGA 1G63A 3F1LA 1QMGA 2J6BA 4QXQA 2HB6A 3MWEA 3L5KA 5MN6A 2NU6B 2DTXA 4BJHB 3FVTA 1W88A 3OFKA 1DKRA 4FWTA 3RHZA 2HNAA 4Z4HA 4BPBA 4FJ1A 1WKCA 4G6ZA 4HI0E 2EC5A 1Z56C 4MW7A 5BNWA 1P9NA 2O0MA 2XYGA 2O20A 3L46A 5J2UF 3IXLA 4UXJA 4KDCA 4LRTB 3BMNA 2ZCJA 3NOVA 1OGYA 3WZ2A 4OFZA 2PV0A 3PUWA 3ZGOA 3M89A 1ZVMA 3CF6R 5EE5B 3WK4A 1G8KA 1P4AA 2V1XA 1ETUA 1W2WB 3BL8A 4KAAA 1MJFA 2JDID 2JA2A 1QK3A 3AB7A 3IESA 4MGIR 5EC8A 3FB4A 3I92A 3IOCA 2OXIA 3R09A 1QRRA 3WKCA 3IEMA 1UEIA 1JECA 2HLNA 2LIPA 3GY0A 4XIYA 5FO0A 4AG6A 1GQQA 1W94A 3Q87B 4Z3DA 3O2JA 4IOKA 2H08A 4OHCA 1A27A 1T4DA 3H7IA 4GU5A 4EQZA 1NM5A 4QBHA 3CLRD 1Q2UA 4Y6PA 3WGTA 3WLSA 4EO7A 3BTSA 3SHFA 3GRKA 2FU5C 1DXQA 1PUIA 1XJCA 4HGPA 1P62B 1Z8HA 1FVFA 1YU9A 1P39A 4EHFA 3D3QA 1T5OA 5C18A 3DDWA 1V37A 1WCIA 5EMJA 2PQ0A 4FIZA 4TTRA 4KR2A 3VYUB 1UOQA 4L3VA 4YA6A 1ZW1A 3ZCQA 3ESRA 3MS4A 1Z75A 1I2CA 2B36A 5U4QA 3N6VA 5ICCA 3W6OA 3PL1A 3CZRA 4KIUA 1YQXA 4LWOA 1NXQA 4D6YA 4QODA 2J45A 2QGFA 4NP6A 2AKAB 3RUHA 3TYXA 4FINA 4MUNA 2JJ1D 1DOAA 5B12A 2JJ2A 2WQ6A 2Q3MA 1DX4A 1JQLB 1LSOA 2JEOA 3K30A 4RFSB 4NY1A 3MD9A 2Q29A 4OKNA 1ZWLA 2NWQA 4KQ2A 2CXUA 3QA9A 2PV7A 2WAMA 1V26A 2PFGA 2X8JA 2DFPA 2GAIA 1QIDA 2XOKD 5BSTA 5HYVA 2HL6A 1UPBA 1O87A 1GQRA 1AGXA 1DL5A 1TF7A 1ZAKA 2XE7A 3L0CA 3NNNA 2CHUA 1IOVA 2QSUA 3OQMA 2QVYX 1TC1A 2AYYA 1RIFA 3SG0A 1OBFO 1X3SA 2E2WA 4KUEA 2WJPA 3HXLA 4MI3A 2CKMA 5JYBA 1E8MA 2PUTA 2ZEJA 3QEAZ 2JHAA 3L9WA 5CW1A 1L5HA 1HT1E 3SAJA 2H17A 4R1NA 2UZIR 3JQRA 4LDPA 2X2OA 4GKVA 3TRIA 3PIDA 1DKMA 1W44A 2ZDHA 3UANA 5BPFA 3G7NA 2R751 2AQKA 1U7ZA 1N77A 1EVKA 2IZ5A 1TLFA 3CF4G 3CT4A 2JRCA 2O1XA 3LHSA 3S70A 4YV2A 2PLNA 1X38A 4NONA 1HNXB 3GJ3A 5LP6F 3AH8A 5HTKA 3UCEA 1E4EB 521PA 3P9RA 4W6QA 4DR1B 3E27A 4ZWNA 4OQNA 1MZVA 2VPZA 4EB6B 5LQSA 2R84A 2IUTA 2QSYA 5T5QA 3AM1A 3THOA 1OI4A 1TZJA 4PF1A 3WG9A 1K4MA 3G2IA 2J3DA 4RA9A 5DHSA 2MINA 3W5HA 4BJ1A 2CXQA 3F1KA 5FUYA 3U7JA 4MEAA 2I4LA 3I1FA 4K1XA 4FYIA 2ZIGA 1C8KA 1Z0JA 3EIHA 5HQ3A 4CKBB 3OLCX 3VR4H 5J1SB 3WWYA 4B40A 3IKTA 5TSDA 1X80A 1KBQA 1O5IA 2CL0X 2W48A 1RP7A 3HU2A 3NHZA 4BNDA 4D9JA 4WESA 2NACA 4EVRA 2VUHB 1QE0A 2NV6A 3FSEA 5ALRA 2IYEA 1J21A 3DT6A 3MBIA 3OQIA 4KQXA 3AMVA 4P4LA 2KHZA 3QPCA 3W3ZB 1MTZA 4N9QA 3K09C 4B3HA 2Z2XA 3O4RA 2B5VA 2YVAA 4TV9B 2FWBA 3PT9A 1XKXA 3A3OA 3QTTA 3P45A 2F17A 3ND6A 6ADHA 5CG2A 1Z88A 4FR0A 4J07A 2UZ4A 4NH4A 5F2KA 4TQ9A 3S5JA 3CR3C 4UBNA 4R1OA 1VE6A 2IPOA 5IULC 4EB3A 1U1GA 3AG6A 4P7FA 4IIBA 2X86A 3ZTYA 4INJA 4DIMA 3UB3A 4RM2A 3NOQA 1A9TA 2QV0A 2A3NA 4NAVA 4TXHA 1TKRA 3G0OA 1JKJB 3P27A 2WUVA 3LY8A 4MQEA 4PSAA 4B09A 5HRAA 2ZITA 2CL5A 2P75A 2RCNA 3FDIA 3OM0A 4ZOCA 1SCDA 1E2GA 5TB5A 5TT1A 4BNDB 3PRJA 2CWDA 4Y8VA 5HOEA 3O3MB 2JLZA 5DNYB 1IG0A 4I8IA 4HPXB 2RHWA 4AZVA 4LWZA 4DWJA 1N5IA 4ZEOA 4D0SA 1YL6A 3QYFA 3TIXB 2C2BA 2FZWA 3EUFA 3DZDA 4Q4HB 5LQDA 2PZLA 1RWMA 5EIXA 1F0PA 1PJLA 1YZYA 2FK7A 1ZMXA 1EH5A 1XVUA 3V7UA 4DN6A 4BO7A 4F3YA 5IT5A 1EESA 1OJLA 5REQB 5CJ2A 5CB4F 2VP3A 1PWXA 4PQGA 1QNFA 2E7ZA 5DU2A 5KYWA 1ICEA 5FDFA 1O2DA 1UC4B 1JLSA 1HE1C 2QY9A 1XZCA 3V7WA 1AJEA 4ZV9A 3D2BA 4DIUA 3H5IA 4X5OA 5KDDA 1KI6A 3LV8A 2WQ7A 1U80A 4WKPA 3NLLA 3ESZA 3P9YA 1S96A 4FUTA 3T3OA 5EI5A 4DR7B 2BI4A 2V7QA 1YVEI 5KDOA 2GZSA 1KC3A 3KTOA 4Q9JA 3W3AD 4NJOA 3S81A 3CEJA 1RYNA 1WKBA 1VB3A 1GZ7A 1AZSC 2WA2A 4OGGA 2OGUA 4IBOA 4L8LA 4QJBA 2Z6AA 3VMFA 3STTA 4EA8A 1XL0A 1OLSA 4GLFA 1CD5A 4IF4A 1IJFA 1JYFA 1JJAA 2AUMA 4KUHA 5DULA 3RUAA 2VEOA 2XAAA 3BK2A 4B2PA 1NQTA 1UBUS 1UBLS 1U6JA 4CDRA 2HRBA 2V6BA 3EEYA 4XVHA 4E88A 4NE9A 1ISHA 2C1XA 1DWQA 2ZRBA 2OD2A 3P7MA 2JIOA 3LO5A 1RZVA 3U7EB 2FSHA 2I76A 4RK1A 4YAOA 4ZU3A 1Q7RA 4WL0A 3T7TA 4XJXA 4P9NA 3NBMA 1DCTA 1AURA 1EXDA 3O1HB 2FEOA 3KV3O 1EFUA 3GVCA 1DAMA 1DTWA 3D8UA 5DX0A 4KHPB 2GAAA 1QS0B 1SUBA 4MPTA 4UUAA 4O1MA 1PDOA 5DFAA 3TLYA 3JALA 2X3UA 2YV2A 1ECPA 3A05A 3RS4A 4EF6A 1E64A 1EK5A 4EW6A 4Z0NA 5AIBA 4WCFC 1MB0A 3IJPA 3V4RA 1JF8A 1GYRA 5FBLB 1CE8B 3TR5A 3UJBA 3IE0A 1PAUA 1R4MB 3VTZA 1BDHA 1DJPA 2QT9A 4YONB 5IJAA 1FYDA 3AKCA 5ALQA 3ULKA 4ARZB 1C9JA 5K3EA 3TE7A 3ND9A 3A1UA 3DQPA 4OHVA 1ZYUA 3L8HA 1P0CA 1TECE 3LHFA 5E4FA 4QM7A 1UJ5A 1Z62A 3WY9A 4JQCA 4QGHA 1MJ5A 1EEXB 4IGFA 3L6DA 2X7HA 2WIDA 2B5WA 2AEFA 3VO1A 2GTHA 4IPTA 1PK9A 1QIFA 2QUIA 2QW0X 1UOPA 4YCDA 2C42A 3O3CA 2IHBA 4JLSA 2BL4A 1KNQA 3JQEA 4ZDJA 1PLJA 1YZTA 2WWWA 2VZEA 3MMSA 3ANMA 2ZUUA 3N2EA 2A0YA 3B89A 4KRXA 2PS0A 4UVIA 4OLAA 2PBZA 1XKTA 1GPKA 5JADA 3TECE 4PZAA 1GQFA 1YHNA 2HRQA 1TXGA 2WD7A 4Q1DA 2Y1FA 3D3WA 4U0KA 2B30A 4Y0AA 1I3NA 4BV9A 4E5SA 1UT6A 5AJUA 4O3FA 1IIBA 2G83A 2XYHA 4M8KA 5DBHX 2Q3FA 3WL5A 1W59A 3B3FA 5FPQA 3SP1A 1EQUA 2ZIXA 3VJLA 1V8DA 2IUYA 2ENUA 2IX9A 3HKEA 4D9CA 1H2XA 1HDGO 1YKFA 1GADO 3B6ZA 2PEZA 1GY8A 2PKCA 4PYKA 2WF6A 2P9EA 1KXJA 1T4MA 3SF8B 5JBQA 3I8SA 4DJ5X 1L3CA 2ZT7A 2ZUCA 3TCNA 3WNDA 3HB9A 3D3KA 3VZCA 1YOVA 1F2DA 1Q1QA 2I6SA 3KJHA 4MVJA 4UDXX 3W4KA 5A4IS 2DETA 3IPYA 4TRJA 1QYCA 1EMDA 1CZHA 3HB4X 3T1VA 1WTAA 1R0WA 1C4KA 3FFTA 3NHYA 2P5TB 1F7UA 2ZULA 2OC4A 4JI7B 2HO4A 1K98A 2PGLA 1JT2A 2INGX 5E0KB 3HR7A 3OZRA 3ZHZA 1QIGA 5L4LA 4FONA 3KR9A 4M6WA 4UNRA 2FW9A 4ND3A 2FDCA 1YS6A 2ZDGA 1YJQA 1RJEA 3PDIB 4CFZA 5DO9A 1Y8ZA 5BWCA 3ITDA 3K5IA 4D5GA 2I2XB 4G8JA 1X1AA 4PZZA 2XB2A 1ZI6A 4NYIQ 3MTIA 4W7HA 4UE3S 3H8JA 3QE4A 3RTGA 5DT9A 3ZDAA 4A8TA 1UKZA 3A04A 1Q92A 2MIIA 5CCBA 2PMDA 3IV9A 3HVUA 4I1UA 5EOVA 2PAFA 5JI3E 1TU0A 2ZAMA 1PO7A 1I4OA 4QHSA 1FX0A 2XDWA 3F2VA 3GGJA 2PQMA 3V8MA 3RF6A 1H0SA 1U63A 5B36A 1FUYB 1PWYE 2BLLA 2W2LD 1XQXA 2IUSA 3BWMA 3MEQA 4MV8A 4C07A 1B6RA 2XZPA 3PGLA 3PQFA 3EX7C 2G9UA 3FF4A 1G98A 3HJBA 3ELWA 4Y6LA 2C2YA 3AHJA 1F8UA 5K0JA 3GN2A 2OPHA 1EGQA 2J5QA 4LWPA 2O3QA 3QMVA 4RSRA 4KVGA 2CEKA 3S0JA 5BY2A 1YT5A 2VTVA 2GVNA 2YQZA 3RRBA 1I2DA 1DUVG 1CT9A 3LDGA 3EEQA 4P5EA 5K4HA 4CE6A 1Z5PA 3MTGA 1L1QA 4ETWA 1BXGA 1NRJB 2I9KA 2E0IA 4PSCA 2V3CC 5CDUA 4BMCA 3WL8A 3GJ0A 4KR7A 5JYEA 4XYLA 2I66A 1HGXA 3UAZA 3DXYA 2I0FA 2W6NA 3F78A 4RTNA 4AKHA 2DFDA 3KEGA 1JL3A 1B1CA 5LUBA 2CVQA 2J30A 3EZFA 1X8LA 1J00A 5DM2A 4FDAA 2GF9A 3R7NA 4QFMA 4C0XA 5K0TA 1DJOA 1FTWA 1CF4A 4PX9A 2PRZA 5JVDF 4YQEA 1DHTA 2H2GA 3BDAA 2WTBA 3OQJA 1JPJA 1NX6A 2FEPA 4GSKA 4OOEA 4MCAA 1V8OA 3D4PA 1HH4A 5AM5A 4ZGBA 4X93A 4ZICA 4BLSA 2WMYA 2GBLA 2OMEA 2X0FA 3TZBA 1PR5A 5IHPA 4HGYA 1YF3A 1ZIOA 4Q3LA 1SA0A 3EDMA 4DMRA 3G0IA 1MIHA 3WB2A 3DZJA 3R7WA 4EG1A 3DBOB 1LX7A 3H16A 2Z1NA 4Q1VA 3ONFA 4YRQA 1KRHA 1Z0KA 4NJEA 3BPSA 3DZ8A 1GPDG 5IBRA 3CW2A 1R0LA 5IDQA 4HF7A 1IPFA 3RRXA 2RJ3A 3R9XA 1R0RE 1O54A 2JHGA 2QMHA 3W2FA 1LPOA 4CF5A 3DH0A 4Q9LA 3GLFE 1KO7A 2GX6A 1E3WA 3M6VA 4S1VA 2Y3IA 4MRNA 3VX3A 3DE3X 3QEJA 3HBFA 2XF2A 3JQFC 2ZJ4A 4DLLA 2D2FA 4YWHA 5TX7A 2NXEA 4NCAA 3ZDDA 3HDGA 3M2TA 3CUUA 4B3FX 2YYYA 1VBNA 3RVDA 1O3YA 5DMHA 4Z4QA 1HMYA 2R00C 3ZI7A 1CULC 3KSAC 2JIBA 3GQBA 4O3MA 2XXJA 3U0VA 1W581 4KTVE 2ABWA 1NBAA 3OQPA 1KE1A 3IIKA 1NVTA 4ZJZA 5F98A 2GF0A 4HDKA 4P31A 5C5EA 1QYXA 1RADA 4NYMQ 4BLOA 3ZQ4A 5BXQC 2EHJA 4ABYA 1WS6A 2FPIA 2I2CA 2PG3A 4FOSA 4G4JA 4OHXA 4FHFA 4Z5XA 3EQ9A 4XGQA 1YONA 4HTFB 3FCUB 3EXIA 1T1JA 1IUPA 1VKRA 1WCWA 2W6QA 3Q15C 4FQ5A 4GDFA 4F6RB 1OE0A 5BSKA 5PGMA 3DE2X 5AR1A 4PO1A 3ZWXA 4UM7A 4JEIA 4DSOA 4IJQA 3GMSA 3UOWA 4ENWA 1PJZA 3RGGA 1PWHA 2ZPAA 1V43A 1XPJA 1T1EA 4WE3A 3U7IA 3VNRA 4BUJA 5A4JA 1Q3TA 2HHAA 3BVPA 4HRVA 2IDKA 3UB2A 5DNDA 1D3AA 3KZ1E 4QL3A 1HBJA 3C41J 5LMNB 4KO4S 3TI7A 2JAUA 2O9JA 5CFOA 2P6PA 1R9MA 5LC1A 3EC7A 3GVHA 5K3AA 2G1PA 4C0QC 2X1HA 3DD5A 4KQCA 3H1BA 1MABB 3EY9A 4CM5A 3WA6A 2NPFA 3FTFA 3E84A 3PA6A 1TDJA 3IQHX 2ZAGA 4BE7B 4EIWA 1ZRHA 2H4HA 1HC7A 3KYJB 1YFJA 2QVXX 2DLCX 2I2WA 4GUAA 5TQ0A 4FLEA 3V8RA 2GDJA 3TRDA 4LZLA 4PHHA 3EGVA 1P3DA 2C29D 4AIRA 3J81k 3I62A 2WWIA 1DLIA 3H65A 1QIJA 4MIKA 1XMQB 5SYMA 4NEHB 1Y6JA 2GPSA 2FK8A 5A7HA 3OE7A 5IXJA 5JCOC 2EQBA 3A9RA 4NJMB 3L3BA 2UYHA 3WISA 4OQYA 1E6KA 4PS1A 2JFXA 4MMZB 3O90A 2BFBB 5IBPA 2I3ZA 1L7DA 3I2FA 3KKLA 3LQKA 5DOVA 4WPGA 1UKBA 1K8RA 1SEVA 3UOAB 2Q8NA 2XJ9A 3P2IA 2IWHA 1KYTA 4CI9A 2FPRA 3CTPA 4OMFG 3KOZA 4HG2A 1BW9B 2AN3A 5JSQA 3VKWA 1F14A 5BWLA 1GITA 2YFYA 5AJZA 4A6EA 5KQMA 2IXTA 3SFVA 1HDEA 3UB4A 3E82A 5HIAA 3HBMA 3QKSB 4KX5A 1TJ3A 4BEBA 1SCBA 4WUTA 3TW8B 1NPDA 1OFGA 2PX4A 4RK6A 4CW7A 2IPNA 2QRQA 3IJRA 3OCVA 4IO1A 4LGMA 4AJIA 4B7CA 3IQZA 1Z37A 4II7A 4LKOA 4B6GA 2FAXA 5LFAA 5TIIA 1VHQA 4MVJF 4OLHA 3R23A 1EVEA 4QTXA 4NATA 2J5XA 5JNSA 2VA8A 1DI0A 1L9KA 3ZCVA 5DLQC 1GU0A 3KYCB 5EPEA 1DBSA 4GOMD 4H1WA 3ZNPA 2XZOA 1NW7A 4MYUA 2BJWA 5AVVA 1DIAA 2WTUA 3KXIA 2PWBA 1GZDA 2FF5A 4JV5B 1AKTA 1K8XB 3M2PA 1ZU4A 1EG2A 1LPAB 1QJ4A 3URMA 4BVAA 1H93A 1LPNA 2H07A 1P81A 2QTLA 3GH3A 2WUGA 3S7TA 3ZJUA 1BXKA 2YL2A 1WZCA 3EIUA 1OYYA 1C8VB 1Y37A 1RM4A 3DYIA 4LRYA 3FCSB 4NOKA 1RAEA 1KMQA 4HAXA 1XCMA 4Y1GA 1KMCA 3H13A 3WKBA 2E87A 3ZU4A 1V5EA 2A5DA 4OJQA 5FV7A 3NS7A 3MCZA 4F7DA 1BCRA 2NUTA 4YRAA 5AVZA 2QS9A 3KQVA 1Z2CA 4Q7EA 2H1HA 3BGOS 1NE2A 4CCYA 3BTOA 3SOZA 1OKKD 2O05A 3TWOA 3MTJA 4RK0A 5CJJA 4ESEA 3BZUA 4FCCA 1UKAA 3PNSA 3GW8A 3LPLA 1NAIA 4B4WA 4HNSA 4ZGGA 4CLEA 5ULLA 2HUNA 4DIDA 2QR3A 4FNMA 1A96A 5LL6P 1V3VA 2JC3A 3FBWA 4I1SA 1SQ6A 1ZI8A 5F5NA 5THQA 1LNSA 1NSTA 3FMIA 4O33A 3S29A 4QECA 5I51A 5INTA 2Q4EA 5KVVA 2OPBA 2G82A 1KEPA 3ETDA 4FXPA 4LJAA 4PS0A 1CUIA 1E59A 5LZ2A 3PTAA 3KOUA 2CB9A 4PFKA 4FFPA 1DO2A 4CETA 5EIBC 1TMOA 4MZDA 2A94A 3BMOA 3KZKA 1WD5A 3VHQA 1OLOA 1SKYE 3U2QA 3QUQA 3T0GA 4N39A 1NATA 3QPVA 3MLBA 5EXPA 4JCOA 4NS1A 2FZGA 2ZRIA 4FTWA 3SQDA 2CHVA 2HAEA 3DE6X 2SKDA 4GICA 3WYGA 5FPTA 4ACAA 4HLUA 2VF4X 1JVNA 4J0HA 3T7EA 3WX0A 1SU4A 2J3MA 3B1KA 4EVSA 3N39C 3NC4A 5ES4B 1REQB 4JXXA 3KJZA 2FUCA 5KYYA 2DFNA 1GSAA 3HYCA 2VDWA 4EUFA 2VP4A 1FMCA 4P7JA 4B0PA 4W9MC 4P4TA 1COWA 1C3OA 1UK6A 3ZUGA 3OMWA 2VWQA 3BIOA 2WZQA 1JV2B 2XMPA 3A58B 2FHSA 2CBZA 5EMMA 5E1MA 2JIQA 5LP1A 1DKUA 1SHTX 4JVNA 2CL6X 1B7GO 1J7JA 1MOZA 3MB5A 1J2YA 4BJ3A 5BW6B 3W8DA 1Z5VA 1NQUA 1ZRSA 5HBRA 3ZK9A 5A4AA 3DULA 4LHYA 3QELA 3O0TA 1YVUA 3CNEA 1E1CA 2GVZC 3LLSA 1B1AA 3WNZA 5LQAA 3SC4A 1A2KC 3ET4A 3HLTA 3VAYA 3MWLA 1DADA 1C1XA 2VJMA 1M6HA 3AEUB 5DF1A 4IQ0A 1H0RA 3H5AA 1P3JA 3L07A 4PXYA 4CNQA 4C2TA 1G1AA 1NF8A 1TA0A 2KPOA 3WNBA 5JXGA 1I32A 2WEKA 2AJBA 2CNKA 2JJ2D 1XNJA 1YVRA 4UAUA 2A1TS 2G5GX 4KPYA 2WKPA 4KYTA 5AOCA 3KPWA 1VKHA 3DBHB 4GE0A 2B3TA 1EXVA 4Y2UA 1H69A 1TJNA 4L6IA 1GLGA 3OESA 1IOLA 1JDBB 1MENA 4TTQA 4Q3EA 1RJ9B 3RRZA 3VYRB 4BPRA 2FPXA 4RYDA 4G5GA 2HN9A 4J7XA 4WK0B 5E1BA 2VJQA 3WLFA 3ZZNA 5LNK1 4YAUA 4LG1A 4TT3D 1VCHA 3A14A 5IK2D 2EEZA 1RXSA 5EXDA 5EZYF 1PE0A 1DBWA 5COQA 5KCMA 2RI6A 1Z0ZA 2GLTA 2NQTA 4GM1A 3UT0A 4REMA 2AN4A 1NXTA 3LF1A 2VTEA 3IBYA 4JD5A 2CNBA 4CM9D 2XX3A 3CLUD 4KIWA 5FOSA 2Q2NA 2REQA 4MKGA 1T24A 1Y1RA 4CFSA 3H3XA 1KSFX 1D2GA 1UQRA 3OHSX 1A4UA 4HNRA 5JANA 4A36A 4QELA 5DISB 3B9RA 2O57A 4ZDKA 1YO6A 3TO5A 1FK8A 2A4KA 3WJAA 4BRUA 2C9ZA 3BM5A 2E49A 3FGOA 4ER7A 1TQHA 4LNAA 2VF5X 5IAOA 1Y7HA 1OLUB 3ED1A 3ZVMA 3B6JA 4GMXA 2O3SA 4P5PA 4EYQA 1PSDA 2QQGA 4AJJA 2VRCA 4JUFA 3NHKA 4P08A 1ZKDA 3AHFA 3QK7A 3GELA 4DMLA 2AIRA 4D4JA 3GOQA 3PYLA 5EIHA 5TJ9A 1IEQA 1WQ4A 4IIJF 4MS4B 1E4VA 5EHNA 1BCRB 2NUTB 5JJ5A 1BFKA 1G3UA 1CZRA 2R4UA 1XD8A 2Y6VA 4F1WA 4URVR 1L9XA 3ANSA 3RHTA 2CGEA 4OHKA 1TFUA 1PFWA 3NTVA 3PLRA 5T67A 4IH9A 2E6UX 3I9NA 1VJCA 4PHTA 5FBQB 1J09A 4C4AA 1EWYA 1NXPA 4ZEVA 1WE2A 3ZU5A 4UMFA 3GFQA 3LGAA 4F2GA 5I5EA 4C21A 2CFTA 2W6JD 3NC0C 3DVLA 3OH8A 1DO0A 3TLAA 1WDWB 2GJ8A 3FHJA 3S2EA 5KNBH 2HQ1A 4WK6A 4B73A 1SCNE 4IX1A 2NVWA 2YASA 3I0ZA 3IKVA 4Z99A 3FPKA 1TTQB 3QUSA 2WZCA 3ZX5A 4GZ5A 2FPUA 4MUGA 3K9FC 2DB3A 2GD2A 3V32A 2FJ0A 1X87A 2FW7A 2ZBVA 2OZLB 4QEKA 4RFLA 3CHYA 4TWBA 2FN7A 4UD6A 3NJ4A 5JSUA 2QQ5A 1G19A 2R6FA 5JXIA 3AVXA 1PJSA 2WW8A 1HRKA 3BUSA 5G0VA 1H2ZA 3QMWA 5F1PA 2PNFA 1XZNA 2UAGA 2WPNA 2XNCA 1WG8A 1C2YA 1P4HA 3AJEA 5KOYA 4RPLA 4DLXA 3A9VA 3T7AA 2EG5A 1KMHA 1UFVA 4E5MA 1LDMA 6PFKA 2PANA 3FYUC 3PUHA 5H5JA 1ONSA 1U2DA 1M33A 1FXUA 4YP0A 4D42A 1QGOA 2HGZA 3HZRA 3LXMA 5J59A 4UQOA 1VE1A 3KZXA 3Q3JB 4QOGA 4GQBA 4Q7KA 3ZYCA 1TD1A 1JIUA 2OGSA 2Q27A 4G25A 1WPXA 2Q28A 1U0HC 4QOSA 3DCJA 3CWCA 1OTYA 1DVRA 1X7YA 4BNWA 5L4NA 4PYRA 4TZTA 3CUYA 1KRXA 1JLLA 1OWMA 1R0ZA 2M6SA 5ELMA 1BMFA 3ZJ4A 5IAAA 2EIHA 1H4QA 3P2JA 1T1RA 1NBME 4CQNA 2XB8A 1SVMA 4M22A 2ZKLA 3B3GA 4MR7B 1E4OA 4DW8A 3MRXA 3FCAA 3AHEA 4UHJA 2ZTUA 4D9BA 3O2SB 5J4VA 3GBSA 3HACA 3ZEIA 3LO8A 1Y1QA 4G0UA 3C85A 2V4ZA 4EKDA 1FP4B 4J8PA 4F5DA 2YN4A 4KQWA 3SSOA 3I4LA 1DPGA 1J0EA 2H0AA 1LDBA 3FX2A 3H1AA 3Q3CA 3QI2A 1OFIA 2B4QA 2GN2A 5CK5A 2V5AA 3AU8A 2WNHA 3E5RA 4KSBA 4IDEA 5FI1B 2JIZA 3ZN2A 5DLPA 3ZIAD 2QG9A 4RKEA 1GKIA 3GROA 1FS5A 4K2HA 1DRUA 1HOXA 2FTKE 4MPJA 2GN8A 1I94B 1GNTA 1KMNA 2C2KA 4BYMA 2WNSA 3UICA 4PAMA 4D9KA 3L02A 1JE0A 3MT7A 3QBTA 4Y7CA 3TNYA 4XWGA 3VVMA 4BN5A 1NVUQ 4E51A 3FFBA 1X1BA 1BA2A 5KJ6A 1F2TB 1T5TA 2CFIA 2FP4B 2GD1O 3FDXA 4U02A 3RUPA 4HQOA 1GDHA 3HZZA 4O8ZA 3JARA 4FHCA 5T8KC 2XH8A 4R6WA 4UPEA 2J8ZA 4X64B 3FOFC 1G1MA 3NETA 4XX0B 2VNIA 1OH7A 2FPOA 9MHTA 5A0VA 5D5PA 2BMDA 1P8AA 3H9QA 2RIRA 3K0AB 1B4DA 2YJTD 4PC6A 1GZUA 1U1FA 1WU8A 1Y4ZA 2G1KA 2GPYA 3C3WA 4JJ7A 3KLBA 1VHTA 4JLOA 1RQ7A 5CLJA 4MHTA 2GHRA 3PV0A 2WIJA 4WKGA 1JEYA 1SPXA 1I6KA 3FRIA 1OU4A 3K16A 3V8NA 5EXTA 2X23A 3EGOA 3I01A 4N7RA 1KYYA 4PBTA 3WL6A 4Q05A 3QVXA 2FSPA 4ZU1X 4JDPA 5AUOB 1DG1G 1K9SA 4Y2XA 5L3VA 1RCFA 3L1KA 1OGIA 2J48A 4HDKB 1GCGA 5EQTA 4IZIA 2Z09A 3K9NA 4NABA 5H3HA 4YQZA 1R00A 2DUNA 2HI0A 2KW5A 3EVAA 1S2DA 1XP8A 2V0CA 2WWHA 2FOXA 3PNMA 2R6AA 3KBBA 2EJBA 4G5RA 4MB2A 1QPZA 1JI0A 4Z51A 4RIGA 2DUMA 3HFRA 1KIMA 3PGXA 1I3KA 4Z9XA 3D3EA 1ABBA 4V1CA 2BM8A 4YRJA 4BU1A 4N7JA 4Y2PA 1S2MA 5DGHA 4AO8A 5J4KA 4YJ2A 3E9CA 5IAKA 1A50B 4Z0TA 1MC4A 1U2EA 2QU8A 4OQDA 1EDDA 3WZMA 3V55A 3DDOA 3H5WA 3ZI0A 1C80A 5IU6A 3A2KA 5HJ7A 1I7SB 5AD1A 1GAJA 2PKQO 2XT0A 3OJCA 5IKEA 1N2GA 2QZJA 2IYNA 5I3ZA 2DHDA 1V1MA 1YQDA 1HWYA 3PQCA 1EFRA 3AYZB 1ISSA 4V0SA 4BFVA 2ZVDA 4G1UC 3JY6A 3ZY5A 5KSPA 3ICWA 3EDYA 5CNIA 1N5OX 1GARA 2QRLA 2A9VA 2W9XA 4B4KA 3SFZA 5DP1A 2EZ8A 5ELXA 4BKUA 4DYVA 3BJZA 1E9AA 2X1LA 1P0FA 1TTPB 3E23A 3G2KA 1CY8A 1KBZA 1OXTA 1XXHB 3I4CA 1Z12A 2QQ0A 3B70A 3DXFA 4GKBA 1Q1AA 4R2IA 2OVFA 1NFRA 2VLBA 4BNGA 3KQSA 3D02A 5DTIA 5CB6A 2RBGA 3H8VA 5EHZA 1A69A 3TLEA 3UN1A 2C8LA 5ITZB 3KQWA 2JFZA 5L7WA 3ND8A 2ZYIA 3TSCA 3RPEA 4K7JA 2PT5A 2JCGA 1L5LA 5SYAA 3SX2A 3MGGA 4YDRA 1V3QE 4BRWA 5BT9A 16PKA 2DP4E 2Q3HA 4AWBA 1RP1A 1FXWA 3LPDA 4DS3A 5KTOA 4KAJA 1PV4A 2CJXA 1FYXA 3N2LA 4CQMD 3OEHA 3V6LA 2JNWA 2VPPA 3RRFA 3ZTWA 3TNFA 1LQTA 1X0XA 1PYDA 1K8ZB 5AJVB 4PXAA 1ZHHA 4F8EA 5B58C 2GYYA 5JDIC 2NZWA 2C04A 2A9KA 1JAHA 1SD1A 4ENSA 4N41A 5AI9A 2XTZA 3F3YA 4W5TA 1TRKA 3OTWA 3QITA 1RPTA 1Z2OX 1M6EX 4JELA 4MP3A 5I5GA 4JYPA 4AECA 5JZMA 2D2VA 2A30A 3EVEA 3NG1A 2VK8A 3FMGA 1DU4A 1JAYA 3P4UA 1GO2A 1U11A 1O77A 2O1WA 4HYQA 5CCDA 1AY0A 1C14A 4ZYUA 1JZQA 5BPHA 3LCRA 4JB0A 4XGIA 1I2AA 1UIMA 1Z28A 3BRSA 3OQHA 5EXEA 3WV4A 1JG6A 2IKSA 3N75A 3L92A 4Q3OA 4CQJA 4V02A 3U39A 3E2PA 4NMWA 1AD2A 3KJIA 3Q10A 1CETA 1NNI1 2JLAA 5TF0A 4KREA 4OKIA 5HG0A 4LNUB 2V0NA 2QROA 2ZT8A 4JKOA 4DRYA 3H3FA 1APBA 3SYKA 3C24A 4DSUA 5JJBA 4A10A 3O03A 3F7TA 1M6VA 4CJXA 5C8YF 8ATCA 3N0VA 1MH1A 1MA0A 1N33B 2PXCA 2IY8A 3A9WA 2P2LA 3BMQA 5KYYB 2DFKB 3QWFA 4GYKA 1HNNA 2O5CA 1BGVA 1E6LA 1R0KA 1KI9A 2VBFA 1Z45A 1AXGA 4DV5B 3LKVA 3TX6A 1GVNB 5I8PA 4RXTA 3I8OA 4BQNA 3S5UA 3FI0A 4YUAA 2PH1A 2WFLA 3RS5A 1PEKE 1I24A 2GBIA 4AP5A 1X1CA 1ZBDA 4GQIA 3UV3A 4B84A 5JAOA 3PXEA 1YK1A 3LCVB 4ILEA 2QE6A 5EJIA 4LBYA 4J6EA 2DR3A 2NUPA 2X2PA 4UD2A 2G17A 1J70A 2ECQA 1GCOA 1KVUA 2HXSA 2AXEA 3I58A 3U44B 1KYQA 4PEVA 3SI7A 2ZYAA 1SXJD 3LTNC 2WAOA 3UBTA 3PQ5A 1N2EA 2NSHA 3ZLBA 4DTIA 3HKEB 4NZYA 3F9CA 4C89A 3EIOA 4C4YA 1E1DA 3QUCA 3I30X 4RAOA 4R1TA 4P38A 1E2UA 1KAQA 5FBRB 3WGHA 2G4CA 1XQ6A 2Z2KA 3WAKA 5FORA 3DCYA 5B2EA 1MO2A 1U3GA 2R9VA 3ELYA 2C2OA 1JU9A 4P3XA 4CCYB 3T7DA 4QQKA 1ZG3A 5LOVA 4KOEC 4ER5A 3L01A 2PT7A 2YICA 2IBMA 2QUKA 2LDBA 3K1ZA 5EKTA 1NW9B 2UYGA 4FJ0A 1USIA 4EG0A 3MOGA 5CX1B 3GGDA 2J3KA 3UYLA 4QE3A 2JBAB 3NIBA 4ARZA 5T8KA 3A9CA 2XY4A 2WK1A 1VJ5A 3WRXC 4F9GA 1N2SA 1M8KA 4YV1A 5JAHA 4H35A 5KINB 4LFAB 2PPVA 4RZQA 1KIAA 4L5IA 2Z8XA 3EEFA 2R96A 1D2MA 1TAGA 3WP0A 4A2WA 4J2OA 3R0XA 2WMNB 4ALIA 1E18A 2P4SA 2XQKA 1KQGA 4PPNA 1PT5A 2VJOA 5IC6A 4DNQA 1T43A 5K3SA 2VXBA 1ETHA 1YRBA 1Z4LA 2JGLA 2X4DA 4OYYA 4QBKA 5JLAA 2OQVA 4D8TA 3UJ3X 4JEUA 3RBVA 1X70A 3OLWA 4A6XA 2C1EA 2WR8A 5EWMB 2ADOA 1QUEA 1ZGJA 1IHPA 1JWAB 1N9KA 2R48A 1RPNA 1W2GA 1R4MA 3OTIA 4LOLA 4MRPA 1VB5A 4HOYA 1OYVA 5CPBA 3T3DA 4AWAA 4BZQA 3E70C 2Z2ZA 1LBTA 3B9BA 4RSGA 4UREA 1S2OA 3AUAA 1T6YA 3K72B 4AX4A 3C97A 3ESAA 1DWOA 4BV2A 4GOOD 3LXUX 4KH1A 4NYMR 4EBFA 3S4YA 3H2KA 1NBWB 2ALJA 4FBGA 2GBLC 2MMGA 3BD9A 4BNHA 1T25A 4EJ0A 5JPDA 1HDIA 3ICCA 5AT1A 3VO9A 1JVSA 4BTVA 4LHVA 2EKLA 1ZI9A 2XDYA 4TS4A 4WKNA 4ZAZA 3ORSA 3V4PB 4DG8A 3QKIA 1IOWA 1KAEA 5JTTA 4YT4A 3EXHC 5GV8A 3ZS9A 3EXG1 3RS0A 5M5BA 4G9BA 4UXHA 5DNUA 1P74A 1XB2A 3A4MA 4BB9A 3NWEA 4E33A 5GM2A 1XVAA 4QHYA 1PP4A 1ULTA 3PB3A 5IMBA 5IABA 2C83A 5TQ0B 3JYPA 2QMYA 1J90A 4RVFA 5ER6A 3KVVA 1FB5A 2H2HA 1JTFA 3WGGA 1ZJYA 3KZVA 2W11A 5TY0A 2N0SA 3H99A 5AUNB 1P2UA 1ZITA 3CLTD 3AI2A 4N48A 4C29A 1U9CA 2GM5A 2FVYA 2IXDA 2H1CA 3B3QA 1U0RA 2HGSA 3E8SA 3FZNA 3LNCA 3M82A 4NX2A 1VG1A 4X7BA 2Z0MA 3UCXA 1SU7A 4IRUB 5JCJA 1B3RA 4FIDA 1G20B 3VOAA 4EHHA 5F3WB 5KTPA 2ZRFA 5C52B 5IH3A 2QUBA 4JLMA 2XRZA 3IJ5A 5KKCA 4M0CA 1ORIA 3JVVA 3QOYA 5MFPA 4CF3A 3QNMA 2WAXA 3TIGA 3I5YA 2JFQA 3IKJA 4W9NA 1W5EA 4QVKA 3OPVA 3OZEA 1JEDA 1K6MA 4OBEA 4DLTA 2LWIA 3QTLA 2IV7A 3OX1A 1R7RA 3L06A 3ONVA 4CKXA 1GNSA 2EJCA 3W4JA 1SCUA 3EVZA 2I4TA 3VDRA 2D2XA 2Z83A 1OHHA 1W47A 3HY6A 1NJ8A 1GA4A 5EP3A 4TWRA 5AYVA 5K9ZA 2XLCA 3H0KA 4R1UA 3STYA 4A9AA 4FHEA 4G4SP 3LUCA 3ZCRA 2Q1UA 5B4VA 5M29A 4GC9A 3KELA 1DPFA 4ND5A 1C9KA 5F7JA 3K35A 2WJ3A 1MTOA 4LXQA 3DUFB 4WOCA 3LBHA 1SEPA 5JY6A 2K7ZA 1ADCA 1WUIS 4RPGA 2PKXA 4WXYB 4AK9A 4TL6A 2VTKA 4K5QA 3BFPA 2ST1A 3D6VA 1QC5B 1A72A 1RKUA 2A84A 3NO4A 4Y9TA 2I2AA 2PSEA 3ZX4A 7ABPA 2QQFA 3SBDA 1NFFA 1KSHA 3ABOB 1OIVA 3F2IA 4N54A 4M49A 5HQ3B 4UJ3A 1SBTA 3I2YX 4IRMA 3PNYA 2GEFA 3TSAA 1VMAA 2R7MA 3NTQA 4U7FA 3MMZA 1QWSA 3O4JA 3M6MD 4P83A 5HMLA 1E9VA 3SJZA 1SZPA 5I7VA 1UL1X 3QQPA 4XEUA 1H8HA 5ILOA 3WMEA 3O84A 3SNHA 1KP3A 4MQ5A 1PFGA 4DANA 2J85A 4DPLA 4M0PA 2C4WA 2ZLBA 4UFOA 1ZN2A 4FMDB 3RGWS 3VZPA 2CNDA 3LC2O 5EY5B 3R9XB 2XA9A 2QRVA 1IB0A 2BEUA 2FUG1 2XA2A 3B1VA 2ERXA 1ODCA 3DOUA 3PRKE 4HYYA 4QU0A 4UATA 5ALFA 3I28A 1H23A 3ZY4A 1GTG1 2GUWA 2PX6A 2Q4OA 4RX1A 5D5QA 3A0UA 4AWXA 5A3JA 1RQXA 1SQSA 1VC2A 3OZUA 2PS9A 4XRRA 3JD4A 5BO5A 4CL0A 2C3YA 1M72A 5KC9A 3C6MA 1KBOA 2EYUA 2I8AA 2P67A 2I6TA 1H8HD 3GV0A 121PA 4N82A 1KKLA 2EWWA 1QOQB 4URHA 4C06A 1YDGA 4O4IB 4ZHSA 1XLWA 2QBYA 1GNLA 1P0IA 4F5WA 4IDOA 1RHMA 4FGZA 3PS9A 4YUVA 4R81A 2ZR7A 4AVYA 2Z2YA 3L8YA 1DOZA 3M70A 5L3ZA 1B23P 1YRYE 1B0PA 2O0JA 3HVKA 1PYGA 4DR3B 2NV0A 3LS2A 4OBBA 4ZVMA 5GMOA 3C6XA 1G6OA 1XO1A 2E82A 3IUSA 4K6KA 5GM1A 2VDJA 5HE9A 4B44A 4QDUA 1PK7A 1R5BA 1YJCA 3ADKA 3UMGA 4D46A 2YN2A 1E8DA 4LV6A 4C4XA 2QAIA 5EUBA 4OIMA 1V4NA 5FLYA 1KWGA 3LX4A 2FR8C 1IXZA 1IPHA 2WG2A 3EA5A 4FX5A 3N8DA 3W9SA 3UZUA 3CH7A 5KUTA 1D03A 1XTUA 2CMDA 1HM5A 3IMKA 1DAIA 3EQZA 4KQ9A 4W8OA 2FSVC 3TVTA 4TYWA 5KNBD 1EFHA 1Q1EA 3ROGA 4CL8A 8ADHA 2C3MA 4L4RA 4BGEA 4WXMA 5GZ3A 4HUQB 3VZQA 3L0ZA 1NKTA 1UFKA 1YR7A 2HF2A 2NADA 1T2FA 3LDHA 4XR4A 2WINI 5DDIP 4F72A 5JSFA 2PRSA 3GJYA 4MRSA 3QJGA 4Q03A 4CTOA 4DV4B 2FZLA 3BBPA 4GVXA 4YRPA 3FSRA 1B8NA 3FWHA 1ZCBA 3R7BA 5E8RA 2D4AA 2PJUA 1T3ZA 4E4YA 3PYXA 1D4ZA 3EODA 5B55A 2IIQA 3KQTA 1YJXA 3NHUA 3DOCA 4QC2A 1XCGB 4R31A 2GYUA 2ZUEA 2ZU6A 1IZ0A 3FLMA 1N1DA 2PGIA 4F3CA 5HZKA 1GZSA 2CWWA 1F1JA 2CT8A 3MJCA 3NVDA 3OCCA 4PC2A 5FOXA 1DCMA 3I4FA 1QRUA 1L4NA 4ARSA 1CFJA 3G2LA 4DNFA 3ZDZB 3F3KA 1QHXA 1YA8A 4H1UA 4TTVA 1C0PA 1DC7A 3ONEA 4D9EA 3TVYA 4GUDA 4L4ZA 1Y9ZA 1L5QA 4Q5IA 4CUKA 1UDAA 2DFLA 5KSOA 2XTJA 4W7IA 1XF9A 3BD7A 4CKYA 1A82A 1I01A 3UMMA 3REFA 4E5KA 2G8NA 5CEFA 3IP9A 2QU7A 3ZWCA 2DPYA 4RAQA 1PFQA 5AVYA 1TUIA 4BKMA 1G21B 3X1YA 3IVGA 5C53B 4RKYA 4IDPA 5BVGB 1M7BA 2ZIUB 4P34A 5D8DA 2RK6A 5KYXA 4S2UA 3I52A 4B3XA 1QTIA 1Z47A 1THGA 2Q2VA 3CVOA 2V0GA 1VECA 1Z4OA 1L7RA 3AJ9A 4KWHA 1ORDA 3PNLA 1PS9A 2JH3A 1C4OA 2YHAA 1FRQA 7REQA 2E1PA 2CSXA 4RIEA 3QJ5A 2AFIE 3JZIA 5F3DA 2O8DB 3KG2A 3R6WA 4KMOA 3K0EA 1DC3A 1JJBA 4FE4A 5DHQA 3OE4A 3S2SA 3T5GA 3LT2A 4J1TC 3FVQA 1AO3A 1DRVA 3LA6A 2IGTA 3A28A 3CZQA 3HBLA 5IXSA 3F3SA 3IEUA 3RVNA 2OTCA 3KP1A 4MPRA 1YQQA 4DXDA 2G40A 3L9XA 4FZ5A 5JZOA 4IWXA 3ZGZA 3WLOA 1G2IA 4EY6A 5M7EA 5IM4A 3E48A 3DKKA 3HMKA 1FEZA 3N86A 3R7AA 2VJAA 5E7MA 2ACKA 2BCGY 2OYRA 3ZV3A 4XFJA 4R8MA 1I80A 3EXFA 1GPH1 1QRSA 3FWKA 2I4IA 2D5CA 3U6KA 3R0IA 2B82A 5J4YA 3EJWA 2E4ZA 3I9V1 3TD2A 4N03A 3R5XA 2CCGA<