1XRNA

Crystal structure of active site f1-mutant e213q soaked with peptide phe-ala
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNQFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 107
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrnA00
4E11A 2QKYA 4LIPD 3WIBA 1XQXA 2GBCA 4X3CA 1YASA 1PV1A 1CUAA 4MEAA 1EXWA 1HPLA 3JYHA 4RE6A 3K2IA 2X5XA 2ZYRA 1CUFA 2IX9A 2VQ6A 2GBIA 4EZIA 1RWQA 1CUSA 2QS9A 1JT2A 4X95A 1SCIA 3L1JA 5AK3A 5CT8A 2RGUA 3H2IA 3WYNA 3B3QA 2BUCA 4MEBA 1YA8A 2VT7A 1ACJA 1XZEA 1LPNA 2CZQA 3O9MA 5K3FA 4K6KA 3WK5A 4DTCA 1XRMA 3A2NA 5ALYA 2WJ3A 3WK4A 1QTRA 1TQHA 2JGLA 3GUUA 2XUGA 2XLCA 1C4XA 5ALDA 5FP0A 2W22A 3PF8A 4B7ZA 1L7QA 1U8EA 5FKJA 2QR5A 3LCRA 4PQEA 3R3ZA 4G4IA 5T4FA 3MUOA 1BEEA 1BS9A 4ZGBA 3QVMA 3TRDA 3G9XA 1EH5A 3DDUA 2CB9A 1ZI8A 4WDRA 5JZ9A 4EB0A 2E3JA 4KYVA 2XUKA 1XZMA 2G4LA 1PJAA 1DWQA 4CFSA 1OCEA 2ACKA 5BWCA 3C6ZA 1SOMA 3FNBA 1JMYA 3HACA 5D3KA 4WFKA 4BAZA 2I3ZA 4X7BA 5ALXA 1CUIA 3G0GA 3UUEA 4UPDA 3G7NA 1QIIA 3DD5A 1F6WA 1KU6A 5AI6A 4BE4A 3AIMA 1XFDA 4EY7A 4G4GA 4CG1A 1Y7IA 1UXOA 2O2IA 1WPRA 2VEOA 1ZI9A 4NMWA 1XZGA 4C01A 2WIJA 4CG2A 1C7JA 1H2WA 2PUHA 3ESDA 1ZIYA 3DYIA 4B81A 5JD6A 1MAAA 1KEZA 1W75A 3S8YA 1MJ5A 1YAHA 2AJLI 1G42A 2QRUA 4G8DA 4QDUA 1ZGBA 1CUVA 3AZOA 3C87A 1XZLA 5CT5A 5EGNA 3H2GA 1DINA 5K3DA 3AZPA 4KRYA 3G0DA 2DHDA 4E46A 3O9VA 3A6ZA 4F21A 4X90A 1VA4A 5DTIA 3WKEA 5AI4A 1QO7A 4HXEB 1R1DA 4MJ3A 1VA5A 1IZ7A 5AKKA 4KE9A 3WL6A 3STYA 5JANA 1WCYA 1EDBA 3M83A 3MGAA 4GLBA 1TCBA 4HS9A 3PUIA 3PF9A 4BZZA 1TIBA 2ZJFA 4LKOA 1VXOA 1GPNA 4H35A 1E5TA 1E8MA 4FNMA 5HFAA 1OILA 1XZBA 1CUEA 3WI7A 4Y2YA 5ALRA 1E3QA 1U4NA 4UUQA 3FSGD 2PU7A 2XQFA 3KXPA 4B9EA 3STUA 4Y2PA 2H7XA 3QPCA 3RM3A 4U2GA 5LZ7A 1AURA 1DX6A 3R3UA 3N0TA 3I1IA 4JUIA 5AI5A 2WHPB 4GBGA 3P2MA 2PKYX 3KWJA 1CUWA 3G8YA 3RKSA 2GYUA 1W1IA 1WM1A 1XZJA 3FWHA 4FFVA 5HF6A 3FVRA 2VJDA 1LNSA 4AX4A 1O6GA 5EIHA 1C7IA 1TAHA 1QIJA 3F9CA 3WLAA 1ZD4A 3MVEA 1XRLA 1QZ3A 2HADA 3ANTA 2Z5GA 4L72A 1DQZA 5CT6A 3OURA 2I78A 3PFBA 3G0CA 3H18A 5A71A 2PSJA 2PSEA 1DT5A 4J03A 4MQMA 4J0KA 2RONA 5AOBA 2YH2A 1CUGA 2P8SA 4AZ3A 2HM7A 2VF2A 5DWDA 3PE6A 1XQYA 2V96A 3A70A 4AZ0A 5CH5A 3H1BA 5DLPA 3G9ZA 3W2TA 1E8NA 4ZI5A 1R50A 2Y2VA 4MYSA 4X6UA 4N8SA 1XZAA 4Z49A 4KE6A 3EBLA 5AI0A 4BVLA 2OQIA 3C6XA 3BIWA 4WCVA 4X00A 1VLQA 1H23A 1GGVA 5BWBA 1EB9A 3ESCA 5H3HA 1ZD5A 3U1TA 3I6YA 3I6ZA 3O95A 4YASA 5AOAA 2AJDA 3BDVA 1LGYA 3LIIA 5HK9A 2Q0XA 1AQLA 2WG1A 2HA4A 4A16A 3KWFA 1W6RA 2JEZA 2WM2A 3TGLA 1ZJ5A 2JGEA 3FSGA 2XI4A 2NW6A 4NVRA 4ZWNA 1EK1A 3PI6A 3FYUB 1LPOA 4BAGA 2ZYSA 4FNGA 3WWPA 5I8PA 3GELA 2X76A 4OB6A 3RK4A 4IQ4A 5AIAA 1H22A 2AJBA 3KD2A 3QH4A 4EBBA 2OPHA 5K3BA 3T4UA 1QLWA 4FOLA 1DWOA 1ORWA 3C8DA 3WJ2A 2PSHA 5AKIA 1A88A 1CUCA 4KRXA 4X85A 3AJAA 3HXKA 2WHPA 3M81A 2FJPA 5ALHA 5HQ3B 2VAXA 4UFOA 4PSDA 4Q82A 2UZ0A 3L1IA 3C5VA 4QWMA 3GFFA 4J0HA 4H77A 1FFDA 3FVTA 1XZDA 2WHQA 3FYUC 2XMZA 1K5PA 3B5EA 3FBWA 2Z8XA 1QIDA 4GEGA 2HA5A 2G5PA 1TKRA 1LLFA 3BF8A 3WKBA 4FLEA 4BTVA 4BP9A 2WTNA 5CBKA 3KSRA 1XZIA 2OCGA 1QOZA 2RHTA 2XMGA 4RGYA 5A6VA 5JYCA 5IKXA 5ALKA 4B82A 3WA7A 2VT6A 5AICA 2ACEA 1XLUA 1K8QA 3BJRA 1T2NA 4S0XA 4U2DA 3WL5A 1IMJA 4J0JA 2FJ0A 2RAUA 4GDMA 4OU4A 1EX9A 5AIBA 4B0OA 3C8HA 3BE8A 4G5XA 1UT6A 1P0QA 1CUYA 4BVJA 1DU4A 3JWEA 6YASA 3QMWA 4IO0A 2DCMA 5CT4A 3LS2A 4OU5A 5AP9A 4Y2JA 5ALMA 2HU8A 4QDXA 4J0DA 3WJ1A 3D59A 1JJFA 2ES4A 4I4CA 5CURA 1VXRA 2BUAA 1HLGA 3F8SA 1AGYA 2YASA 2JIDA 1ZJ4A 5FV4A 4AN1A 4BC1A 5EIAA 3X3HA 4Y2VA 3JW8A 1CUBA 4W1PA 4GI1A 3WWCA 2XUAA 2D5LA 4OUKX 2J3QA 3W04A 2V9ZA 2XUPA 1N5RA 1MX1A 4AMZA 5LLSA 3D4LA 2CUTA 5C81A 4OYLA 2XUQA 4G9EA 4IH4A 1JJIA 1LPSA 4PO3X 4GXNA 2B20A 2LIPA 3BL8A 1GQRA 4L0CA 2WIKA 1E8DA 2C5FA 2B4KA 2H7YA 4UBNA 4WFJA 5YASA 3DNMA 1A8UA 5HZGA 3IUQA 5JAHA 3W05A 5EHQA 1Q0RA 3V48A 4W63A 1DX4A 4MWTA 5ALTA 1ZI6A 5K3CA 2ZYIA 3VJKA 5ALIA 4G4JA 1BN6A 2ONCA 1YA4A 5ALFA 3F97A 5E2IA 4N8EA 4WJLA 1QFSA 3DJYA 1MX9A 1N1MA 2QXUA 1JKMA 1G4HA 5AKZA 3C70A 3S2ZA 4LHEA 4WY8A 4PSUA 2Y1KA 3KOOA 5AO9A 1F0PA 4U2FA 4JEIA 2JEYA 4BP8A 2ECFA 1IVYA 5JAUA 1UFOA 3N2ZB 3AIKA 1CPYA 3E1GA 1EK2A 3GBSA 5JZBA 4CCWA 4UFPA 1F0NA 2Y6UA 5CXXA 1XKTA 2XQIA 3Q8WA 3QMVA 1IUNA 3EQ7A 2DQYA 2WKWA 5LZ4A 4UBMA 2HRQA 5C8XA 4NS4A 5AM2A 1QIMA 4NZZA 4AO8A 4ZV9A 3C6BA 4EY8A 4FLFA 5JZSA 5FUMA 1B6GA 2ZJ6A 4DNPA 3QITA 2DHCA 5HFNA 4UBIA 3AILA 2VJAA 3VVLA 1KU0A 4PNZA 5IVKA 1YCDA 4Q3KA 4HTAA 3HLKA 4C89A 3AFIA 4OCZA 4BATA 3FAKA 4QE3A 2GZSA 4QDOA 3TJMA 2Z3ZA 1I6WA 4KE8A 1CEXA 4H7FA 4BDSA 2C4HA 2J4CA 5T4EA 1XLVA 4K2AA 1ODCA 2BKLA 3R40A 1GPLA 2B61A 1R9MA 4JH0A 1TCAA 1GKKA 3FLBA 3QBJA 1IZ8A 5DYYA 5JAOA 1SC9A 4H7HA 1BCRA 4Q3LA 4W1RA 3STVA 2VAVA 3OC0A 3IDAA 4B80A 4AN0A 3DL4A 4W9RA 2HFJA 3DS8A 2WFLA 4KAFA 4Y9SA 5HKBA 1SCKA 5K5EA 1J07A 1VZ2A 1XRPA 4LXHA 4ARBA 5ALOA 4PSCA 4U2CA 2C7BA 3I2KA 2WIDA 2BAGA 3IULA 3C5WP 5CH8A 2V98A 4J0CA 1FFCA 1FFAA 2PVSA 1Z68A 1AC5A 2PBLA 2OCIA 3GROA 2WILA 4J0IA 1QE3A 3IUNA 4FWBA 5KBYA 3AZQA 5AKEA 1QTIA 2JGKA 1Q0ZA 4FFWA 1L7RA 3CXUA 1QFMA 4HRYA 1XROA 2OGSA 4KEAA 2XUFA 4M0MA 3D2AA 3STWA 1R9NA 3WWDA 5AK5A 1UZAA 4OPMA 4MXDA 2ZSHA 3STXA 4UHHA 4ROTA 1IUOA 2WJ6A 2QJRA 1D07A 3F67A 1UK9A 1CIJA 1QIEA 2WLSA 1WB5A 1CQWA 5JARA 3VISA 5AKJA 5C7YA 3E3AA 4K5QA 5AHXA 4ETWA 5I9IA 5LZ2A 4L3WA 4MYDA 5E4YA 2VJCA 4M0FA 5HKAA 1U2EA 1WOMA 4AQDA 2DHEA 2PL5A 2O7VA 4DMHA 1VKHA 3EF3A 3WK8A 2W6CX 1QIFA 1PFQA 2QUBA 1A8SA 2EEPA 4BCCA 5D7BA 2XQKA 4HVTA 1FSSA 2XDWA 2CKMA 4DIUA 4QDZA 3ILSA 1X70A 5HF5A 4KE7A 1CV2A 1EVQA 3IA2A 3GZJA 3V1KA 1TK3A 3WL8A 2RHWA 4OYYA 3I2FA 4X91A 1CQZA 4HXGA 2RIPA 3BDIA 3E0XA 3BF7A 4QEKA 4I3FA 3DOIA 4BDTA 2AJCA 5CMLA 4LYDA 2OQVA 4PV7A 4F5ZA 5EHZA 1Q83A 2R8BA 2XUOA 2OLEA 3HJUA 2XLBA 3R3WA 4EY4A 2QM0A 1UKAA 5C8ZA 2OGTA 4P92A 5FDFA 3EQ8A 1XRQA 4FHZA 4W1SA 1UOOA 1YR2A 2I3DA 1SFRA 3T52A 5IVDA 2BGNA 1UK7A 4QWWA 5DNVA 4OSEA 3VJLA 3CCCA 2GBGA 2ZVDA 4BZWA 5ALJA 4UHBA 4BCDA 1CVLA 3DCNA 5DYWA 4Y2RA 3M3DA 1BRTA 3I28A 3D7RA 5AKXA 3ZLTA 4N5IX 1W76A 1UK6A 1N8SA 1M33A 4F0JA 2OG1A 4FKBA 1UOPA 4J3JA 4EY6A 2PU5A 1BCSA 4GECA 5LZ9A 4QLAA 3I2GA 4EA6A 2JF0A 4DNOA 3OM8A 3ZLUA 1EINA 2G63A 3A2LA 5C8VA 5ALWA 1R3DA 1LPMA 1X2BA 3OPMA 1YB6A 5JADA 1RYYA 4C6HA 4BYMA 5KWJA 2XMDA 5E4TA 4BBZA 1VJ5A 1CRLA 3M82A 1H2YA 3R41A 4H7DA 5K3EA 1Y7HA 4P93A 4X6XA 1FFBA 2J4FA 3STTA 1LZKA 2DQZA 2XUDA 3IB3A 1L7AA 1WPXA 4YX9A 1P0IA 1K4YA 4FTWA 1MAHA 5AOCA 1SCQA 3WMRA 4AB1A 3IIIA 3WWEA 2VSQA 4JYMA 2C58A 5ALVA 4GWLA 3W9BA 4G1FA 3QZUA 1UWCA 2HA7A 2CJPA 5CTAA 4UBOA 5LZ5A 1GXSA 3I6MA 4BRSA 1BEZA 2HRRA 7YASA 4CG3A 1HBJA 3VDXA 2QUAA 4UBJA 1ISPA 4QDTA 4L9AA 1WB6A 4Y7DA 1NU6A 5AKHA 3GA7A 4QLOA 3NWOA 2JGFA 3I2HA 3DEAA 4V2IA 5BV7A 5DTJA 4DGQA 1ZICA 3WIOA 4C4YA 4RE5A 2CMFA 5A7GA 3W06A 1Q84A 5ALNA 2ZSIA 2C5GA 3SC2A 4HRXA 3D2BA 4XWGA 1ZIXA 1K6EA 5JIBA 3QPAA 5AK4A 1P0PA 3SWWA 3H19A 5T4HA 3BJMA 1JU3A 2PX6A 3E4DA 2WTMA 5HQ3A 1AUOA 4DLNA 1UKCA 3O4GA 1GPKA 3ICWA 3AINA 1YSCA 2OAGA 3O0DA 3FLEA 4JYPA 1P0MA 4MWSA 3Q0TA 5ALUA 4C4ZA 1GQSA 3WK7A 2QTBA 4HZGA 5ALSA 2G5TA 3W9UA 4YPVA 1VZ3A 4B0PA 4GW3A 5A7HA 4RNCA 4WY5A 5D3ZA 5HCUA 2HDWA 2WFZA 1LZLA 4ZV7A 3I2IA 2DFPA 4LXIA 4Y2UA 4DYHA 3I1YA 4FLMA 3PFCA 4RPCA 3D2CA 4XJVA 5EHXA 4KJXA 4N5HX 2HA0A 2Z3WA 3V1NA 4X93A 5ALQA 4QNNA 2OXEA 4F60A 4B9AA 1QJ4A 1H2XA 2XUHA 3FCYA 3DKRA 4C87A 3NUZA 3H2HA 4I19A 3G02A 1BROA 4EUSA 1THGA 3G9TA 3RARA 3FCXA 1ZD2P 3PICA 4X71A 3A2MA 5IVIA 3AUKA 5SYNA 5ALLA 1MX5A 2WU4A 4H7EA 4M0EA 5CT9A 3IUJA 4OB8A 1H2ZA 4AXBA 4H0CA 5ESRA 3RLIA 4BB0A 3D0KA 1XRRA 2OCLA 1DT3A 1EA5A 4N8DA 2FUKA 2JGJA 1MT3A 1GKLA 1X2EA 1HDEA 3EQ9A 3IURA 1DWPA 2PPLA 1XZCA 2IIVA 4Q1VA 4QZVA 3CN9A 1ZOIA 5I7UA 4X6YA 1QIKA 2WIFA 3WL7A 2GBFA 1THTA 3BXPA 5LZ8A 1MU0A 1EHYA 4FBMA 3DOHA 1BN7A 1LBTA 1AZWA 2WFLB 1VE7A 3UUFA 1CUUA 4OD0A 1CUXA 1JI3A 3WKDA 4AMYA 2RI6A 5FPPA 4WFIA 4UHCA 4H18A 2DR0A 2VTVA 1DQYA 1F8UA 4A5SA 1Y37A 1CR6A 3MUNA 1G66A 4MQLA 3QYJA 2ZYHA 1QGED 5HK8A 4KAJA 3ESAA 1UOQA 2I03A 1USWA 1WB4A 3HYSA 1J2EA 1CUJA 4E14A 2YXPX 2HA3A 1CUHA 3ED1A 2H9YA 2J3DA 3WZMA 1TRHA 3ZWQA 4INZA 1B41A 4TPKA 5JATA 5A7FA 4HAIA 2BGRA 1U65A 4DNFA 4BRZA 3F96A 1XLWA 2EDCA 2PM8A 1G5FA 3WQHA 3DKKA 3IUMA 1YS2X 1ETHA 5AM5A 2WUDA 1FJ2A 4G9GA 5AH0A 3B12A 3O4JA 4CCYA 2FX5A 4BE9A 1IUPA 4H7IA 2XQGA 3PUHA 2H1IA 3H04A 4GHWA 4LYEA 5LKRA 4XX1A 1QIGA 1QIHA 2Y6VA 2XUJA 5KREA 2OGZA 3HABA 2C0QA 2HU7A 1W52X 5AK6A 2YYSA 3C6YA 1JMKC 5LKAA 3WWOA 1TCCA 1XRNA 5K3AA 1O6FA 5AKYA 3NOXA 3U0VA 3EIOA 1YB7A 5LIPA 1MTZA 3G0IA 4Y2TA 3ZI7A 1LPPA 1WHSA 3HC7A 5AM4A 5HF8A 3CN7A 4P08A 3C43A 4KAAA 1HQDA 4DM7A 1QONA 1ORVA 4C4XA 1CUDA 4B83A 1XZHA 4YK7A 1MPXA 2D0DA 1DTEA 4U2EA 5F4ZA 3WK6A 4O08A 4U2BA 5DNUA 1WHTA 1NX9A 2WSLA 5DJ5A 2QOEA 5SYMA 1AMNA 1LPBB 3R3VA 3FLAA 4X97A 2K2QB 1QO9A 2VATA 4XIIA 4XVCA 3C45A 2XB6A 4H7JA 3ANSA 2GZRA 4BTLA 1LBSA 5AM0A 2Y2UA 4CIAA 3DL7A 2JBWA 4Y2SA 2QMQA 4LXGA 1CLEA 3DLTA 2WFMA 4KR0A 1EDDA 2CEKA 3DQZA 5AM3A 4CCYB 1XZFA 1CUZA 2OCKA 3IBTA 5A62A 2AXEA 3LIPA 1XQVA 3OG9A 2DSNA 1MN6A 3R3XA 2HIHA 3WKAA 1MNAA 1JU4A 3H17A 5BOVA 4CIBA 4EHBA 3QMMA 5CW2A 4B84A 5ISMA 1AX9A 5AJHA 3ZPXA 1BE0A 2WUEA 4UBLA 2BCEA 5JAPA 5K3FB 2JGIA 4E15A 4JNCA 4UFNA 1YS1X 3VJMA 3HRHA 4UHDA 1J1IA 5ALGA 3KDAA 4CI9A 3WKCA 5AI8A 2H7CA 5IH7A 4KACA 1S8OA 3H0CA 3SX4A 2VJBA 5JD4A 4H7KA 2EDAA 5ALPA 3BIXA 4IH1A 2XT0A 2GYVA 5EFZA 3G0BA 5E4JA 3V1LA 3DYVA 2HHAA 1XZKA 2XMSA 3TEJA 2XUIA 3LLCA 1OXMA 2XMCA 3AIOA 2HL6A 1UK8A 5LP1A 2PSDA 2BUBA 1CFJA 1HKHA 5AKLA 3G9UA 1R88A 4K6HA 3V1MA 2AJ8A 5D6OA 2WHRA 4DMCA 4IHAA 1FFEA 3FYTA 5CRIA 1VOTA 5IVHA 3IVMA 4Q05A 3L1HA 2O2GA 2XMBA 2WIGA 2WJ4A 3YASA 2WUGA 2HA2A 4J0GA 3SK0A 2QT9A 3K9BA 3ICVA 3BWXA 1E66A 1BU8A 3HSSA 3I2JA 2PSFA 1MO2A 2Z8ZA 3V9AA 2WG2A 4Y2XA 2QZPA 3NGMA 3OTQA 5AI9A 3WK9A 5FLKA 5CXUA 5EIEA 2BJHA 2GYWA 4UHEA 3VKFA 4TGLA 1R4ZA 1ZD3A 5J3JA 5FOQA 5DYTA 3D5EA 2C0PA 3WYDA 1UKBA 5JALA 4ZRDA 4AO6A 3PDCA 4ITVA 5A2GA 3QM1A 2ROQA 2JGMA 2WUFA 2CBGA 2XMQA 3HZOA 1A7UA 4Q3OA 1ZGCA 4X94A 2R11A 4G8CA 5AM1A 4PW0A 1JJBA 3VXKA 5T4BA 4UBKA 3H1AA 4FDMA 2WG0A 1JFRA 1T4MA 1ACLA 1XQWA 4ZREA 1A8QA 4BCBA 2XMRA 4ARAA 4BVKA 1MNQA 4QA9A 5HF9A 3ZLVA 5JD5A 4B6GA 1GZ7A 3UMJA 3K6KA 5JASA 1EVEA 1K63A 3FOBA 1EDEA 4UHFA 1HL7A 2HA6A 4C88A 3FYUA 2B9VA 4DMKA 5ALZA 2O7RA 4P9NA 4BC0A 2BFNA 2PUJA 3QPDA 1LPAB 3LP5A 4HXFB 4DMFA 1ODSA 4EY5A 2ORYA 1AKNA 5DNWA 3H2JA 4PF1A 5AKGA 3OOSA 4WDQA 4X92A 4FBLA 4B85A 5FPQA 4TVKA 2XE4A 2QVBA 1N5MA 4W1QA 3H2KA 5KWIA 3WA6A 1E89A 5EI5A 2X8BA 4ZXFA 2QXTA 4K6GA 4BAUA 4DSAA 2OAEA 3WZLA 2V97A 3CCBA 3O4HA 1RP1A 2WQZA 4G8BA 5ALEA 3ESBA 3R3YA 1VE6A 4Y2QA 4AO7A 2HU5A 3ZV7A 2O2HA 4D9JA 3VVMA 1EB8A 1NU8A 4DSZA 4J7AA 4OB7A 4DNQA 5EHNA 5FRDA 4A23A 1XKLA 5FXMA 5CH3A 1YAJA 3HEAA 1ODTC 1GT6A 4Q34A 2ZJ7A 2IITA 3F98A 1W4LA 2XQJA 3HI4A 2VA9A 3R0VA 2QJWA 2WU3A 4FMPA 2HFKA 3O4IA 3D3NA 1EI9A 1J06A 4IH9A 5LYYA
chains in the Genus database with same CATH superfamily
4E11A 3IH5A 2ZM6B 3S81A 4AF7A 4CLEA 2CVQA 3AUUA 3HBMA 3WIBA 1XQXA 1YHYA 1R15A 2GBCA 4XARA 4X3CA 3ZVMA 5K0LA 4KFCA 1E2UA 3R9XB 1M6NA 2BHLA 4I1YA 2QUZA 1N2BA 2ZRAA 3NHFA 2Z6UA 3ETCA 3C4VA 3N8GA 3SKYA 1Q1GA 3RC8A 3F4LA 3NHWA 4PC7A 3IDOA 3DA8A 3K2IA 3N2KA 1PN3A 2ZUCA 2ZLBA 2AN1A 2D0OB 1XC7A 1CUFA 2OT3B 2BKAA 2QGZA 2P6UA 2QGNA 1C3OB 2VJPA 2X9GA 4PYOA 3U7IA 1S2IA 3K70D 5I7WA 5H4HA 1Q15A 1QH8A 1T29A 4I8IA 3NM5A 2O8BB 1WCXA 4GOJA 4RH3A 1RWXA 2G82A 4BO7A 4HH1A 2IHVA 2OCAA 5CYPA 1K88A 1K7YA 4AC9A 2XB2A 1QCYA 1CUSA 1NC1A 2QA5A 3H9JA 1SCIA 2DFDA 2HSDA 3L1JA 3QENA 4JL5A 4L16A 5CT8A 1QP0A 2CXHA 3OPYA 2G7MC 2RGUA 4RTJA 1WMDA 3F1KA 5BYAA 3DL0A 5J5VA 2WJIA 2V7VA 2W2PA 3H2IA 3HCEA 3A1WA 3FHCB 3LUKA 1FLNA 5HUQA 3N0VA 5GY7A 1XQ6A 2BM8A 4R0NA 2F4VB 3FOWA 4MEBA 1PRYA 4RIGA 4P4NA 5TQJA 2VT7A 4Z0NA 3VAZA 4E12A 1N33B 4RESA 2BT4A 3RUIA 2X7JA 1J21A 2P30A 4JWKA 3L79A 3URKA 2FSVA 5B1EA 4Z7QB 1X39A 2H1SA 3JPWA 1ZN8A 2ICAA 1LPNA 3KCQA 1FTWA 3KV3O 4PLHA 3RIXA 2UUPA 3IEXA 3O9MA 5LVAA 4NIMA 4P83A 1G20E 1DOAA 5K3FA 4DREA 1TQ6A 2RHRA 1KWKA 5JXHA 1EX7A 5H8WA 5D00A 2F3RA 3AYZB 1HDOA 4LXQA 4MVJI 3FMGA 4IFBA 2V0GA 3KJFA 2XTZA 2Y0EA 1S4MA 2I4LA 4U3JB 3M6WA 4UXIA 3FCUB 2A0UA 2P41A 3P2OA 2V03A 2WF7A 1GG5A 1D1SA 5ALYA 3OE5A 5C35A 4WX2B 1SQ0A 4PYKA 2WZCA 5FBWB 5JDCA 4P34A 1R27A 3BMOA 5DSXA 4KPEC 3CPEA 4IIGA 1RRVA 2JGLA 2RIRA 5AW8A 5CGQB 2XPCA 1I4LD 2DT5A 2OECA 3K0CC 1NOIA 3RS8A 5EJ8A 5ALDA 2YJNA 5CPFA 1GIAA 2VXCA 2W22A 2XKAA 1YZTA 2ZTSA 2R8YA 5IBPA 2IS4A 3TDNA 5GP1A 1U8EA 2JS7A 1IHYA 3NBQA 2DU8A 1NJSA 3CRQA 2B25A 4ZYZA 5K8VA 3VKWA 3EC1A 3CLRD 4PAOA 2P67A 2VSYA 4G4IA 4XB6B 1GCUA 4NCAA 1TCVA 2MYUA 3D4OA 5DSZA 4B3CA 4DYVA 2CSXA 4YJ3F 5KU7A 1BEEA 3CG4A 4DJDC 4ESEA 5B58T 5JSZA 4DQKA 3U6BA 3TRDA 3VYRB 3G17A 3UENA 4LXXA 1EH5A 2DGDA 4ZCSA 2CB9A 3B1XA 1ZMRA 2J6CA 4BLVA 1VJGA 4KQKA 1RMQA 3FUTA 3FR7A 4PLWA 2GARA 2O07A 1V5FA 2XCIA 3NBAA 3WJ7A 1DKPA 2AW3A 4HNQA 3VHLB 3URMA 2YHUA 1SCBA 2DTEA 5IZCC 4Q3CA 4UE6A 1DWQA 4AG6A 2ONZA 2YVQA 5E7QA 3KETA 1C9KA 3GCZA 4QFBA 3ZZNA 4CFSA 4Z51A 1L9KA 2ACKA 3C3XA 4ZRMA 1JHMA 2IIPA 2Q5IA 4MB2A 4GS5A 1NPDA 3C6ZA 4NHEA 3RB8A 3KK0A 2BM0A 4HS4A 5FBQB 3VO9A 3H3XA 3HWSA 1JMYA 3MJTA 1I2DA 4EJ6A 3B9BA 4C21A 2WABA 4LVNA 1KJZA 3AJ9A 5B2ZA 4R98A 1Y5RA 4X1IA 2YN2A 3BMQA 4O4LA 4UDNA 3UHAA 1TM2A 4C7VA 3UUEA 4GPIB 1CCWA 4R2XA 5KYXB 3O1HB 3JZFA 1KSFX 2ZIXA 4JGBA 3JWIA 1Y0BA 2I5PO 4EZBA 4U7DA 5L4NA 1KY2A 4UOZA 2C54A 3NRJA 1BVUA 4E5KA 1VL0A 1C81A 2B34A 3FWKA 3NTLA 2BI4A 1I51A 2VYQA 4JBIA 1UXHA 1PSZA 1OB5A 4K6CA 5KSZA 2X4LA 4C7OA 2UXCB 2OD9A 1Y7IA 5I9NA 2WP0A 2VEOA 2ZSDA 3VNQA 2DFTA 1G5IA 4EW1A 1Y1TA 3VGPA 1PFGA 2LDXA 2WKRA 3BMQB 3CEJA 1Y6ZA 3I4LA 4LHSA 4NMWA 5KX5F 3BC1A 2G67A 4IRXA 1S96A 4CG2A 4WLUA 3AHDA 1U1DA 1SA0B 3GFTA 1H2WA 3EPRA 1B3BA 4TSFD 1ZIYA 2GNAA 2NT4A 4G1BA 4NEGA 3OIDA 4OQQA 4QFDA 4YAWA 5PGMA 1K7XB 1OZHA 4UNPA 2H4ZA 2VYND 1KEZA 1QKKA 3D9QX 4HGOA 3UXEA 4EHIA 2LGJA 4XYEA 1W75A 4DAOA 5C5DA 5MF6A 2VHUA 5KUTA 1IE3A 4ZCQA 2R8RA 4EI7A 5H4GA 2PL1A 2X0KA 4XYMA 5FYQA 2ZWPA 1JQKA 1YAHA 4QPZA 1LDEA 4QULA 5G40A 1JKIA 1YZQA 1P4HA 2AJLI 1WVIA 4DKJA 5I51A 2AX3A 4YBZA 2I2CA 2YHIB 1ZINA 4PSKA 5DYNA 3RKRA 4YV0A 3S1SA 5KJCA 2Q1SA 1H0KA 3EZLA 1ZM3A 3DFKA 5EUMA 1KO1A 3PI7A 2MDTA 3PJDA 2A59A 4ENSA 1ZIDA 3PC8A 3O21A 2FYTA 1H2FA 1FDOA 4JJ7A 3RVNA 4QU8A 1JQDA 2ZETA 4CVNA 2DHDA 1X14A 3EB9A 3A1CA 1O8CA 5FR2A 5KOHA 2ODAA 5K6AC 5TMPA 5J2UF 4DUYB 3A1UA 3H83A 2NPIA 1HA3A 2P2DA 3K0BA 4JI5B 5KMGB 1BYIA 4MV7A 4O4HA 1VA4A 2IXGA 2QJFA 4LXYA 1RWVA 2OV2A 4BJHB 2GESA 2WJGA 3WKEA 4XXHA 3TRFA 4LHVA 3GNLA 1NM5A 4OGWA 4P0PB 2WK1A 1QORA 2ZM5A 4R05A 1ORDA 1VA5A 4K9PA 4R54A 5ED0A 2JARA 4NKRA 4U6NA 5BQ3A 2YZMA 3DXFA 4J0QA 4R01A 4BNZA 3UAGA 4QREA 3WL6A 4OHOA 1KTIA 3O38A 2ENUA 4MRRA 1SUPA 1T4BA 4OXIA 1NGSA 2ZQZA 3QWFA 1EDBA 5JANA 1I3KA 1MVLA 4ICIA 3HVRA 3I0NA 4I6EA 5LUAA 4UVIA 2J7PA 3HCDA 4LGYA 2EG9A 5FBRB 3OZXA 4G0MA 4MKHA 2X0DA 3WB9A 4DDVA 1TCBA 4DR1B 3PUIA 1Y6FA 2I8CA 4NZOA 2ZTHA 4BZZA 1P6XA 5I9SA 2Q6IA 4WIAA 2BFPA 4MINA 5IT4A 1GKYA 1XTJA 2IDKA 1GPNA 3BIJA 4JGIA 2EW8A 3OCWA 4QU9A 4MB0A 3S27A 3V55A 1GLGA 2QMYA 4FB4A 2PUBA 1HQCA 4JUDX 2IYUA 3KTDA 1AUXA 3SHQA 3WL4A 3BCUA 3ZS9A 3MGKA 2OKGA 5BOSA 2AKAB 3ZVLA 5ICEA 1KI4A 1OILA 3LJKA 3LNCA 1Z4KA 3D7SA 4L2IB 1P72A 3H5VA 2WSSD 2LV8A 3WI7A 4DANA 2RHMA 4URVR 1HURA 5ALRA 3J81A 1HKUA 1RC1A 4UUQA 4JP3A 4UM9B 4PCLA 4QTXA 1OJLA 1H5UA 1SC3A 2YKGA 3KEQA 3O4RA 4EFKA 5AUNB 2Y92A 1Y82A 3CH5A 3I05A 3KXPA 4RHCA 4JI4B 4I7EA 4K28A 3W8DA 4KUGA 3OFNA 4KIWA 3MPUA 3QPCA 2FPRA 3L1VA 4KXFB 3BGDA 3P9QA 4I08A 3R3UA 3I1IA 2CHQA 2GS9A 4ZODA 3OQNA 2WWYA 4GNRA 2A1TR 1RRFA 3M6LA 1M0TA 1MCZA 1CJKC 5F2EA 5AI5A 1VIYA 2VDMB 2GAIA 5BN4A 4CL2A 2WHPB 4Z7OB 3IFSA 2WLTA 4NBWA 1X1AA 4R9SA 3DBRB 2YDYA 4KVGA 2REQB 2I7XA 5FOUA 1LQUA 2ZULA 3W7AA 2I6GA 3GJSA 1YULA 4EKGA 1YH3A 2V55B 4PZPA 2AX4A 2Z2YA 1UMBB 4DCGA 2AFIE 1BD4A 1PGQA 1OLSB 4IMJB 1WM1A 4DF3A 5I4KA 2Q4DA 2XR1A 3IERA 5B53A 1XZJA 3R20A 4QATA 4ZJZA 2PXHA 3FWHA 4BNXA 1LK5A 4FFVA 3RTGA 5HF6A 4TV9B 8LDHA 1GDTA 3NYRA 4UU1A 2HDOA 2ZIAA 4YY3B 1OLUB 1TAHA 3KYCB 1W25A 2VS1A 2BBSA 2ZWOA 1QIJA 4L08A 3U44B 2WMDA 2NP6A 4ZOAA 3TLYA 3MCVA 4ZAWA 5KYUB 1TDJA 2F90A 2H1HA 5FIUA 1XRLA 3W4JA 3K71B 1T8TA 2CXOA 1CZKA 3QHPA 5F12A 4KPUB 4TYMA 1ORTA 1TM7E 4L72A 1AH2A 1EFAA 1XCOA 1EP3B 1K5HA 3NV9A 2P1ZA 5CT6A 1TJPB 2EIXA 1H0SA 3Q3JB 4H60A 4KHZA 3S8MA 5I7RA 1HORA 2FCRA 2A4MA 1B00A 1V95A 3PHCA 4GX1A 1IN8A 1E3JA 4OMCA 1B43A 3D8SA 4CLOB 4D0GA 4C4RA 1Q7TA 2A5LA 4BHTA 2ZR9A 3ZEAA 3KTAA 1DDGA 2E5FA 2PSJA 4UQOA 1E1RD 1PG0A 3GFVA 1JE0A 4J03A 1JLKA 2X2PA 4RYLA 3ODGA 4MHTA 4MQMA 4J0KA 1GRRA 2RONA 5TS2A 3WNZA 5B7GA 2P0EA 3RASA 1DIBA 1DCKA 4RMHA 3G7UA 4U7PB 1R18A 1JG6A 3DC7A 3RYIB 3Q8KA 4NZ9A 1RXSA 3PCTA 2ZQYA 4RD4A 3R74A 3VTKA 1J2YA 4XB2A 1X92A 4M98A 1W47A 4AZ3A 4BMDA 1O1YA 1Z6YA 3V7YA 3VAAA 5IKOA 1I2AA 1OU0A 1ND5A 2CEAA 5AW0A 1VRWA 2ZUSA 5EKXA 5B6IA 1I94B 3C3YA 5K4AA 3TE6A 3THYB 5HE9A 3R7SA 4GI5A 4AZ0A 1V4VA 3D81A 5DHTA 1IN1A 1HTWA 2O2YA 2QTWB 3C6QA 5HS6A 5FPKA 4P4TA 2NO0A 4EKEA 5DLPA 1FDIA 1G5RA 3G59A 2KX7A 2WRZA 2WIAA 3SSAA 4EGCB 1FFGA 3IEKA 4MI3A 4ONEA 1WSBA 3JSXA 3OOJA 1PZHA 3EA0A 1X7XA 1XOIA 3E5MA 2NSJA 5ARCA 4RTQA 1OE0A 5ARBA 1XHEA 4Z49A 2ODBA 2BTEA 4N5NA 3G2NA 4ZTUB 1FYFA 1CZUA 4L4ZA 4DIKA 1MW9X 5AI0A 4BVLA 2Q3CA 2IQIA 2X42A 2HDHA 1PLJA 2PHZA 5E1BA 2JLZA 5K45A 1RYMA 2XUZA 5IAKA 3HTXA 1GGVA 2VOJA 4ZEVA 4R8KA 3H84A 1FNMA 1YZHA 1Z2DA 1SC4A 1EB9A 2J0UB 4KXNA 5BSUA 3ESCA 4O8ZA 4PYJA 4XWWA 2LWIA 1PW7A 2CFTA 4TXNA 4LK3A 4AYXA 1GUDA 3M3PA 3I6ZA 4YASA 3O95A 4FKZA 1LFAA 3BDVA 1EUDA 1H9BA 1I3CA 3R0XA 2NSYA 2QYOA 4E5DA 3P9SA 2OLKA 2C3MA 2PT9A 3IQFA 4IFEA 2E82A 1MMFB 1R4NB 1C8LA 2D2FA 4JJ4A 3ZCTA 1BVHA 2WG1A 4G07A 3AJRA 3AVYA 4A16A 3KWFA 4HJRA 1ZJ5A 1E2IA 3KJZA 4CMAA 4L74A 3JQFA 4ZP1A 2D13A 3PEYA 2XI4A 4M9ZA 4P32A 1ABBA 4OFBA 1FLDA 2JLQA 1G98A 4JT9A 1TM1E 3AEKB 4Q4AA 4QQKA 3PI6A 4LJKA 4HQKA 4ZK6A 2YMLA 1SXJE 4NBRA 1TVKA 5ESWA 1TT7A 3T9DA 1OFVA 1USKA 3LQYA 1AK2A 4GR4A 4EUFA 4ESVA 2VP3A 2G1PA 3NBYC 2FMIA 1HYQA 3SR4A 4BP3A 4WASA 4Y6SA 2I54A 5DTRA 4EW2A 1G38A 2Q3HA 2I7TA 2X76A 1Z8DA 2PEZA 4N54A 3T5BA 4CM9A 4YT2A 3RUCA 1ST2A 4IQ4A 4R2JA 4HWTA 1H22A 3KD2A 4NE9A 2Y1FA 4YAFA 1EK6A 3EBPA 4V0RA 1I1OA 3CSSA 1BGVA 3FI0A 4P82A 4EBBA 2BGTA 3PQEA 5K3BA 4HAXA 4L6AA 4PX5A 4QQNA 5K0NA 1DWOA 2BP7B 1DBQA 2D5CA 2IE8A 2YJ3A 2ZBQA 4FOLA 5AKIA 1A88A 1TJ4A 2DOKA 2YJTD 1EFPA 1PTJC 1M7HA 3G9QA 4A8JC 5DNAA 5L9AA 4AJHA 1ID1A 3KRTA 4XAQA 1Q0HA 1M8GA 2VDRB 2YXNA 2BW0A 5JNWA 1EFKA 2HUNA 1E6KA 3CRVA 1TW2A 3EY9A 4U9UA 3LKVA 4BN0A 3JATA 2VDOB 3JQFC 3ZYCA 1P4RA 3MWKA 4I5IA 3CUKA 1HTBA 4DSTA 1GRCA 3A2KA 4JASB 3EIHA 4L02A 1O95D 3PXBA 1E3EA 2EIHA 2XKBA 2QG9A 3JQ8B 3C5VA 4I4LA 2ZIEA 3SHFA 4OOFA 1RWNA 3GFFA 3PUXA 4J0HA 4D80A 4EB8A 1PDWA 3JQBA 3FVTA 2PQ0A 3QVGB 1EWVA 1XTPA 2I87A 1QYWA 2P4UA 3EF1A 1EE9A 3FPFA 2WDPA 3NHUA 4EVIA 3NDIA 2VWQA 5E3JA 2DH5A 3L4KA 3OZWA 4RS4A 5CW1A 1U6KA 1JV2B 2G9UA 3NWPA 4BNFA 1V11B 3TOSA 5JRJA 1MJNA 1QGZA 1AO0A 2IYRA 4MRVA 2B0CA 1JMVA 2Z8XA 4TKUB 4BWVA 1QIDA 4GEGA 5DM1A 2VDQB 2CUNA 3ZLBA 2XCTB 3TNFA 2FAXA 4L5BA 4TVBA 2PSSA 3BUSA 1FXSA 1NWHA 3HO1A 1KFJB 3O31A 2LXNA 1J7KA 2O0HA 2Q5LA 4MV5A 5CPBA 4JBGA 5AK0A 5J4VA 2ZE6A 4XOIA 1WXIA 2H11A 2WF5A 3T3HA 2BHRA 5ITVA 2CW5A 5AJTA 4G5GA 4W5WA 5EIOA 2VSNA 4YMHA 4YA6A 1WBDA 5JDIA 1SCAA 2IYTA 1IG3A 5KKNB 5MN4A 2D8AA 2XB4A 4MW1A 2PUFA 4Z4EA 1C1HA 1HM5A 3BWEA 3CPSA 1RHKA 1QYCA 3ITDA 4EG6A 4PO1A 1PT7A 2JHCA 4WGFA 3ADOA 2QN7A 4MVXA 3SS9X 4A1FA 1CRZA 3OQ6A 4AJPA 1WDLA 3W5HA 1NF9A 3HG7A 5IKXA 1Q7CA 1CY7A 3B70A 2YQ4A 2MTBA 3FZYA 3SR0A 3HLYA 4AUEA 3BBPA 3K0KA 3HFJA 4IDFA 1UBGA 3UUWA 1PJSA 4I50F 5K2MA 1ZK3A 1TU3A 3ORHA 2HGZA 4S0XA 3JD4A 9GPBA 1H5NA 3EK2A 5KVSA 3FPLA 1OXXK 4QGHA 5LQSA 1JEJA 4GSYA 1CHNA 1IMJA 1GR0A 1RQRA 1JGTA 2FEWB 2YN4A 3HN6A 3WL5A 2PX2A 3EFHA 3RF7A 3A27A 4FW9A 4IXTA 3VPAA 4OUDB 3DV0B 3FRHA 3LHIA 4P3KA 1EX9A 3Q8MA 3MAAC 3ZQ6A 5A3RA 4LOIA 4F4IA 3CLUC 3CR3C 2ZDGA 1EFVA 5JWHA 3WX0A 2Z3VA 3RD5A 1GPUA 2FWPA 2ZG6A 3FTQA 3BE8A 3HHPA 4HWGA 4F9TA 4HN9A 3SBDA 3ND5A 3E22B 3Q85A 4RY9A 5EUCA 2NVBA 3UY4A 4YFVA 2PDAA 3DW1X 1QH1A 1X77A 5LJLA 2EX0A 3ZZMA 1UP7A 2CVZA 4QEZA 1HDIA 4RIFA 2X4GA 3JWEA 5CLQA 4RQTA 2GZ3A 3KJEA 2COKA 3LHFA 2FZ4A 3QMWA 2ADOA 4GDFA 4C0HA 1H66A 1R6TA 2IPAB 3NM6B 2CUZA 3GVXA 4DNXA 4PYQA 4KJZA 1MV5A 2CMHA 1KRHA 3RT9A 2RSLA 1R0WA 3ETEA 2V4UA 3FPCA 1PKEA 2C5EA 4R1NA 5HJ2A 1J8QA 3J7TA 3K4QA 5E7JA 4MUYA 1O87A 4EPWA 6CHYA 1JJFA 2ES4A 1BFUA 4I4CA 5DXFA 4BKPA 1YBVA 4IXMA 4PANA 3B53X 1DELA 1Z5PA 2CXXA 3FKQA 2NVUB 3L0OA 1HLGA 3V1YA 3F8SA 3DDNA 4UUMA 4L4SA 1W44A 2HT6A 3T4EA 2JIDA 4B3BA 4FFBB 4JROA 4BC1A 5TC4A 4HMOA 4P3XA 5EIAA 4B4WA 2QRHA 1JDPA 5AHOA 2ZSKA 1WF6A 2OXFA 3JW8A 1T91A 1WXEA 2IOFA 2QRVB 4GRDA 4KBFA 3HJBA 4W1PA 4YUVA 3TZCA 4JVSB 1Q11A 2H0AA 4BUCA 3U3XA 5LP6A 3OEWA 4QM7A 5GINE 1EEHA 4WMLA 2ENWA 3D6AA 4JEUA 3VM6A 3WWCA 2E7ZA 2D5LA 3K0AB 3PTAA 4NP6A 3E23A 5J9FA 4HZIA 3HHEA 4FI3C 3OCXA 4AI6A 4XFKA 3E9YA 1QVVA 1MG0A 1ZUNB 1M6VA 3SQXA 1S7CA 2YZGA 2BDTA 1Y63A 1Z74A 2AN3A 4HNAA 4OSPA 4YV1A 3QYFA 4JI6B 1ACMA 1WQ3A 3H5AA 1P1JA 3W6PA 5ARDA 3Q5EA 1I1HA 4TTRA 3EZFA 5LLSA 3D4LA 4RHXA 2CUTA 4TTVA 4OY3A 3L0PA 1TKBA 1E9FA 2B4TO 2DBQA 2HRDA 2RC5A 2XUQA 3HLTA 3K9CA 2FPGA 3OEED 1N8KA 1NC3A 3KHUA 4FUQA 2C4KA 3OQ1A 1P74A 1LV7A 4EG3A 1T2EA 4I8DA 4YPFA 2YXBA 2VTEA 5A3SA 2OR3A 1GQRA 4FJ2A 1KJYA 4LJLA 2IXFA 4ZQBA 1GXSB 4G1VA 4LMAA 4WKPA 3TRIA 3NQ41 2ATVA 1E2EA 3NVAA 3WJ2A 1WE2A 4CM4A 3TIGA 4NY1A 3UWOA 4WFJA 5YASA 3TXXA 4A6XA 1NXPA 5EJ2A 3OZCA 2VXBA 3IUQA 5D3MA 1L4MA 2MSKA 3DLAA 3BGIA 4A0FA 3ON5A 2QRQA 4KWTA 3MT9A 1E7YA 4JXZA 1L5NA 3IT2A 3A6PC 3ZWPA 5C4IA 4OGKA 1XZQA 3WV4A 1CYDA 4EVQA 5IDXA 1UJBA 5U4QA 1KE1A 4N47A 1TUIA 2QX6A 2R62A 3VSDA 1JA1A 3A1NA 2ANCA 2CBXA 2HN9A 2EFJA 3HS3A 4X1OA 4MUXA 1ZPDA 2RK6A 4MO2A 2YHBA 2GCOB 2AE1A 3VJKA 4DCPA 4ITRC 1MZPA 2OHVA 2JZCA 3IO3A 1FDUA 4RENA 1BN6A 3K9HA 1JP7A 1S3SA 1EM8A 3FF4A 2EVWX 1X6VA 3RC3A 3TQFA 5JV5A 4AQ7A 3ZWYA 3FGPA 5HDQA 2B21A 2CY0A 1RJWA 2FWAA 2J3JA 2WJJA 4BNLA 3QUBA 3U62A 2ERYA 3GEMA 2LBPA 4ESOA 1JBKA 3NUGA 1KBOA 4N8EA 2MWMA 4YAOA 3FOZA 4EB3A 2C9OA 1QZUA 3GLGE 1FTNA 2WZQA 4JJAA 3PD1A 1N2CA 1N1MA 2QXUA 1DFIA 3H11A 5TQ2B 5JS8A 2NUAA 3UM9A 5IM4A 2YV5A 4Q7KA 4XX0B 3BA1A 1YL7A 4O1HA 2J67A 1Z7WA 4B3GA 1O9HA 3T1TA 5FPSA 3OLWA 1O96A 1PVOA 5IFLA 4KX3A 1EPUA 4WOJA 1ZR4A 5AO9A 4KBGA 1F0PA 4TTIA 5FAKA 1PZXA 3N2LA 2J9FB 1RJEA 3GRPA 1VPLA 1IONA 2IW3A 3GEDA 4F91B 1IM5A 1GRNA 1RC8A 2QV0A 3Q3GE 3WXBA 3IVAA 2JFPA 4JEIA 3RADC 3DR3A 1NXOA 4F9FA 3HKEA 4MV6A 4N40A 2ECFA 3OJXA 4EH1A 3NLLA 4HX5A 1W5AA 4UARA 1JU9A 3WMWA 3E9DA 4ES6A 2F6RA 2RKWA 1CPYA 3AIKA 3RJTA 1FU4A 1Q2UA 1RT9A 2GO7A 5FTLA 3E1GA 2WKSA 4QG7A 3EGIA 1GPDG 3FHOA 3OOEA 5A03A 4BEBA 2ZJOA 3H4VA 1KFKB 2IF2A 3AESB 1T9CA 2R1TB 2RMKA 4JP5A 3LFTA 1F0NA 2Q6TA 4YXWD 2Y6UA 5CXXA 4M86A 1KFCB 4QAJA 4WK2B 1H5QA 4TL9A 2DT8A 2IVZA 1IK4A 2RDMA 1IUNA 3EQ7A 3D8HA 3GLKA 2WKWA 3TS1A 5LZ4A 2WIBA 2XYPA 2GTIA 4UBMA 3A1DA 2G7ZA 4GWKA 4HDCA 5EL0A 5HQJA 4RKRA 4JAVC 4D42A 2FPWA 4NS4A 2DHQA 5C8XA 3CVXA 2V6FA 3SZLA 4PZCA 1N57A 1I3OA 1N6OA 3MTEA 4AO8A 4E4TA 1JN0A 2CGEA 1OX6A 2Z43A 5A1JA 4ZV9A 3C6BA 4LRYA 1NPTO 4OP2A 4FLFA 1PR3A 2JD0A 3RS0A 4BFXA 3FUXA 3PHHA 2QBYB 4OLAA 2ZDQA 3LT5A 3N2GB 4EO7A 1J09A 1P9WA 2GF9A 2Y76A 2DHCA 3LRTA 3U4AA 3ZZUA 3L0CA 3AILA 2RB5A 4UJ5A 3GLRA 3DWIA 2CYBA 3VR0A 3CKKA 1K4KA 1TQ8A 5CK5A 5B3JA 5B55A 4RZXA 1TVEA 1YCDA 2VDWA 3LPAA 4G5FA 3TTTA 5B4UA 5MFZA 2RGAA 2QMEA 3BRQA 3A58B 3PRHA 4C89A 3T1HB 4UUBA 5EVJA 3KPJA 4K6MA 4XIGS 3IUPA 3PT9A 4ZT5A 1KNQA 2HV9A 4U1RA 5CB8A 2YS7A 1GGNA 3P94A 3S1LA 3SPXA 1GZSA 4G0PA 4QDOA 1ENYA 4ENPA 1GAXA 4RCYA 2A58A 1I6WA 1BMFA 1H9AA 4M8SA 1SURA 4RHTA 3DEZA 3OPVA 2OORC 2QTMA 1JTFA 2FZCA 3O9ZA 4ZOCA 1JHVA 4B44A 3LXRA 4AJ1A 1A8PA 3F6CA 5D87A 4MVJF 1UPBA 3MTIA 4ER0A 4O33A 4NE2A 2J4CA 1IYZA 1U3CA 2CK3A 1XLVA 2OOKA 5KTOA 4NXNB 1Q1AA 3DDSA 5IXYA 5LQAA 1G6KA 2FOIA 1JTEA 1ODCA 2BKLA 2UYHA 3IJ5A 2VQ3A 4PX3A 2B61A 3PLRA 1HYHA 3Q41A 4GPD1 4A2CA 2JVIA 3VNSA 4JH0A 4LGCA 4H4DA 2FZVA 3B60A 4Y6OA 5CR9A 3VHQA 4PU0A 3VU1A 3GP8A 3GJ4A 3FLBA 4G41A 4UMEA 5KDDA 3GDHA 1GQ2A 1ZM9A 1QHFA 3QBJA 4MDHA 3OKPA 1T4DA 4BV9A 4H7HA 1BCRA 5AW5A 2FMHA 1I9CA 3JX9A 1WP9A 3STVA 3ASUA 3QYPA 3ZWAA 3AETA 4B80A 5L53A 4DUGD 1Z28A 1B1AA 4QPDA 4DLZA 4EGFA 1INLA 4W9RA 3LI2A 5LU8A 1QUEA 1JHQA 2J59A 4NZMA 4Y9SA 4Q9JA 5TE9A 3ETLA 4ISBA 3NHKA 3BWDD 1FYWA 1Z8FA 3LDAA 1C0LA 4MWDA 3VYSB 1XRPA 5C1DA 1HFWA 3FAZA 1KA9H 4ARBA 2ZANA 1XHFA 4PSCA 3WWYA 2Q8NA 4C7OB 1KVQA 2AV6A 2QTLA 1CR1A 4JCCA 5JQGA 2UUCB 3WGMA 3JZAA 2CK3D 1B8VA 1J2UA 4LYGA 4EF5A 2YICA 3C5WP 3BK1A 1NQOA 1Y9DA 2HREA 1LSSA 4IXWA 5DI3A 1AHHA 3W78A 3LZDA 3UB2A 2G25A 4JDUA 1FJXA 4LJYA 1NZJA 2QROA 3I0ZA 1TI7A 3WB0A 4YJGB 4R6XA 1RSZA 3RIEA 1Q92A 1AC5A 2VJKA 1RAFA 3HJTA 4B6OA 2R25B 4DM3A 1EG7A 1SHLA 5KNDA 4BQPA 4J0IA 5CX4A 4KHPB 1I2ZA 3ADPA 1B93A 1FE8A 1KO7A 1QE3A 1ZW6A 3MS4A 4II3A 1OTHA 5I9MA 3PGVA 3EIQA 4E31A 1ZRMA 2HCJB 2IDJA 1YZKA 3GQBA 5CNIA 3ZN2A 3BGOS 4BGDA 1XCMA 3S1AB 4CTMA 2Q3MA 2W6PA 3ASVA 1ZL0A 4EJSA 3SZMA 5C18A 1ZIOA 3IT1A 4O2LA 4UTVA 4GU5A 1WABA 4R41A 3CXUA 3SLRA 3OU7A 2H59A 1QFMA 4MR8A 5DEOA 4HRYA 3B2NA 3VSCA 4KREA 3E3LA 4CIDA 1SKBA 2OBYA 3RE1A 3BFXA 3GFPA 3KQNA 2IGTA 4FQ7A 2HAEA 5F5LA 1AM4D 5BSTA 1C0KA 1CB0A 1VCHA 3OX3A 1EVIA 3PCRB 2JAWA 2AD1A 3AF1A 4M0MA 3QA3E 4NYJQ 4QNRA 2BD0A 3KWLA 3IAM6 3MBKA 1ETUA 3NATA 2QX9A 3DVRX 4F4UA 1P7ZA 2XXJA 3DE5X 3DLCA 1U5BA 5AK5A 1KIAA 5HZHA 2GHTA 1LI4A 4OPMA 5ITZB 1RU3A 2VCHA 4MXDA 3K70B 3STXA 3U80A 3B2QA 1Z4QA 3EX7C 4LFAB 1T2DA 2QJRA 1FNNA 4IJ5A 2GM3A 2EZ8A 2ZPTX 4M0LA 1FVOA 1XMVA 3NIWA 2FPSA 5CDGA 4A36A 1MOZA 2A5FA 4BFUA 4QPPA 1JECA 1NDQA 1OQAA 1Y1RA 3QWHA 4M0UA 2AI1A 2O6HA 4DR3B 3WDSA 2PUDA 2QLMA 2ECKA 1BG6A 2OORA 1FDVA 1MC1A 1SZJG 1SUWA 2HSGA 3M0EA 4HFRA 5DM0A 2Q4BA 4F97A 1EXNA 5A0VA 2H17A 2H4YA 4GP7A 1URPA 3H9EO 2Z30A 2WYIA 5HQTA 3ZIAA 1KPGA 3USZA 3U61B 1P17A 5JY6A 3BTSA 4ZOQI 1KGDA 2J41A 1DJMA 3IJPA 3G8DA 4HEJA 1T9GS 1GA4A 5E4YA 1E3SA 1NYRA 1NBMA 2QIPA 3HY4A 1E94E 2VJCA 3N2EA 2G6BA 3QG1A 4IUYA 1WR8A 3AM4A 2VQFB 4NG4A 3A3OA 4S1VA 3OQVA 5T6BA 2A6PA 2TSYB 1PSDA 3B3JA 1R6AA 4Q3EA 1Y4UA 5CU7A 1J8MF 4C5BA 2QYSA 4XX0A 3TIVA 4RGBA 2QMHA 1PS9A 3NS7A 1ZZGA 5BQFA 4YRNA 2O7VA 4FYJA 4ZFNA 3C7CB 4C2TA 1RQNA 3AYXB 4UCWA 3WK8A 5THQA 1GD1O 2AD5A 4ZVLA 3REGA 1G20B 4D96A 5BMVA 5LDGA 2F4NA 4CMKA 1B6RA 1BA2A 1CNEA 1ZM2A 2AQHA 2VO1A 3ABIA 3EG9A 2IV2X 1F20A 1PQUA 5THXA 3LTEA 4RM2A 5TX7A 5I3CA 1A8SA 3H7AA 4G09A 4HO1X 4KH0A 4BCCA 4J6EA 4L73A 4O5AA 4HVTA 3T4PA 3V8NA 3HR4A 1Q7EA 1K3UB 1UCFA 3AR3A 3QEOA 4RDCA 1T1GA 1ADJA 1JVNA 1CLUA 1JW9B 4TWJA 2JFNA 2QZJA 2BLLA 1X3LA 3AHGA 1KI6B 4FZ3A 4V0NA 1X80B 5F77A 5HF5A 4KE7A 1G7SA 1XJ0A 4GKAA 5DVZA 2QMOA 1PR9A 4DQDA 3ZOKA 1XYYA 3EZ2A 1HE8B 4M0CA 1NF8A 3HDQA 3QNUA 1BWRA 2ZS8A 1C7QA 2WJZB 5EJ5A 3GZJA 6AT1A 5I4BA 2FEOA 2M9MA 2X13A 1U7HA 1T25A 3A3YA 3UCEA 3WL8A 5IG2A 1NDUA 3A0UA 3E1KA 2LCFA 4IICA 1L4LA 5K51A 3TFWA 2PX0A 4MMZB 2RK4A 2G36A 3RHTA 1G4AE 3I52A 4LZZA 1X1EA 3LM8A 4Q1FA 5GOTA 4Z3DA 4ETMA 3OOYA 4HXGA 4UAVA 2UKDA 3E0XA 4J94A 2C3PA 4F5YA 1EZ4A 2FX3A 1EE2A 3QKRA 5GWXA 3VNRA 4RF5A 3SI7A 4WNAA 2CD7A 1W94A 1IB0A 1XVTA 3K9WA 4I3FA 2UUOA 4UEQA 3DOIA 3MNFA 4IWNA 3BFPA 4LWZA 4QOFA 3T34A 1GV0A 3P9XA 1XPJA 4B7AA 2AJCA 3PFHA 3TAXA 4R9RA 2O3JA 1ZSNA 5CMLA 2X15A 4YRFA 2ZUDA 5ESDA 4U9HS 2BRUC 2WSSA 1G55A 2FSIA 3JARB 1TOAA 4Q21A 4PV7A 5WRFA 1RNLA 4UULA 4F5ZA 5EHZA 1QH8B 4YAEA 5CCBA 5C51B 3EUFA 1E1RA 1BHQ1 3DFZA 5AXBA 3ZU6A 4ZT6A 3ZCPA 3ZNOA 2OVFA 3CISA 3PPWA 3VO2A 3LVRE 3OJ0A 2NQ8A 2XLBA 3VTZA 4ND8B 2BIFA 4EY4A 3U3OA 3ZCXA 4Q4LA 1QO0A 1UOEA 3B3GA 1D4OA 1YIAA 5C8ZA 3DHNA 3T1NA 2J3EA 3GFSA 2JFBA 1CZRA 1CHDA 3AEYA 3BTVA 1Y7PA 5EZYA 2F8SA 4MGEA 4K9NA 1FCJA 3SR3A 4HQFA 1NW7A 3T95A 2E4WA 1R8QA 2QPOA 2VF8A 1Y33E 1N6KA 2Z98A 3GUZA 4FC7A 4IUBS 3VR3D 4DSOA 1EJBA 2OZKA 2DRIA 5CX1B 3GCGA 3E3OA 3L4SO 3EW7A 1KAQA 2FSGA 5CVTA 1R0BA 1RKQA 3FSJX 3TL2A 1F7VA 2H7VA 4OKIA 1Z6AA 2UZIR 3O8QB 2JBAB 5CG1A 4B33A 4MLCA 4KQWA 2GBGA 4G5YA 1O8BA 4B6FA 1COWD 2QRPA 4F56A 2P1RA 3Q7SA 1VE5A 1JJAA 2ZIZA 3JAWB 4L7QA 5ALJA 4BZWA 3OU2A 1SZDA 3A36A 1F14A 2O8DB 2VSFA 4LHXA 4IJUA 1N9ZA 5DYWA 5D01A 5FOSA 4DMMA 4ESHA 4Y2RA 3WLTA 3E7WA 2WSMA 1RKUA 2Z9CA 1OFGA 2CLIB 4K9MA 4ZPJA 1MRNA 2F3QA 2O48X 4CL8A 4E33A 5CFRA 4W7HA 5EWMB 3M4ZA 3P4UA 4Q00A 4POOA 1EFHA 1N6NA 1R6BX 1PS0A 3I28A 3P0RA 4M1TA 4QXRA 3EXG1 5GV8A 2PRJA 2XT9A 3FROA 4C07A 6NULA 5AOVA 1ZRHA 1V37A 2FA9A 4JOCA 3LX8A 4N5IX 1W76A 3R44A 3EGDA 4EI8A 1N8SA 1KQOA 4DJEC 4YHHB 4CLXA 3PX7A 4K9SA 2FG5A 1X7ZA 1NIPA 1JHDA 4PCAA 1MO6A 3H2BA 3K5IA 5LB4A 4EY6A 2FRXA 3DZBA 3QXHA 3EDRA 1Q6YA 1DWUA 1JHYA 1GTL1 1R37A 3Q7TA 4MTCA 3TR0A 3VTFA 4D3FA 4R69A 4A8HA 5GJVC 1DCTA 3KFVA 2BFDB 5EGSA 2LPMA 3HFRA 2D7JA 1JDBB 1VHTA 4JB3A 4UU7A 5BSVA 4WN9B 4D8VA 2HGSA 3VC2A 3BH7A 3OBIA 2O1EA 3QVKA 4KO2S 4B1FA 5ALWA 1IBSA 1LPMA 3FDJA 3R6WA 1U90A 4KMRA 4WADA 1N78A 5KC8A 1UJMA 1AVTA 1Z88A 3ZE9A 3B89A 1WETA 1GAWA 2XMDA 3CB2A 4JOSA 1JLLA 4FE3A 3OLCX 3E9CA 4B5KA 4G4SP 4OQXA 4CF3A 4CTJA 1FY2A 4HWPA 3I8OA 2FXIA 3P0JA 2R6AA 2P8JA 4IHJF 1PFYA 2GBLA 2N47A 2GEDA 1W59A 4BO4A 1FMCA 4PO9A 4Z9AA 4JBWA 2ATCA 3S2EA 4FHFA 4DMLA 4HGPA 5CLHA 1UQTA 1CP2A 1QCCA 3FMOB 3NWJA 3R7WA 3GDWA 3EH2A 4JKYA 1L7AA 4A0SA 1JILA 1WPXA 2Y68A 1H1DA 2ZUUA 5AHKA 4D4JA 2HCFA 3DZJA 2CJWB 1VG9B 3OLXA 1WV0A 4ND5A 5BRJA 1HZJA 3FR8A 3GUHA 3RAJA 3TM4A 3NTUA 1K4YA 1RHQA 2JKYA 1NZDA 4CF4A 1J49A 1EUZA 5B5SA 1K2WA 2F8TA 3NKFA 1NSTA 2FRDC 1X7YA 3NJ8A 3B6IA 4FTWA 4PX9A 5BMVB 5FL7A 2EFGA 1MENA 1W88A 3IIIA 3GDOA 3RVOA 2NM0A 4KAXA 3QLVC 2ARKA 3IJEB 3HWRA 3W9BA 4C6TA 3QZUA 1RAGA 5JWOA 1QG6A 2CJPA 4PZZA 3DSRA 2XODA 4MV1A 4QGFA 4RJIA 1OYYA 1GILA 1RCFA 3DO8A 3ADBA 1THZA 1Z6QA 1WW2A 4CG3A 4D4HA 1YV9A 1XZ8A 1NUAA 1BDBA 3LG2A 1A82A 4W8HA 4B2LA 4CKWB 4D8XA 4UBJA 5AVJA 1ISPA 3FGNA 1DPGA 3V4LA 1Z6XA 4JOQA 4O2RA 4RLFA 2E49A 2AZTA 1C8BA 4J16A 2PLNA 4QDTA 5E9AA 1WB6A 5G0WA 1NU6A 1NMZA 3JCZA 4N03A 3A9UA 3PQ5A 4L78A 1DFGA 5NULA 3TDMA 1DUIA 1FS6A 3BTUA 3NWOA 1JWAB 5J1TB 3N0XA 2JGFA 1PUJA 3LVBA 2CLKB 2GZAA 4AF6A 2IYPA 3ZE2B 2REXB 1XRSB 4DGQA 1Q0UA 2EZ4A 1QUFA 4EUHA 1ZICA 1C9EA 2F9FA 4NI5A 2I2XB 1EVJA 2ZJBA 1B8UA 3L8HA 3MGCA 3PZBA 2YWJA 2CMFA 3E53A 4HQLA 3SZUA 3V2UA 5BN5B 4CKCB 1YMQA 2X86A 5JDIC 2FR0A 4U0JA 3TEFA 1RQ2A 2ZVJA 2EX4A 3PQ4A 3TNLA 4HRXA 1IFXA 5ICMA 4XWGA 1U9CA 2C61A 1PJRA 3E9ZA 1K6EA 4EHNA 1ZQ1A 3E9NA 1JIUA 2D5BA 5CIQA 3HDGA 4XUCA 1WZNA 2XB9A 2JIBA 4FP9A 4CKYA 4UASA 3QPAA 4HAUA 3KVVA 4EEZA 3RGWS 1P0PA 1SOUA 2AC4A 5AW4A 5LBIA 2R84A 2VTDA 1ADYA 1E1NA 1ORRA 2DECA 3BD9A 2RGEA 3BJMA 3H19A 2GA8A 3H99A 3IGFA 2PX6A 1Z73A 3KZ1E 3SU8A 3TSAA 1DC3A 2JH8A 3HA3A 4BNWA 4HZUA 3THXB 4MUAA 2VLBA 2FU5C 3LUCA 3V8RA 1NJ6A 3GPIA 3JYLA 3DMPA 2CCKA 3WVNA 4CTOA 1ZBDA 2MINA 7REQA 3MA0A 5AVOA 1AUOA 5IAGA 4BMOB 2UXDB 1VI2A 4QGSA 3WGQA 1TTHA 1RQPA 1UMKA 4BB5A 1XTTA 4KXWA 4MR7A 4HLDA 2F8MA 1UKCA 3QUQA 3NXKA 2KE5A 3OPYB 3GMDA 1HNWB 4YCJA 3WFZA 3B6EA 2H06A 4BX2A 4MP8A 4CV2A 2BR3A 3D6VA 1WCIB 3HFGA 3PB3A 1C1DB 3FDZB 3OE7D 1ILEA 1P9OA 4JITA 2DBVO 4GXQA 3BJIC 1A2OA 4DT1A 4C4ZA 4CFYA 4E4RA 3AB3A 2F48A 2DB3A 2D5IA 2GK7A 1KZ4A 4K03A 2FK8A 3SG0A 4GQBA 1NXVA 3K9GA 3KCNA 1E4EA 1NG1A 2AT1A 2OESA 3NOOA 4P5PA 5FBKA 4QYTA 5ES4B 3GEIA 2AWOA 3WYCA 2ASVA 3OPQA 4O4JF 2WY2D 1O2DA 4P8RA 1VZ3A 1C1XA 3EFEA 2R00A 3JAKB 4GW3A 3QFTA 4Q4JA 4E30A 3T5MA 3C3KA 4WY5A 2OBFA 3BD8A 3PUZA 3AKYA 4J1TC 1X0XA 2NPOA 3IDSA 3FFWA 2GHIA 5G4LA 5HCUA 2OE2A 3M6AA 1FFSA 2PA3A 1LZLA 1PJ4A 3JALB 3LBNA 3I2IA 4P3OA 4W82A 4XW2A 1YWGO 4KN8A 3IHWA 1QB8A 4HLUC 1VJCA 4QXMA 2RBKA 5DOZA 4C03A 4JXXA 4MPJA 4Y2UA 4ARSA 2HXYA 2J32A 1O94A 3FNQA 1QB7A 1PR5A 1P7VA 3NGXA 1L1FA 3DXYA 1I6KA 3K94A 1T8UA 2QSZA 3EXG2 1BU5A 4IDNA 3STHA 1DMSA 2B30A 3CRW1 1NXSA 2GWHA 4XJVA 4D8YA 3SY8A 1Y89A 4HQ0A 4WJKB 2IBMA 1HE2A 2DWQA 5LQMA 1U8ZA 2ERCA 4MQEA 4X93A 5TMEA 1TA0A 4KO1S 2J31A 4RVGA 2G0TA 4JZYA 5DGCA 2QIOA 3EQ6A 2WA2A 1V6AA 2AWNA 2OXEA 1IULA 3NW9A 3J80A 3C15C 3HCNA 4F60A 1ECJA 1QJ4A 3JVVA 2FPIA 3N1UA 5TGDA 4L51A 1GTSA 3HCCA 5HRUA 1V39A 4YROA 2V3VA 2R97A 3CVOA 2PJUA 5KSPA 3TRKA 2WPDA 1RLMA 1DKUA 3UWPA 4TROA 3TCXB 2NSLA 4YRZA 3I5UA 1P8JA 4PGGA 1AF4A 3SMQA 3GY0A 3ZWWA 3H2HA 4EA8A 1SRRA 4I19A 3IV9A 1FP7A 1T2AA 2PMEA 1EU1A 4LNAA 5AD1A 1EHCA 4ZQEA 2W2KA 1T8RA 2FTKE 4P4SB 5DGTA 4QT4A 1BROA 5ERXA 1QCDA 3AIIA 3QEKA 4KDEA 5BNIA 3GIDA 4CQNA 3G9TA 3RARA 2ZB7A 1GZ6A 1U2ZA 1ZD2P 3FCXA 3QJGA 4X71A 4I3HA 3AUKA 5SYNA 4KPUA 4TMWA 3ZXYA 2XF2A 2XNHA 1MX5A 3BIFA 2H5EA 3CQ9A 4GAEA 2OG2A 2QR3A 4M0EA 5CT9A 5JMTA 1NTOA 4TOIA 2BBTA 4KRGA 2BJWA 1CSEE 2R96A 1U9YA 2GI4A 5ICSA 5ESRA 1UBTS 3RLIA 4BB0A 3JSAA 1NR5A 1QFYA 1SZCA 2FR1A 3GD7A 3IOYA 1BZYA 2OCLA 1EWKA 1M72A 5TT0A 1HWYA 1EA5A 1K6IA 1NY6A 1T15A 2B8TA 2FUKA 2OTCA 1V5EA 3PEUA 1EZ1A 4N8DA 4P1ZA 4WECA 5LM3A 1F8YA 1MT3A 4JUFA 1ECBA 1TMOA 2BN4A 2CMGA 4J2HA 3IURA 1KAGA 2PGAA 3HDHA 1DWPA 3EHDA 3SKXA 2FLKA 2XJ9A 2IIVA 4Q1VA 2XIQA 4RD3A 3RODA 4UOQA 1XCGB 5EPEA 1LTQA 3FA2A 4B2IA 3BGVA 3L92A 3OP1A 4KWEA 4ZYVA 5LWQA 3BRWD 4YH1A 2HI0A 5I7UA 4KDRA 2FEKA 1VLZA 1UBCA 1WMBA 2IWRA 2V3CC 2A5YB 2ZSFA 1L5RA 3EH1A 4RKYA 4DJAA 1THTA 1U2PA 3QBVA 4LDZA 2Q3BA 2L0XA 1QFJA 1QG2A 3DE1X 3GP3A 1WNFA 2X3FA 1TQDA 3HEBA 3QU2A 3K1YA 3NEAA 4HFMA 1JEQB 5C1IA 1YCFA 5LYJA 4D5EA 3GEEA 3Q1KA 4FBMA 3DOHA 3AUJB 3BEOA 3ANYB 3F3SA 1ULSA 3I9V1 1LBTA 2POCA 1UZMA 2BFAA 2WFLB 3A9SA 4B8ZA 3TUIC 4EENA 1CUUA 2Z2JA 3ILVA 2YV4A 2QRNA 4CMIB 2IBSA 4KSYA 1OZ0A 2WM3A 3FHJA 1NVXQ 1B7GO 1KMCA 2X9QA 3R0ZA 3ZY3A 2KJQA 4G81A 3FPBA 4NCJA 5SZHB 1HDRA 2R5WA 5DI3B 3RRZA 3X1KA 3KWMA 4JLOA 2ZYUX 3AY0A 2DR0A 1OVMA 1DQYA 1F8UA 5LL6P 3HBLA 3QLJA 3JD1A 1X0VA 4GGPA 5FPTA 2H1CA 1GUAA 2NZYA 2QM3A 1XA4A 2HD4A 1BMDA 1MDFA 1XD2A 1MO4A 5AJYA 4JGGA 4DCMA 1OI7A 2AW5A 3AR8A 4IRMA 4MO9A 3RR2A 1F0YA 2UVPB 2F59A 1EXVA 1RPJA 3ESAA 1R9JA 1UOQA 1DAEA 1FU7A 1QLHA 1USWA 2NAPA 4TKZA 4ZGGA 3ECCA 1HETA 1O58A 3OZEA 4COOA 1A4UA 1L4FA 1MO5A 3O74A 4KX5A 1SXHA 3U7JA 5D7NA 2LTAA 1HYEA 2V7PA 1FU8A 4L4XA 5DMXA 5JFTA 1GTRA 3IVXA 1SVLA 4E14A 3DDHA 3EIEA 2WW8A 3PKZA 2HA3A 2PN1A 4A0RA 1I0IA 1C1DA 5IU6A 1XWIA 3C5HA 4JLWA 4CT5A 1QVAA 1HG1A 3BFJA 3OTOB 3ED5A 2WM8A 5TGTA 3TKAA 1M73E 5CITA 3UAYA 4DA8A 3F3KA 1B41A 4XTRA 2PX4A 4GI2A 4YI5A 3LVFO 4DQVA 3UPTA 2ZKLA 3QV1A 1U5CA 1D8TA 4HAIA 1JL3A 4FFMA 4O2AB 1Y42X 3ZKWA 3SQNA 1AG9A 3I92A 2IPNA 1FEZA 3GAZA 4IO1A 1OT5A 5EJ6A 2G1AA 2YV1A 4O29A 3WNBA 1KJQA 1XO1A 1XU4A 2L69A 4RL4A 1DAIA 1G5FA 2VSXA 1M0SA 5E6RA 5FOXA 3TLBA 3QPVA 2V5UA 1B0PA 2BZ0A 2YYAA 2OV4A 3TPFA 3ZIAD 4PY2A 2IYEA 4UNQA 3ACBA 5AM5A 4HAYA 1G63A 3M3HA 3EXHC 3U17A 2I1WA 4G9GA 4OK6A 1XMIA 3PU6A 4TSKA 4CCYA 3D4PA 4BNTA 1NP7A 2BMDA 3KB6A 4OJMX 1DAPA 1M8KA 2J0VA 2VYVD 2C00A 3PUHA 4PLPA 5DOVA 1LB1B 1MFZA 4GMDA 4OHWA 1L0BA 2OWDA 3KYIB 1PX2A 5F1PA 1BS1A 1II8A 3L9XA 3LRXA 2ZSBA 5ITWA 4PFKA 1DS6A 3PNLA 2O50A 3EZGA 1G8SA 5CGZA 2C1ZA 3DTVD 2VYCA 2QV7A 1MIOA 2QY6A 2R6CA 3IDZA 4FDAA 1MB4A 4DCCA 1W52X 3MN1A 2RGNC 5AK6A 2QI9F 1UL1X 3ITNA 1K8ZB 3SF0A 2FDRA 1JMKC 1RPZA 1OC4A 1TCCA 1R5OA 4YAUA 4U8HA 3EWAA 4TTQA 4RFLA 5DXJA 2FSPA 1FTSA 1XRNA 1XTVA 4HDKA 3JPYA 5K3AA 3UHPA 5C80A 3GAMA 3NOXA 2J5RA 4M1QA 3ZV5A 4C3ZA 3UMMA 1YB7A 4EG5A 1MHPA 1PYOA 1H6CA 5LIPA 4MRMB 4DWVA 4LW8A 1MTZA 3KAQA 3LGAA 3GMIA 1KAOA 4QELA 1BWPA 5GZ6A 1SJ9A 4M22A 2EERA 2GCEA 3NTVA 1EHIA 2NTJA 4GE3A 3U9LA 1NATA 2REQA 1ORVA 3QE3A 3REFA 3MCUA 3W9YA 1TO1E 5EJIA 9LDTA 5LWHA 3ENQA 1DCFA 3H1GA 5DKFA 3N8IA 3GGDA 3B48A 3P9YA 1JSCA 1GG2A 2OAP1 3MIZA 1JKJA 4YK7A 3ZWOA 4C0AC 2GNOA 8GPBA 4QU0A 1WEKA 3SM3A 1E3WB 4AP5A 5T3YA 3I6BA 3UAVA 1IJFA 4H16A 2PJZA 5F35A 1J1ZA 4DUPA 4BO9A 3ZXUB 2PNFA 4L95C 4Y1FA 5CEJA 4F96A 5K99A 4QUBA 4WQMA 1XYGA 4O08A 4BECA 5TIIA 2XKKA 5DNUA 2F1JA 4LV5B 1ZUWA 1TCUA 2WD8A 4S1WA 4XJSA 5DJ5A 2G0NA 3AI3A 4H59A 4BFVA 1MGPA 2Q4EA 1ZD1A 4XM2A 2CXPA 5SYMA 2AGVA 2PUVA 1AMNA 3MSXA 2Q99A 4AECA 4Q4DA 2C1EA 4YDQA 1J9ZA 4ZMRA 1G7RA 3NAQA 3NHJA 1T0JB 3OQIB 4U4AA 5EKUA 5DN6D 3PVSA 4MYUA 2VATA 4S04A 3CUSA 1AQJA 1L5HB 4S24A 5L4SA 2CHUA 3GVCA 1USVA 1EG2A 3OQMA 4QG3A 2LKCA 2ETVA 3NJ4A 5A4JA 1FK8A 2C20A 3C39A 2MIIA 1N9GB 1EFVB 2O2ZA 3G79A 3HO6A 1OZGA 3LC0A 3LRPA 4TL8A 5BR7A 4RH1A 4OKNA 4BYGA 3A8TA 2RFLA 2JAHA 3Q87B 3TB4A 1J33A 3UMFA 5F21A 1P7PA 4NNJA 4YP1A 2Y2UA 1E0KA 4DLTA 1SK8A 2WTXA 1ZESA 1L5MA 2BZGA 2H5JA 3DL7A 2RHLA 1Z5VA 1E9DA 5C2JB 4Y2SA 1XI2A 1IQRA 2AHOA 3GJXC 4A8JB 5BUSA 5KTSA 1NBWB 4E94A 1AUQA 2CLCX 1U0SY 1KIFA 3GRCA 3ZK8A 4BGEA 4B17A 3UH1A 4I14A 3U9SA 5KX5B 4X62B 3M34A 4V38A 1XZFA 4QHYA 4AM8A 2W00A 3QTTA 2EGGA 2FW8A 2R85A 4E4YA 2RGRA 1FTQA 3C41J 3QXSA 1KPIA 2O5EA 2O7QA 4TM7A 2RI0A 1XQVA 1A9YA 3KYDB 3CZPA 5EYPB 2RH9B 3VKHA 3IEVA 2HIHA 1RPAA 2WF9A 2CCGA 2G9VA 2OCDA 2GAOA 3FPKA 3H17A 2C94A 4FE4A 1KSJA 5TV2A 4AL4A 3SYRA 4E5SA 4C05A 3LY9A 5ADVA 2YC4C 3QMMA 1A9XA 4L4UA 3I9OA 1QANA 2Y1OA 3SVZA 4YWHA 5ISMA 3O4VA 4LRSB 4QYIB 1J8YF 2C96A 5KX5A 3HZRA 3T9BA 3LX6A 2EZUA 2Z9DA 1DSSG 1N2GA 2X4IA 5ILOA 5ECWA 1LCIA 4RJLA 5LQUA 2IHTA 2R79A 4WCDA 4B87A 2WUEA 5JAPA 2C9ZA 4ALLA 1IN4A 4DCNA 4ZVOA 4AP9A 3DOJA 1AKYA 3PA6A 4Q19A 4MDFA 2P35A 5H9VA 2VNHA 2O7SA 1P0FA 3CZCA 3GRUA 2JGNA 1NW3A 3F5FA 4WXYB 1ZH6A 2AOUB 1TPYA 2MSWA 3MTQA 3TX6A 5F1KA 1OYOA 3OZFA 5IJAA 5KAPA 2PLRA 2VWHA 3NHMA 1W88B 2VHQA 2QE7A 3KXDA 3Q7EA 2OBMA 4PG5A 3KNZA 2PS1A 4FXOA 1ZU4A 4GZ6A 4RPLA 1N5DA 2CXTA 3VYWA 1FNBA 3L41A 4D3ZA 2I6UA 3BL6A 5EZ5A 1RAIA 4XUGB 1IHPA 3ITEA 3R75A 3LWDA 4W9NA 2OM2A 4FT4A 4M99A 1B1CA 4KMSA 2NYVA 3TNJA 4B6EA 4CI9A 3A37A 1PLKA 3QKTA 4EO9A 5GM2A 3LLMA 3UQZA 3SEQA 1IK6A 3OEHA 4ENVA 4ACAA 3NMUF 1TC1A 2BHNA 1CRQA 4MITA 3R8CA 1Z0DA 3F78A 4YUAA 4OX9Y 2JJ2A 2B9EA 4JBHA 3DOFA 3K53A 4QO7A 1V6CA 3DAYA 3SX4A 4TKLA 3OT1B 2OFWA 4YP0A 4LQLA 3U4MA 4PBTA 3WJAA 3GCDA 1IXYA 5JD4A 2O3UA 4H7KA 2AFVA 1JFFA 3E4CA 4QUAA 3K9FC 5JJ5A 2JVKA 1D2HA 2I2DA 2WDZA 5TPZA 3THWA 3EARA 2W37A 1TUBA 1YQ9A 2XT0A 1KDOA 3JWPA 4EGSA 3G0BA 1CX9B 2Z09A 3CXRA 1KK0A 3OWOA 5CNJA 2HHAA 3IEMA 1BOFA 2NACA 2NPFA 3GB9A 4F92B 4IH9A 4LNUB 2REOA 121PA 5GZ1A 4QX6A 1ZMOA 4GD3Q 3KT3A 2VRNA 3P5BA 2VZ0A 1E7RA 2QLJA 3MBOA 1I9GA 4YJ3A 4AYWA 5LP1A 2W5UA 1QPGA 5IDYA 1M5TA 3W2EA 4YCCA 4AJJA 3MTAA 1HKHA 1QOQB 1TUBB 2JJ2D 3AUTA 3C98A 3FG9A 3G9UA 3GPBA 3IVGA 4LC9A 4R8SA 2UU9B 5FF9A 5EVCA 4JA0A 1HYGA 1OF1A 2B35A 3OEHD 4KV7A 4RJ2A 4XRGA 4ZDKA 5KNBA 5LMNB 3R5KA 1ZJJA 4RVCA 1U8UA 3PJRA 4MGIR 3QKSA 4MS1B 4DMCA 3FYTA 2X7HA 4PPFA 3A9CA 1RP7A 2C2HA 3RG8A 3JTEA 3TJRA 5CRIA 3QEBZ 4RD0A 1YMVA 5IVHA 2PIAA 4MHOA 4EUKA 3DMNA 3V2IA 1IMOA 3N2IA 2EARA 1SPXA 5GM1A 5I47A 5EEHA 2ODPA 3SX0A 3X2EA 3PXEA 3TLKA 4DA4A 4CHTA 4QJ3A 1WU8A 2XECA 3HWX1 4LK2A 3GZ4A 4GM1A 3RVJA 3UT0A 3KT6A 1US8B 3OQJA 4TZ6A 2VXYA 3WGVA 1Z2OX 3K7EA 3BD6A 3OHMA 1EFDN 3K9BA 3G5MA 3BMNA 2CXRA 4RWEA 1Z83A 2OV3A 4FOPA 4WESB 4HUTA 5ECDA 4HF7A 4IOKA 3TXYA 2PSFA 2GN8A 1XA0A 3ZU3A 1B0ZA 3WLSA 3H4TA 3ZWKA 3AHJA 4W9MC 1G2QA 1Z06A 4MGZR 1L7BA 4Q1CA 3MQFA 2WG2A 5AJVB 4RA9B 3KQMA 2A5GA 1XMQB 1XT6A 3N9IA 4BLOA 5CCEA 4KQJA 4V0OA 3WK9A 3JQEA 3NC1C 4RV5A 5FLKA 4OI0A 1FUYB 2BJHA 3DEIA 3K9NA 1RI4A 3NEJA 3WQBA 4CL0A 3W5VA 2WPDD 4ZYYA 1OIVA 2TRSB 4TGLA 1O6ZA 1V8PA 1YZFA 1TVMA 3ELBA 2J08A 1BH2A 1ZD3A 4YJKA 1J8VA 1PGPA 1Q3HA 1WIWA 5B7QA 3UN1A 2YZ2A 4ME6A 4GUDA 2ZYAA 3V33A 1FRZA 2NQ2C 3IMKA 5A4KA 4AO6A 4C04A 1ZU5A 3PDCA 1WULS 2ZT6A 4INAA 3DBHA 5ENDA 1Y9EA 1V11A 1Z7YA 1Z5GA 2HIMA 1E2LA 1FPMA 3LPCA 5IDVA 5IJ9A 1HX7A 1GAQA 1GL6A 1XP8A 2A0YA 3QHQA 1GARA 2CBGA 2XMQA 3HZOA 3H1EA 4WRRA 5J1SB 1YTUA 2ZUEA 4PR3A 1Z08A 3IVRA 3PHJA 4Q3OA 3EMKA 4LMPA 1ISIA 4I46A 5BNFA 1H8EA 2IU6A 3RSLA 1AKUA 3OD1A 1U4OA 1WDMA 2Z2XA 1PD1A 3A9TA 3NPMA 4WT7A 721PA 1E98A 3PLNA 1JEAA 1RWBA 1LTKA 4M4SA 4DHWA 4R71A 3B3FA 3MT7A 3RUDA 2RHOA 5H9WA 3K4PA 1FVHA 2GCPA 5IRCD 1T0HB 1FMTA 3TDKA 4FDMA 1RW4A 4RVUA 4RQAA 1RABA 4BGUA 5IT0A 4DG8A 1EVYA 2XMRA 4HQNA 4PCVA 3DZHA 4KKXB 4B3XA 5HF9A 4B6GA 1GZ7A 5J2UA 1QV6A 2H9AA 4YJDA 2J33A 1E99A 3JD0A 3EC7A 4F3CA 2DQ4A 2SNIE 4KV9A 5JCOC 4K0RA 4IDDA 4UUPA 1F8XA 1UM9B 2BMEA 1FRNA 3K6KA 5C1BA 3U7HB 3FNRA 1EVEA 1IU9A 3DLIA 3T3MB 3IEUA 4M1MA 4MUHA 1KYWA 2YZNA 2IKSA 3FOBA 3QG5A 4LSGA 1NNLA 1EDEA 1XQ9A 4LZOA 3E9MA 4OJQA 3SC3A 1QZXA 1RS0A 3DKVA 4W5HA 1E5XA 4WZAA 3DV0A 1HL7A 4EF6A 3HJHA 4G0UA 2X2OA 4BEJA 1AGPA 4E7PA 2ZYWX 1P1IA 3C1OA 1ML4A 3FYUA 3UTCA 5LOVA 4EYOA 1OAAA 1DHTA 2ZYTX 3BOSA 1QH9A 3GNSA 3DMGA 1FP4B 2FUNB 3LUGA 4PZAA 2YVAA 3JS5A 1GA1A 1N2HA 1DKNA 3MHPA 4BC0A 4XPIA 1LPAB 3LP5A 4G26A 3T8YA 1ZOSA 4S05A 4NLLA 3EOAI 1UJNA 2ZROA 4ZO6A 4QUGA 4YRSA 2J9XB 3GJ5A 3ONFA 3N6VA 2X9VA 1BX0A 2ZAGA 3AL3A 3ROKA 4C5AA 4R7GA 5AKGA 1U9JA 2EF1A 1X7ZB 5KIAA 5IHPA 2EKBA 2ZT5A<