1XRPA

Crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNQFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 115
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrpA00
3A2LA 1FFEA 1G5FA 3LCRA 3A2MA 1GPLA 2PUJA 3SX4A 1XZKA 4B80A 4KE7A 5DYYA 2HHAA 4ROTA 4G8DA 4ZWNA 1RWQA 2Z3ZA 3IUMA 4UHFA 5JD5A 5K5EA 3WKAA 5EHZA 2OQVA 1QIHA 2C58A 2WFLB 5EIHA 1WB5A 4QEKA 5IVKA 2HA4A 4J0KA 4G4IA 3R0VA 2QUBA 5AKXA 4IHAA 2WQZA 5LYYA 4Y2YA 1ZD2P 3IVMA 5DYTA 4C6HA 2Y2VA 4JYPA 3ESAA 2HU5A 1Q83A 4KRYA 4DIUA 5DNWA 3GBSA 4FWBA 1XZBA 1L7AA 4X6XA 4FNMA 2C5GA 2ZSHA 4RNCA 4E15A 5CT5A 3V1NA 1EVEA 1O6GA 3PUIA 3MGAA 3LIIA 3H19A 4G9GA 3AIOA 5EHQA 3D7RA 3N0TA 1W75A 2HA7A 5CMLA 3WQHA 2Z8ZA 1MN6A 2B9VA 2XQFA 3P2MA 4MWSA 3QBJA 3QPDA 4EBBA 5T4BA 1FFDA 1IZ8A 2J3DA 4CG3A 5HQ3B 4FLEA 1WHSA 2H7XA 3O9VA 4YX9A 2QJRA 2XUQA 2BFNA 2JEZA 2HA5A 3GFFA 5K3CA 4B81A 1KU6A 2ACEA 2BGNA 3H2IA 3C5VA 4G4JA 3STUA 4LYDA 4N8SA 2QXTA 4AB1A 3T4UA 3DOHA 2WJ3A 1JJFA 1UOPA 3ZI7A 1EDDA 3HYSA 4GXNA 3W9BA 1KEZA 4L0CA 4QDTA 4BE4A 2JIDA 1PJAA 4AO6A 1T4MA 4CI9A 1CR6A 5BWCA 1XZJA 5AK6A 3O0DA 5JAPA 4IH4A 4ZRDA 1MJ5A 1ZI9A 4BAZA 5AIAA 1BEEA 1WB4A 1T2NA 1FSSA 2WFMA 5ALXA 4DMFA 2XDWA 3RLIA 4FFWA 3FOBA 4MEBA 5HKBA 5ISMA 2WG1A 4BVKA 1O6FA 3AUKA 1FJ2A 2ZSIA 4XIIA 3F98A 2WG2A 3G9XA 3WKEA 1VXOA 1BU8A 3KD2A 2R8BA 4H7DA 4WY5A 5CRIA 5CT6A 3HABA 1X70A 3ZWQA 1MX5A 2ZYSA 3QPAA 1XROA 2Y6UA 3VISA 5ALOA 1CUHA 2CB9A 2LIPA 4IH1A 4DNPA 2WHQA 4QLOA 4UFNA 5FUMA 2AXEA 3FCXA 5DNUA 2G4LA 3H1BA 2AJCA 1QIKA 4ZI5A 5ALNA 4DMHA 2XUFA 3G0CA 5HKAA 5EHNA 1QIFA 1QIJA 1GPNA 2O7RA 1SOMA 4NVRA 4AZ0A 4PW0A 5CXXA 5JASA 1ZJ5A 1RYYA 3R3XA 3V48A 4EY4A 2XMZA 5LZ8A 1IUPA 1XZFA 3BWXA 1AZWA 1DWOA 4BP9A 4BTLA 4AN1A 4BRZA 1ZIXA 1EB8A 2QMQA 2JBWA 2RHTA 1DQYA 2YASA 1Q0ZA 4WFJA 3A70A 2GBFA 7YASA 3I2FA 5AKHA 4BP8A 1R4ZA 3QVMA 4HVTA 1W4LA 1JMYA 1DQZA 4XX1A 2ZJ7A 5T4HA 2V98A 2AJBA 1AUOA 3QM1A 5EGNA 3HEAA 4TPKA 5AI9A 5IVDA 3AZQA 3STTA 2DR0A 2GBIA 1EDEA 1QOZA 5ALQA 3H04A 3I6YA 4G5XA 4P93A 5K3BA 2DHCA 3R41A 3PFCA 4UBIA 2HA0A 3WK4A 1JMKC 1LPNA 5LZ2A 1XRMA 4P9NA 5AKZA 4OSEA 5KREA 1VLQA 5LZ5A 4TGLA 3ESBA 4LYEA 4HRYA 4P08A 2VAXA 1AGYA 1XQYA 4O08A 1Y7IA 3WK6A 4J3JA 5AIBA 1WCYA 5AKEA 5FPPA 5AKKA 3H18A 3BIWA 3AFIA 5DTJA 2ZJFA 3AIMA 2YXPX 4ZXFA 1UT6A 4QE3A 1Y37A 3AZPA 4UBJA 3G7NA 3PUHA 5AM0A 2QRUA 3V1KA 3X3HA 4BYMA 2GZSA 5CH3A 1UFOA 1TIBA 2FJ0A 2WIFA 1E3QA 3W06A 3WK8A 5YASA 3IBTA 4H7FA 1ORWA 3FCYA 4BRSA 3DKKA 5ALJA 3PF9A 3HI4A 1CUEA 4BCCA 3FYUB 3AJAA 3DL7A 4OD0A 2RGUA 4FHZA 3OG9A 4AO7A 2PBLA 5DJ5A 4GHWA 1XZEA 1E66A 5IVIA 2Y2UA 3VDXA 4K6KA 5ALSA 4MYDA 5ALHA 2C4HA 4C4ZA 3DKRA 3G9UA 1ODCA 5ALGA 1LPMA 1XZGA 1MAHA 3C8DA 3GZJA 3WK5A 5AO9A 1GQRA 1NU6A 4X90A 2XUAA 2XUHA 2HFJA 2DSNA 4H77A 5ALVA 1SCQA 4RGYA 1UKCA 3M83A 2OXEA 2CMFA 2JGEA 5JYCA 1AMNA 3I2IA 2WUGA 2HA6A 4BC0A 3YASA 5KBYA 4HTAA 3I2JA 3CXUA 1ZICA 3R3VA 1WPRA 1CUVA 1WHTA 2JF0A 1XRRA 2HRRA 3G02A 1J1IA 1H2YA 1R9MA 2WFLA 3BL8A 5AKLA 5AM5A 4B0OA 4EY8A 2JGMA 4KAJA 4PF1A 2Q0XA 4J0CA 4LKOA 3JYHA 4YASA 4XVCA 2XUDA 3O95A 4HAIA 4M0MA 1VZ2A 3C5WP 1Z68A 4QDOA 3CN9A 1G42A 3TRDA 4WFKA 5EIAA 4W1QA 4Y2RA 2RIPA 4W63A 4Q3KA 5HF5A 3V1MA 1G66A 4UFPA 3PE6A 4PSCA 2XMBA 2VJCA 3HZOA 4I4CA 1QFMA 2D0DA 1KU0A 4MYSA 3GUUA 5HCUA 4Z49A 5A7GA 4ITVA 3TEJA 5HQ3A 3MUOA 3GA7A 4OUKX 3H0CA 2RHWA 4L72A 3I6ZA 3FNBA 2O7VA 2V97A 2HU7A 4WY8A 1N1MA 1BCSA 2PU5A 2GYWA 3WWPA 5E4YA 1X2BA 3H2KA 5CT9A 3G0IA 2H1IA 3BE8A 1YAHA 5AH0A 5ALKA 3R3ZA 1ZI8A 2ECFA 1E8DA 3EF3A 3PFBA 5JATA 1AC5A 2QXUA 4X94A 3DNMA 2CBGA 2O2GA 4X00A 2WLSA 3VKFA 3WZMA 3C6YA 3F8SA 1H2WA 2CZQA 1U65A 1LPAB 5AP9A 3ESDA 2FX5A 2RONA 1IUNA 2C7BA 2GYVA 1A8QA 1CUAA 4MEAA 3IUJA 4U2GA 5EIEA 2D5LA 3I2GA 3WKDA 2DHEA 2PUHA 3G9TA 5AHXA 4H7KA 1EVQA 4K5QA 2OCGA 1LLFA 3V9AA 3STWA 4Y2UA 2HM7A 3STXA 2WUDA 1W76A 5HZGA 2FUKA 4WDQA 4BE9A 3C87A 5EI5A 3L1HA 2XUIA 5LKAA 1E8MA 1VJ5A 1R50A 1K8QA 2VQ6A 3D2BA 1ETHA 1F0NA 1BS9A 4K6HA 4F60A 5IKXA 5AKGA 1CRLA 1A8UA 1DU4A 2OCKA 4G8BA 4H7JA 5C8VA 5CH5A 4EZIA 5LP1A 3ICWA 2O2HA 3D3NA 3WIBA 3K6KA 1THTA 1CVLA 2WSLA 4ARAA 3FBWA 2DQYA 3DLTA 5AK4A 3O4HA 1CUUA 1BEZA 2XUOA 4JEIA 1Q84A 1FFAA 4UPDA 1EK1A 3WKCA 5ALEA 4CG1A 4PSUA 2QS9A 1N5MA 5AI0A 4AN0A 1H2ZA 4X7BA 4NZZA 2HA2A 4DNFA 2JGJA 3EQ9A 4G9EA 5C8ZA 4KE8A 1CUZA 1MNAA 4GW3A 1LPBB 3DYVA 5CT8A 3ILSA 5AM4A 5IH7A 1BN6A 5HF8A 3EQ8A 4S0XA 5JZBA 3ANSA 3HC7A 3R3YA 3Q0TA 4H0CA 4OB8A 4F0JA 2CEKA 1XKTA 1QZ3A 3GROA 1XZIA 3IURA 5CXUA 3PF8A 4FKBA 2V9ZA 4F21A 1HDEA 2I3DA 1N8SA 3SC2A 5HK8A 1SFRA 5FDFA 4NS4A 1VE7A 4B0PA 4X92A 3ZLVA 3S8YA 1W52X 2EDAA 1H2XA 2H7CA 2CUTA 3A6ZA 3HLKA 1LBSA 3R3UA 2QZPA 3E0XA 2VJAA 5IVHA 2H9YA 3PDCA 3C45A 4U2EA 4HRXA 3I6MA 1JJBA 4BDTA 3W04A 5ALIA 4J0GA 5J3JA 4K6GA 3VVMA 1QO7A 4FFVA 4QNNA 3WA6A 2JGLA 4J0HA 2BAGA 3EIOA 2OG1A 2WJ6A 4QLAA 1B41A 3OPMA 4UUQA 1BCRA 3E3AA 1IVYA 4GI1A 4QWMA 4M0FA 2VATA 4L3WA 2P8SA 1UOQA 2EDCA 2IX9A 5LZ4A 2PSHA 2J3QA 4D9JA 1MU0A 3KDAA 4QDUA 1BROA 4Y2XA 4ZV9A 5AICA 1EXWA 4B6GA 4C01A 5DLPA 4KACA 4ZGBA 4WDRA 4KYVA 4Y9SA 4INZA 4UBMA 4CCYB 2XMQA 1WM1A 1SCKA 3F96A 4RE5A 4W1RA 5K3AA 3S2ZA 1CUCA 4OB6A 3A2NA 2XMRA 2K2QB 1EA5A 2XUGA 3FYUA 4Q1VA 4QWWA 5C7YA 5KWJA 2B4KA 2WIJA 4Y2SA 1XQXA 3C6BA 1GZ7A 3M82A 1U8EA 2PU7A 3ZPXA 1MPXA 4X6UA 1ZD5A 4DGQA 3OC0A 2XB6A 3C6ZA 2ORYA 4J7AA 4B9EA 3DEAA 3E1GA 2BGRA 3WL5A 2CJPA 5K3DA 2OGTA 3M3DA 5AM1A 1ZD4A 2H7YA 1K5PA 4U2FA 3D2CA 3STVA 1ORVA 2HADA 1SC9A 3IIIA 1YA4A 4CIAA 3EBLA 3OURA 4B9AA 3ED1A 3DD5A 4UBLA 1CUIA 3SK0A 4PNZA 1ISPA 3B12A 3DL4A 4QA9A 1GT6A 2C0PA 4M0EA 3W2TA 4DLNA 3FYTA 3DDUA 1GPKA 2QM0A 2WHPB 5I9IA 1CV2A 4DTCA 4H35A 3QZUA 4ZV7A 1OCEA 1RP1A 1CUSA 4ZREA 2WKWA 1K6EA 4X85A 3M81A 1PFQA 2WU3A 3DOIA 1HLGA 1VZ3A 1JJIA 4BTVA 4Q34A 4UFOA 4QDZA 4U2CA 1XRNA 1XZLA 3HSSA 2XUPA 5AI4A 2ES4A 3KSRA 1UKBA 4KEAA 5AM3A 2HFKA 2BUCA 5K3FB 2OLEA 4KRXA 1DT3A 3KWJA 4QDXA 5FOQA 3H1AA 4AX4A 1UOOA 5AKYA 3MUNA 5ALPA 5ALFA 4FNGA 1UXOA 3LP5A 3FVRA 4LHEA 3IULA 4HXEB 2WIKA 1TAHA 5A7FA 4Q82A 3I28A 5AI5A 2OGSA 2QJWA 2XQKA 3UUEA 1LBTA 1J2EA 3G0BA 1TCAA 1ZJ4A 5CBKA 3AIKA 5HK9A 2GBGA 5HFNA 2HDWA 5A62A 3HACA 4OB7A 1OXMA 4DNOA 3TJMA 3HRHA 4G4GA 1DX6A 2OCLA 5LZ7A 5DWDA 2PSDA 2QUAA 3BXPA 1MX9A 3FLBA 4PO3X 3TGLA 2XUJA 2DCMA 3VJLA 1YA8A 1XZDA 1C7IA 4XWGA 3FAKA 2XQJA 2PSJA 2VF2A 1MT3A 1EH5A 4OYLA 1UKAA 2VTVA 2O2IA 1G4HA 3E4DA 1N5RA 1EK2A 2IIVA 1QGED 1XRLA 2WM2A 1CUFA 5ALRA 4I19A 3WA7A 1XLUA 2VJBA 3FLAA 5KWIA 5CT4A 5ALWA 5ALYA 5AOBA 3RM3A 4G8CA 3LIPA 4X3CA 3UUFA 3BIXA 1VA5A 2G63A 2WUEA 2XLCA 3C70A 1JU4A 2XQIA 1H23A 2PSEA 3D0KA 3I2KA 3G9ZA 4GBGA 2QR5A 3WWEA 2OPHA 1BE0A 4PV7A 3F67A 5DYWA 2DHDA 4E11A 3OOSA 3C43A 3STYA 4EY6A 4RPCA 1HKHA 1TKRA 3VVLA 3WK7A 1QO9A 1LZKA 1NU8A 4BCDA 4HXGA 2WU4A 5EHXA 4AMYA 1DTEA 3D59A 1LPOA 3JWEA 4FLMA 5JANA 3UMJA 4AQDA 1CPYA 5JZSA 2WHRA 5FXMA 1THGA 3O4IA 3I2HA 4EY5A 4C87A 1XRPA 1QIMA 1UK9A 2C5FA 1HBJA 1UK7A 1CUJA 5DTIA 5D3ZA 2XUKA 5FLKA 3QITA 3K2IA 2J4FA 1YASA 2OGZA 4PQEA 3BF7A 4H7HA 4FOLA 1NX9A 1GQSA 3NUZA 2XE4A 5I8PA 1AURA 4K2AA 2JEYA 3K9BA 1CUWA 1VOTA 1ZGBA 4AMZA 5E4JA 1OILA 2HIHA 2BUBA 3EQ7A 3R40A 5FV4A 4X97A 4P92A 5JZ9A 5T4EA 4DSZA 3B5EA 2HU8A 3CN7A 3L1JA 1XZHA 2WILA 4EY7A 1BN7A 4YK7A 4H7EA 3BDIA 2XLBA 3CCBA 1VKHA 4UHHA 3W9UA 2VT7A 5AK3A 3G0GA 5JADA 5AK5A 2VEOA 4LIPD 4CCWA 5BWBA 3QYJA 1U2EA 5AI8A 4JH0A 3DS8A 1HL7A 4UHCA 1TRHA 3ANTA 1QTRA 4W9RA 4C4YA 2NW6A 3I1YA 3QPCA 2BJHA 5AKIA 4JNCA 4UHEA 4FBMA 1XLVA 4DSAA 3H2GA 3O4JA 2G5PA 3BF8A 2CKMA 1P0MA 3R3WA 3QMWA 5BV7A 1J06A 1WOMA 4H7IA 3BJRA 2WIDA 1ZGCA 5HF9A 3KWFA 4FTWA 3SWWA 2QOEA 3C6XA 5F4ZA 2XT0A 2W22A 5AKJA 2FJPA 4CCYA 1WPXA 4V2IA 2PVSA 2GZRA 3N2ZB 2R11A 3WJ1A 1R88A 1CQWA 3WL6A 2XQGA 2VJDA 5ALUA 2QKYA 1CFJA 1E8NA 3L1IA 5ALDA 2VAVA 3ESCA 4LXGA 4KR0A 3VXKA 3LS2A 4CFSA 1W6RA 4BAGA 4WCVA 4F5ZA 1BRTA 1JT2A 1TK3A 2OAEA 1D07A 5SYMA 3WKBA 1A88A 1AKNA 4WFIA 1R3DA 1A8SA 4EUSA 1K63A 5C81A 2J4CA 1HPLA 4C88A 5AI6A 5AOAA 2HL6A 4B7ZA 1E5TA 1DWPA 3NOXA 1XZCA 3U1TA 2B20A 3C8HA 3QH4A 1ZI6A 4CIBA 2PL5A 3H2JA 4N8EA 2PPLA 1XRQA 3O4GA 3VJKA 3WI7A 5JAHA 1DWQA 5A2GA 4GLBA 1DINA 5FKJA 3H2HA 1LNSA 4G1FA 4U2DA 5ALMA 2WHPA 3D5EA 4A23A 3BDVA 2DFPA 3AZOA 3WL7A 4HZGA 4KE6A 1CQZA 1P0QA 2JGKA 4NMWA 5JIBA 5D7BA 4BVLA 2BKLA 1CUXA 1TCBA 3F97A 3NGMA 4KAAA 4DNQA 6YASA 1QIEA 3D4LA 5AJHA 1MAAA 1JU3A 3ICVA 4J03A 1MNQA 3JW8A 1DX4A 4UHDA 1AX9A 1UK8A 3ZLUA 3V1LA 5K3FA 4FLFA 1VE6A 5H3HA 1YB7A 4E14A 5I7UA 4TVKA 4KE9A 1XLWA 1F0PA 2Z5GA 5HF6A 4J0IA 4A16A 3BJMA 3G8YA 3AILA 1P0IA 1QLWA 4Y2TA 4BBZA 4W1PA 1SCIA 1X2EA 1ZIYA 1P0PA 2W6CX 3HXKA 1CUBA 1DT5A 3WK9A 3AINA 4IH9A 2UZ0A 3OTQA 2QVBA 5AM2A 5LKRA 3G0DA 2WTNA 3FWHA 4JUIA 5JD4A 4U2BA 3DCNA 4X95A 2V96A 4AXBA 1PV1A 3ZV7A 5LZ9A 1LPSA 2I3ZA 2AJLI 4L9AA 1XKLA 3RARA 1F6WA 4FMPA 3WIOA 2X5XA 2XI4A 5LLSA 5SYNA 5ALLA 1U4NA 4W1SA 2GBCA 4N8DA 4EHBA 1FFCA 1FFBA 1EHYA 2Y6VA 4QZVA 4OYYA 1EINA 1QJ4A 3I1IA 2BCEA 2XMGA 2ZYIA 3IA2A 4ARBA 4WJLA 1GXSA 4UHBA 1ZOIA 5JAUA 4N5IX 2WG0A 2ZYRA 5D3KA 2ZYHA 1HQDA 4Y2VA 1I6WA 5K3EA 1A7UA 1JI3A 2HA3A 2IITA 1YAJA 1Y7HA 4Y2QA 4KJXA 1QIGA 1W1IA 3NWOA 2ROQA 2OAGA 1E89A 3IB3A 4HXFB 3B3QA 1UZAA 1QIIA 3WL8A 3FYUC 2YYSA 1CUGA 3ZLTA 1EB9A 4J0JA 1TQHA 2I03A 4OCZA 4FBLA 4GECA 1UK6A 2DQZA 1ODSA 4EB0A 4LXIA 1VA4A 4Q3LA 2ZVDA 4FDMA 4B83A 1R1DA 5BOVA 1AQLA 4MXDA 3WZLA 1QTIA 3IDAA 1ACLA 2E3JA 1YS1X 3KOOA 4IO0A 1GKLA 5CW2A 2RI6A 3PI6A 4MQLA 1S8OA 1EX9A 5T4FA 4CG2A 5EFZA 3GELA 5CTAA 5AOCA 4H18A 4AZ3A 4BDSA 2QTBA 2BUAA 4JYMA 2XMSA 3D2AA 1MO2A 2ACKA 4X6YA 1CLEA 4A5SA 1L7QA 2WJ4A 4B84A 1H22A 3U0VA 4OU5A 2PSFA 5JALA 4UBOA 1XZMA 4GEGA 2PKYX 3RK4A 1GGVA 2WFZA 1CUDA 5JAOA 4Y2PA 1Q0RA 2ZJ6A 3IUQA 1R9NA 3DYIA 1IMJA 4BCBA 4BVJA 4DYHA 2VT6A 1YR2A 1L7RA 2OCIA 3RKSA 2GYUA 5E4TA 4LXHA 3T52A 1VXRA 5ALZA 1YB6A 2I78A 3DJYA 4MQMA 1XZAA 2OQIA 1J07A 2AJDA 4BATA 3VJMA 4X91A 4EA6A 3FSGD 1QFSA 3WMRA 4RE6A 3HJUA 4BZWA 3QMVA 1XQWA 3WWCA 4HS9A 3OM8A 1C7JA 1M33A 5CURA 3FLEA 3Q8WA 2XMCA 3WYNA 2WTMA 5D6OA 4MJ3A 4GDMA 1XFDA 3MVEA 4ETWA 3H17A 4XJVA 5DNVA 2EEPA 4PSDA 3FVTA 5A71A 2G5TA 1MX1A 1LGYA 3IUNA 5A6VA 5JD6A 4Q3OA 1UWCA 1CIJA 1YCDA 1ACJA 1F8UA 4BB0A 5FP0A 1GKKA 2JGFA 1JKMA 2PM8A 4GWLA 4DMCA 5C8XA 5LIPA 1ODTC 4E46A 4OPMA 3WWDA 1YS2X 4BC1A 4Y7DA 4DMKA 2HRQA 2ONCA 2WUFA 4AO8A 1K4YA 2Z8XA 3CCCA 4I3FA 1MTZA 1WB6A 1LZLA 1IZ7A 3DQZA 5CH8A 3LLCA 1IUOA 4B82A 1LPPA 3WJ2A 2QT9A 4DM7A 4X71A 4MWTA 1CUYA 3FSGA 5FRDA 5ESRA 1B6GA 1QONA 2WIGA 4C89A 4IQ4A 2X8BA 2AJ8A 2XMDA 1EDBA 4BAUA 5A7HA 5E2IA 2RAUA 4C4XA 5ALTA 5JARA 2B61A 3WLAA 1YSCA 3QMMA 5FPQA 3O9MA 3PICA 2JGIA 1CEXA 4UBNA 2VSQA 4KAFA 4X93A 2X76A 4B85A 1TCCA 2Z3WA 3F9CA 2C0QA 1EI9A 4Q05A 3WWOA 3W05A 1QE3A 1XQVA 5HFAA 3WYDA 4N5HX 1JFRA 4UBKA 2VA9A 4BZZA 4YPVA 1USWA 4Y2JA 2PX6A 1ZD3A 2Y1KA 4OU4A 4J0DA 1C4XA 1QIDA 2YH2A 3KXPA
chains in the Genus database with same CATH superfamily
3BB3A 5CDUA 1PKXA 1G5FA 4EHJA 4KPUA 3QIVA 2V59A 3D1VA 2X9LA 5B3LA 1T26A 3G3EA 3FCEA 4H08A 1PS9A 4A0GA 2O1WA 4WESA 1MHPA 2R96A 2IT1A 2VF7A 1NLFA 2ZRJA 4RZIA 4G8DA 4Q4HB 2H0AA 4KIUA 1SUEA 1J70A 2ONYA 2XTAA 1TYBE 2QN3A 1E96A 3KXLA 4HV4A 1SD1A 3KR2A 1PGPA 2Q4DA 4FK8A 2A35A 3DBRB 4F5YA 1SU8A 2HF9A 3I12A 2MSCB 3JQ7A 1TQ4A 3L40A 2WFLB 4I0WB 3IX7A 3OT4A 3PR1A 4JLPA 1UM9A 4AMBA 4IDDA 4BN5A 3B82A 1WB5A 4QEKA 2IDZA 2VPQA 1ND5A 5AW0A 1GRRA 3IO5A 2ZUVA 1UH5A 3OETA 3PNOA 2ZJ0A 2OV2A 2VLBA 3R0VA 4HGYA 5AKXA 2IE8A 4URYR 1QHXA 2WQZA 4JFAA 4GI7A 5CP8A 5DYTA 5TQ0A 4B4UA 4C6HA 1RXVA 2Y2VA 5DHRA 3CW9A 4RQUA 1U1CA 5L6MB 4NH4A 1Q83A 2RJNA 5DNWA 4ZVLA 1DRJA 4HR7A 1ZH0A 1YWGO 4MS4B 3B38A 4NDZA 1GRVA 5IZCC 1L7AA 3OLQA 3AUFA 2G5GX 1XOIA 4X84A 2ZSHA 5EJGA 4E15A 3VHLB 4KYIB 4G1BA 4DQUA 3V1NA 4EH1A 4HWPA 4ZZ2A 4R4JA 4HGPA 4IJVA 7REQA 5FBQB 2Q07A 1IONA 2O8FB 1BGWA 1IPFA 4ENTA 4UAVA 2Q21A 4GH5A 2BFFB 5M29A 1RXSA 5FH9A 3ZCPA 1SO8A 2XXBA 2X1VA 1Q1QA 5KTYA 5JCJD 5IEBA 3D7RA 3D5QA 3N0TA 1M1YB 3VSDA 3MGBA 5F5LA 4AKHA 2XDQA 3WQHA 1P6UA 4ESEA 3O7WA 5IX8A 1MN6A 2YVAA 4R9UC 4DMMA 4CDMA 1Y98A 3MINB 5TQVA 2E5LB 2R8RA 4AURA 1BDBA 4IF6A 2I9PA 2O4CA 3ZIAD 1FFDA 1YUBA 1M76A 1E20A 2PRZA 1Y4AE 1BXRB 2VHZA 3L7NA 1UPUA 1WZUA 2LWIA 3OT1B 5G0WA 2B36A 2J3DA 4AF7A 4CG3A 5B30A 1KWKA 1EEHA 4ZCTA 3RSSA 5HVNA 1SM4A 2CHUA 1PNTA 2KW5A 3PUXA 3R6LA 5DLDA 1XMQB 3G59A 2JJ2D 3W8DA 1A76A 1E62A 4YMTA 1NNSA 2VPZA 2XKAA 3T1QA 4YX9A 4POAA 2XUQA 1A8IA 4N41A 1I7PA 2FY8A 1KY5A 3C2QA 4BP3A 4V2UA 1YQXA 1XA3A 1DKLA 1G8FA 2JEZA 3B89A 3VAAA 2XH8A 3B6MA 3WDMA 4ZI3A 4UUBA 2FPUA 4CR6A 3IMEA 2BGNA 2GUWA 3H2IA 3C5VA 5A4IS 1XCMA 3D3QA 3M6FA 1AKRA 2FP3A 2GFQA 3BRWD 3JR7A 1LA2A 4OJQA 1GD1O 3IAM1 2QXTA 4CMJA 1I33A 4N0PA 1VMKA 2A7XA 3DOHA 5AVKA 3RSOA 1UOPA 1W48A 1EDDA 2OESA 2QTCA 3ZI7A 3WYGA 3SYMA 4FEAA 1M6VB 4B5KA 1QYCA 3EWNA 1NBIA 1CEEA 3O8QA 4OHRA 2FEWB 3ZDCA 1QZTA 2VJNA 1F48A 5E7QA 2X23A 4O2BF 4AO6A 3EVNA 3FOEC 1E1KA 1T3SA 3O1HB 4ZCIA 5BWCA 2AW3A 4NAVA 4OUDB 3GDHA 4HFRA 2YYAA 3EBOA 3KL2A 4IH4A 2EG9A 3PC3A 3NHBA 3A6JA 3NBKA 3QXHA 3GCXA 4MSUA 2W5UA 4NFHA 4O2AF 4B6FA 4BU1A 3SJUA 2F43B 1YRWA 2HQ1A 1BEEA 2AS0A 2IE0A 1EWYA 2AN9A 3SC3A 3V7UA 4R9VA 5BN3B 3C15C 5GJCA 1VE9A 1T2NA 1W30A 5JXWA 2G9QA 2O2ZA 2WFMA 5LOVA 1KZHA 1X15A 1JR3A 3CPEA 2R1TA 3N2YA 4PBRA 5GWXA 4WN3A 1MV8A 2WICA 1FP7A 4FFWA 4MEBA 3OPXA 4ZT2A 2ZRLA 2FPKA 3UV3A 3HUFA 2HRZA 3JQAD 3ZHOA 3U13A 3L7LA 4CDRA 2HGZA 4BO2A 1ISIA 2QSJA 3AG5A 2R7KA 3C6MA 4RD0A 3KQNA 1ENYA 2H51A 2FZ4A 1Y4DE 3AR3A 4RM3A 3KYIB 3CO5A 1I51A 3HCBA 2DSTA 4Q7KA 5DI9A 3R24A 3LL7A 3F98A 2CUNA 2IYTA 2VWPA 5EZ5A 3AH8A 4DARA 4PLHA 1W94A 1K89A 5AW1A 1V16A 3B52X 1K6XA 1IXZA 3G9XA 1EFUA 1N2HA 1TT5B 1V9CA 2X5JO 3KQOA 4TMXA 3U4QB 2LKCA 2O0KA 4O08A 3U3ZA 3VR2A 2JLAA 3GUCA 3K6JA 5HM8A 1BGVA 5DX8A 2DQ4A 4H7DA 4LSGA 4WY5A 1GNSA 3W4IA 2OZEA 3WSTA 4CMCA 4HBGA 3B5IA 1NHWA 4MDEA 1X70A 4FE7A 1K7YA 2JDID 3KYCB 2EFCB 3SYRA 2RH5A 1TM5E 3LF1A 4AG5A 1K8RA 2O6HA 3N7UA 1V0JA 3RNOA 1KJJA 1MX5A 1PK7A 4DXDA 4MW9A 3VU0A 3P27A 3QPAA 4XUCA 1XT6A 4RV9A 3FCAA 1W4CA 2OHIA 2Q1XA 1DEXA 1U8FO 3AU9A 5B2FA 1FXWF 1V96A 3BXZA 1CUHA 1KH2A 3I39X 3KTOA 3LZCA 4I5FA 5ALOA 5FEUA 2O54A 1GTG1 2J3HA 2QX6A 3JATA 2AFHA 4GEKA 4HEA1 2AXNA 1U28A 4LI0A 1EFCA 4UOEA 1XMXA 4G0QA 3HCRA 1T1GA 4ACBA 2E1RA 4QLOA 3C6KA 1VCNA 2GF0A 1P4GA 1ADJA 5FUMA 1N2CA 5EUCA 2AXEA 2IYSA 4GKAA 4ZODA 2ORED 3FCXA 2HHCA 1DQPA 1W87A 4QFMA 3FH0A 2DX7A 3UXEA 2WA1A 3H1BA 4P32A 4Q7EA 1JALA 1KO8A 3G5MA 4BJ3A 4MKIA 2CB0A 4NYIR 2XUFA 2IELA 3FVWA 1BAPA 5K4AA 1X80B 3VTAA 3JVDA 4WI1A 2GPWA 5HKAA 1QIFA 1D04A 1R0XA 1G8AA 4IQGA 5FWYB 2L17A 3K2QA 2QRPA 3SXUB 3TS1A 2N1BA 1BKYA 3O3CA 1P72A 2A92A 1G1AA 1RWMA 2UZAA 2WVHA 1RYYA 5SY9A 2OD7A 1KYVA 4X54A 5B3KA 1IUPA 5CFOA 1VKOA 4Q1CA 4JD5A 4MRMA 5DB4A 2ZZNA 2VHJA 3U7RA 5K7SA 2RKOA 1GQYA 4R9SA 4UM7A 1YMQA 5B1HA 3GLGE 4M0UA 4H1UA 1IU9A 1Q6YA 2AK2A 4AN1A 1VG1A 1RPTA 1HT2E 2OB1A 4XIYA 2J33A 2WDZA 4MPPA 1EMDA 4YECA 1SXJA 1D2EA 1EDZA 1K7XB 1N5OX 1H2RS 1OMOA 3OX2A 4GOJA 4LDRA 1SG0A 2WEKA 5DH9A 5DP1A 5JFOA 1NVVQ 3WJ7A 2AUNA 3BE4A 1KWGA 1Z2CA 3I1JA 3G13A 3MUEA 2JI6A 1DQYA 4YRPA 1ZFNA 2EFEB 2XOKA 4M7OA 4O5AA 1D5CA 2EP7A 3KEGA 4WFJA 1YIOA 1RWKA 4E94A 1AB5A 1TKAA 1UBMS 3KCQA 3I5UA 2FCAA 4FCCA 4URXR 4ZT7A 1VJTA 1UPCA 5T8KA 1W19A 1CZHA 1QK3A 4OHBA 5FBWB 2GM4A 2GD1O 4IPTA 3BHMA 4I4TA 1ISJA 3HYLA 3VGJA 4YMLA 2H6EA 3PA8A 1IBRA 1RHQA 1ABBA 1XTPA 5ES4B 1JMYA 3H4IA 2KB0A 2BHLA 3PVCA 3VYRB 1TDJA 2FEAA 1GAEO 2JHCA 1YVUA 3WDSA 2O5VA 3G5TA 3LTEA 5KU7A 3RVPA 1ZK3A 3K53A 5P8WA 1FDRA 3GGPA 5EGNA 4ILKA 4TN5A 1U8ZA 3T7DA 3HJCA 3E5NA 4ZVPA 4OHYA 5AI9A 5LOVB 4LWOA 3GAFA 4XZ3A 3STTA 3BVPA 3OHMA 3DAPA 5JS6A 4RLQA 5ALQA 5HDBB 3RI3A 3CLRC 1LI7A 4G5XA 5K3BA 3N2KA 4KKVA 4OQNA 2AKYA 2AXPA 2C95A 2OAP1 1EP9A 3AT1A 3CUTA 3PE4A 1TMYA 5JUWA 4Z4QA 1XMVA 5A5FA 1J90A 4IUBS 4PN3A 1V25A 5CDGA 3NH9A 2XIQA 2XRMA 2VK4A 2ZVPX 4YO7A 4F3NA 2LE0A 5BV8A 5KTOA 3AFMA 1QSGA 2GD0A 3O83A 4ND4A 5BNZA 4YCLA 1O87A 4HRYA 4BKOA 3K1AA 1JHAA 4NBNA 3W8NA 1XZPA 3OLXA 5JNTA 1AGYA 2BGGA 2ZBPA 2ASVA 1RQLA 3QX8A 4GPAA 3BGSA 5DHQA 3S27A 3K8ZA 5JMTA 1K6IA 2EJWA 4NJEB 5KNCH 3ZCTA 2NLOA 4G0YA 5AIBA 1OU0A 4KI0A 3LQFA 1YR9A 2OP1A 4JB8A 4OQZA 3JRWA 1BMFD 3AKDA 1NVEA 4B35A 1UPBA 2YIVX 4M87A 3TZBA 3EQZA 4LJ7A 2I99A 2IYFA 2YOGA 4NIMA 2PKRA 5DTJA 4ZDKA 3G2HA 1SVOA 3LZ6A 4ARUA 1QOPB 1VLLA 1Y5LA 2O0LA 1Y9ZA 2OV6A 3EVZA 4F8JA 2B37A 5DYNA 5LFAA 1JLMA 1UT6A 4ZAFA 1U8CB 5TJHA 1PUXA 1TIKA 1JJAA 2XB8A 3V42A 2CF5A 2AEMA 3AZPA 3F6BX 3ZVMA 1HRDA 4QOJA 2X8WA 3QEMB 2GVDC 1OYWA 4NFLA 4ZIRA 3VO1A 3M2PA 3ZOZA 3UHOA 2BGIA 3LDGA 3CNQS 2I3BA 1VB5A 4UC0A 3WWZA 1KZYC 1BNCA 5E0OA 1GT91 1RYEA 2GTHA 2GJSA 2RKBA 5GM1A 1Q50A 3N0RA 3OZWA 4EL0A 5ARBA 2CHEA 4HEHA 5KZMB 4HDQB 1KAEA 1NW9B 1UFOA 1XQ6A 4ZMBA 3K0SA 1ZCAA 1ZGJA 4WECA 4TKZA 2BFPA 1MCZA 1TF5A 1XMIA 4TRMA 5MFZA 4ZK2A 1QP4A 2JI8A 3QVKA 4DG5A 3G2NA 3W06A 5SZKB 2XNKA 2B78A 4ER6A 3OZFA 1P2UA 3PQ2A 4Y18A 5MN4A 1E77A 1IEXA 3BYZA 1S02A 1GEGA 4F45A 4QNMA 5FTLA 5FWAA 3OQ1A 2PD3A 4OI1A 1WW3A 3GZNA 1GPH1 3F8WA 2GLUA 2ZYVX 2O6LA 2ZAOA 3Q2KA 3SJ7A 2VSNA 1L4EA 1H0KA 2CF6A 5AKLA 2I4RA 1NAIA 1H2FA 3SBEA 2P9TA 3SOPA 4KO8A 5F1KA 5KDLA 1CTQA 3H5NA 4Z4IA 4WLNA 1PNOA 4M4SA 3BFJA 5KYKA 1W25A 5H16A 3AJAA 2ERYA 3DL7A 3P32A 4RTJA 2C7GA 5TPZA 4M88A 1ULZA 2PMCA 4ICIA 1E9CA 4C14A 3Q85A 3TLYA 2E55A 4ND5A 4W5TA 4GHWA 4K3VA 1XZEA 1SCBA 1ZYUA 1IOLA 3EJWA 5HJ5A 3K30A 2F3PA 1XF1A 3M49A 3RIXA 3UMCA 2YINC 1N32B 3NWBA 3MC1A 4R8VA 3B51X 1H3EA 1AS2A 1CY8A 1DV2A 1G60A 2Q8QA 3IQWA 1IXSB 3HSYA 4Y6QA 5DX1A 5DEOA 3T7TA 1RTKA 1NP6A 3U49A 1A5BB 1OLSA 2H0QA 2H29A 1UBKS 3D6AA 4F5EA 3MWFA 2C4HA 1SOVA 3DKRA 2ZRHA 1I3NA 2ARKA 1X1DA 2VFAA 4FYVA 4HUJA 2HOQA 3WMGA 3ZV5A 2DTEA 3R9WA 2YRWA 3HL4A 4JK3A 4F93B 2CWWA 5KJ1A 3FHJA 1XZGA 4YRKA 2PXCA 2BKAA 4HN4B 2RGWA 3WO0A 2EIHA 4OV6B 1G2OA 1MG5A 1PS8A 5HKKD 4HWSA 3I52A 5BR7A 5JSZA 2F4VB 1Y34E 2HWUA 3EXHA 1C3OB 1GPUA 1R74A 4JI2B 1NBMD 1KTIA 3QUTA 1NU6A 4GX5A 4X90A 2PLNA 2DP4E 1DOAA 1JHQA 3NGXA 4H77A 4PYRA 1IBSA 1TM2A 3RVOA 3VKVA 4ALKA 1CVIA 1XK7A 4AN4A 3T5AA 3AC0A 2CFRA 5HPYB 2QZJA 3U31A 3U4DA 2VTKA 3W4JA 3OE5A 4PYNA 2CMFA 4Q93A 2JGEA 3WHLA 2OUIA 1KERA 1ZMXA 3TSOA 1QHSA 1KEKA 2BKEA 2ZG6A 4DXHA 1HGXA 3SIRA 4IZ6A 3EVAA 4WWHA 2C94A 3I2IA 2X6RA 3JQDA 5BWNA 3PXCX 1JDBC 4IGAA 3QWAA 2G1AA 3OZRA 4QJBA 4RO0A 3SJCA 3YASA 4ACAA 1TZMA 2BCJQ 3HE3A 4P53A 3ZV4A 5CDYA 4X20B 1ZICA 3MJFA 1CUVA 3IBSA 1WHTA 4RGQA 4DDUA 3LV8A 3PKIA 1XRRA 1ZWLA 3G02A 3J7TA 5JJCA 3VI3B 1EWRA 1JI0A 3HKDA 4ISCA 1G3IA 1UDAA 3C4QA 4QGAA 3BL8A 1NI5A 4WW0A 3ZW7A 3ST7A 4DEVA 2PEYA 1DDOA 5AM5A 4B0OA 1RAAA 2Y1CA 5DTMA 3JZDA 4IVNA 2EQBA 1VIYA 2UV8A 4EY8A 4DR4B 1V3VA 3PX7A 1MB9A 2JGMA 1QHYA 2CZGA 3WWYA 1HWYA 3D0RA 2IHVA 1Y3DE 2LTAA 3EMKA 4LKOA 4MNTA 3BIJA 2BIFA 3JYHA 4HLNA 2OXTA 3SEQA 1NIPA 1WTCA 1ZMBA 3CRZA 1NHGA 3AX6A 3IEUA 1AIPA 2W6OA 2UVPB 4ZO9A 2OBYA 4YMGA 4EHLA 5ICEA 3LWDA 1VZ2A 3C5WP 3TBHA 1B0ZA 3ZD9A 4L50A 1M8KA 2IXGA 4ZOLF 1Z68A 2B82A 2O5RA 2P9QA 3TRDA 3TUIC 2Q1SA 3QBEA 3UTCA 1ZEMA 4PG4A 3VR4D 2HO5A 2FUEA 4W1QA 3UCFA 2KJQA 5G0TA 4CQMD 4W63A 2PCJA 4TOIA 3IDQA 4R1QA 2HSZA 3FTPA 3MQ2A 1G66A 1GSIA 4I3HA 4KX3A 2IF0A 3V1MA 3SN6A 5JPCA 2I7CA 1WVMA 4ND8B 3A05A 5CLIA 1NVVR 1J8MF 2GEDA 1T6NA 3OCYA 4A73A 2Q3DA 5D5PA 1EFRD 4MPRA 1YL6A 1D8AA 3DZJA 3OPQA 3QY0A 3NHPA 2AN5A 4HJRA 4F9GA 5HJ2A 1O1YA 1GPDG 4O4JB 1ID8A 4RGVA 1UDCA 3GLHB 4GMFA 4IIXA 2J6HA 4D8VA 1KU0A 5IARA 3RTDA 2VZEA 5T6BA 3GT4A 2I2BA 3CNBA 1UAGA 3GUUA 1RYZA 4JNKA 1BOFA 1VRCA 2O2XA 2WU8A 3EEFA 2QRLA 3IAFA 1A3CA 4WCFC 1G7RA 3C8ZA 4Z49A 3NJ4A 3B9QA 1K68A 1DBWA 3BRCA 3ML1A 2VUHB 4OLJA 4X1IA 4DLAA 3CLSC 4RL4A 2VP2A 4IILA 1UXGA 4Q4LA 1W9HA 3TEJA 5HQ3A 4I8XA 3OMLA 3FVQA 3GI1A 1QNFA 3AJEA 3NI2A 4LJSA 2V7PA 3MUOA 4XJSA 2CSXA 1OX4B 3H0CA 3L0PA 4BFSA 5CIQA 1SUBA 1J20A 3G0OA 4F92B 2O7VA 4ZGGA 1T0HB 4NXNB 3TO5A 1WXXA 3S2EA 4PLVA 2I6GA 5CVUA 1HM5A 2HJRA 3MRXA 2BV3A 4IFIA 2X9VA 2ZYWX 2QD3A 4MTLA 2W93A 1KORA 3ZCRA 4G63A 4IHJB 3SHQA 1BQEA 4DEXA 2K6GA 5C4IA 2C78A 3MOIA 1TZ2A 4NMHA 1I1OA 1FRVA 3V8PA 3ZQJA 5F2NA 2EBHX 2QMHA 2ZBQA 2Y27A 3E6AA 3GPDG 3SIXA 4JITA 2W2KA 3RLFA 4BB6A 2H1IA 2PVCA 2ENWA 4A7PA 3RVBA 5JCPA 1NGSA 1OA0A 1F4LA 1LV8A 3H4MA 4K88A 4UASA 5ALKA 3EZGA 2NX2A 1V5GA 3WXMA 3H9JA 4QUAA 5DXFA 4QXQA 1KA9H 3NTUA 1BFDA 4RS3A 1NVWQ 1QWSA 1H93A 5E3HA 3PFBA 1P44A 2F9LA 2ZPUA 4KBYA 4CCAA 2FSIA 1LI5A 1AC5A 1F9EA 2OXCA 3GZ4A 4UKDA 4RTRA 4B4WA 1K0UA 4YR7A 3BBLA 5HZHA 1JSLA 4DUGA 2QXUA 2WD9A 4FKZA 4JCOA 3DNMA 2IH2A 2HSDA 2CBGA 3KZVA 4TT8A 1G21A 2FRXA 3KAQA 2F00A 3RU9A 4CV2A 2BJWA 1M2HA 1OZAA 4FSXA 2V45A 1JEQA 1Y4SA 3EEIA 3PRHA 1WX1A 1YMVA 1XV5A 2ZWAA 4ZCPA 2FN4A 1SUPA 1HOTA 2I7VA 3CR3C 1G8MA 3ICOA 4DLPA 2CSUA 1TUBB 5I5GA 4PZAA 3RTAA 3HQ4O 3W2HA 1ZR2A 3OJCA 1LDBA 1KFEB 2OC9A 1DAKA 3VSEA 1XTTA 2GYVA 4FGZA 3ZHBA 1CUAA 2DUNA 2AFIE 1Q0LA 5FQOA 1PZMA 1JSZA 4MEAA 2I4MA 4K6MA 3QY9A 3SZLA 1XALA 5EIEA 3N28A 4D4JA 3A6HA 5K45A 1UZMA 4C0BA 2G88A 3OU2A 5DIFA 1RIIA 1V5EA 3EXAA 4AKSA 1YS9A 1N1GA 4F3TA 1Z0FA 4M46A 2BFDA 3QENA 1U7PA 4BNZA 1USGA 3CRQA 2OGWA 3NHLA 1LLFA 1W8DA 3C97A 1UDBA 4Y2UA 1TNDA 3HA5A 4PC1A 2Q1WA 2W48A 1W34A 4NYMQ 4WXHA 5EWJA 4D98A 4K28A 3G85A 1Z16A 4YLEA 4DLVA 3UK0A 4DJEC 3HP1A 5TEVA 4F96A 1SELA 2BF4A 4MUAA 1LY1A 2F59A 5HZGA 4FMDB 1FTYA 4BE9A 3PK0A 3K09C 4IX9A 3Q8LA 4GD3Q 2JCYA 4GKKB 3TNYA 2Y3IA 5EI5A 5T5QA 5F9HA 3EUEA 3DA8A 3ZKWB 3KXDA 1E8MA 2PGLA 2Z5VA 3ZDAA 2V54A 4WA8A 1PD1A 2J59A 3U44B 1R50A 1WR8A 3A4LA 4R7ZA 1K8QA 2G0TA 1ETHA 1I7SB 2NSJA 3NMUF 4JT8A 4WKBA 3AQ4A 4F60A 5IKXA 1BGXT 4RFVA 4M8IA 3VR6A 2F1RA 1XXHB 3T3EA 4G8BA 2R6AA 4IGIA 5BR1A 1ZXXA 1ZHOA 3GDGA 3RB8A 2OD2A 3KFLA 5C8VA 2CUZA 5H70A 3WSWA 2QMZA 5CH5A 5ERGB 1JQ5A 3OLCX 1O0BA 1J2JA 4BLQA 1ZAKA 3ICWA 3PQFA 1DTWA 3MMNA 4K3UA 1WL8A 3TNDA 1R2QA 3K6KA 5HFJA 3WB1A 4Q7LA 5IKMA 3I9MA 3TTUA 3ZXUB 2WSLA 3UFXB 5H1YA 4MR9A 3FBWA 1OXVA 2DQYA 1YB4A 1CUUA 2EL9A 2VBCA 1N9GA 3H5WA 3PI7A 2ADOA 1GARA 4PZ9A 5EWLA 2Y76A 3M9XA 2VNIA 3OSZA 1DXOA 4R8RA 1JDUA 5EUBA 1W5AA 4BJ5A 1TM3E 4NBLA 3J7AC 2Q9AA 1EK1A 1OIXA 2OK7A 5EVCA 1VMIA 4UJ3A 3ZH9B 5IUNC 2RE8A 2QS9A 1S4MA 2QY9A 3RKUA 3IHLA 2QRVB 3KKLA 4YFVA 3NBQA 2V7EA 1LVUA 4BLPA 2I8LA 3UH0A 3VOSA 4X7BA 4DLYA 4ZVUA 4MIEA 2R62A 1PWHA 2ODWA 4IM7A 4NZZA 2HO4A 2HA2A 4DNFA 3OPNA 1E9RA 4K87A 1CUZA 2ODEA 3OA2A 4HZUA 4YUWA 2A1UB 3PQ7A 1LPBB 4JR0A 4AJ4A 2QVXX 4JMLA 1LDNA 3ZQ6A 3OQPA 2VH1A 3PJFA 5CT8A 1DFGA 2CK3A 1Z0UA 5KTSA 5JCOC 3R20A 5AWFC 2E4WA 5IH7A 5AHOA 2W9XA 3EQ8A 1DB3A 2WD8A 1VI2A 1VPLA 2ZI5A 1BHSA 1ULTA 3ANSA 2ZQZA 3FDZA 3NR2A 4DCOA 2QP9X 3GJXC 3R3YA 2AF3C 4MKHA 2H1LA 4MYHA 5CU7A 5IVPA 5EXSA 4H0CA 3VV2A 2GN1A 1L0BA 2C54A 5C8DA 1C50A 3GROA 3JQFC 1XZIA 3OP1A 3IURA 4COOA 3SLGA 5EJEA 1A71A 2FSSA 3IKMB 3WAGA 3DT8A 1FVXA 4FZJA 3AHFA 8ATCA 1X7WA 4C22A 4F6RB 3U40A 1HDEA 1BJKA 4F21A 5KTRA 4J7XA 1NUQA 2IHYA 3GY0A 3SC2A 5HK8A 2JGRA 3A2KA 2RHRA 5A4DA 1VE7A 4CQLA 4IAOA 2REQB 4X92A 3JWGA 3CRNA 3S1LA 2XTJA 2PH7A 4E1AA 5BMVB 4A2WA 1HI9A 2JBHA 3CMMA 1QDUA 5JQGF 4ERNA 5HCIA 2DJIA 4CKBA 3NASA 5TEWA 5AW2A 1FYFA 1NFQA 1U7DA 3KVNA 1CKEA 4F7DA 1L5OA 3M5PA 1QK4A 4LDAA 2CXTA 2AZMA 3KT3A 4WK2B 2P1ZA 2OBFA 3R3UA 5CGZA 3E0XA 3KKMA 4LCJA 4JDUA 1AMUA 2VJAA 3NFRA 4KZPA 3JZIA 4QM7A 5FNVF 3K0HA 3M5DA 1Z2PX 2JZCA 4QREA 1PJ2A 1SUAA 2P30A 2ZUSA 4Q9HA 3WGZA 4PCLA 3PDCA 5DTEA 4RKRA 4NCJA 1JJBA 1P6QA 3DV0B 3LH5A 3SKXA 4TTQA 3W04A 5I7VA 3QJGA 3VVMA 1PX2A 1L5HB 3NJ8A 3HO8A 2L19A 4RYDA 4LN1A 1EFPA 1RT9A 3ORQA 5JO9A 1A0OA 1TTTA 5L7WA 2QG6A 1ZVJA 2Z98A 1A2KC 4LDJA 4MVCA 3C1UA 4J2HA 5EWJB 3WRWA 4ER7A 4F5WA 1NVKA 3I4LA 4J0HA 1KKMA 5J4YA 1AKVA 1K2VN 5WRFA 5LD2C 1N75A 2QZZA 4PCAA 2WJ6A 3D4BA 3AUTA 2AYZA 2H8GA 4QLAA 3TQCA 4EJ6A 1MW8X 1J09A 4EI7A 3VR1A 3SC6A 4MCHA 1N7HA 4B74A 5F78A 2W37A 2CW5A 4G1EB 2HLDD 3FYDA 1TAQA 4LOIA 1XPJA 2P8SA 4QPDA 5KQMA 1WV1A 3SSAA 3GB9A 5DW3A 1P1JA 2EDCA 1Y5RA 3DC2A 3CKYA 5LZ4A 3HXMA 4TRNA 2PSHA 1GR0A 5EIXA 3S2YA 1C80A 4FP9A 3NV9A 3HL0A 4QDUA 4CM9A 2AE2A 1T9HA 3CT4A 4ZV9A 2F6RA 5IDVA 4DCCA 2E87A 3BCRA 4WNAA 1KARA 1DNPA 3WIUA 1XVAA 4ZCMA 1AT1A 1VCIA 2XCOA 5IT5A 1Y80A 1HH4A 2PS0A 1UKYA 1ZK4A 1J8DA 3A6GA 3HDTA 4ZAXA 4FFNA 3TXYA 3KFVA 1K6JA 3UW3A 4PN7A 1VIAA 4HWRA 1QF7A 4NYJQ 3ZJ5A 1U0FA 1VDZA 1PKEA 4RVCA 4DDTA 5H81A 3JQ8B 4XJXA 4EFMA 3ONDA 5K3AA 1CUCA 4OB6A 5IMBA 1HMYA 3H8SA 1M0WA 1V3QE 2K2WA 3JTMA 5T3UA 4BWVA 3U7HB 1P18A 2Q2OA 2FWRA 2J5KA 1RCUA 2K2QB 1SIBE 5FORA 2GZHA 1TE2A 5CLJA 3L7YA 2PLRA 3HG7A 4AJEA 1TL7C 1EEXB 2EBFX 4E5MA 1OBVA 2IYNA 3BQMB 4O5OA 4QGBA 2WTUA 2Q3HA 4V0OA 1Z4KA 3LCMA 1EUQA 2GR9A 4ZEOA 4YQYA 3P0JA 5EVJA 1JG3A 4DCGA 4Y2SA 2O3QA 1TPZA 3DFKA 3EE6A 4CI0B 3IPLA 4GF5A 1K66A 4QHSA 1NRIA 3EUAA 3M82A 3T4PA 4FOSA 1JMVA 1FU7A 2O3UA 3EGOA 4TUYB 5DGCA 5SY6A 5B6PA 4PYKA 4ND1A 3W5UA 4E5UA 3SLRA 1U9ZA 2IHKA 2YXLA 4INPA 4JKOA 1ZD5A 3K0KA 3K9NA 4UTZA 4ARSA 2XB6A 3NWEA 1T0BA 3BK7A 1NI4A 4FONA 5ITZA 1PJCA 1Y3IA 2VEDA 3U7JA 1Z6TA 3OFVA 4XYGA 4EVQA 3CVVA 3ETGA 4KUGA 2Z2JA 3RT9A 3FDZB 2QQGA 3AF0A 5K6RA 3CE9A 3HKEB 5SZIA 1AU9A 4P1ZA 1SD5A 2FUG1 2PLFA 3VU9A 2VCHA 3FIUA 4TV9B 2JRLA 2GJKA 4UXIA 1H4SA 1U0TA 4NZ9A 1U3CA 1CERA 4BP1A 2AOTB 3T7EA 3DFMA 3TAHA 1C7RA 1KVQA 2EHDA 4WOPA 3BWYA 3KPYA 1BG6A 2QU7A 3PNQA 1SC9A 2V3WA 1T8UA 2PWPA 3FZQA 5EQDA 5EIBD 2IZZA 1KR5A 1H9BA 3GOQA 3H86A 3X1MA 3IAS1 4BFYA 3JY6A 3DG9A 3V3KA 5BPFA 1M6WA 1ECPA 2CFCA 2H65A 4YJ2F 4QBTA 4KQFA 3KD3A 3KT0A 2VSYA 1MJHA 4CKBB 3AHGA 2GZMA 3DD5A 3DNFA 4UBLA 3T7JA 3GGCA 2GEFA 2PTGA 4NC9A 1OLXB 2NIPA 5KSOA 3UKOA 3DL4A 1NBWB 3T5CA 4U2KA 3EG9B 2AD1A 3PDIB 1D3AA 2C7PA 1HE5A 4A91A 3KYDB 4JY7A 2X6QA 1P1IA 4N6NA 2YVQA 1HQCA 1U1GA 3UGJA 4CM5A 3FYTA 4FNAA 1JHMA 4HN2A 1EUDB 1ULHA 2XHEA 3OO0A 4LKRA 2AN4A 3DMFA 2FPIB 3P9NA 4KQ1A 4MUMA 3L7DA 5LQMA 2IP4A 3FWNA 3GARA 1U28C 4U3JA 4H35A 1PN3A 1E6CA 2BHSA 5DMXA 1X7XA 1ZVMA 2EKBA 4ZV7A 4DANA 3DWEX 4C03A 1ZONA 1OVMA 3AVWA 1ORDA 3OCZA 1HF3A 2I22A 2IIQA 3FMOB 4RFSB 4X85A 1U1IA 3KTAB 3NKVA 3SF8A 2H1OA 1R66A 1RWXA 4ZAYA 3PL1A 1Z4OA 4AFNA 4RESA 2ZREA 2EKQA 5BYBA 1R5OA 3BB1A 2B2XA 3PXDA 4LOKA 4KLNA 4HPJB 2E1PA 5EMKA 1IMOA 1VZ3A 3B3JA 1Y1PA 3NPAA 3FA2A 4Z6KA 2OO3A 2WABA 3OY7A 4I1YA 4EY3A 1STOA 4U2CA 5C34B 4RF2A 1XZLA 4EQZA 4JC8A 2IZ1A 4IOKA 2J9ZB 2BD0A 3UB4A 1ICIA 4BFTA 3KSRA 3OFNA 1YJBA 1RCTE 4G4SO 3UC5A 5CVCA 2OXIA 1R7RA 3QF4B 4X3PA 2B1GA 1ZD1A 5AM3A 4OQDA 1E9FA 1Z5GA 2AHOA 4Q3EA 1UMBB 3JALA 4KDRA 2BUCA 3N7TA 2VUSA 4R2HA 4ERXA 3NVDA 2NV0A 3I5XA 1PR4A 4E22A 2DHQA 3FFXA 5KVSA 1Z5ZA 1JHYA 1QAOA 2PZJA 3KR9A 3N3AC 1PFWA 2E2WA 2LPMA 3KWJA 3LUJA 1ISHA 1EUYA 5B57C 2V55B 2BBOA 3H1AA 4DBLE 4M1YA 1SXJC 2YL2A 4I1RA 1EQAA 3OPYB 1OXTA 4ZJZA 1UANA 4I6GA 4Z4HA 3FFWA 3W5HA 2HLHA 2D2EA 4ZAVA 3IP8A 5ALPA 2TS1A 2JBAA 4EHDA 4HUTA 4CMEA 2JJQA 4ETNA 4ZI7A 1T2DA 3UBMA 3PQ6A 2XZPA 3VBEA 3JZMA 3FVRA 2ZUUA 4LHEA 1QMGA 3C1AA 3GJ0A 5BSWA 5T8KC 1PNQA 1TAHA 3T0GA 1H42A 4Z3DA 2GN2A 2WYOA 2IH5A 3M1LA 5CDTA 4KQKA 4Z7OB 1T24A 3EPLA 4D4LA 1NN0A 5KAPA 4BEBA 3BKXA 3U4AA 3BXGA 4WLFA 5T6MA 1PWYE 4MR8A 4JOBA 1EP1B 1JQKA 3G0BA 3IFSA 1KSJA 3A3PA 1E1NA 4Q16A 4QODA 3DF9A 3AOGA 1DJLA 4FFMA 1RZRD 3CVXA 3V4LA 4XYBA 1JIQA 2FN7A 2WK1A 4GM0A 3RS4A 3W7VA 4I55F 5K8JB 4W99A 2BFCA 3HV2A 4EITA 2X5NA 5GTDA 1U3DA 2VPYA 3AIKA 1X74A 2O07A 5JYBA 1LSJA 2JARA 2YIJA 2CXSA 4G5YA 3Q3HA 5ITZB 1N1DA 3KYJB 1QG2A 3KOZA 3HMKA 5A62A 3HACA 2DUJA 3TLZA 4A27A 1OXMA 5HWSA 1XZNA 2NZXA 4BQIA 1HYEA 4CEJB 4ETIA 3TE7A 2OCLA 1N0UA 4N7BA 1TAUA 2DWQA 4JQOA 4DIMA 4B76A 2PSDA 2EFDB 1JA0A 1U02A 1P39A 3FLBA 2POCA 3BMQA 4W5HA 1V1RA 5J4HA 3PXXA 1O9GA 3LC0A 1R6VA 3VJLA 1GY8A 1WZCA 4MRPA 3AYXB 4PWYA 4URWR 4LMPA 4XWGA 1T9BA 1PDWA 1XQ9A 2D2IA 2RAFA 2XQJA 1V7ZA 1T9GR 1MT3A 2R4UA 2JKVA 2XDYA 1B76A 4J2TA 2AC4A 2G9RA 3BFVA 4MMZB 2IXFA 4U7TB 3HP4A 4PYLA 3OOWA 5EPOA 4J9UE 3SICE 3H5AA 3BXOA 2Q0QA 1HE4A 1D9XA 1TQ2A 2FPGA 2IIVA 2QDXA 1XZQA 2UVQA 3PEFA 3SDBA 1L4YA 1XRLA 2RK4A 1CUFA 3U5TA 1PJLA 4XFJA 4CIVA 4DWVA 3KVVA 1KI6A 3FLAA 1HK7A 1RMYA 3ZXYA 4FFRA 5CT4A 5ALWA 3RU2A 4UAUA 3LIPA 3GEEA 1IJEA 1TZBA 4L85A 4WBSA 5IBQA 1QH1B 4DG8A 3BIXA 1JEYB 13PKA 3TXAA 1S6YA 1IL0A 2W2VA 4M9ZA 3HU5A 3L7IA 4E4RA 1FFYA 4AK9A 5D5QA 3KKKA 3RYFB 1C9MA 1X8XA 3D0KA 1SBCA 4NYJR 4YRMA 3I2KA 4PPFA 4XPIA 4Z9FA 3TM4A 1LLCA 2QTNA 1ZISA 2OYSA 2QR5A 2UVDA 1FE8A 3EGCA 3F4BA 4Q24A 4HDRB 2VSFA 3AR4A 4NAUA 5JDIC 2ZCVA 2X40A 2DHDA 4UEOA 1D7AA 3FNIA 4YLGA 5JH7B 4LJ8A 2FE4A 2QYTA 4CE6A 1WKVA 4DZZA 4EY6A 1NXQA 3UJ8A 2JFHA 4CIYA 1OAOA 2GM3A 2ZDQA 3OJEA 4MICA 4J4HA 1FLDA 4XD7D 4P0QB 2QTGA 1F51E 1Z36A 4RETA 3V97A 221PA 4C7BA 1PS0A 4QPNA 4RADA 3U48A 1G2QA 5IG2A 2EFGA 1KIMA 2CLEB 2P8JA 4HO1X 2DPHA 3GFVA 4LI3X 2WU4A 1OR8A 1JAYA 1ZM7A 1NG1A 1S3GA 1ZO8A 2WYVA 3GBVA 2YS6A 3GLVA 3D59A 2FMIA 1FU4A 3I9NA 4LEIA 4F84A 4WUTA 5C8YB 4J3NA 1SRQA 1ELOA 4ZTBA 1GZDA 3LXMA 4RW0A 4AQDA 5EERA 5KOJB 5BN1A 5JZSA 1V41E 3HM2A 5FXMA 5KSPA 4QVKA 2C61A 4EVIA 3O4IA 4OQXA 4R0NA 4AYWA 3ELYA 1KIFA 4AZSA 3I2HA 2GAJA 3P2YA 3SQMA 4LVUA 3K70B 2H1RA 4BBPA 4P33A 2IYXA 3IPXA 4DQLA 4ENRA 5EZYF 1NRXA 1QIMA 4YT8A 1ML3A 4AUKA 3KV1A 3WLOA 7ADHA 4TSRA 3UZUA 3LT1A 3ON5A 4QUBA 2DLNA 4IUYA 2FWMX 4FGJA 5G4KA 3FKSD 4GZ5A 4YRDA 3G1WA 6ABPA 4BMPB 3P20A 4ZI7B 4BV8A 5H68A 1WA5A 1X7HA 3PHJA 1RAHA 2W8BB 4KIGA 4KSCA 4L73A 4NBVA 3BXEA 2ZYTX 4PLGA 3UGQA 4YEDA 4XGKA 2FR8A 2J4FA 1Q95A 3JXEA 4JYZA 4MV7A 3L6BA 3ZBQA 1GAJA 3BA1A 2WSYB 3BF7A 3R0XA 4HT3B 1EIWA 5CEEA 1OE0A 1SG9A 3H1PA 4LSMA 5D3MB 2CD7A 4DB4A 4TLEA 3HCWA 1VP9A 1JXAA 1ZS9A 1QCCA 3THXB 2Q3CA 4I9HA 2VF4X 4PHCA 3R9KA 3EXHC 3FMPB 1ODFA 3FUCA 1A9RA 1HDCA 1PUJA 3GHYA 3NTQA 4Q4JB 4AMZA 4CUJA 1HL3A 3GLGA 1PJTA 4NE2A 1QK5A 3L4SO 3SJAA 3VR5A 4ZEMA 5BN4A 3SR4A 3WGKA 1XKQA 3DM5A 3EQ7A 3R40A 1PJBA 2NU6A 4MA5A 4X97A 4GP7A 5EE9A 4OFWA 3ZYCA 3FRHA 4UUOA 3QE2A 1T1RA 4Q9AA 1MV5A 5T4EA 1OU4A 4QIHA 2OEPA 1FBNA 5FUBA 1ISFA 3PRYA 5EL0A 1FTGA 3L2OB 3DMGA 3CN7A 4DZTA 2ZBVA 1U0RA 3CGGA 4L28A 5BSRA 3FB4A 3O92A 1PL7A 1A5AB 1ESZA 1HDIA 1NJ1A 1UC9A 2DBVO 2DFVA 1F2UB 2DWCA 2WILA 3DAYA 3ZY5A 4CLRB 1H4VB 5DM2A 4YB8A 4EY7A 3GFOA 3NETA 2Q7XA 2GI4A 1V1RB 4TWAA 2JIOA 4C5AA 3KEOA 4FYYA 5BW8A 4H7EA 4F4CA 1P1BA 3KB2A 3N6XA 1LDEA 2PYZA 8GPBA 1SBIA 4HZIA 5CB6A 4BX0A 1E2EA 3ME5A 1FNNA 3M9WA 1DX9A 4D2IA 4FINA 5EP3A 1VKHA 3USES 3LC2O 1FNSA 5B4VA 5AK3A 5HBRA 3VH4A 4L57A 1DPFA 2PTHA 5TGZA 2FEMA 3RC3A 5AK5A 1RNLA 3OZ7A 1EVYA 1C1DB 1FOEB 4LNHA 1XEXB 2C3OA 3RDPA 3WYEA 2Y1FA 4CCWA 4R3NA 2RI0A 4PZEA 3K9FC 1ENOA 1FTSA 2N75A 3GH1A 3ZTYA 1JYEA 2C2YA 3QYJA 3H1TA 4BKMA 1PDOA 1PJZA 4JJKA 1OA1A 1W0KA 2EL7A 3IQZA 1RWBA 1MRSA 4UM5A 3ZDYB 1KMMA 5LR6A 2IHUA 1KFKB 2DC1A 5E6SB 1W36D 3NQ41 3AKCA 2ZWIA 2FX2A 4RMNA 2AMVA 1L5WA 2ZRNA 5TVGA 3IVRA 3U1VA 2R4TA 3EQ6A 2YHIB 5AVZA 1DJPA 2BJHA 2LR0A 1SVKA 4JJAA 4GZLA 1W88A 3DE1X 5AKIA 4JB2A 4JASB 4Y67A 5HKOA 4R8SA 3LT2A 3I4FA 4MQEB 3WY9A 4UZSA 1PJQA 3GCGA 4DSAA 5IJZA 1IG0A 3NB0A 1FFGA 4X1YA 1JSRA 2O8DB 5IH3A 3U62A 4KXYA 1MJFA 1LWNA 4DV6B 5CB4A 1E0AA 1P0MA 1SKYE 3QMWA 3VTKA 2H1CA 1KFJB 1ZVVA 3ZE0B 1NBHA 1WOMA 1D1QA 2R751 1PR0A 4DHWA 4L74A 1Z0JA 4YDQA 2WIDA 5ITVA 1K9SA 3FVVA 1A27A 2QW8A 1ONSA 4M38A 4RH1A 4KQMA 1QR2A 5ECYA 3SWWA 1YQDA 1D6SA 2P4HX 2R2AA 4K9DA 2FTKE 3UY4A 2JB9A 3DBOB 3CUKA 3E4CA 3H1GA 1NMYA 1NXSA 4LK3A 5JXHA 3CRMA 1T5DX 3CZCA 3P7MA 4ZHQA 4LF5B 5EC8A 5I9BA 2ZT7A 3DONA 1UAAA 2UUCB 5AVJA 1JT9A 2PIAA 1SBHA 3M8KA 4J29A 3VFDA 1OJ7A 2FJPA 3EGDB 3LFUA 2HTFA 1MRZA 4IQFA 5DP2A 4CCYA 1IC6A 3GMSA 1Y3BE 4XI9A 3ZQKA 2PVSA 3I45A 1Y5IA 3N2ZB 3WJ1A 1L3IA 2OYRA 2C82A 1LQTA 4ZD6A 2OV3A 2ZM5A 4H4CA 3WL6A 5EZSA 5KNCA 3Q8MA 3AMVA 3KT8A 1PK9A 4BTEA 1Z7YA 2VNKA 3DUWA 1VLZA 3EFHA 4LYJA 4L76A 1JE0A 1N5LA 4HDKA 3L0SA 1CQIA 1P29A 3HBLA 1DI0A 1RYFA 1V95A 1E2PA 3EYWA 4QQ8A 5JJLA 1JPJA 4LJAA 5ALUA 1FQKA 5F2KA 1N2SA 3ROFA 3RUAA 1C3VA 2HWXA 3EXIA 3GLQA 1R9JA 1SUIA 3FHCB 5HF8A 3RVJA 4J6FA 3E9NA 3OY2A 4M8KA 4YP9A 3HDYA 3G6WA 4H9GA 1JQDA 3FUTA 2AWNA 1PP4A 3LHDA 1W6RA 3SXPA 1AKTA 3CSUA 3QG5A 1L3BA 2L69A 4MUYA 1X7ZA 4WCVA 2I87A 1NN1A 3ZBPA 3K71B 3KPWA 4KHPB 2X1MA 5FL3A 4WT7A 1XE3A 4WFQA 1KO4A 4Q3DA 1YDEA 2M6RA 2Y05A 1D07A 3WRXA 1L5QA 4HI0E 2JZNA 3D8SA 3MD9A 5GM2A 3NHMA 3IBCA 3GLGB 2JJ8A 4YT4A 4FEYA 2VJYA 1E2BA 1A88A 2ONJA 4OHPA 4R83A 3HO1A 3OLWA 2W6QA 2ZITA 1OH5A 1A8SA 2OFWA 3LTNC 1K63A 2CLCX 1VPTA 1OWMA 3IDFA 1PSDA 5G0SA 2PDAA 2NPOA 4YUZA 3FMIA 4B2YA 1HPLA 2FRVA 3I4CA 3KHTA 3B7GA 2WI8A 3LRPA 4NL4H 3V80A 1QVRA 1AQYA 2P2ZA 4BNTA 2EZ8A 3BIFA 1E2HA 4CN8A 3PHCA 3INRA 1GHTA 1V8ZA 1N5DA 3KZ1E 5AOAA 2ZBRA 1E5TA 1DWPA 4U7GA 5LYJB 1F7VA 3MWGA 2BSXA 2EXXA 2W2LA 1Y9EA 2MSLA 2ZRAA 3IXQA 3K96A 3NOXA 3OAAD 2WTXA 5EQTA 3U1TA 3TZHA 4W8GA 3C8HA 3F7TA 3HCPA 4F06A 3MG9A 1YZYA 1ZI6A 3GEMA 1K7CA 1LW6E 4HY3A 1G63A 5FOVA 3WYBA 2MDTA 4F2GA 1XDUA 2NT3A 3BZBA 3H2JA 2PS9A 3K5IA 4KWTA 3O4GA 4BV9A 4CHTA 2GN6A 2H31A 5D1HA 2YFQA 3NORA 4GLBA 3EIEA 2QTHA 2JJYA 3MAJA 2J5QA 2Q27A 3NHZA 4E5VA 1QGYA 2QRHA 5ANRB 1LNSA 2VDQB 1MAWA 1JDPA 3KB8A 4G6ZA 3DHWC 3QFHA 2WHPA 3QNWA 2WTBA 3HBMA 4NQZA 2D0PB 4AWBA 4L3OA 2P5SA 1GRCA 3VOTA 1XK6A 2D1FA 4HZGA 4CM4A 1RKUA 2AR9A 3L8FA 3R6TA 3GDFA 4JR2A 4D3ZA 4KQ9A 2A1TR 3GK3A 3C5EA 4JLMA 3ZTWA 5IHXA 4ANFA 4JYAB 1TTHA 3DOUA 1WQ4A 4N0DA 5THXA 1B43A 2ZW9A 1DAHA 2H5IA 3DFZA 5DISB 2ZSEA 3E3LA 4OL0A 1KDRA 4QXOA 2B8TA 3MS2A 3ENZA 4LYYA 2D13A 3NGMA 3LK7A 3GJ7A 5IM5A 4ZYWA 5CB4B 4LCBA 2MJLA 1LF5A 4N40A 3P45A 1ACMA 3IVCA 1ONOA 4U0KA 2HQSA 3I09A 5KDOA 1Z4IA 2PFGA 5AJHA 1NOKA 1RE0A 3PPIA 3E9YA 1JU3A 4TMFA 3ORFA 1WDTA 1KJIA 4HAXA 1Z5WA 1R0KA 1MNQA 1TEZA 3W3ZB 1P5FA 3IJRA 3LC1O 1K9VF 4C6SA 2LVBA 1DX4A 2WVGA 5ILOA 5JS1A 4CKCB 4WXPA 1NYRA 1TW2A 1N2XA 3OJ0A 3N8IA 4JLKA 4YRZA 1GAQA 2NUPB 5IC6A 3LLMA 2PZLA 4UXHA 1Z2AA 5DMHA 5EXDA 1UBEA 4LDPA 3ER6A 3ZLUA 4ZHQB 3KQLA 3AVYA 1G1MA 3BBPA 1C0LA 1MXHA 3DTVB 1VE6A 2J6BA 4CEIA 5HNKA 2QRQA 4KPFC 1JR6A 1WP4A 5KIAA 1E3WB 1UOEA 3CY6A 3LJKA 3JU3A 1CJTC 2YIMA 3HM9A 4NY1A 4DQDA 1EVKA 3PD1A 1DUSA 1ZKDA 4KW7A 4RPHA 3W7BA 1B23P 2WW8A 1HA3A 1WMDA 2G07A 4LQ4A 1EZ4A 1YRBA 2HV9A 2YV5A 9LDBA 4RLHA 1M54A 1QDLB 4EARA 5F12A 2GEVA 1EQ2A 2MR6A 4L8LA 4C7KA 4J0IA 2H2AA 3BJMA 3PX3A 3VR3A 1Z0ZA 1NBME 3A7DA 3E70C 3LYUA 2JGNA 4D9MA 4WBNA 1OH6A 3G8YA 4QPZA 3AILA 1TI7A 4EWLA 3AF3A 3W6NA 4GX0A 4EF6A 1IQ0A 1DQSA 3FI0A 3IOYA 1SUFA 4PPNA 5CVDA 4BBZA 1DTSA 1Q57A 3A3NA 1GCGA 3G2KA 3IT3A 2H4HA 4Q47A 5KMGA 5EQFA 4W1PA 1JZTA 3DM9B 2R0QC 3QVGB 1T4DA 2MSWA 3EYAA 3HCCA 3RFTA 1FXSA 4DC1A 1Y82A 1E0SA 2PWZA 1WF6A 5PGMA 4DXAA 4YCCA 4DIOA 1B6TA 2O4UX 4XAQA 3Q9SA 1LSUA 4NBUA 2W6CX 1R10A 3LA8A 3VR4H 1GU1A 5DF1A 3BQNB 3OH8A 2GZAA 4MVYA 3V7YA 3K5WA 3VSCA 4IH9A 4OXNA 3T94A 2IUUA 3ZNPA 4FKMA 3WGUA 4TKUA 3VZPA 2QVBA 5AVRA 4DV3B 3KUKA 1TOAA 3HUTA 1Y48E 3LBFA 3LKVA 2ZJAA 1I30A 2CXNA 3FPCA 5TNXA 5I4BA 3OZEA 4EPVA 3PB3A 2ZB4A 2GTPA 3VPFA 4BY9E 2PIDA 1F2VA 4QYTA 3CZAA 3ESYA 2WTNA 4ASUD 1DBQA 4EBFA 4ZOQI 1WETA 4K26A 1W2HA 2A0FA 2HPAA 5KYGA 4PC7A 1LS6A 2ZXUA 4U2BA 3DCNA 4J03A 4LWQA 1VQ1A 3BSWA 3GQBB 4JSYA 2GPNA 4PLYA 2V96A 4UDNA 3TZEA 1KQPA 2ZRIA 1T36A 3OJOA 2B83A 2Y1XA 4JJFA 2V7XA 4AJIA 3K5PA 5LZ9A 3TEFA 2WJAA 3HZHA 5CA0A 2AJLI 3L7JA 3A9UA 3NP9A 4REQB 1KEEB 3S2GA 1ZL0A 1XKLA 3IIJA 1FFWA 1GZVA 4UU1A 5D86A 2FPRA 3IEXA 3OE7A 1OYOA 4FMPA 1S2IA 1YDMA 1NQVA 1OLUA 2FEPA 1NMSA 2NYVA 4OMFG 4WRRA 3UCXA 2A4KA 4CT5A 3RC1A 3WIEA 5SYNA 3ZUPA 2H1SA 4KR7A 2W83A 3E9CA 3THWB 4DPMA 1NLUA 2IX3A 3IAAA 2FPSA 4JBXA 1RHMA 2C20A 1HV8A 2W71A 2JAPA 1TJ5A 1NBAA 3DPUA 3UNXA 5A2QA 1FVFA 1O5TA 5E6UA 2A9JA 3WTCA 1CJMA 4TV8B 5B6JA 1M0TA 3KSUA 3MSCA 1EWQA 3PUVA 1VI5A 4KAXA 4B17A 1U3GA 3IKJA 3UPUA 3RVNA 2QTLA 2W2MA 5GGXA 2R8ZA 1AXEA 1P1FA 4E88A 2AFIA 2VJQA 4UNNA 3I1IA 1USKA 3C3CA 4IIUA 4B6JA 2P41A 2ZYIA 1JWLA 2HF2A 4QYXA 4WJLA 3DCYA 4CM4B 4GSYA 3W3AA 1ZOIA 4C3UA 4OHZA 1KRHA 5LWQA 4OGFA 3NT2A 1ZRMA 4N5IX 4OHCA 3AETA 5LP6B 1P7WA 5D3KA 4U6SA 4Q7JB 3P9PA 5AVTA 4MQBA 1R4MA 2VOEA 3T1TA 3HA3A 5G2OA 1Y4ZA 2ZYHA 4DNXA 3AV3A 3L7OA 3TK1A 1XTRA 2GEBA 1I6WA 2CFSA 2OCYC 3AVOA 3VYUB 3N75A 4PSVA 4B6PA 3ZW8A 5M04A 2XTZA 4HK4A 3C3AA 1TZKA 3HJNA 4IDHA 1Y3HA 1VB3A 4U7WA 1RRVA 4YRFA 3E23A 4FCVA 4RJJA 5ADUS 2IITA 5L95A 4NKRA 1YAJA 3CUSA 1CBUA 1IH8A 1QVVA 1Y7HA 2IYVA 2PY6A 3K92A 3KFXA 1Q0QA 3LDUA 2ZR8A 3NHSA 2MSNA 1JTEA 4KJXA 1UBTS 3ZGXA 4K9SA 1SHUX 2VDJA 1L9XA 3FTCA 4ZVKA 3NAMA 4DA4A 1DOZA 5H4GA 2FW6A 2FNAA 2HZ7A 3IB3A 3MLEA 2AFRA 2JK1A 3RAFC 1HYBA 3IP5A 3B3QA 2YY7A 4AJKA 1QIIA 1ZNXA 2J5XA 4FT2A 2H1VA 3PCRB 1RXIA 4EGQA 4B75A 2Z2KA 3RG2A 3GGOA 1CUGA 3ZLTA 2IBSA 1YMUA 4CEIB 1ISGA 3FGOA 5FFFA 1W0JA 2I03A 1M8FA 1Q3HA 5L3SA 2DMRA 1AOXA 3CC8A 1A4RA 4BMZA 1UK6A 2Q4TA 2VDPB 3UXYA 4EB0A 4LXIA 2IUEA 3ZY4A 1DSSG 3EARA 1PYDA 3S2UA 1PX0A 4BQQA 1KYXA 2ZVDA 1JF8A 2PH5A 3BMXA 3CVOA 3GGGA 3QVTA 3UYLA 2JL1A 4BKUA 3MWYW 1F8YA 3NRJA 4O4HF 4W82A 4JYBA 5JAIA 3WLNA 5CNKA 1ZKMA 2W2QA 4DR7B 4MEJA 2C57A 1N6OA 4DY6A 1AQLA 2R5NA 3OZCA 4BQFA 4X5OA 1MVLA 3BFPA 5SICE 1NY5A 4AJ1A 3R5TA 4BGVA 4EB3A 1ACLA 1T0PA 1YS1X 1XHLA 3EEBA 5EWMA 3A4YA 1JYSA 4LOAA 3KOOA 5LQRA 1P2VA 5CW2A 3A1SA 1U6JA 3VR4A 2RI6A 3M4JA 4YMVA 1RJEA 3VI4B 3O0TA 4IXWA 4LNUB 3CEJA 3NDPA 4CG2A 5KSYA 3AFOA 3GELA 5CTAA 5DBHX 4F4IA 1ZU5A 1UQUA 1WW2A 1O5IA 3OQMA 2QTBA 3TINA 5EQJB 1CFZA 1TTQB 2EGHA 2M98A 4JVNA 3GPLA 1EP3B 1SG6A 2QL7A 3I72A 5BSVA 3WSVA 3DZIA 1ZM4A 3EVFA 3S55A 5A4FS 2D1TA 2D06A 2ZIGA 3AWDA 4YACA 3F6EX 2BM1A 2ZE6A 1OYVA 2WFAA 2WJ4A 2WT9A 2FG6C 3FZYA 3C3YA 4HQFA 4TMTA 5J1TB 1RM5A 1DFIA 3GOHA 4JLNA 3TI7A 2M32A 3PC8C 3CJQA 1OZHA 1Q7CA 3TX6A 3U0VA 3V2HA 4OU5A 4F1WA 6Q21A 2W6ID 4K05A 3TW8B 1KK2A 4YRSA 5KVCA 3LX4A 3ETDA 5GZ1A 1B93A 2QRJA 1XZMA 3QWHA 2V5VA 4KQWA 1SC3A 3VOAA 2B7LA 5K05A 4O4IB 4MDHA 4WXRA 4Y30A 3NOQA 2XCQA 2GAIA 4M1WA 1OKKA 1T36B 4EG8A 4KPEC 2WFZA 2JFYA 4MVJM 1W2WB 4QJIA 4C7XA 1TU3A 2J7PA 5EMJA 4D8WA 1O96A 2YN0A 4FSDA 2FB9A 4ODIA 1NBEA 5KYNA 2IW1A 4KDEA 2C2WA 4R2LA 1R9NA 3MPUA 4EFKA 4B32A 5A06A 3H3XA 5K51A 2G83A 3GZTB 1IBLB 1IXKA 3IQIX 2X7XA 3I61A 4UXJA 4A2CA 2YCLA 1BVRA 3T5BA 4FCWA 5HOEA 2QE7A 4HTFB 2G9VA 2Z2XA 5FFMA 1U80A 3ER8A 4H16A 2Q4OA 3ISVA 4G0WA 3RKSA 1BD3A 2PNFA 5F33A 3ZW9A 2GYUA 4Z1OA 1VECA 4AKGA 3W7AA 1BVUA 3GVCA 3IDSA 3IP6A 4NJMB 3ZE7A 4FEGA 3AXSA 4GC5A 3ZWWA 4E30A 5DM60 1EG2A 3T52A 1VXRA 2HT6A 3ISJA 1TVKB 4R2WA 5AJVB 1KPGA 3GFTA 1X0XA 4L5CA 2GPSA 3N2GA 4MQMA 3HU2A 1WY5A 4BNUA 1ZVKA 2C92A 1XZAA 3L9WA 3KR0A 1N6KA 4HFNA 2NO5A 3IE2A 3QKSB 3Q0IA 1X13A 2AJDA 2RK6A 3DGFC 3FIJA 1BHO1 3S7ZA 2L82A 2YWGA 4MWDA 3G7UA 4D97A 4FW8A 3KXIA 1JH8A 3TQQA 4ZVNA 2QP4A 3M70A 1PR9A 2JVIA 1VJDA 4WUVA 4M86A 1RZUA 4IDOA 4R7TA 1UEIA 4XVRA 1XQWA 3DMRA 3FBGA 2A6PA 4PQGA 5CURA 3ZWCA 2NU7B 3BK2A 3Q11A 1HSOA 3PZBA 4RWEA 4XRGA 1LLDA 1IWOA 1CB7A 3IESA 3RJMA 4CMEC 1CJBA 4B3IA 1FJXA 2GSWA 4MJ3A 1R8YA 4YRIA 3SQLA 3ZY3A 4ZQEA 3H17A 4CLHA 4AJOA 1IHUA 2J0UB 2C2HA 3AEQA 3CLHA 3HKCB 3JZFA 3PIRA 2Q5FA 5KS2A 2Q6VA 4OQQA 1YA6A 2I6SA 2Q2QA 1MX1A 4RY0A 3JVVA 3MWDA 3ZY2A 5ERYA 5HMMA 4Y9DA 1EPUA 1E3IA 3HPRA 3AF2A 3IUNA 4M9XA 5HRCA 1JDZA 4W5NA 3LVBA 4H4EA 1THMA 5KVVA 2JLXA 1JEJA 1HO3A 1E1YA 3OIDA 3WGYA 3L8DA 1CIJA 4FR5A 2BELA 4YJ3B 1O89A 1MJGA 3DHNA 1QGOA 4OBEA 1ACJA 3AEXA 4WZ6A 2UYOA 4BB0A 5LPNA 3A6FA 4YAFA 5BSTA 4HUQA 4RC9A 3K15A 3TKAA 1CQXA 1N25A 3OEHD 5LLDA 3JYOA 1JKMA 1SWVA 2EWVA 3VH3A 3A6KA 4ZAZA 2JIZD 1QV6A 4C0XA 1MC1A 4IIBA 5K0ZA 4BNMA 2XOXA 4MHSA 3SZ3A 3NIBA 4GP9A 1YS2X 5JDCA 2BP7B 5E1OA 2XZLA 2Z09A 1NXXA 3SAJA 3TH5A 1HC7A 3SS8A 1YL7A 1U7HA 4FSHA 4ALLA 4EJSB 1Z4MA 1UR5A 3KC2A 4PVDA 4XQGA 2Z8XA 2VPTA 4FDVA 3PXAA 1K5DA 5LDDC 4MUJA 5LBTA 3MXOA 1WB6A 1JFTA 1LZLA 2JD2A 2QVCA 3NPMA 3ZIUA 1TU0A 3HXPA 3PDWA 2XR1A 5CH8A 2M6LA 3KQSA 5I48A 2EV9A 1Z5PA 2OHFA 3LLCA 3CVUA 1YHYA 3CVWA 1X92A 3ZDDA 1B1CA 2IXDA 2DM6A 2HMAA 2QT9A 3TR6A 5CYGA 2G1JA 2WWGA 1M67A 4X71A 2Y1LA 4YP6A 4PZLA 5FRDA 2IXEA 2X7HA 3MTDA 3HRKA 3O8BA 1FYDA 3ROZA 5JBIA 1LBEA 3D4OA 5DNDA 3VR0A 2GS9A 5UKDA 3MRTA 3ZJUA 3E22B 2P6PA 5CPFA 4J0FA 4L5BA 4V0LA 3R0QA 4P4TA 1G64A 1XTKA 2FSVA 2GPYA 2Q2VA 2IHBA 3AERA 3FNHA 1RAIA 4KG7A 4NENA 4HDNB 1LTHR 3UPDA 4BFWA 1NNI1 4GBJA 3GPIA 4YY3B 1OBOA 1TM1E 2IQIA 4QO8A 1V5FA 2XNSA 4K9RA 2WAXA 4C4XA 3NJRA 1Z6XA 5ALTA 4BWYA 2AUMA 1V8FA 1YSCA 4UM9D 1CS4C 4FB5A 2P4QA 3PWZA 4DY4A 2AOVA 3R9XB 5K2MA 2FLKA 2VSQA 3Q15C 1CY1A 2GRJA 5ADHA 1TCCA 1Q1EA 3NVMB 4RULA 4DREA 4FHDA 1BA2A 5BR8B 2C0QA 2J6IA 1EI9A 3KR1A 4D46A 2TYSB 2WWFA 3UAOA 2QPLA 1G8KA 4ARVA 4POOA 2QYOA 5P21A 4K9MA 2YMPA 3WLMA 1ESCA 1QE3A 2F1HA 2FU5C 5HFAA 4RVFA 2B7CA 1UP4A 2ZCUA 4N5HX 1OAOC 3GJQA 1XR3A 2GDJA 3JQBA 5DI3B 1ZHHA 4LYAA 1UF9A 2FEKA 1GM5A 3KETA 2WOOA 1CQPA 4NMXB 4URFA 4XFDA 1U11A 4BZZA 1G0NA 1VYHA 2B5VA 5J2TF 5FI5A 2MYTA 3TPCA 4Y2JA 1A9SA 2C9MA 4CU5A 4BNFA 2ZJZA 5AVVA 3CKKA 3W90A 1AN9A 1NZJA 3VYVA 2P6OA 3K2EA 2J09A 4Z9AA 2Y1KA 1UBGA 1P1HA 1MQ8B