1XRPA

Crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNQFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 115
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrpA00
1AUOA 4C6HA 4G8DA 4CCWA 1H23A 3NGMA 1QIHA 4ZV7A 7YASA 5ALNA 4Y2QA 4C87A 3DEAA 1A7UA 4N5IX 1FFAA 2WUGA 1XLWA 4W1QA 1MNAA 1NU8A 1XQWA 2ONCA 3KXPA 4ZI5A 2RONA 2EEPA 3Q8WA 4UPDA 5E2IA 1GQSA 2WIGA 1VZ3A 3SWWA 4DNFA 4Q34A 1ZI8A 3FYUA 4H7EA 4AN1A 3MGAA 4XX1A 1CUAA 3BIWA 3F9CA 1WPRA 3FOBA 5AKXA 3VKFA 5DTJA 5AM4A 5K3CA 4BVKA 5AOAA 2YH2A 4C4XA 3MUOA 1QTRA 2BGNA 2WSLA 4C01A 3OTQA 3STYA 4EY7A 2WUEA 2LIPA 4DNQA 2X76A 1P0QA 2JBWA 1AMNA 4C89A 4AB1A 5JZ9A 3BF7A 3DLTA 2FX5A 3HACA 4UBNA 3WWPA 1R9MA 2WFLA 4TVKA 2PM8A 3DOHA 1Z68A 4GDMA 1QLWA 5D6OA 3TRDA 2X8BA 1R3DA 2QVBA 4P08A 3G0CA 4CI9A 5AIBA 4IH9A 2QKYA 4OYLA 3D5EA 3HJUA 4PV7A 2RHTA 1UXOA 1BCRA 3UUFA 5JASA 2C0QA 3R3VA 3WLAA 4BATA 4Y2SA 3F98A 3I2IA 4J0GA 1X2EA 5FXMA 4Q3LA 1MU0A 1SCQA 1SOMA 4FLFA 3WKEA 4HZGA 1DQZA 5ALZA 4W63A 1KEZA 1HBJA 5K3BA 5ALPA 3X3HA 5DJ5A 1D07A 4YASA 2I3ZA 4E11A 5CH5A 4J0IA 3P2MA 4E15A 5ALHA 3NWOA 1JU4A 3W9BA 5DYTA 1CUWA 5AKIA 5JAUA 4K6HA 3V1MA 1EDEA 1UOPA 5AH0A 5LKAA 1QZ3A 2ACEA 3T4UA 5AI6A 3PF8A 2OCLA 2OGSA 2QRUA 1CQZA 5D3ZA 2DCMA 4FNMA 2WJ3A 2G63A 2WTMA 1BROA 2C4HA 2PSEA 5LZ5A 3C87A 1R1DA 2Y1KA 1N5MA 1WB5A 3IUMA 2JGLA 3R3YA 3OM8A 4J0DA 4P93A 4NVRA 2ZYRA 3H19A 3WK6A 3PF9A 2H9YA 4UBMA 3HEAA 1C7JA 1A88A 1XKTA 2R11A 1CUCA 3I1IA 4ZXFA 2JGFA 5HKAA 1LPSA 1ZD5A 5ALXA 2HA6A 5JD4A 1P0PA 2ES4A 3VJKA 1FFBA 4ZGBA 3HLKA 3F96A 5AM2A 5FV4A 2Z3WA 2HADA 5A6VA 5EIEA 3WWOA 1GPLA 5IVKA 4OU5A 5C7YA 4GI1A 1DT5A 1HLGA 2CZQA 3VJMA 3DL4A 1QO9A 2V9ZA 3WL5A 4H18A 4UFOA 5CH3A 2HA5A 5CBKA 4A23A 3W06A 3O9MA 4EHBA 5ESRA 3STWA 5KWJA 1EB9A 3YASA 3A6ZA 3K9BA 1WPXA 4HRYA 1BN6A 4Q1VA 4DLNA 4QWMA 4WFKA 3H18A 4X85A 1NU6A 3VISA 1ISPA 4Z49A 3N2ZB 5JALA 4BAUA 1VOTA 3D3NA 3LLCA 2JGIA 1CUEA 2XUDA 1UT6A 3ZLVA 4XIIA 4DNOA 2AJCA 2JIDA 3AZPA 3O4JA 1CUIA 2XQFA 2XUJA 1GKLA 4Y2VA 3V1NA 2QOEA 2P8SA 5AI9A 1EVEA 3D2CA 2NW6A 4G8CA 1JMYA 1QIEA 1MTZA 4RE5A 1W4LA 1RWQA 5BOVA 2PUHA 5AKKA 4DMKA 3BXPA 2C5GA 2J4FA 4GW3A 1LPPA 1H22A 1UK8A 3W05A 1SCIA 4X95A 4PF1A 5F4ZA 3WWEA 4AXBA 4B9EA 1CUZA 4UBOA 5KWIA 4PSDA 5CXXA 5JAOA 4GECA 1EA5A 1USWA 2G5PA 2QUBA 1K8QA 4C88A 1QIIA 5K3FB 4FKBA 4KE7A 1ZJ5A 4C4YA 2PUJA 2OCGA 4J0HA 2J3DA 5DYYA 1FFDA 3I6YA 1ORVA 2XMGA 3E4DA 1ODSA 1X70A 3KD2A 4K6GA 1VLQA 3EIOA 1BE0A 3PE6A 2JGEA 5K3EA 1PFQA 2VEOA 4H7DA 2H7XA 1ZD3A 5HFAA 5AOBA 5SYMA 1L7RA 1HKHA 1LBSA 3RARA 4WDQA 5FLKA 2V96A 1XZDA 3R40A 4LXGA 4UBLA 3AZOA 4Y2TA 1XQYA 2PL5A 4LHEA 1GXSA 2AXEA 2CBGA 4HAIA 4F0JA 3WYNA 4Y7DA 4G9EA 5JIBA 2WFZA 2GBFA 4MEAA 1W52X 3GUUA 3BWXA 1IUPA 1GT6A 2B9VA 4KYVA 2WUFA 5I8PA 4F60A 1JJIA 3WK9A 1G66A 4ZV9A 4ETWA 3EF3A 4Q3KA 4FTWA 3FLBA 4L0CA 3E1GA 4JYMA 4BB0A 2QXTA 1U2EA 4AMZA 4X3CA 1W1IA 3WIBA 1Y37A 4YK7A 1WB6A 3FYUC 4Y9SA 2ECFA 1GZ7A 4BVLA 1TRHA 3JWEA 5CXUA 5ALFA 4X7BA 1CQWA 2ZJ6A 3WJ1A 5LKRA 1DINA 2VTVA 4M0FA 1N5RA 5H3HA 3DKKA 5LLSA 4OU4A 1Q83A 3W04A 2OAEA 2PPLA 2WHPB 5CT6A 3HYSA 5HK8A 4MQMA 4WFIA 5A7HA 5ALIA 3WA7A 3LCRA 3GA7A 1QFSA 3PFCA 5BWBA 5FOQA 4DYHA 2WHRA 2EDAA 1EI9A 4CCYA 5AJHA 2RIPA 1R4ZA 2WG2A 4AO6A 5KBYA 2Y2VA 2WU3A 1P0MA 1SFRA 4H35A 3WMRA 1XLVA 1THTA 3V1KA 1UZAA 5CT9A 2OLEA 1XZHA 4M0MA 3OPMA 4A5SA 2Y2UA 2JGKA 4X94A 4Q05A 1XRPA 3BDVA 5EHZA 4BCBA 3FWHA 3WYDA 2OGZA 2VA9A 3KWJA 1YAJA 3IUJA 4JUIA 5LYYA 2DR0A 4FFVA 1MNQA 3PI6A 4J0CA 4X91A 1TK3A 4QWWA 2OAGA 2HFJA 5I7UA 3EQ7A 4P92A 1ACJA 4MWSA 4KRYA 4N8EA 3UUEA 4X97A 2C5FA 4Y2XA 1DX4A 2RI6A 2OPHA 1ZICA 3CCCA 2G5TA 4KEAA 4X6YA 5CTAA 4BZWA 4WCVA 3IBTA 1LPOA 1XZFA 3CCBA 5IVHA 1FSSA 2IIVA 4JYPA 3AUKA 3BE8A 5IVDA 1EB8A 4W1SA 5AM3A 4DMFA 4X92A 5JD6A 2WG1A 2I78A 4G4IA 1UOQA 4X93A 4BRZA 3QVMA 5C8XA 1ODCA 1ZJ4A 1CUBA 5ALSA 1N8SA 3O95A 4FFWA 2VATA 1CRLA 3FAKA 5EIHA 2OCIA 4PSUA 1W75A 1WB4A 1TQHA 4QA9A 3R3UA 3TGLA 5ALDA 3JYHA 4NZZA 4B0OA 3Q0TA 3FYTA 4MXDA 2VF2A 1ETHA 5CH8A 4B82A 3AIKA 2HA7A 4H7JA 5ALGA 2O7RA 1HDEA 1F0PA 4FMPA 1C7IA 1AURA 2HRRA 4EY6A 4DM7A 1YCDA 5C8VA 1LBTA 3FLEA 4WDRA 3C6YA 4FDMA 1ODTC 5ALLA 2Z3ZA 4H7IA 1C4XA 1VXOA 5LZ7A 4U2BA 1ZI9A 4YPVA 4W9RA 2D5LA 3S2ZA 1XZLA 3O0DA 4OB8A 4FWBA 3RM3A 3WK5A 3C6BA 1QO7A 1KU6A 4LYDA 5T4EA 1YASA 2G4LA 1XZBA 4HRXA 3I28A 3H04A 1E5TA 5JARA 3DL7A 3L1IA 3K2IA 1H2YA 4U2CA 2IX9A 3G9UA 4QEKA 2QZPA 1W6RA 5CT8A 1YB7A 3KOOA 4BZZA 4B0PA 1B41A 1CEXA 2ACKA 1IMJA 3C6ZA 3L1HA 3AILA 2OQVA 2EDCA 2WILA 5ALTA 2GZRA 3O4IA 4K5QA 1P0IA 4G4GA 4Y2PA 3R0VA 4ROTA 4EY5A 3I2GA 2Y6UA 2XI4A 4F5ZA 3H2JA 1DWQA 3H1BA 1E3QA 3WQHA 2WIFA 2HFKA 2BKLA 4EA6A 4X6XA 4I3FA 2VAXA 1YB6A 3D2AA 4LKOA 4ITVA 1CUJA 4BC1A 2OQIA 1CFJA 1FFEA 3AFIA 4BP9A 2HA4A 3IA2A 2V97A 1QOZA 4B85A 1UFOA 3DYVA 3IDAA 1GPNA 2UZ0A 2BUBA 3OG9A 2ROQA 4OD0A 5A62A 3GBSA 1XZCA 4Y2YA 4BRSA 2YXPX 4CFSA 5EI5A 5YASA 5AK5A 4U2FA 3S8YA 2GYUA 3GZJA 1DWOA 3KSRA 2AJ8A 1R9NA 1UKBA 4H7FA 3EQ8A 4WY8A 1TAHA 4IH4A 1AX9A 4CCYB 3TJMA 4OB7A 1LLFA 2BUAA 1WM1A 1QIKA 2ZJ7A 3ZLUA 5CURA 1LGYA 3QYJA 2XMQA 4S0XA 1IZ8A 1CIJA 4AN0A 1W76A 1J06A 2WUDA 2VJCA 1OCEA 2GBIA 1TCCA 1QJ4A 4ZREA 4MYDA 3E3AA 3HSSA 3U0VA 4GLBA 2QM0A 1K5PA 4FBMA 4J7AA 3VJLA 1CUUA 4CIAA 5IKXA 3QMMA 1S8OA 3PUHA 1U8EA 3E0XA 1ZIXA 5ALVA 2JF0A 4AQDA 5K5EA 1UK6A 3R3WA 4B80A 1MX9A 1BU8A 4RGYA 1XRNA 2WKWA 2WG0A 4H0CA 4BTVA 4QNNA 3HRHA 4M0EA 4CIBA 2WTNA 5HF8A 3A2LA 2GBCA 4HVTA 3ZPXA 4PNZA 4EB0A 2XUIA 3C8HA 3CN7A 2HIHA 5A7FA 4AZ0A 5EGNA 3BF8A 1H2WA 1QONA 4E14A 3WKCA 1EH5A 4EY4A 5LZ2A 3C43A 4KE6A 4Y2UA 3ESAA 1QIDA 4GXNA 3WZLA 3CN9A 3R41A 2HU8A 3V9AA 1VXRA 1MAHA 3D4LA 2C0PA 1CLEA 3AIOA 3AINA 3H1AA 3R3ZA 4RPCA 3QMVA 1O6GA 3V1LA 5AKLA 3BJMA 3FLAA 1CUHA 2DQYA 3ESCA 3MVEA 2H1IA 1MAAA 4HTAA 2XUKA 3WA6A 5ALJA 4DNPA 2WQZA 2FUKA 2XQGA 1ZI6A 2WM2A 3DYIA 3VVMA 5CT4A 5D7BA 1VZ2A 4A16A 1ZD2P 4JH0A 5AKYA 2HA2A 1LPMA 2XQJA 4AMYA 3DS8A 1CV2A 5A71A 1BEZA 2J3QA 1TKRA 3DD5A 2CKMA 2ORYA 4G9GA 1CR6A 1VE6A 4OPMA 5JAPA 4KR0A 4QLAA 3G0IA 2CJPA 4P9NA 2QT9A 4IHAA 2XT0A 5HF6A 3DKRA 2BUCA 1EVQA 3DOIA 2PSFA 2IITA 5ALYA 4J03A 5HFNA 3W2TA 4J3JA 5D3KA 1NX9A 4KAAA 3TEJA 3O4GA 5JZBA 2PBLA 1Y7HA 2AJBA 5BV7A 4Y2RA 3HXKA 5ALKA 2PSHA 3FCYA 3RLIA 2J4CA 2FJPA 2HU5A 3V48A 5DYWA 4BE9A 1QE3A 5HZGA 3STXA 1LZKA 4W1RA 3L1JA 4BDTA 4BYMA 1R88A 5J3JA 4ARBA 1A8UA 3I2HA 1MX1A 2XUHA 2WJ6A 1XRRA 3H2IA 3IB3A 4UBJA 5HKBA 2I03A 2BGRA 2C7BA 5HF5A 4CG3A 3JW8A 5AI0A 5T4FA 1UKCA 5AI4A 1TCBA 1U4NA 1ZD4A 4GHWA 4CG1A 4EUSA 4UHEA 2JEYA 2WLSA 4MQLA 4ZWNA 2H7CA 3VDXA 5AIAA 2WFLB 3T52A 3C70A 3FSGD 2XE4A 3HI4A 5FP0A 1FJ2A 4UBIA 2BJHA 2CEKA 1WHSA 2QTBA 5HQ3A 1AZWA 1AKNA 1MJ5A 4UHHA 1XZIA 2C58A 5JADA 1IVYA 2XMCA 1PV1A 2O2HA 3QPDA 4BAZA 2CB9A 1MN6A 3HABA 4EZIA 5BWCA 1A8QA 3SX4A 2XQIA 4U2EA 4DMHA 4X90A 2WIDA 4TGLA 2DQZA 2O2IA 3A2MA 5C81A 1ZIYA 3OOSA 3HZOA 3VXKA 2QJRA 3GFFA 1PJAA 2QR5A 2XMRA 3FVRA 5HCUA 2XUOA 1XRMA 1WHTA 3ESDA 1DQYA 3BIXA 2WU4A 4Y2JA 4UHDA 1XROA 3UMJA 3QH4A 3WL7A 2QJWA 4LYEA 1XZEA 4KRXA 1A8SA 4G1FA 4WJLA 2BAGA 2K2QB 2WHQA 4F21A 6YASA 1CPYA 5FPPA 2Q0XA 2GBGA 2HRQA 1YS1X 4OB6A 3IULA 4X00A 3G0DA 3M83A 1U65A 3B5EA 4D9JA 2GYWA 3NUZA 4BBZA 2XB6A 1JKMA 2ZYSA 1ACLA 1JJFA 4BC0A 3STUA 5IH7A 4YX9A 2HDWA 2XLCA 4PW0A 4UHCA 4GEGA 2BFNA 3F8SA 2X5XA 2PU5A 3DCNA 1JI3A 4UHBA 1E8DA 1JU3A 5JD5A 1WCYA 4QDZA 4PSCA 5DWDA 1HL7A 5IVIA 2Z8XA 3ZLTA 1H2ZA 1QIMA 1JT2A 3GELA 1SCKA 4AO8A 3QBJA 4MWTA 4UFPA 4NMWA 3BL8A 2VQ6A 5LZ4A 3G8YA 5K3AA 3D0KA 4KAJA 5CT5A 2XQKA 4KAFA 5ALUA 1L7AA 1YAHA 1XZKA 4DGQA 3WK8A 1LPAB 4L9AA 4N8SA 1J2EA 3LIIA 4IQ4A 1R50A 1EXWA 3B12A 3C5VA 1DTEA 4L3WA 1BN7A 5AKGA 1RYYA 1F0NA 4W1PA 1X2BA 3ANTA 3AJAA 5CW2A 5LZ9A 3LIPA 2GYVA 1JFRA 1VJ5A 5LIPA 4N5HX 1ZOIA 1N1MA 2Z5GA 1UOOA 3ILSA 5ALOA 2Y6VA 5HF9A 5EIAA 1IUOA 3WJ2A 3WKAA 1JJBA 1AQLA 2VAVA 3N0TA 2PSDA 1ZGBA 3A70A 1H2XA 3WK7A 1E8NA 1EDDA 5AKHA 2O2GA 5JYCA 5K3FA 4DSZA 5ALQA 1BRTA 2AJLI 4FNGA 1CUGA 2B61A 1IZ7A 3IUQA 3ED1A 3RK4A 2Z8ZA 2ZYIA 2H7YA 3AZQA 4HS9A 1EINA 4XVCA 2WIJA 3DJYA 3WZMA 5A7GA 4BE4A 4U2DA 2RHWA 4H7KA 4OYYA 5AOCA 4DSAA 4FHZA 3M82A 2W6CX 1QTIA 1YA4A 1Q0RA 3WKDA 5KREA 2AJDA 2QUAA 2XMSA 1CUSA 1QFMA 1K6EA 3G9XA 3KWFA 3QITA 5ALWA 5AICA 3U1TA 2PU7A 3I2JA 3FBWA 2XMDA 2DSNA 4DTCA 3I2FA 4H77A 4RE6A 3SC2A 2B20A 2QXUA 3I6ZA 5JATA 1SC9A 1ORWA 1K63A 3I6MA 2OG1A 3DDUA 1Q84A 5AK6A 5K3DA 2JEZA 4CG2A 5E4YA 2BCEA 2WHPA 1G5FA 1XKLA 3H2HA 5AP9A 5E4TA 4GBGA 3C8DA 4H7HA 3WL6A 1YS2X 2DHCA 3I2KA 2VJDA 5JANA 3PUIA 5HK9A 4AZ3A 1XZJA 1B6GA 5EHNA 2XMBA 1VKHA 4QDTA 3BDIA 3ZWQA 5AO9A 1RP1A 4HXEB 2OGTA 5A2GA 3G9ZA 1UWCA 3I1YA 2VJAA 4BAGA 5FKJA 4X6UA 3HC7A 4OSEA 4DMCA 1XRLA 1OILA 2VJBA 3G02A 4I4CA 4QDXA 1BEEA 2XUAA 2HA3A 1QGED 4QZVA 1EK1A 1J1IA 4BCDA 4XJVA 4MYSA 3QPCA 4KJXA 5EHQA 2CMFA 4XWGA 1T4MA 5C8ZA 5DNUA 3D7RA 3SK0A 3KDAA 1TCAA 3ESBA 1BCSA 4FBLA 5AK3A 2ZSHA 5JZSA 4G8BA 5EHXA 4C4ZA 1L7QA 5AKEA 1XFDA 1AC5A 4B81A 4E46A 5JAHA 4N8DA 4WY5A 4TPKA 2VT7A 2O7VA 4UUQA 4EBBA 3LS2A 1T2NA 2YASA 4OUKX 1VA4A 2DFPA 2PSJA 3NOXA 3ICWA 1EHYA 3B3QA 1YA8A 5FPQA 4LXIA 3A2NA 4G5XA 1GQRA 2PKYX 4G4JA 4QDUA 5AI5A 1F8UA 3DNMA 2HL6A 2PVSA 2D0DA 1BS9A 3WWDA 1I6WA 3PICA 2R8BA 1HPLA 4Q82A 3H2GA 1CUXA 1CVLA 4PO3X 2XMZA 4QLOA 1THGA 2HA0A 3R3XA 4FOLA 2V98A 5E4JA 3C5WP 2RGUA 3LP5A 4FLEA 1J07A 4ZRDA 3VVLA 4QDOA 1WOMA 3QM1A 1CUVA 3PFBA 4I19A 5LZ8A 1GPKA 2OXEA 5CRIA 4MEBA 1M33A 1CUDA 1XRQA 2FJ0A 4INZA 5DNVA 1OXMA 2OCKA 2ZVDA 3MUNA 1XLUA 3WK4A 3F97A 3OURA 3W9UA 1LZLA 3G0GA 1MT3A 3O9VA 1QIFA 1UKAA 4ARAA 2I3DA 3IUNA 1ZGCA 5DTIA 1DWPA 2JGJA 3OC0A 2HHAA 2ZJFA 5CMLA 4FLMA 1AGYA 4UHFA 1MX5A 4UBKA 4B9AA 3ICVA 1XZAA 1QIJA 4QE3A 3ANSA 4BCCA 1EX9A 5FRDA 4LXHA 3H2KA 4K2AA 4GWLA 4BVJA 1EK2A 5ALMA 5HQ3B 1CUFA 4KE9A 3WI7A 2XUFA 1XQXA 5AK4A 2XUGA 5ALEA 4DIUA 2DHDA 4J0KA 1KU0A 1O6FA 1DX6A 4BTLA 1EDBA 4IH1A 5EFZA 3H0CA 3QZUA 1MO2A 4HXFB 1QIGA 5AHXA 1E66A 4B6GA 3FYUB 3QMWA 3G9TA 1F6WA 5AI8A 4U2GA 3FCXA 2GZSA 2QS9A 5I9IA 3IURA 2ZSIA 3IIIA 5T4HA 5AKJA 1XZGA 4MJ3A 4V2IA 4O08A 3FSGA 1GKKA 2VSQA 4IO0A 2JGMA 5AM5A 5FUMA 2WFMA 5FDFA 4BP8A 1E8MA 4RNCA 5ISMA 5DNWA 2W22A 5AM0A 1UK9A 4HXGA 3STTA 3QPAA 3D2BA 5DLPA 1VA5A 2WIKA 1LNSA 3FNBA 2XUPA 1Q0ZA 1GGVA 4AO7A 1LPNA 3G0BA 3O4HA 3WL8A 5ALRA 4B84A 2WJ4A 4JEIA 3EBLA 3M81A 5AM1A 3C6XA 1LPBB 3C45A 1E89A 4X71A 1G42A 1TIBA 1UK7A 1JMKC 2ZYHA 1CUYA 2XDWA 1YR2A 4UFNA 2B4KA 1YSCA 3FVTA 2VT6A 4J0JA 5LP1A 3G7NA 1HQDA 4BDSA 1DU4A 1Y7IA 1K4YA 4PQEA 3STVA 1G4HA 1VE7A 2XUQA 3GROA 3PDCA 4JNCA 5T4BA 1MPXA 2XLBA 4Q3OA 4EY8A 3BJRA 4B7ZA 5SYNA 4B83A 3ZV7A 2PX6A 3ZI7A 2HU7A 2RAUA 4L72A 4KACA 3M3DA 1FFCA 3WKBA 3K6KA 2CUTA 3H17A 3DQZA 4WFJA 3CXUA 3RKSA 1XZMA 3EQ9A 3WIOA 4AX4A 2DHEA 2E3JA 3F67A 3IVMA 4K6KA 4LIPD 2HM7A 2QMQA 4NS4A 3D59A 1IUNA 2YYSA 1DT3A 4KE8A 3WWCA 1XQVA 3AIMA 5AKZA 4OCZA
chains in the Genus database with same CATH superfamily
2G9UA 5CP8A 2TRSB 4C6HA 4G8DA 2Z08A 1GUFA 1IZZA 1H23A 1KJIA 5KYWA 4M9CA 4PWYA 4NFYA 1H5UA 1DJPA 5TY0A 2AQIA 1RBZA 1YKSA 1HUQA 1E1NA 1SUEA 4AG6A 5HR5A 4HN2A 3LSYA 2NU7B 4OHVA 4QGFA 3I53A 1JHXA 4PC1A 3R3SA 2NV2B 3L4BC 1B2LA 1RWOA 2BBSA 3OLWA 2CUNA 3P4UA 4Y6PA 1FFAA 1INLA 1TE2A 2AC7A 3ILHA 1N4AA 3OEYA 1KZ7B 4G97A 1XLWA 4I1IA 4ARSA 2O07A 4L5IA 1I3KA 2XW6A 5TF0A 2GM5A 3ADKA 1JR3E 3ODPA 4OXKA 3EIFA 3CNNA 4WZAE 1XDZA 2ONCA 3ZK9A 4L0MA 1GYQA 1D8AA 3FGZA 4FYXA 2HSEA 2EYUA 2JLSA 2ZR7A 3U3DA 4IIUA 2HPZA 2WIGA 1VZ3A 2PGOA 2W71A 1ULHA 4J9VA 4Q34A 4DNFA 4ZI7B 3KM0A 5GPBA 2TMDA 5LMZA 4TL8A 3VPCA 4ZFNA 1EFVB 1PRYA 3NNDA 4FQ5A 2XKKA 5LMNB 4R1SA 3VVCA 1CZLA 4I7EA 3UHOA 2KYRA 4P4NA 5IH3A 1LVHA 1CSEE 2PO7A 2LTAA 4QO7A 2X42A 1X94A 1U2GC 1F0YA 1MR3F 3F9CA 1VHQA 3VKFA 2IU4A 3TVTA 1S7CA 4IEEA 5AW5A 5CA0F 5K3CA 1SZJG 4IJ6A 3QQPA 4MITA 1Z3CA 3ZKWA 1TI7A 3K6JA 2VHYA 2ZRHA 2O9JA 2J3IA 2HMWA 3AB8A 1RCFA 4H0FA 5HILA 1USUA 3DXFA 4BWYA 3U7QA 2BF4A 3PTLA 4C4XA 1BX3A 1WF3A 3OCCA 4COKA 3Q7QA 5DDIP 4Q1FA 1L5OA 3H5AA 3STHA 2P6RA 1QTRA 3MYRA 4QATA 4PCAA 1Y9JA 1HQCA 2WSLA 3M1LA 3PXEA 4FJ0A 2IDMA 4C01A 3LLMA 4G23A 5JFGA 1HQYE 4JU8A 4Y18A 3N7TA 4EY7A 1R64A 2H1OA 2ORVA 4M0UA 5F35A 5IJ0B 3ZGZA 5AW8A 4MUNA 4DNQA 3ZDAA 3D4IA 2AOUB 2JBWA 4YV0A 3FTCA 1AMNA 3V4RA 1L4NA 4KGVA 2BGGA 2FWJA 2YWEA 4C89A 5GMOA 3UKOA 4BEJA 2D2VA 1RFGE 5C9ZA 1IBSA 1NURA 2OB1A 3ISTA 1ORRA 2Q2WA 3W34A 4MS4A 4KWIA 3EGDA 4I6EA 3FYDA 1JHZA 3LOPA 3QX7A 1PGQA 2XE7A 3QFHA 4MV6A 4CVNA 4DSUA 1D5CA 1LV8A 1UFVA 2DG2A 2JAWA 3PG5A 4OBBA 5LL6P 1AS2A 6REQB 4UBNA 3MJ4A 4F06A 1KMHB 2ID7A 5CFRA 1R9MA 3LT2A 5L8VA 1D0VA 1QPZA 1AZLA 1CYDA 2FPRA 2PWPA 1NDUA 3CC8A 5T8KC 2Z0MA 2W6MA 3DOHA 4NECA 5EWJA 4FINA 3KE8A 5AHRA 3UJ8A 4EO9A 3GLFE 3A9CA 1B6SA 4YRCA 3RTDA 3R5TA 4RHUA 4WOJA 4E6PA 4AQ7A 1WUYA 3V55A 3TGWA 3EGVA 4F5YA 3RAGA 2B92A 3WHLA 3KXLA 3VDNB 1R3DA 1YZ3A 2Q2QA 2QI9F 3QVOA 4P08A 1A2BA 3KT0A 3R2JA 4WXYB 2AVNA 3V8MA 2Z1NA 5SZHB 4CI9A 2ZM6B 3E9QA 1BCRB 1GL3A 2B2CA 1DADA 2GD6A 5AVYA 3BRWD 3L18A 2QKYA 3RVOA 4H1HA 5F9MA 1SC3A 5BW5A 1I4OA 4YV1A 4RKFA 4AMUA 4HRVA 1X1QA 2HRCA 3BJZA 1GNQA 1QJCA 1MDFA 2FMIA 2Q21A 1UXOA 2XB8A 1RWVA 3IEVA 1MMFB 4JOSA 1GFZA 3UUFA 2ZVJA 1MA0A 1XDGA 3H9BA 3QK7A 4KPUB 3K0CC 1ZH6A 1UBHS 4OMDA 1EUZA 1GY8A 4BATA 1DC6A 2NP6A 4RWEA 3EZ6A 4MVJD 4YROA 2EX0A 1LDBA 1U31A 3QIAA 4XYEA 3RWBA 3UAWA 3WGYA 2Z3VA 1FP4B 2X7HA 5CB0A 1U2GA 5EWLB 1X2EA 4G0OA 1MU0A 1NJ5A 2JW5A 2LZ0A 4DR1B 3NM6B 4ILKA 1R6TA 3MCAA 5FOSA 5TC4A 5TJ9A 3V00A 1U8CB 2WSIA 3A25A 3WKEA 4HZGA 3OE1A 5DXJA 1V7PC 4WERA 3K16A 1QF7A 3ZBUA 3ZJYA 1IHYA 4JYCA 2OV2A 3SU8A 5LDHA 1XP5A 5TS3A 5EHGA 5DBOA 1MH9A 1XJ5A 2FA9A 2VYNA 2CK3D 1U0OC 1FQOA 4JLWA 1Z2DA 3JU3A 3LYAA 5ALPA 4R2JA 1SZDA 1JFFB 5K3BA 3RQSA 5J1SB 3GFVA 4JFAA 1EM8B 2M98A 4DAEA 2R8YA 4MKXA 3SM3A 1VHWA 4DIKA 2A84A 3P0FA 1YFLA 3V4PB 2QP4A 3PQ7A 5CH5A 4IXMA 4J0IA 2PWZA 2A58A 4ML3A 3M1IA 4X45A 4E15A 4Z6KA 3IPYA 2CL0X 2XOKD 4MV3A 4PLVA 2GF9A 3TNJA 4P4SB 2QY9A 1UDBA 1H0SA 5JXJA 1RZRD 1JU4A 3IT3A 3TQIA 3H1GA 3O82A 3W9BA 1Z2AA 4WESB 5TPWB 2DE0X 3OJEA 1YKFA 4KNYA 3V1MA 3PLAE 5ULLA 2IYQA 4RW0A 1PFKA 4JSRA 2PD3A 1B74A 4MLZA 1PUJA 1P9LA 3VBEA 3W5CA 1QZ3A 1QHNA 2HBRA 2ST1A 3TK1A 1U3WA 3PP8A 4L8WB 3V9PA 1OYYA 2JD2A 2OGSA 2ZVQX 3PE3A 3SZLA 1PZHA 2QRUA 4B4VA 4Z4HA 1Z29A 4BFSA 4ARCA 1JBEA 2NXCA 2QQ5A 3R7BA 1SO8A 1BROA 1U0JA 3D8UA 3DXYA 4UJ3A 3AB3A 4WA8A 1K2WA 1G3RA 4C20A 3SVTA 4LJRA 3FJOA 3QVJA 3X2SA 1N5MA 2ID8A 1VIVA 4WLFA 4W5TA 3CNLA 4KLCA 2XBLA 2IHYA 2P68A 1QGAA 3D5QA 3LDAA 3Q1KA 4NU6A 3H19A 3BCSA 3WIUA 4TKMA 3IJ5A 1N6HA 1L1QA 2H9YA 1C4WA 2I7XA 3HEAA 4MVYA 3JAMA 1M1NA 2WPDD 4JIGA 2PPVA 2ZBVA 3EXHA 5ECGC 2WWWA 1BGVA 4LE2A 1TU4A 3THYA 1LY1A 1SVIA 2AK2A 3I1IA 4HFNA 3A14A 4PLCA 3FDZB 1VL8A 3LY5A 1IQ0A 1FJHA 1I51A 3V8NA 1H4TA 3PHCA 1N1GA 5IJAA 5AJZA 3BWDD 2W43A 4XM2A 1MIOB 2I7VA 5HKAA 3JARA 2DC1A 1LPSA 3UFXB 3WYFA 3A6GA 3NHZA 4WKBA 5BO5A 1G8AA 2HA6A 1QCZA 4IXDA 4KIUA 4TV8A 1XZPA 2W6QA 2J5BA 2D3TA 4CF7A 5JD4A 2F4NA 3VU1A 3O74A 4EHLA 1YVDA 1PVDA 1Y82A 3EGIA 3I45A 1GAQA 5FOVA 3VR2D 3F6EX 3G2IA 3U40A 4RTKA 2AVDA 3L07A 2AZDA 1SU4A 3MMPA 2VSYA 3GUVA 3HLKA 3FKJA 2VZLA 3F96A 5F76A 3PXGA 3MJTA 4COOA 4X66B 1Y1QA 5AM2A 1XN1A 4GKAA 5FV4A 3U7QB 3GU3A 1K8YB 2HUNA 1R0KA 1IUKA 1GU7A 1R0RE 1YZHA 3R5SA 1MDBA 3BVPA 2UZIR 5EIEA 3UAGA 2Z95A 1XKQA 1RKUA 1WSDA 5IVKA 3IJRA 4B31A 5C7YA 1XTRA 1DT5A 4EG8A 1G3UA 2VUHB 3KPWA 3PUJA 4BFVA 5JYDA 3DL4A 3ZWOA 4NXMB 1NLYA 4KIWA 2OA0A 1G60A 2DWOA 1Y3IA 3O8QB 4KIGA 5CH3A 1Y3DE 2GBLA 5CBKA 5COQA 3GPIA 4D3XA 1O96A 2ZJZA 1JHVA 2YWRA 2W0SA 3AGPA 2X23A 5BVGB 4EHBA 3BHJA 3K92A 4KFSA 1HT3A 3VFDA 3A6ZA 3A06A 4ZVMA 2BH9A 2BFFB 4I6JA 3S8EA 2QX6A 1ESMA 2PKXA 4GL2A 2FZCA 1NI3A 4FD3A 1WPXA 4RPIA 3T3HA 1F8YA 1Z18A 1BN6A 2A1UB 4MW4A 1J6UA 4L50A 4LF7B 4RKYA 4BNDA 4HH0A 4W5JA 1FYWA 4EJ0A 1N7HA 1O5TA 4XGNA 4DARA 4D02A 5DNDA 4XCVA 1OA0A 4K6OA 2P9EA 3HEBA 3LPLA 2IEIA 3P2IA 1VKOA 4V3BA 4WFKA 3IGFA 4ZP1A 3BXHA 3G5MA 4XGKA 2ZZNA 4MW2A 3MHTA 5M04A 1RQXA 3F74A 1BCSB 1FE8A 3DQQA 3TW8A 3N2ZB 3K5HA 3ORHA 3SOZA 3DMHA 5HNKA 3SE0A 3D3WB 3CSDA 1M6NA 2YR0A 3RUHA 3B52X 2VTKA 4J0FA 1HOTA 4LRYA 2PLAA 2XUDA 4DT1B 1IDN1 4KVZA 3VPBA 4RQBA 2J09A 4XIIA 2FSPA 1Y4AE 1YFZA 5LJLA 4MDEA 1CRPA 4KV9A 3BSSA 2ZR8A 2JFXA 3K73O 4OGKA 1Z62A 3V1NA 3IMEA 5AI9A 3M34A 1DOZA 2VZEA 4NPAA 3Q3IA 1PJ2A 5AHOA 3U3JA 3K15A 1UMDA 2X6QA 4XM1A 4LXUA 4P4SA 2QD4A 4G8CA 1ZGHA 4HNAB 2GF2A 3SC4A 4HK4A 2PH5A 3G2PA 4WNIA 5B3JA 3PE4A 1YULA 1W4LA 1RWQA 1TADA 4BKQA 3E05A 1NUAA 3AF6A 4TZ6A 4CMIB 3KQNA 1WU8A 4QOSA 2RKWA 1Z56C 2WNHA 2FMFA 1RLOA 2J5KA 5AKKA 1P9WA 3BXPA 4KWEA 3ESZA 5BWNA 3CLTC 4IINA 3PNOA 3U4QB 3LQRA 2ISCA 4WCDA 2E9SA 1YL5A 2PZFA 3PKIA 3W05A 4RD2A 4IIJB 1SCIA 2JI7A 4AXBA 5A2QA 3PRKE 1SPXA 4L51A 4UBOA 4PSDA 4AY2A 3TSAA 5J5AA 1KFEB 4NATA 2ZT5A 4K2HA 1P31A 2QUBA 4L4YA 4C88A 1QIIA 1JYSA 3OLVA 1K3TA 2PD4A 4FKBA 3UM9A 3X1KA 2FB9A 5E3HA 4QRHA 4W5WA 5J23A 2R2AA 1K7SN 1Q1NA 3T0GA 5IARA 1QUFA 1NN5A 1HE2A 1Y3CE 4J0HA 4KO1S 4LHVA 4RMHA 2PUCA 1ZOLA 3I6YA 1WEHA 5BQ5A 2X3UA 4MI6A 3M49A 4Q4HB 1S7GA 3I39X 3W1EA 1L7XA 3ZHZA 4BNTA 4P53A 4GQBA 3WRXC 1VLQA 1DKPA 3K53A 3PE6A 1JEEA 1W8DA 3RIGA 1PK7A 4XPZA 5CDTA 1EM8A 1DARA 3WO1A 4Z53A 3PNKA 1LSSA 4XWOA 4DRXA 1E98A 3LZCA 3ANYB 4ZQIA 1L5KA 3M9LA 5ENDA 1Q7GA 2AE2A 3UANA 4C0QC 1OXSC 1ZD3A 2ZSJA 4JI7B 5AOBA 2I99A 2CVHA 2WP0A 3OH8A 5K0BA 1L7RA 4ZHQA 5HS6A 3KT3A 4PGAA 1FVXA 1G20A 3H5NA 3NHFA 1TJPB 3R6GA 2GZDA 3T4PA 3DLHA 3O8OA 4UMVA 5FLKA 3QYPA 3RWMB 2HZBA 3LZDA 1XZDA 2IOFK 4YP5A 1JG7A 3IPCA 1K9VF 2QTCA 4JDUA 3C3XA 2AR0A 2J0UB 3K70B 1WDMA 4HDCA 3OX3A 4DTIA 4LHEA 1X7WA 1RIIA 2L69A 5I9NA 1ZIDA 1Z07A 3CNBA 1U6KA 4MAFA 3IB6A 3S8MA 3R7AA 5KCMA 4TMXA 4A1FA 1NUSA 2G9VA 3A05A 3D8NA 4Q9JA 1U28A 1QHXA 2GERA 1UPXA 1WD5A 4MCIA 3CPHA 4G0UA 5KNLA 3KQKA 1X7XA 4KUEA 1W52X 3S7TA 3HM9A 1SELA 3B1ZA 3GUUA 2RAFA 5KVSA 2RKBA 3WGZA 2R5NA 4PPGA 2IP4A 4Q1AA 4YT8A 3SQXA 2Y27A 1JWBB 3I8SA 4KYVA 3ICEA 1XSEA 5C5IA 1WO8A 4ZU1X 3KSZO 3WK9A 6ABPA 3IEMA 2I8CA 4D2IA 4GOKA 3ORYA 1WUKS 4HN4B 1FLVA 4JI5B 3W1VA 2PXAA 5KQRA 3RU9A 5B1EA 1LTHR 5FUWA 5JSFA 3EXIB 4FTWA 4R83A 3FLBA 4FGSA 1OLOA 1XF9A 3L41A 4NEQA 3VV3A 2WC1A 1EUDB 1D6SA 2J3JA 3E2PA 2QXTA 3IILA 4JYMA 4C1BA 4BUJA 4EUHA 5J43A 3ROXA 1YZKA 4D9GA 3OKCA 1OVGA 4YK7A 4AY4A 4R69A 1O08A 3K9CA 2X5NA 2KM1A 2P4SA 3PFNA 1KHTA 4HQOA 4E0BA 2VRBA 1XVIA 1FNMA 3I5YA 3AEUA 2H4HA 5DHQA 4F3KA 1THMA 3EVZA 3TGPA 1TK9A 3WL4A 2JJ1D 1UM9B 3JWEA 4HEHA 4QG3A 4RZ3A 2XWSA 3DZKA 3R5JA 3FUWA 2FCAA 3VU8A 2OEPA 5BNTA 5ALFA 3T6KA 1WMBA 4DVGA 2O0HA 4B4DA 4J43A 5BYJA 2AFHA 3P4YA 5LXTB 1GNPA 4C03A 5JI2E 1XQ1A 1JVNA 3WJ1A 5CFQA 2P4HX 3DLCA 2R4UA 1DINA 3HBMA 1T9DA 4AMBA 3IERA 2KMLA 1ST2A 1LK7A 1N5RA 4AG3A 4KRFA 1QRUA 2R6FA 3HM2A 3INNA 2I76A 3DKKA 4KWCA 4DV3B 1YTLA 4MR9B 4OU4A 1F48A 4G8JA 1TC2A 2OAEA 1ZK0A 4X7RA 3QVVA 1NFRA 2PPLA 3RIHA 5CT6A 1U0TA 2GPBA 3U3ZA 2GLTA 2OCAA 1E7YA 4JMPA 1X87A 1PK8A 4F9TA 4DCPA 3C7KA 3M4ZA 4MQMA 4NCNA 4Q3BA 1SBCA 4DDWA 2C59A 3GLIA 4L6IA 2I91A 3KLMX 3DAFA 2CMDA 4JLDA 1DAKA 1ZOPA 4LF6B 5ALIA 4X8MA 3AL3A 4C7OB 1BAPA 3ZQUA 3S40A 4BXOB 2XOKA 2R84A 1G0NA 2YJNA 3QPWA 1J8DA 2EEZA 5BRNA 3UMSA 3D8SA 3K71B 3LKVA 1P2UA 4PYMA 4F6RB 3GH3A 1A82A 1QFSA 3GLRA 2F17A 4WCFB 2O8EB 1WU7A 4HX9A 1A8HA 1E1KA 3ER6A 3PFCA 4XB6B 2E4VA 1R10A 2E48A 4ZCMA 3ZY5A 1QGUA 1KAHA 2P8JA 5DW3A 2B25A 4EHIA 5FOQA 1RPZA 2GN6A 4QQKA 2ZUCA 4US0R 2IDKA 4D4KA 3ZHSA 4DYHA 1XEFA 3BXZA 3CX4A 4UDYX 5ERYA 3WYCA 821PA 1R4ZA 3PNMA 4FCTA 4HAVA 4PS1A 4Z9XA 1XIVA 2M6RA 4M21A 2CDNA 2Y2VA 4QOHA 1HE5A 2RGXA 2WU3A 2BGLA 2I4RA 3DULA 4MVJE 3IBSA 4KGZA 1E2KA 4ERNA 3VKHA 3GPCA 3TYXA 3WMRA 1PNTA 1L4BA 4QFBA 2B2XA 4ZT4A 1L0BA 3EUFA 4UM8B 1WA5A 4JLNA 3EBPA 2HAEA 2DUMA 4J7UA 1X80A 3DT6A 5CT9A 1A72A 3IKVA 3UK2A 1P5JA 3KUXA 2OLEA 1YUNA 3EVGA 3Q15C 3RASA 3X1JA 2FW9A 5H59A 3WNZA 2GPNA 2JCYA 3CUKA 4GNRA 3SLGA 4HNUA 3IP3A 2JGKA 4X94A 1A9XA 1KC1A 1XRPA 1BKDR 3OZCA 4TTTS 5JSQA 1W73A 4JXJA 2PZAA 4I55B 3WYDA 4B47A 1B16A 3I83A 4RTOA 4F3NA 3IUJA 4JUIA 2G80A 1II0A 4CMBA 5LYYA 4H08A 4DWJA 3F8TA 5BW4A 4FC6A 4YC7A 1MNQA 4MDYA 2VPIA 4J0CA 2C5LA 1TK3A 2G17A 4QWWA 4ZGGA 1NZDA 1TPYA 1ESZA 2BM0A 2PEZA 2VJOA 2Y0PA 1JHQA 5I7UA 4JT4A 3UMGA 3SJAA 3EQ7A 3N59A 3VR4D 3VZBA 3DE1X 2F4VB 4P92A 1YRYE 3UTCA 1CHDA 1ULUA 3CWZA 4CDMA 4B6JA 2FN9A 4WA7A 4X97A 4O2LA 5BQPA 4DQUA 4A82A 2RHMA 2RI6A 1RLJA 3CCCA 1NL3A 4Z1MD 3H4IA 4WCVA 4LRWA 3IBTA 4KVGA 3IAEA 1QQ7A 3S2YA 3UIEA 3DMNA 3G5TA 4B34A 4RTRA 1EVZA 5IVHA 1JR6A 1ZJJA 2CE2X 2ZRKA 1FSSA 1Z12A 4AZWA 1MB3A 5F1OA 2H85A 4R71A 3ABSB 1LF5A 2FWBA 2P9YA 3AUKA 2W7TA 2CNOA 5M2QA 2C4WA 1H42A 3H6GA 5E2BA 4BNFA 4E13A 5AM3A 5TARA 2XNCA 3DQPA 2ZTLA 4OAQA 4DMFA 1SK8A 1U4OA 3GJ6A 4JLJA 1V9LA 1EFKA 1OYOA 2Y3IA 3OKAA 5H16A 4PTYA 2I78A 3UYKA 3EVAA 3LRXA 5J4KA 1JECA 2F7SA 1FNCA 1ZOOA 2BM9A 4P33A 1T6XA 4Q12A 2VNAA 2Q3LA 3LLUA 1CUBA 2QZZA 2MDTA 3MBKA 2A1IA 3TLYA 3AEXA 2BPOA 2Y1XA 4BVEA 2H4JA 2XTZA 2VDNB 4B1FA 2XODA 2E49A 2GEFA 3VU0A 2CF6A 2Y0CA 1GZDA 4QDKA 3KQPA 4GKVA 1WB4A 3ZS9A 2NQ8A 4JC4A 1GCAA 2CFOA 1RKQA 1U90A 2OQ2A 1IN7A 2DBQA 3PTZA 3KETA 3EFHA 2YOGA 4QSMA 3TGLA 4MLDA 3TL6A 3O3CA 2CN1A 2C3PA 4EF4A 1UODA 2Q5QA 4NZZA 5F9FA 4MR8B 2WLTA 3UAZA 4OX9B 1N34B 3KPYA 3T5BA 1PHPA 3CG4A 5HRUA 2R85A 2VF2A 3HJNA 1ETHA 1G4UR 4GWKA 4B82A 4HXYA 2HA7A 1ZVJA 2ZJ5A 5DP1A 5EMMA 4DB2A 1SIBE 5EKUA 3RSCA 2AZXA 721PA 3MB8A 3CVVA 3UWKA 1K6JA 2G4VA 4DMLA 5BOSB 4CMEC 4XB2A 1DLJA 2VNKA 5AYVA 2WM9B 1EFCA 5L3SB 4YMLA 2B4RO 4FMPA 2GETA 1PD1A 3T9AA 5ELXA 3H9GA 3MJSA 1N0UA 1Q5PA 4H6VA 2FH5B 5FOXA 2X41A 4G9BA 5BRAA 3IAHA 2BEUB 2WEKA 1T25A 3MMZA 4WXHA 1QGUB 1ODTC 3A9TA 5MGBA 1ID8A 2BEKA 2H8GA 6ADHA 3LYLA 1C4XA 1QAOA 2QN8A 1ZUNB 4GSLA 3W2HA 2ORWA 2K7ZA 1FFSA 3FRHA 4AKIA 1X3LA 2P9HA 5ELMA 4W9RA 4I1VA 5TQ0B 3VYWA 3LCVB 2D5LA 3OT4A 2H1VA 5B58C 3Q9LA 3S2ZA 1KAQA 1MGPA 1XZLA 2VVTA 3AFGA 3T5CA 2PL1A 2BKUA 1C5KA 1E3WB 3THXB 1DFHA 4DWOA 1OB5A 5B1DA 3RM3A 3WK5A 3B5IA 3JVDA 4QGGA 4RX1A 3HMQA 4B4WA 1YJ8A 2OZLB 1DDOA 3AF5A 3ORRA 4LYDA 5T4EA 4PRLA 2E4ZA 2IELA 2G4LA 1EE9A 3H04A 4BQPA 3GEHA 1E3TA 3DFMA 3EXEA 4PGHA 4B3GA 1VP3A 5HOQA 4XGIA 1BS1A 1J99A 3MCTA 1TYEB 2PGAA 1GVNB 1KJ9A 3N6VA 4DCOA 5AW1A 3MHPA 2IX9A 5IKEA 2D8AA 2G6TA 1GCIA 3EXHB 1EPUA 3G9UA 3I64A 4N0MA 2JKVA 4QEKA 2BJWA 3IAFA 4DMGA 1YB7A 3TOXA 1A9XB 2H7VA 2L19A 2R25B 3FUCA 4B40A 5KDDA 3DVLA 1I1QB 5CCBA 3IUEA 1OFIA 4GOLD 5CCEA 5DHAA 4GE3A 4H6PA 2FMTA 4KMSA 1EBFA 2ACKA 2H2HA 3L1HA 1U0HC 2FW6A 3TLXA 2RSLA 4F2WA 3AILA 4NE2A 2OZVA 1L3IA 3NTOA 2OQVA 1MO4A 3G59A 2WYWA 2EDCA 6LDHA 1KYIA 3CBGA 3O3OB 1A4IA 1LKZA 1MJNA 1LS6A 3IE0A 2VQFB 5EJ9A 5DTQA 4LZNA 3O4IA 3GDOA 3ND5A 3I3SR 3SJZA 2JIZA 2PUWA 4G4GA 2VK1A 4WKPA 1S2DA 5D51S 4CT0A 1W5FA 2X13A 3UATA 2D06A 4NCAA 1FXUA 3I2GA 4POAA 2XI4A 4F5ZA 3AM4A 5L4SA 2VA8A 1L8AA 1DWQA 2WKPA 1PQYA 5F77A 2RGBA 2H1CA 3PA8A 3PFWO 3SC2B 2WIFA 1ZQ9A 3A6KA 3O4VA 4JKYA 4ALNA 4QPZA 3VH1A 4R51A 4TXNA 3FHCB 3CUTA 2WWIA 5BPHA 2OECA 4P38A 2YKGA 1GADO 4WESA 4NQZA 4ZVPA 4QUDA 1GZ3A 1AGPA 4IYJA 2X0IA 2QN3A 4JP3A 2N1BA 2PBRA 3DUWA 4HWGA 2FP3A 3RD5A 1P5ZB 4XJSA 2F8TA 5LQNA 1P1FA 4TS9A 3BKXA 2IA5A 2N46A 3HHEA 4L28A 1YI8A 2FFJA 3ET4A 1GKIA 1TJ4A 4MCAA 4MTLA 3H2BA 1H8HD 1E1QD 1CY7A 4PE5B 5G4KB 4AIRA 4FHDA 4M9QA 2GM9A 2DFLA 3WADA 2XNKA 4OQFA 5A5DA 2PK3A 3KLNA 5HE9A 5DB4A 3NUGA 5KS2A 2E2WA 1W30A 4IRXA 5TVKA 3P52A 2XRMA 4TT8A 1F9AA 1IY9A 1MRSA 3P45A 4O4IA 3HXTA 1H4QA 1O8BA 3E22B 1E96A 2Y68A 3DDCA 5IMSA 1P4SA 4KO3S 3THYB 4OD0A 4Q02A 1E60A 3KYJB 4MRAA 1YT5A 3VYRB 1RAGA 2EQAA 4PRYA 2BTOA 1W9MA 4XUEA 5A62A 4Z9FA 3GBSA 4KAXA 2X6RA 3RO7A 3EPRA 1WXHA 2YZNA 3HCEA 4NIMA 4Y2YA 3U1BA 1KYYA 4TUYB 4BRSA 1SMKA 3GEIA 2PXCA 2O2CA 4QXOA 3CF4G 3MMXA 4DYVA 2QQEA 3EPKA 3KC2A 1T8PA 1BYUA 3OFVA 4HLQB 3DAGA 4GBJA 3EX7C 3VH3A 2IYUA 4NABA 3IAS1 5AVRA 4U2FA 1KWGA 2V6IA 3S8YA 3IL2A 2GYUA 1HC7A 4F9EA 3GP8A 1S1MA 3WG9A 1SM4A 4IDOA 4N5NA 3ZW7A 3TQOA 1DEXA 2JCGA 2VP0A 3MTDA 1ADYA 3Q72A 4GI5A 2JDIA 1V1JA 3ECSA 1Y81A 2DULA 4KBYA 3A1CA 1RYMA 2QRGA 3BIJA 3PUXA 1TAHA 4F2HA 1L1EA 4KBGA 3LUDA 3GJ7A 3OX4A 2XCRB 3E7PA 4DBLC 3RHTA 2NZUG 4CCYB 1QH8A 4HYTA 1G1AA 1B8VA 1UEJA 3A3NA 1IDOA 1QHGA 2QR2A 5AVVA 2BUAA 5DULA 3SJUA 4JGBA 3RUEA 4WL0A 3I9NA 4HDMB 2VRCD 3IX7A 3QJ5A 4BZQA 1P1KA 3WE7A 3GZ4A 3M8KA 5EJAA 9ABPA 2PT6A 4ZVRA 2IYLD 1WTCA 1N1EA 1TJNA 4IUCS 2XA9A 1Z0FA 1T9HA 3IV9A 4LSWA 5K45A 2RGWA 4I5IA 1ZC3A 5FA8A 4D8WA 1K66A 1YRBA 3LGXA 2C8JA 1MABA 2WHXA 1G9SA 2RG7A 1VKRA 4LYJA 4DY4A 4AI6A 3GXBA 4LDZA 3A9SA 2BONA 2SICE 4BV9A 2HIAA 2QSYA 3HVKA 5IF9A 3NAQA 3WQSB 1KVQA 6NULA 4ALLA 1KH3A 3U4QA 2H0AA 3TXAA 5IAOA 2ZTSA 2PAAA 3BZBA 3SSMA 1JJAA 3TVDA 1Z0UA 1IM2A 2ZI4A 1P2GA 4GOOD 1RWPA 1SVLA 4MS3A 1RI5A 3WOVA 1NW6A 3LUAA 3U0VA 4OJYA 2QM0A 2EF0A 4GP7A 1VMIA 5INTA 1HE4A 3DDOA 3ZWKA 1NKSA 2HD4A 4FBMA 2XNHA 2ZSBA 3EZFA 4I9HA 3ZWVA 4C0LA 1Y8ZA 4OI2A 3SSAA 4C2TA 2IBMA 2WWXA 4A0FA 1DL5A 2Q0QA 4B44A 2O5RA 1KEUA 1LX7A 3SLKA 3EZNA 3GGSA 1BMDA 4IHQA 2AFHE 4M37A 4TS4A 5DO9A 5GJVC 3RSQA 5ALVA 5DBFA 4DANA 3NRJA 2M6SA 1G5HA 5BSUA 4E2XA 1DGQA 4U9UA 4QODA 1XEAA 4PZ0A 3R6LA 5L3SA 3AR2A 3CX6A 5BN5A 4K9MA 5ITZA 4PSAA 2WI8A 4RGYA 1CE8B 3SJBA 1FJGB 4CNBA 5DV9A 3U62A 3AWDA 2QZSA 1SPBS 4H0CA 4Q9KA 5G2OA 3VOBA 3SZGA 4BTVA 4DLKA 2LW7A 2MIIA 3MT0A 4HHEA 1PN3A 3AEUB 2Z9DA 4M0EA 5KYTA 1GM5A 2FUG1 2QVCA 3TJZA 5JTUA 5E8JA 5HF8A 4CV1A 3A2LA 3IR7A 4ZVLA 4CM4B 4BHTA 3UZUA 3LQ1A 5KTOA 4DJJA 5LOVB 1ZA1A 2Y0BA 3JSAA 3WOHA 3ZI0A 5DTMA 4DMRA 3QU4A 4EB0A 2VH2A 3QVGB 3VA7A 2QRMA 3CN7A 1VCIA 1SUBA 1YRHA 3EMDA 3L6EA 1J2YA 4L8VA 3SYNA 3WLLA 2OXTA 3WNBA 4AZ0A 4DBZA 2GFIA 1IN4A 5A7FA 2J3MA 3TQCA 4LZZA 5F9HA 2FSGA 3GZTB 2BFDA 1QG4A 3IQIX 1D1QA 4KQ9A 3TOCA 4HR7A 3KYCB 4OJTA 4WADA 4DB4A 1OE0A 1EXMA 1EX1A 1HDZA 1EH5A 3P5SA 3UT5B 3UUWA 1WMFA 2YXDA 2IZ7A 4EY4A 5LZ2A 1DCTA 4CL3A 1TM5E 1PT9A 1ZL0A 2FW8A 2RH4A 4N9QA 3G5UA 2ILVA 3CZPA 2PN1A 4R2IA 4BZXA 1K7YA 3DBVO 4TL9A 1QIDA 4DLZA 1WX1A 3FROA 1WW8A 2PZBA 4RHFA 5IN5A 1KMIY 1GO2A 2F3SA 2PX0A 4FS3A 4MVJA 4AL4A 3LF2A 3AHJA 3AL0C 3L79A 1BFKA 3WYGA 2PRKA 2NXEA 2XB9A 3BFPA 5D5QA 3HCAA 3HZRA 4Z1MA 2RE8A 3DV9A 3JD3A 1NXPA 2PS3A 4XVUA 3AVYA 3D4LA 2GEDA 2REOA 2CBZA 2C0PA 4JQOA 2BFCB 1NR1A 3AINA 4S04A 1EVLA 1M5UA 3R3ZA 4RZUA 3TNDA 1NF3A 2Q3JA 4B43A 4PLYA 1QH0A 3V1LA 3VPHA 1OI4A 5T41A 4RF3A 1PR0A 5AKLA 2O1SA 2AC2A 2YV3A 2AB0A 4KWTA 1EJ0A 3BJMA 4MW0A 3V34A 4L22A 4FDUA 2I6GA 3FLAA 2CK3A 4O1MA 4XFKA 1Y9ZA 2Q8QA 4LJKA 2AV6A 1FDRA 1UDWA 3NZEA 3UGKA 4BZPA 2G08A 4MUEA 3ZBPA 4BMCA 1Q19A 4Q47A 2XB2A 2XCLA 4TM8A 3ICQB 2VJQA 1EDZA 1Q3KA 3PJEA 4ZOBA 3RC1A 1SZPA 1AF7A 2QXYA 4O4IB 3TPFA 4B6EA 4C7BA 2C96A 4DNPA 4EB8A 1EJ2A 1SXJB 2DH6A 2O4UX 1J90A 3NDIA 4QRDA 4IX9A 1IZ0A 1ZI6A 3W5BA 2WJWA 1VLLA 1L5NA 3DYIA 3DPUA 5D7BA 2BKAA 5LQCA 4UKDA 3TI9A 2O3RA 1W5BA 5CFMA 1QPGA 3WLIA 2HEIA 2HHJA 1GNSA 5BQXA 4B7CA 3PSHA 5LQSA 1CV2A 1OZFA 4NMMA 1ZS9A 5EWLA 5A71A 7ADHA 1C29B 1UJCA 2GQ0A 2LWIA 5JECA 4N7BA 3EPPA 2FMXA 3O91A 1GPMA 3OAAA 1JTEA 4QASA 2UVDA 4RFSB 2FE1A 4UU8A 1E9AA 3OUTA 3PTAA 3C1UA 5EUCA 4G5GA 1RE1A 2OR3A 3L7JA 3V4SA 1DIGA 1SHLA 2VZ8A 5IZCC 3D4OA 1ZG3A 2ODPA 5CVCA 1VGRA 3GGOA 2D0IA 1A9YA 2WJJA 4WN9B 3TFWA 3UBMA 1SKMA 3V4ZA 3MGCA 1KPHA 1LDEA 2ALJA 3G0IA 3I42A 2KBFA 3PJFA 2HLDD 4LJ8A 1V1RA 4KLZA 4Z51A 3NXKA 2UVPB 4JOCA 3RBVA 2QT9A 1PS8A 4TXMA 1G21B 5HF6A 5A06A 5JMWA 2IEZA 4OM7A 3N2IA 1UMKA 3SS7X 5JNTA 2C8KA 3GFBA 4Q1EA 3AEKA 1EVIA 1ABEA 2IXTA 1RLTA 1SUPA 3ZWPA 1FJXA 4E09A 2NADA 1KSFX 1T5HX 1UOEA 2JZNA 3MBOA 1X7ZB 1KQOA 3MWLA 3NBZC 4HMPA 3TAXA 3JALA 3DVRX 2XYPA 3CTPA 1DOAA 4J3JA 3ZXXA 4E5DA 3BIOA 5EIXA 1SKYB 4ZK6A 2HCBA 2C31A 3JQDA 2V7XA 3P27A 4TZKA 1P1JA 3NM5A 5D87A 1Q12A 3Q7TA 3IBYA 4PYRA 3QNUA 5DPMA 4QYXA 4ZAWA 3J81k 4X7PA 4JQYA 1WDKA 2YWXA 2ZQ5A 2YW9A 3DZJA 4YGXB 2C29D 3LUGA 5I48A 1P44A 3HXPA 5BV7A 1O95A 5E95A 4INPA 3AXTA 4QQFA 3SCZA 2IV7A 4KREA 2BV3A 2RB5A 3LGAA 5LA6B 2VNJA 3LNTA 5FWXB 2IS6A 2EARA 4I4IA 1G17A 3VNVA 4DHEA 2V1XA 3E70C 1W5AA 5L51A 3W3ZB 5JG7A 4CQLA 4CEJA 3MWJA 4NP6A 3RR2A 1NLUA 4Q16A 2K6GA 4PPQA 5KYYB 4W9NA 2FJPA 1DHTA 2OCPA 1Z5UA 4XTCS 4Y0VA 5JCZA 4E4TA 2QUKA 4F71A 3NIDB 2DETA 1FRFS 1A71A 1KDPA 1JSLA 1ES9A 4GL4A 2B30A 2HK7A 3F5QA 4HPXB 4JJKA 4W1RA 5DLEA 1SCDA 2JAPA 2YQ4A 4ZICA 1SOUA 1R88A 4PPFA 2E21A 2PXXA 3FGOA 2X0NA 1EUCB 3I2HA 2FZLA 1XT6A 2YVQA 2WJ6A 4MUHA 2H4ZA 5LDGA 3R8CA 4M98A 1XRRA 2Q1UA 3QHAA 5K2MA 3BHNA 3VYTB 4D0LB 2C2XA 1MO3A 1L2TA 1SUCA 1F6BA 1QG2A 4QU5A 1OASA 3H5WA 1NAIA 1QK4A 1XCPA 5AI0A 4CM4A 4MPDA 4OHYA 1G8YA 3RAEC 1FXSA 4BMXA 4DIBA 1KP3A 3B78A 1VLMA 1MP0A 1ZISA 2JS7A 1GNTA 1J70A 4G5QA 1ZVKA 1I1HA 3F9RA 1ONPA 3FFXA 5HA5A 2O5CA 1MB0A 5JDCA 4MQLA 3SAJA 3W2FA 2H7CA 1D5WA 1E6EA 4Y6SA 4ZOCA 4DIFA 1CQJB 1UQRA 4DAOA 4Y6OA 1E3IA 1KF0A 4LG1A 2YWJA 4MTCA 2EBFX 4MVWA 4L3OA 5DBGA 1SQ5A 4G5FA 3RABA 3V8VA 4QAQA 1UBMS 5FUXA 2XE4A 3PSAA 1AKUA 2F67A 3O6VA 5GOTA 4UM9B 2DJ5A 1FJ2A 2OHVA 4UBIA 4OX9Y 4MVJP 3EIEA 9MHTA 2BEWA 2W2OA 3LAWA 3ME5A 4LOJA 4BECA 3DLBA 2QTBA 1PFYA 1AZWA 3SSOA 4ZEMA 1KRWA 3VI3B 2WMYA 1AKNA 3IP7A 2XZLA 1DBSA 1V6SA 4OQXA 4P81A 1ESEA 4OI1A 1XZIA 4UULA 4EJMA 2JFPA 1RKVA 2J46A 5LUBA 1HTBA 9ATCA 2J5XA 3CW2A 1ML3A 3Q10A 2K5UA 4GMDA 5HUQA 1RJDA 3CURA 1YJAA 3KKQA 4PC6A 2R3SA 2VPPA 1Q0QA 5FPHA 2ZUEA 1DX9A 1N0HA 2F3TA 5DW0A 3VDMA 3H75A 1JXMA 3QPDA 4UJ5A 2C1XA 1I7DA 4RVUA 2DPMA 1II9A 4D92A 2CW5A 3GLKA 3HYLA 4DG5A 1AJEA 2GCNA 5HKBA 3DTVB 1Z9BA 2OBXA 1KAMA 4ROSA 2V7UA 3SVZA 4BP1A 2IGTA 3MYYA 1MQ9A 3Q6NA 2IX3A 1R4NA 2OKCA 1S8FA 3L7OA 3PIIA 4WK4B 1AUVA 3KE9A 2VBCA 2DXIA 2VYFA 4PVDA 3BB4A 3MD9A 1VLVA 2MWMA 1NPDA 1E1LA 2IYSA 1UH5A 3ZS8A 4DSOA 4E08A 3QSYA 1OXXK 4RH1A 2VPTA 1MV5A 3BMNA 5DSXA 3S1AA 4V0MA 4WLEA 5AUOB 2FPSA 5BWCA 1A8QA 1E6UA 4MKZA 1AHIA 4IICA 2XQIA 1ZITA 2V74B 3SX4A 4DEXA 3E6AA 3URKA 4R1NA 3LFUA 3BC1A 4DMHA 4RZXA 4BGIA 5KNCA 3PXAA 4II3A 1OWLA 4G85A 3JASA 2YV5A 1M54A 4FYJA 2VUSA 5IW8A 1ODKA 3WQQA 2QDKA 1PL7A 3OCYA 3IIKA 2HF7A 3RJ9A 2BR4A 1A1SA 1R5BA 2O05A 3C2QA 3FSRA 3QOWA 1AHHA 1NVWQ 4Q4AA 2YWFA 2RH9B 4WXPA 5HM8A 3VXKA 2QJRA 3GFFA 2PYZA 3ETDA 1XHEA 2HU2A 3KZ1E 2A4KA 2QR5A 3UOGA 4JITA 2ICAA 2DUUA 3FPBA 3V4VB 2XMRA 4C3OB 3OQ6A 1N5OX 4N7JA 4NHEA 2X14A 2H06A 2ZBUA 1XTVA 3QFRA 4JU9A 2HPAA 1JXOA 4H27A 3RYFA 1WNTA 3P0EA 1YIAA 2BFBB 2GTHA 4PC3A 3SBDA 3TNFA 2WUWE 4MR7A 4QG7A 1ZGZA 2ZP1A 2EHDA 2OGWA 3PC6A 3TRKA 4M4SA 3UWOA 1EDOA 2WZBA 1P7YA 1IN5A 3MCVA 3NKFA 2RBKA 2I34A 3BTSA 3E8MA 4MGZR 2J6BA 3MGBA 2K2WA 3QBTA 3IESA 1BWSA 1A8SA 1GKUB 1TVMA 2VL7A 5A4DA 1DEOA 1FRNA 5FBRB 3CINA 5WRFA 1QYWA 4ZCTA 3G79A 5CD1A 3LQFA 5CYFA 4YQFA 2C03A 2HMTA 5UKDA 5FPPA 1JDZA 3G2MA 5AJVB 1W0KD 3PUVA 2GBGA 4LC9A 1L5LA 5BWMA 2GT1A 1DAGA 4M1WA 1FOEB 1CULC 3G0DA 3KFVA 1G8GA 3GRRA 1BDIA 1U65A 3QHPA 3B5EA 4QQNA 3ZX5A 3PC4A 4RJJA 2HMUA 4FYHA 3B2NA 3R24A 3VQTA 1KAOA 4N0QA 3AJDA 1ZQ1A 3BYZA 3LUJA 2J0QA 1I2AA 2FPXA 4BBZA 4HEA6 4RABA 3WHIA 1YQEA 1ZJ6A 3FKQA 3O8OB 3DV0A 2C3YA 5IJWA 1Q0TA 3BFXA 1GLNA 1UM9A 3ICOA 1C7FA 4TOIA 1Z3IX 1DVRA 4LV6A 1Z2EA 3SC3A 2HDWA 4GM1A 1O89A 2FPKA 2XLCA 4HAWA 4PW0A 1EA7A 2H2GA 2YJ3A 2V03A 3FOWA 3P96A 3LCMA 2CXPA 1ZD8A 2E1RA 4C0SA 3ZR4B 2YHAA 1B6TA 1ZPDA 1P2VA 4IXTA 2IH5A 3ONVA 2X5XA 2VJMA 2Q1YA 3THOA 1K6XA 3EYAA 4UHBA 2Y67A 4KN5A 5DT2A 4HRAA 3JTMA 4PQFA 1JU3A 2PFKA 5CX1B 2J3EA 3Q3VA 3S1SA 1ABFA 4A3SA 1WCYA 4DM3A 3OJOA 4QDZA 3LPAA 1C4KA 4A2WA 2GRUA 4UCWA 3RV3A 3UCXA 1KVTA 1MJFA 4JB2A 2CCJA 1KO4A 1I0LA 2Z8XA 1G38A 1H2ZA 3RUDA 2B5WA 5JI3E 2I0FA 2DFKB 2PWAA 1UEIA 5FB3A 2W42A 2JJ1A 1GLVA 4MI3A 5C4GB 3RVPA 1M2NA 2KQUA 5L7TA 5IM4A 1Z6XA 1TEZA 5AJUA 3VO1A 2NO9A 4UE3S 5DWVA 1IEXA 4MQBA 4DJFC 3D54D 1XPJA 1N92A 2VAMA 4BMSA 3SFVA 3S81A 4MWTA 3CO0S 3GD5A 2R8PA 3EGOA 3CY6A 3MXTA 4ARVA 3RI3A 2YDXA 1UBCA 1AHNA 1N32B 3G8YA 1TF5A 2AWNA 3DD1A 2JI8A 4BQFA 4KAJA 3RVKA 3ES9A 3L84A 1YQXA 4KAFA 4KK4A 3X1DA 4X8HA 4DYDA 4XI9A 4ZHQF 4OLBA 4GZ5A 1USVA 3RRNA 1XZKA 1NJGA 2IYOA 2J0UA 4DGQA 1E94E 2XE6A 1IQUA 3LE8A 1F6DA 1S8NA 5JS2A 4TKVA 2WPNA 3RUIA 1YBMA 1NWCA 1Z0DA 1R50A 3LIIA 4Z9YA 2ZUDA 1EXWA 1HH4A 1DIOB 2PJZA 3O94A 3B12A 4PYQA 3EG5A 3GT0A 4WI1A 2ZJYA 4I4TA 4NBKA 4G0NA 1BQ4A 3V33A 5CXQA 4BPBA 2HX1A 2ZT6A 3CJTA 1HX7A 4W1PA 4HC4A 4AUNA 2XAUA 3AJAA 1E2GA 1DJQA 3CIFA 4LJYA 1VMAA 3NVAA 5FTNA 5C5DA 4ERXA 3LIPA 2ZUSA 1W1WA 1YS4A 4M88A 1IWBB 1RZUA 2ADFA 4TMVA 4L73A 2CFIA 1VE9A 3CVXA 1RWNA 2PUGA 4N5HX 3OVMA 4W5RA 1IXYA 1OWNA 1NXSA 1UPCA 2HHLA 4R1QA 2Q3EA 4U1RA 4X3PA 4C3UA 1UMCB 2LCFA 1EGQA 4KG7A 1JP7A 4MH0R 2O8VA 5T5QA 3U4MA 4NOMA 1KEEB 3WJ2A 3IDSA 1JJBA 4B6RA 621PA 2QGZA 5HIIA 2GK7A 1Z6AA 2QT0A 3MJRA 5BN1A 3KNZA 3NDJA 8LDHA 4CM8A 5AKHA 1U1GA 1CNFA 3NBUA 3UK6A 3FF1A 4O8CA 2RBEA 4DSZA 1BRTA 2HCFA 2OM2A 4E88A 3LTNC 1M6VB 3QX9A 3VC1A 2OMKA 5JUWA 5ESXA 3OX1A 4FFDA 3T1YB 1HMPA 1LLCA 3FCEA 3K1TA 2BE9A 4FYVA 3TB6A 1KDOA 5BORA 2X4LA 4KHZA 2YY5A 1T3HA 4WW0A 3B3AA 3GGPA 4O4JF 4KSCA 1XDDA 4HDOB 3B6EA 2HJWA 4M7RA 1Y48E 3RK4A 4L7VA 1EAYA 3LW8A 4JC0A 3E7XA 4YRLA 4HP8A 4RM3A 3VYSB 2VAWA 3H4VA 4HS9A 5F51A 4DS3A 4KQ6A 4IKEA 2WIJA 3GMDA 3WZMA 3T7TA 4BE4A 1I4EB 3NO4A 1F8FA 4L3VA 4QOEA 3UBTA 4IWNA 3CLRC 4X9XA 1JFFA 1TU0A 1VJDA 3I9MA 3C1OA 3G89A 1PR9A 4N82A 4MEJA 5B4UA 4FD2A 2XXJA 3K0AA 3FFBA 3BT7A 2QX7A 3L8HA 2OC4A 4JVLA 5IT0A 4E4YA 3G1UA 2AJDA 5COBA 2H2FA 5BN4A 5KREA 1Q1ZA 4ENWA 3DOJA 3DOFA 1Q57A 3WYEA 5C32A 2NU6A 3KB2A 5JXIA 1Q7RA 4PZEA 3TE6A 1KKLA 2YZ2A 1LQUA 1QFMA 4JBIA 2VT2A 4U7FA 5LIRA 3B3FA 4LC0A 1FS4A 2B9EA 4ZDJA 1AD2A 3N0WA 4X3OA 2D1RA 4XGQA 2RAPA 1ISRA 4U7WA 1ENPA 3I2JA 3KV3O 2XMDA 4DTCA 4F4UA 5F5LA 2J3HA 3OQOA 2CV1A 3HCRA 1L5FA 1ZM4A 3FWYA 4RE6A 4RK4A 4U3JB 2XT9A 2UYOA 4EUSA 4LAFA 2VK8A 1AKWA 4K03A 5E9QA 1TYAE 1TL7C 5JNVA 1DSSG 2QIPA 1W25A 3EA5A 1VJGA 5JATA 2CYCA 1ORWA 3D6HA 4Q3CA 3F3KA 2MR6A 2QE7D 4CLOB 3I6MA 4AF6A 3DDUA 3AFOA 1Q84A 3ADCA 4HYQA 2HRZA 4B87A 5K3DA 2ZR9A 3QYFA 2C5HA 3NBFA 4LYHA 1PNVA 4KVAA 5PGMA 4RGQA 3UYLA 4RTJA 1G5FA 1Z83A 1XOIA 4IIJF 1KE1A 3EPLA 3JYLA 3H2HA 3OFND 4NZ9A 3LBAA 5AP9A 4NJEA 1O1YA 5E4TA 5L6MB 1UP6A 4I36A 4DV5B 2FGKA 5AVUA 4MULA 2O0LA 2R7MA 4GBGA 3B8HA 2YFYA 3IFSA 4OATA 4OMUA 4LE0A 5DYIA 2GHQA 2DHCA 4O2BB 3LMKA 2VJDA 1P9NA 3CTMA 1E4VA 5FO0A 5K8VA 3TCNA 4XWWA 1L5YA 2P79A 1QZTA 4B2LA 2CFRA 1I14A 1CWUA 1GZHB 1N5IA 5K20A 4XLZA 5DEIA 1Z37A 2GHIA 4AZ3A 4DQDA 1T0HB 3NAMA 3ZNPA 1D6NA 2DYKA 3QY0A 4ZYZA 4X1YA 5KSZA 1ESDA 3CVOA 4F86A 1K0FA 4FU0A 3BDIA 5JVDA 3NXSA 4OMFG 3FETA 4ZCQA 4ES6A 4JENA 5AO9A 4HXEB 2QTHA 1ZAYA 2OT3B 5I5EA 1Y1SA 1YBVA 2P9ZA 3DV0B 1MJGM 3K0KA 2FPMA 5A2GA 4ARIA 4QUGA 2I8AA 1HRDA 4JK3A 3AP1A 1UWCA 2DECA 1TC1A 3K0HA 1NP3A 2LNDA 3H2YA 1VSUA 3V8PA 5AXCA 3HLYA 3IC5A 1IC6A 3KKMA 4Q7KA 3QXXA 4C06A 1POXA 1O6BA 3HJGA 3BCUA 3SGLA 1N77A 2IS2A 5H70A 3PC7A 1V37A 1T8TA 2V58A 3H11B 4JT8A 2XD9A 4I1SA 3UQYS 1Y6GA 2D59A 1EFUA 4ABTA 3FWPA 3F3MA 1X1TA 3AFNA 4ZOEA 5FLEX 5E6SA 3BWVA 2QU7A 1GGEA 1PGJA 2OORC 3NOVA 1PKXA 3RVMA 3DNFA 3LT5A 2QAIA 4IIFA 1ZM2A 3WIEA 3S27A 5GP1A 1HNZB 1ZGAA 2QRNA 1HI9A 4NZOA 2XGMA 3E2IA 5FI0B 5THXA 1DKMA 4RS4A 4C7JA 4HVLA 4W5QA 3LO5A 4XDGA 3QP9A 2WVHA 4L08A 3DA8A 1CBUA 3T3EA 3U39A 3QV1A 5BV1A 1TO6A 4U39A 5A9TA 4OEHA 4IV5A 3DDSA 2PS9A 1EWYA 4MYSA 2KI5A 3F71A 2F3PA 2PNFA 2Q4EA 5BOSA 2OQRA 4QHSA 3KXKA 4KU4A 4RYLA 4URXR 4RKWA 4ZODA 1EVKA 1E0KA 3DHVA 1NHWA 1E99A 5C8ZA 2PLRA 3FN4A 5EMKA 1XDBA 4LHYA 1D4FA 4JQSA 1GG9A 4ZO4A 3SK0A 2OOSA 1RZRA 1BHJA 3QVUA 1JH8A 1BCSA 2PD6A 4GX5A 3TW8B 3GB9A 1RYDA 3N9IA 4RVOA 1JMVA 3RRBA 1QORA 1J2JA 4EQ6A 4YMTA 4XA8A 3KVYA 2PMBA 2IZOA 4TTVA 1L7QA 1G2IA 2J7PA 1UANA 5AKEA 1P2TA 3AO0B 3TQRA 3W5VA 4AJLA 4N8DA 4YDSA 3TB4A 3TAUA 4JP5A 5F1PA 2WF9A 2OP0A 3S44A 4UD6A 1R18A 1P1IA 2OHOA 1W5SA 4EWLA 1MOZA 3NV7A 2HNAA 3FMIA 4NESA 4DJEC 4EBBA 2HO5A 3R5FA 1C8LA 5BURA 1D6MA 3BERA 5C31A 1RCUA 1UC8A 3VBCA 5LLDA 2QV0A 4V0ME 3SOPA 2CNBA 3WMFA 5HMLA 4D80A 2HT1A 3T1HB 3R76A 4G1EB 3TLGA 1FFHA 5J1TB 1TJ3A 4DCMA 4DQ0A 5SV2A 2A2ZA 3ICWA 1VE3A 3DEYX 1IFXA 1JZQA 3O8QA 3DE5X 3QVTA 3CUEF 4BNJA 2F9MA 2YHUA 3F5SA 5TGTA 2IE0A 5A4IS 3MIZA 2V55B 4GUAA 4GEKA 4LDAA 4R9RA 1A9RA 1NSFA 4E7OA 4G4JA 1JJVA 2LDXA 1U9IC 1NP7A 1F8UA 1FXWA 3DWEX 5L40A 4B6QA 3WGHA 1H8HA 3E3LA 2BDUA 1UDAA 3W5SA 1JHUA 1EWVA 1ECPA 2V9CA 5KQMA 3PD0A 3SIPA 5AD1A 3L4KA 3NDBB 2PVSA 3NC1C 2IXGA 2Z04A 3ZQKA 4V0KA 3W6NA 5IDQA 5JO9A 4QTYA 4GP9A 4B3MB 3IIEA 2OO5A 4HY3A 2WABA 2X8LA 3UC5A 4DCCA 3K6SA 4ALMA 2XRZA 1FYVA 4LISA 1VE1A 1Z6QA 1LW7A 3PQDA 1PTJA 2R8BA 2GN4A 3ADDA 3VR2A 1AGRA 2G9NA 2UUPA 3SR3A 3WBJA 5EUBA 4YR7A 3O9ZA 4ZVSA 1H2AS 2B8JA 4NFHA 3LSTA 4LZWA 1PL6A 2GZHA 3BTOA 1RTTA 3UJ3X 2IIBA 3FB4A 2ZIZA 4QLOA 3K0CA 2HA0A 1JN0A 4NDZA 2O3UA 3KVVA 4FOLA 4K8OA 3K96A 1SRQA 3C5WP 4ZEXA 3K1AB 3WAKA 4OKIA 4RVDA 4GVLA 2M9MA 4Y98A 4IO1A 3IAM1 3PRYA 4CGYA 1Q0PA 2YBEA 1QDUA 2QTTA 3G2QA 2JEOA 3K20A 4IDBA 3W9YA 3A6PC 4QU9A 2B8WA 3L6RA 3H8WA 1NXOA 4QL3A 3GEEA 4O0MA 4ZAFA 3E5NA 3TECE 1OPXA 1FDTA 1Q7BA 3ASUA 3IUPA 3OIWA 4IJWA 2AMVA 2ZT8A 3OP1A 4X1IA 4ENPA 3LK7A 4A0RA 1HZZA 3NI2A 1FP7A 4I19A 3DWFA 3LH5A 1P8AA 2HV9A 1GPKA 1J2TA 1IOVA 1GG5A 4MEBA 3ZXIA 4CKZA 3PD1A 1MIHA 1LBHA 5TGZA 3U48A 2Q8NA 3A3YA 2ZS7A 1R00A 5LQJA 4FFMA 3ZHOA 3EVFA 4LDRA 4Z9AA 1WP9A 3FBGA 3GT4A 2VRCA 3RRMA 4NICA 5DNVA 1BDMA 1GLGA 1KJNA 3FYHA 4FN5A 1OXMA 3MOSA 4TRRA 5C1OA 2OCKA 1S89A 2GWHA 5IXJA 5ENZA 4DLLA 5EQTA 4NU5A 5FT9A 2IC5A 3K2QA 5E1BA 5KDLA 1BC5A 4ZT5A 3D7MA 1K0UA 1EUDA 1RMTA 3MRVA 3OURA 3W9UA 3EG9B 3F3YA 5DCYA 1UAAA 4HPJB 1U2RA 4HB0A 1QIFA 4G0VA 2XIQA 4EELA 2EKPA 4RK0A 4BNWA 1XNJA 3DTVA 3NTXA 4W99A 1L4LA 4N03A 3G2JA 10MHA 3IRVA 1LSOA 1G20B 1M0WA 1X39A 3FZNA 1Z7GA 1V5EA 2B1RA 1Q16A 2NZWA 4U6NA 3VKWA 2C4NA 1AGYA 2BZ0A 1USIA 3WMXA 1E9VA 5DRTA 4CUKA 2QIOA 4D82A 2I6TA 2Q9BA 1I33A 3QKUA 4XSGA 3CZ4A 1C2TA 4BL5A 2YHBA 2ZM5A 2JI9A 1N57A 2OBYA 4IEIA 4PPNA 4GVXA 3M6WA 1U0EA 2ISSD 3DTYA 1V11B 3DUFA 4US2R 1SCUA 3SS9X 1EK2A 3EZGA 3S29A 3N05A 4JWTA 4UQLA 3U44B 5IBCA 3R23A 4YUYA 3LT4A 1V1MB 4RCZA 5CLQA 4KE9A 1Y4SA 1PQPA 4B3CA 1GA1A 3JTEA 3BK7A 4LI0A 3OHSX 1CP3A 1XQXA 2XUFA 3CPEA 5LCXA 2PGIA 4JOQA 4UUMA 2FWNA 3IUYA 3NKVA 1B4DA 4I0WB 2HV8A 5ALEA 5BSTA 1E1CB 3KSMA 4RA9B 4QTZA 1KBQA 1U3FA 3MOIA 3NH6A 2QP9X 3VYUB 1XXHA 1WXXA 2J07A 4EG7A 1QV7A 1DX6A 2JGNA 1FMCA 3C3WA 2ZJOA 4C4PA 1DBRA 3ROFA 2NO7A 3X1YA 3DBLA 1E9BA 1EDBA 1J5XA 1NT2A 2PRZA 2VDRB 3H0CA 3QLJA 1QVVA 2OFWA 5EFZA 1L5HA 4PZZA 3VPFA 4EEXA 1V41E 4BNHA 5AUPB 3AUJB 1GQQA 5JCOA 5DHPA 3OOEA 1I2ZA 1NBOA 2OILA 4N4AA 2UUCB 2DR3A 3THWA 1E66A 4B6GA 2FF7A 2ZRCA 2C5BA 3ND9A 1OPRA 4XAQA 1WCIB 4BU0A 3QMWA 4TX1A 5JPCA 5E4FA 3ENKA 3W3AH 3S2EA 5IAAA 4HGYA 4PX2A 2JATA 4R5HA 3MCWA 3QRWA 3UH1A 4ZIRA 1MB9A 4D9IA 4U2GA 1V9SA 3D1JA 4M1EA 3TIGA 4KITB 1KFJB 1IXRC 3VNQA 2VOEA 2AMLA 3HKCA 1FB5A 1IRXA 2NNWB 2DTEA 3R9IA 2C1EA 4N0EA 1NW7A 5DN6D 1B76A 4XIJA 3JZDA 1M8PA 2F3QA 2ZTMA 5I47A 2R8RA 5I8ZA 2ZSIA 1XTZA 3SI7A 2D7JA 2R00A 5AKJA 1XZGA 1X1SA 3OE7A 1SN7A 4PGMA 1KQGA 2HEGA 5FFFA 5KCZA 1D7OA 3R1IA 5F5XA 3CF6R 2V0GA 5CB4B 4IO0A 1TO1E 4BJ5A 4D6PA 4JL6A 5D7NA 1I7PA 1E2LA 5AM5A 5TR9A 4F7DA 2WFMA 4YCDA 1QU2A 5FDFA 3N0XA 16PKA 4GMKA 2Z6QA 3WGKA 4MROA 5TB5A 1JXQA 1GOTA 4R40A 3NHKA 4P0PB 1BGXT 2WRZA 3HXOA 5FUYA 2IVZA 2P5UA 3DBHA 4H31A 5DLPA 3DDNA 3GJRA 2WIKA 4LI3X 1MQ8B 1PKEA 3NANA 3FNBA 1GCUA 3M33A 3SP1A 1EJ6A 4XTRA 2I2XB 1U8YA 1EM6A 2QYHA 1I2MA 2BHTA 3DLAA 3B6ZA 1GGVA 1R8JA 3ECAA 4DLTA 2B1IA 7REQB 3IDFA 4XOUA 3PWSA 1V5WA 4J75A 2BCGY 4JEIA 2YN4A 3EBLA 3M81A 4D0NA 1AUXA 1TTPB 5C7IO 1X1RA 4BNUA 1EGVB 2QE7A 5FQOA 3TTUA 1Y1TA 1RXWA 1XL1A 2G7MC 2OK7A 3QWHA 5DNEA 2DFTA 4FX2A 4OJMX 1TIBA 1QR6A 2EKZA 1T6NA 2WAAA 3DP7A 1G291 3EF1A 5AVZA 2W00A 4ZA2A 1NN3A 3AVOA 3F0TA 1QE0A 1A97A 1V8DA 1X0VA 3OPYI 3D7NA 1LFAA 3FRJA 1NVGA 1IK4A 3JRNA 5JWOA 1PNRA 3ZQJA 4RHTA 4F3RA 3S5UA 3BG5A 5LP1A 4JJFA 5FR2A 1X3SA 4BDSA 1ZVVA 1X7DA 1DU4A 1T2DA 1IONA 2QLBA 4TRNA 3QVKA 4ITUA 3ZGNA 4RTQA 2RBGA 1AZSC 1W34A 2HRBA 3L43A 5CPBA 4Q0MA 4C6SA 1Z2CA 1O0SA 3GIWA 4FE3A 4OFXA 4PG5A 4E4RA 1H66A 1YQGA 3W5JA 3LZ6A 1JAYA 4QKQA 3AP3A 4L6CA 4EPRA 3E9ZA 2HLDA 2WJYA 1KSGA 3E9CA 1EEHA 3H83A 4G0QA 4F04A 3K1JA 1B00A 3KOXA 1LWNA 3QVSA 2VHXA 1JZSA 1TGVA 2E0IA 4FNOA 3BTUA 1NLFA 5TLSA 2FUCA 5EZQA 1UL1X 4RF4A 4TV9B 1G8KA 3EW9A 4FGZA 4FYMA 5IT5A 3TG2A 4KACA 3VHLB 2OZLA 4K0KB 2CZGA 4TTPA 3E03A 3KAJA 2QHXA 2P11A 4G3XA 4ZEWA 5ILOA 1U99A 1SUAA 2WMOB 3GWGA 2CHGA 4WJKB 1WDLA 1N3LA 4XUDA 3WTCA 1BXRB 4WFJA 2WYVA 3TR5A 4Q9DA 5LQMA 1A9PA 4QSHA 4KNVA 1YTUA 3WIOA 3JQGB 2DHEA 3E15A 4FFSA 5JAMA 2PX3A 3L8CA 4Z4CA 1P1BA 2E3JA 3QU5A 3FDIA 3IVMA 4QYIB 3UMVA 3FVWA 1GT91 3WX0A 3GVHA 4C5AA 3P2YA 1GV1A 2NVUA 4U3JA 2HM7A 4YUVA 4ZYWA 5AR1A 2W6ZA 4H1UA 4N54A 2B37A 3G13A 1DIHA 2HBZA 3D59A 1JDPA 4PRZA 1FMLA 5IANA 1T2AA 3RNLA 1E1YA 5GIOE 2ODWA 3GT3A 1OGYA 1VPLA 2QTRA 4E5YA 3DBOB 5GADl 1WUHS 2VCE<