1XRQA

Crystal structure of active site f1-mutant e245q soaked with peptide phe-leu
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDQVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 107
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrqA00
3A6ZA 4L9AA 3DYIA 1K5PA 3W9UA 2DQZA 1YS1X 1CUDA 1H22A 4B83A 3HXKA 2QOEA 1QIEA 1DU4A 4H7KA 1MJ5A 2DHEA 2GBIA 3H2JA 4FNGA 3H17A 1IUNA 1CQZA 2HA7A 2CZQA 1GQRA 5LZ7A 1TAHA 1XRMA 5CT4A 1WM1A 1CUZA 2Q0XA 2ZYIA 3T4UA 5D3ZA 2HL6A 3T52A 3O4JA 1JMYA 3AIKA 4BB0A 4WJLA 4GI1A 1XZMA 4OU4A 3QBJA 2RONA 2YXPX 5AKEA 5HZGA 3DL7A 3EQ9A 3AIMA 5FV4A 3G9TA 4J0KA 2BKLA 4UBMA 4X97A 4EY8A 4XVCA 3E1GA 3ESAA 2C0QA 2RHTA 5ALUA 4YX9A 1UKAA 3FBWA 1E66A 5AKXA 2JF0A 1JT2A 1FFAA 1HQDA 5JZSA 3WWEA 3R3XA 4FOLA 3DOHA 1F6WA 3ANSA 5LZ2A 4X93A 3FYUB 3D4LA 4QEKA 4G1FA 5AM1A 1EXWA 1VXOA 4F0JA 1QE3A 4PNZA 1UWCA 5AM3A 1U65A 2HRRA 3OURA 2XQJA 1R50A 5JAUA 2O2HA 4KAJA 4CIBA 1FFEA 1DINA 4XJVA 1XQYA 3VXKA 2VSQA 5ALIA 3I2JA 4WDRA 2JGEA 4H7FA 2X76A 3AINA 3RARA 3PFBA 1JKMA 2WJ3A 4BZZA 2YYSA 3CCCA 1XRQA 3VJLA 1LBTA 2VATA 4H7IA 4AMYA 3ILSA 4M0FA 3VISA 2WTMA 1THTA 3PUHA 1R88A 2CB9A 1EVEA 3KSRA 3O0DA 1MAHA 3QH4A 4C4YA 2XMGA 4DNQA 4HXFB 5J3JA 5AKGA 1LBSA 5AI4A 5ALRA 5CT6A 4J0JA 1BN6A 4G4JA 1EK2A 1HBJA 4N8DA 4AO7A 2OGSA 1QTIA 2XMDA 4BBZA 1IUOA 1CUEA 1CVLA 4EY5A 1VE7A 1XKLA 4Y7DA 5T4EA 1XRRA 1QFMA 4AO8A 4FBLA 1T2NA 4BVJA 4CIAA 3DQZA 5JAHA 3VJMA 3W05A 2FJ0A 5JATA 3HEAA 3I28A 5ALKA 1GKKA 1Q0ZA 4C89A 2EDCA 2CJPA 1D07A 2OAGA 4JYPA 1K6EA 3D0KA 3HABA 3U1TA 3C70A 2FX5A 2ZYRA 2XUQA 1EH5A 4GLBA 5LZ8A 3STTA 1YASA 2C5GA 2XQGA 3B12A 3TGLA 5T4HA 4KACA 2HHAA 3H18A 1K63A 1CV2A 4X3CA 4K6HA 3FAKA 5AI8A 3WYDA 3HC7A 2H7XA 3ESBA 1O6GA 2V97A 3IUQA 4N5IX 3V1NA 5ALXA 1BCRA 1OXMA 1CUFA 1QO9A 5AOAA 4OCZA 2BUAA 3WZLA 1XLWA 3YASA 4X6XA 1ISPA 3WL6A 1EI9A 5AK6A 4INZA 3KWJA 2UZ0A 2HIHA 2P8SA 3SX4A 3W2TA 4H35A 1LNSA 4CCWA 1BEZA 4UFOA 1ORVA 3JWEA 2AJDA 1MNAA 2HA2A 2J3QA 1USWA 1KEZA 1HDEA 2O2IA 4UHDA 4OB8A 2OCGA 5BOVA 3G9ZA 4Z49A 2JGJA 1XFDA 1J1IA 5YASA 2DSNA 3I2KA 3W04A 4JYMA 3S8YA 1A8SA 3N2ZB 1XQXA 2AJLI 3E3AA 4GHWA 1EK1A 3AIOA 4X6UA 5LIPA 1YA4A 4PF1A 5JADA 1KU6A 2BJHA 2WHQA 2H9YA 1HL7A 3G7NA 2G5PA 4EZIA 5D7BA 3WI7A 1CUHA 4FWBA 2ZJ6A 1ZD4A 5ALLA 4B0PA 1W52X 2Z3WA 1JJIA 4RE6A 1HLGA 4LYEA 3IA2A 2XT0A 1P0QA 1CUIA 1WCYA 4MWTA 1EB8A 4B84A 5DYWA 2WIGA 2QMQA 1VOTA 1R9MA 3UUFA 1ZD2P 2AJ8A 5AM2A 5I8PA 1QIFA 4DNPA 2QS9A 3M3DA 1P0MA 2K2QB 3BF8A 3D2CA 2HA0A 2OG1A 1ZICA 4X95A 5LKAA 1ACJA 3G9XA 4XWGA 4MJ3A 5AKYA 2CEKA 4RGYA 2Y2VA 4KRXA 2WHRA 1QIDA 2CKMA 2DFPA 3AUKA 1ODSA 2RI6A 3WWOA 2H1IA 1W76A 1E3QA 1QIIA 2ZYSA 4U2BA 1U8EA 4WFKA 4B9AA 4UUQA 1A8QA 2GBGA 3WK8A 2E3JA 2WFLB 2HU5A 2OQIA 3PF9A 3QPCA 2XMBA 3R0VA 5ALJA 4PV7A 1WB5A 4LXGA 4V2IA 4L72A 5DNVA 2VA9A 1IZ8A 4F21A 1FSSA 3G0BA 5JZBA 4MQLA 1ODCA 4G9EA 1LZLA 2GBFA 4U2FA 2Y6VA 1JI3A 4TGLA 2VJDA 5HQ3A 5AP9A 3H0CA 3O95A 4DIUA 1LPMA 3HZOA 3QYJA 4QNNA 5ALMA 4HRXA 4ARAA 4FBMA 4KE9A 3LS2A 3H2IA 4LKOA 1L7AA 4NMWA 3WA6A 5LKRA 4P08A 2JEYA 3D59A 5HFNA 5F4ZA 4B9EA 4MEBA 5A7HA 4HXEB 4Q1VA 3W06A 3VJKA 5SYNA 1ZJ5A 3WKDA 1CUYA 4DLNA 1DQZA 3IB3A 4EY6A 1B41A 1XLUA 1SCIA 3HRHA 2HU7A 4QLOA 4C6HA 5JD5A 4X85A 2ES4A 1YB6A 3GA7A 1EDEA 3R41A 3BWXA 1ZIYA 5HF6A 4OD0A 3LLCA 5C81A 4UPDA 2OLEA 4PW0A 2AJCA 1XQWA 1SCQA 2VJCA 5JALA 2C7BA 2IIVA 4HTAA 1J2EA 1ZI9A 1U4NA 3G0CA 5IVIA 1GGVA 5LZ5A 2WHPB 4QDOA 4X71A 4BATA 1TK3A 2B9VA 1MX1A 1UKBA 4LXIA 3JW8A 1WB4A 3V9AA 3WMRA 1WPRA 2Z8XA 3C5VA 3I2GA 3H2GA 4G8DA 3CN7A 4W1QA 3DDUA 3IULA 4DNOA 2XUJA 2J3DA 4LXHA 1B6GA 1XQVA 3WK6A 3D2AA 1QIKA 5FP0A 5LZ9A 3MUNA 1DT3A 4AZ0A 2Z5GA 3KD2A 1N8SA 1TCCA 3NUZA 1MU0A 1P0IA 3BL8A 5AI0A 4GDMA 5ALOA 1O6FA 4MYDA 1NU8A 1JMKC 5LZ4A 4B80A 3FWHA 4NVRA 4QWWA 5CH8A 3SC2A 4BVLA 1FFDA 4ZRDA 3VVLA 1CUJA 1DX4A 5HK9A 4ETWA 1LPSA 3FLAA 1DWPA 2B4KA 5CMLA 1CQWA 4YASA 4B81A 1H2ZA 3DD5A 2PPLA 4Y2UA 1QIMA 5T4BA 4ZWNA 2XUHA 3LCRA 2Y6UA 3CN9A 1QIJA 2QR5A 5ALSA 4G5XA 4MWSA 2WUEA 1N1MA 4FHZA 3BDIA 1YR2A 4BTVA 2GBCA 4BRZA 3WQHA 1C4XA 2AXEA 2XUDA 1AQLA 3PF8A 3H2KA 3WL7A 1PFQA 2ACKA 4L0CA 2QRUA 1VJ5A 3WK7A 3FLBA 4H0CA 4X92A 4KAFA 4H7JA 3C6XA 1BS9A 1XZHA 3IURA 4X94A 1IZ7A 4Y9SA 3D5EA 3D3NA 4A5SA 1AMNA 1G42A 1IMJA 2C58A 1LGYA 4DM7A 3A2NA 3FYUA 1N5RA 3UMJA 1GXSA 1YSCA 5ISMA 3PUIA 1CFJA 3A2MA 3IBTA 4JEIA 4FFWA 1QIGA 3WLAA 3STVA 2HFJA 3B3QA 3WJ2A 1XZJA 3VDXA 4JNCA 4FMPA 3ED1A 1MAAA 1QFSA 2XI4A 5C8VA 2ZJFA 2WFLA 4UFPA 3ZWQA 5FOQA 3AZPA 5CXXA 3R3ZA 5KWIA 2HADA 3BE8A 4Y2RA 3ZLVA 4LHEA 4UBNA 3C6BA 3PDCA 5HKAA 2PU5A 3GUUA 4M0EA 5JASA 1JU3A 5LLSA 2ROQA 3EIOA 3BIWA 1TIBA 2VAVA 5A71A 3V48A 4DNFA 1UXOA 3GROA 3BXPA 5IVKA 4KE6A 4W1PA 1TCBA 1DT5A 1GPLA 1QGED 4J0IA 1Y7HA 3PICA 4WCVA 4EUSA 4UHEA 2O7RA 4PSDA 4WDQA 1ZGBA 5ALYA 5FLKA 5JD4A 3DJYA 4UBJA 4GEGA 4OSEA 3STXA 3R3WA 3FLEA 1QO7A 4BC0A 2G4LA 3C87A 1KU0A 2V98A 1ZI6A 5JAPA 3R3YA 5JARA 3EQ7A 1AUOA 3WL5A 5DYYA 2ZSHA 2JGKA 3I2FA 5ALEA 2GYUA 5ALPA 5K3EA 2PSDA 4DGQA 3G0GA 5C8ZA 5AK3A 3STWA 2WLSA 1DQYA 2W6CX 4E11A 5ALNA 3ICVA 4J0DA 2I03A 4O08A 3BF7A 4S0XA 1FFCA 2WUFA 1BROA 1YB7A 4Y2VA 4AQDA 4J0HA 1BN7A 4D9JA 4Q34A 5FXMA 4ZV7A 4A23A 3EQ8A 2WIDA 4I19A 3HI4A 4J0CA 3KWFA 3ZI7A 5EHQA 2PM8A 5T4FA 2XUAA 4XIIA 1VZ2A 4MEAA 2DHDA 3AZOA 4QDUA 4AZ3A 3WJ1A 1XZEA 4AX4A 3FNBA 4DSAA 2JGMA 2B61A 2WFZA 2PVSA 3H19A 3DLTA 4QLAA 1EDBA 2OGZA 4B82A 3O9MA 5E4YA 1XZAA 3MVEA 4QE3A 3F9CA 2JGIA 2XMSA 1LLFA 3C43A 5H3HA 1EVQA 3OTQA 4Y2XA 5E4TA 5AOBA 2Z3ZA 4BCBA 5HCUA 4CG3A 4PO3X 1CUXA 2IITA 3O4GA 5LP1A 4L3WA 3HSSA 2WM2A 2WSLA 4WFJA 3WIOA 4NS4A 5ESRA 4XX1A 1BU8A 4NZZA 4BYMA 5IVDA 2WG2A 3STUA 5AM4A 4IQ4A 1BCSA 1CUAA 4OUKX 2XUGA 3D7RA 5I9IA 3ZPXA 2ZJ7A 3F96A 3C8HA 4CG2A 2VEOA 3IUNA 1X2EA 4K6KA 2QT9A 2WG0A 1GPKA 3FVTA 3WK4A 1F0NA 4I3FA 5K3FB 5BWCA 2QM0A 1CR6A 5AIBA 5JAOA 1MO2A 2XB6A 4Q82A 4QDZA 2FUKA 5ALGA 2XE4A 1YA8A 1UOQA 3WK9A 2VT7A 1XZBA 2CBGA 3M82A 4FLMA 5C7YA 4W1SA 1RP1A 2OPHA 5K3AA 2Z8ZA 3FCXA 5AM5A 1L7QA 1EA5A 2RGUA 1MPXA 3QPAA 4KRYA 1CUWA 3EF3A 4OB7A 5KBYA 5ALQA 4E46A 2C0PA 4YK7A 1VKHA 2OCKA 1GPNA 4HRYA 1XZKA 4H7HA 3S2ZA 2XUFA 5AK4A 3CXUA 4P9NA 5FKJA 4Y2PA 2EEPA 3JYHA 4DSZA 5AKHA 5FUMA 2NW6A 3I6MA 5FPQA 1XZCA 3FVRA 5AI9A 3DKKA 1R4ZA 2V9ZA 1L7RA 3AFIA 3WK5A 3Q8WA 3R3VA 3QZUA 1GZ7A 2GYVA 1W75A 2BAGA 5DYTA 5K5EA 1H2XA 3V1LA 1VA5A 2VF2A 2G5TA 4GXNA 2PUHA 4GW3A 1EX9A 5EHZA 2O2GA 3C5WP 1F8UA 1EDDA 2X5XA 3LP5A 3ESCA 3G8YA 4ARBA 3AJAA 1UK9A 2XLBA 1QTRA 2V96A 1YAHA 3GFFA 5K3DA 4QA9A 1R3DA 2OCLA 3QMVA 4QZVA 5EIHA 2WQZA 3QMWA 3V1KA 4FFVA 3F97A 2JGLA 4OYLA 4JUIA 1DTEA 3G0IA 5CH3A 1JU4A 1XLVA 4X90A 3I2IA 1LPAB 1MTZA 1ZD5A 3WKCA 3TRDA 4KJXA 1XZIA 2X8BA 5JIBA 1TQHA 3L1HA 4J03A 1ETHA 3MUOA 4UBKA 4TVKA 4P92A 5AO9A 1GQSA 4IO0A 3DCNA 2XQKA 3C8DA 2PSJA 1IVYA 1EB9A 4GECA 3DYVA 1LPBB 1WOMA 4B0OA 5JZ9A 1QJ4A 1R9NA 4UHCA 2HDWA 1P0PA 1UZAA 1DWQA 5D3KA 4UFNA 3WWDA 4DMHA 4MYSA 5AI5A 4M0MA 3WKEA 1G4HA 3VKFA 1N5MA 5A62A 4E15A 1TCAA 1VXRA 2RAUA 2J4CA 3C45A 2HM7A 4ITVA 3F67A 2PKYX 3IIIA 5FRDA 1XZLA 4Q3OA 4H18A 5FDFA 3I1IA 4KAAA 4TPKA 1S8OA 3C6YA 4YPVA 5D6OA 1X70A 3ICWA 5EFZA 4ZGBA 5CRIA 4MQMA 4AO6A 1RWQA 3DKRA 2ZYHA 2WUDA 5E4JA 4BCDA 2XQFA 1OCEA 2ZVDA 2DHCA 3BDVA 1DWOA 1EHYA 5AKJA 4AXBA 3B5EA 2QKYA 4BAUA 4CG1A 4OB6A 3RK4A 1M33A 5ALFA 1EINA 4KR0A 7YASA 3IVMA 4X6YA 3RM3A 2D5LA 5AKLA 1XZFA 2RIPA 1ZIXA 3GELA 1CLEA 3WKBA 2WU3A 5AH0A 4Y2TA 1LPOA 1MX9A 3QVMA 5A2GA 2Y1KA 2QXUA 2Y2UA 2HA4A 4W9RA 1SC9A 1TRHA 1YAJA 1UK6A 3FOBA 3L1IA 4DMCA 5AOCA 4EHBA 1QIHA 2O7VA 4EBBA 4GWLA 4A16A 2GYWA 2HA6A 4EY4A 1UT6A 3H1BA 4AN0A 3DL4A 1X2BA 2XUKA 2PSHA 1BEEA 3C6ZA 4BTLA 3GZJA 3HJUA 3DEAA 2QUBA 5CT5A 2VT6A 4K5QA 1FFBA 3R3UA 4FKBA 2WIJA 1CUVA 1XZGA 1JJBA 3N0TA 5DWDA 5ALDA 2OGTA 4UBOA 4EB0A 3EBLA 4GBGA 2I3DA 4AMZA 3SK0A 2DCMA 2XMRA 2R8BA 2XDWA 2RHWA 3I6YA 4FTWA 4X91A 4BE4A 5EIEA 4H7DA 1Q83A 4AB1A 5HKBA 3G02A 1G66A 1PJAA 3O4IA 4C87A 4G8CA 3ZV7A 2WUGA 3H04A 3HLKA 2QTBA 1CUUA 2PL5A 5EIAA 3OG9A 1THGA 1AURA 3HACA 1MX5A 2OAEA 4G8BA 2QXTA 2JBWA 4N5HX 2BGNA 1VA4A 1YCDA 4RE5A 5ALTA 4ROTA 3SWWA 3HYSA 2XLCA 3A2LA 5HFAA 3NWOA 2WKWA 2ZSIA 4KE7A 2QVBA 3FSGD 4KE8A 3I2HA 2XQIA 4U2CA 2WG1A 4UBIA 3O4HA 4BAZA 3P2MA 1E8MA 5HQ3B 1H23A 2HA5A 3DNMA 3DS8A 1AKNA 1VLQA 1HKHA 4C88A 2AJBA 2EDAA 4DTCA 5IKXA 4OPMA 5CT9A 5AK5A 2HU8A 4CCYB 4Y2JA 5AKZA 1LPPA 5DJ5A 1Q84A 3BJMA 1WB6A 5HF5A 4BDSA 2B20A 3GBSA 3I6ZA 5AI6A 4PQEA 4BE9A 4CI9A 4BDTA 3A70A 1UOPA 2FJPA 5BV7A 4WY5A 4IH1A 1QLWA 1NX9A 2JEZA 5HK8A 3OOSA 1H2WA 3QM1A 5ALVA 4U2GA 4IH9A 2QJRA 1W1IA 3O9VA 2H7YA 5DTJA 3RLIA 1CIJA 4Q3KA 5CTAA 3ANTA 4H7EA 1ODTC 3G0DA 5FPPA 5CH5A 2WTNA 5CXUA 2XUPA 3M83A 1W4LA 3IUJA 2BFNA 1LPNA 2HFKA 5HF9A 1CUBA 4G4GA 2OCIA 4MXDA 4BZWA 4Y2YA 3VVMA 3WL8A 2C4HA 3IDAA 2PBLA 3H1AA 4RPCA 3ESDA 4IHAA 1ORWA 3K6KA 4BVKA 4IH4A 4F60A 1Y37A 4H77A 4C4XA 3NGMA 2W22A 5AIAA 1QZ3A 3QPDA 1UFOA 2QZPA 2WJ4A 4W1RA 4J3JA 4X00A 4BRSA 1NU6A 1WHSA 4ZV9A 4HVTA 1J06A 3WYNA 2WFMA 2BCEA 2H7CA 4K6GA 4J0GA 1G5FA 3ZLUA 4FDMA 1JJFA 4K2AA 1JFRA 1DX6A 2XUOA 2ORYA 2D0DA 4KEAA 1Q0RA 1XRPA 4Y2QA 5DTIA 4G4IA 1SCKA 1E5TA 1UOOA 3LIPA 2PSFA 2WIFA 5K3CA 1CRLA 2ONCA 1E8NA 5DNUA 1WHTA 1AZWA 2YASA 4BP9A 2VQ6A 1SOMA 2YH2A 5K3BA 1PV1A 3PI6A 5K3FA 1C7JA 4HZGA 1AC5A 3PFCA 1LZKA 4QDXA 5AJHA 5BWBA 4QWMA 5EI5A 3L1JA 1QOZA 4C01A 1XRNA 1ZGCA 5EGNA 2HA3A 5AKIA 5HF8A 1CEXA 3BIXA 1WPXA 3KXPA 2DR0A 2G63A 2GZRA 5KWJA 4HXGA 1VE6A 4BCCA 3KOOA 4ZI5A 4UHFA 1GT6A 5IH7A 5CT8A 1XRLA 4E14A 2WHPA 3M81A 1RYYA 1FJ2A 3FCYA 1ZOIA 1BE0A 3FYTA 3D2BA 4RNCA 1UK7A 2QJWA 4J7AA 4FNMA 6YASA 3AILA 1IUPA 3W9BA 3UUEA 5DNWA 3IUMA 4WY8A 1MN6A 1U2EA 1AX9A 2WILA 2VAXA 5AICA 2GZSA 3OM8A 3Q0TA 3MGAA 3AZQA 2WJ6A 3WWCA 4UHHA 5ALHA 4AN1A 3LIIA 4LIPD 1AGYA 5LYYA 4I4CA 2VJBA 5AHXA 3DOIA 1TKRA 3ZLTA 3K9BA 3TEJA 4Q05A 5ALWA 2CMFA 3KDAA 1I6WA 3FYUC 4FLFA 3QMMA 1ZD3A 2JGFA 5JANA 3G9UA 4KYVA 4QDTA 4X7BA 4BAGA 2DQYA 4DMKA 2I78A 5AKKA 4OU5A 1Y7IA 2BUBA 4WFIA 2LIPA 4FLEA 3OC0A 1MT3A 2VJAA 3PE6A 2J4FA 2JIDA 4G9GA 4Q3LA 4C4ZA 2WIKA 2BUCA 1CPYA 1XROA 4ZXFA 3WIBA 3QITA 2R11A 2CUTA 4Y2SA 4B85A 4JH0A 4EA6A 1ZI8A 4F5ZA 5CW2A 5CURA 2XMCA 5C8XA 2ACEA 1J07A 5JYCA 3BJRA 1VZ3A 1HPLA 3STYA 4ZREA 1E89A 5SYMA 1A88A 1XKTA 4LYDA 5KREA 1XZDA 4CFSA 1YS2X 4BC1A 4PSCA 5AM0A 1SFRA 1ACLA 3TJMA 1H2YA 3WA7A 4U2EA 2PSEA 3RKSA 5IVHA 2XMQA 5DLPA 3V1MA 1K4YA 2XMZA 4BP8A 1C7IA 2HRQA 2WU4A 3WZMA 4W63A 3E4DA 4OYYA 3CCBA 2VTVA 1R1DA 1Z68A 3FSGA 4UBLA 2PUJA 5CBKA 3F98A 4N8EA 1MNQA 3X3HA 5EHNA 3U0VA 2BGRA 1CUGA 3K2IA 3F8SA 3E0XA 4EY7A 4N8SA 4UHBA 2IX9A 5A6VA 2QUAA 1A7UA 1CUSA 1F0PA 3H2HA 2C5FA 5A7FA 4CCYA 1BRTA 1QONA 1UKCA 3WKAA 3OPMA 2I3ZA 5I7UA 1W6RA 5A7GA 4B7ZA 2OXEA 3I1YA 4HS9A 2XUIA 3NOXA 5E2IA 1T4MA 1UK8A 4P93A 1CUCA 1K8QA 5JD6A 4PSUA 5EHXA 2PU7A 4U2DA 4DMFA 2ECFA 3R40A 4HAIA 2PX6A 1E8DA 5ALZA 1OILA 1GKLA 1A8UA 4DYHA 3WWPA 4B6GA 1ZJ4A 2OQVA
chains in the Genus database with same CATH superfamily
3OE5A 3C16C 5HM6A 4H0FA 1V5GA 3DEFA 4P7GA 5JY1A 4P81A 1USVA 3OX3A 1OAOA 1UT8A 1ZH4A 3ITKA 3IJEB 2BKEA 3MIIA 4KXYA 3VAAA 3T3HA 5ITZA 1CUDA 4JI4B 2Y92A 3SEQA 2HDHA 5LNK1 1M1YB 3VR5A 1ZL2A 4KKXB 3IPYA 4B83A 4RJJA 2J3HA 2UV8A 2XXAA 4GMGA 1MW9X 2QOEA 4RY8A 2IOQA 2H51A 1K6IA 5D51S 1DU4A 1DAOA 1MJ5A 2AZ4A 3GFOA 1Q22A 4GMXA 1Z37A 1GKIA 3BFJA 3OIUA 1N5KA 2YFKA 1KXZA 1R0WA 3OEED 4H60A 5IUKC 5DIZA 4F93B 3FDZA 1E7YA 4M49A 2XDAA 2AEEA 4G63A 1YV9A 1UFVA 4JVMA 4YV7A 3LD9A 1WW3A 2BDTA 3T5PA 3LOPA 2Q1YA 3LLVA 4DWOA 3OD1A 2A9PA 1JHPA 2HMUA 2FB9A 3OQJA 1CQZA 1UBGA 4AZSA 2WRZA 2CZQA 2V9PA 4MV5A 1G2QA 1NYRA 4XWOA 1XD2B 3OLWA 1PR5A 2I2WA 2XRFA 3MM4A 3MBKA 4IQGA 4BFCA 4EI9A 1ECPA 3A05A 3GD5A 3DZIA 4FEGA 4KDRA 4OFXA 4R8MA 2VK8A 3H3JA 2TMYA 5KTSA 3HKEB 3ED5A 4O4IB 4IIJF 1WM1A 4EYKA 2Q0XA 2ZYIA 4X62B 4RJLA 4RVFA 3NX4A 1X1RA 2DUJA 4WCFA 4Z2YA 2VPXA 3WP1B 4TWBA 4QKQA 1J5PA 1NXSA 2CZCA 2ONKA 3OF2A 4MGIR 3R0JA 4NBSA 1HZJA 6PFKA 5JMWA 2HL6A 1PK7A 3VU9A 4P3KA 2F4VB 3ZIAD 3WLLA 2JLUA 3MCAA 4ONEA 4YMUA 2LD4A 2MU1A 1G8YA 3OZFA 4KYIB 2AMLA 1OUMA 3NTRA 1NXQA 3HVIA 4IQFA 4JBGA 5M29A 3NHLA 1LFAA 1VPDA 4HDOB 2FCAA 2RONA 4HZIA 5I4CA 2V3CC 1W9HA 3CRZA 3BEDA 4CMEA 4PYLA 2I7XA 3KVOA 2JA2A 1Z08A 1P5FA 2BTOA 2GKSA 2GILA 3F2VA 4XDGA 3THYB 2AG6A 4L85A 3TJRA 1NF3A 3DMTA 3QWFA 5TQ0A 1W0JA 3C3CA 2D1RA 5AMXA 5G0SA 3KUDA 4H17A 1Z5VA 2VR1A 4O1HA 2B1JA 2Z5LA 2Q8NA 4JLWA 2NWQA 2X6QA 3E1GA 1AK1A 2FR8C 2GPYA 3KWLA 2PRIA 1BS1A 5CLIA 3IVAA 1ZP6A 2WA1A 1UKAA 3TPZA 2HJSA 3URKA 4YX9A 2AR7A 4TKUB 4FB4A 1HQDA 4AJHA 4CV2A 2GXUA 1LDBA 4Q5IA 4QC2A 4F1KA 1R9GA 2CFIA 2BEWB 3WWEA 4QXOA 1PJTA 4MW5A 4BVKA 1Z83A 3SGLA 1AHIA 1DX9A 3VTKA 2BT4A 2X8LA 3ZGXA 1NG9A 1FYXA 3MNFA 2AB0A 2BEWA 3NOQA 3ANSA 3MJCA 4JSYA 4PQRA 4EFLA 5F9HA 1SKAA 4R71A 2RG1A 3IQXA 3BMNB 1SXJC 2GNPA 2PS3A 3DAOA 3DTYA 4CN8A 4EP1A 1WPGA 3D4LA 1DL5A 4G1FA 3PDJA 3IMCA 1UPAA 5AM1A 2ZSDA 4FOSA 3CVXA 4F0JA 4O2BF 2FN3A 5BSMA 3H0EA 2QE6A 5CJPA 3ROMA 1CX9B 1RVDA 5TQ0B 4Q7LA 1EJ2A 3KSDO 4PGMA 1WA5A 1O4WA 2K87A 5AVXA 1R50A 2HHJA 4LXTA 1YQTA 3PPVA 4QUIA 1VPWA 1EQ2A 1J2RA 1JP7A 3QYPA 5JYDA 1T8UA 2QR2A 1OT3A 2FP4A 1HYGA 4URVR 1Z6TA 4ZN6A 1K86A 3I2JA 4IVRA 1S7GA 3ZVKA 1CTQA 5TARA 4JBYA 2G25A 2JGEA 4XQEA 3PVSA 1EDOA 1Z2CA 3OOJA 4GUDA 3NH9A 1CF9A 2J48A 2PT6A 3PFBA 1WW8A 1JKMA 5CDFE 2WJ3A 2V7QD 2ZJ4A 3BGWA 5KPDA 2P6MA 3UCXA 1LBTA 3HGTA 3LQQA 3TLBA 1TK2A 1RRFA 1DC5A 4XSHA 3GEPA 5HE9A 3VISA 4JB3A 2OK8A 1TEHA 3OFSA 3IUPA 3LQ4A 3OUZA 5BSEA 1JDPA 2JI7A 5TY0A 1YI1A 3V4FA 2G88A 1RIFA 2HZ7A 1OBVA 1NVTA 4MWOA 3S29A 5KKNB 3AVQA 3CWZA 5DHFA 4TM7A 3JQFA 1X94A 4A0RA 4EBFA 2B8EA 3DFFA 4AZ3B 2IH4A 4X54A 3OPNA 1JB9A 2KLHA 5LL6P 3VU0A 3BXZA 2WF6A 4AG3A 2EFDB 4FS8A 4ZTUB 1BFDA 5AKGA 3GLHE 4PPQA 4J0JA 1XF9A 2I55A 5ALRA 4ZHQA 1S8AA 1II8B 1J39A 3WNVA 4E22A 1XDZA 4EK9A 3EPRA 1I2BA 1PNOA 4KUGA 4CF4A 1DIRA 1KMHA 2QYTA 3UICA 2B4QA 4FDAA 2JBAB 3BK7A 5FNVF 2JCGA 3NG1A 4GSKA 2BFEA 5HBGA 5AW0A 1QFMA 3DP9A 4YLGA 1JXAA 1LXCA 4MLPA 1VJRA 3QVSA 1ZYUA 3B6KA 3HZRA 1Y6ZA 3QW2A 2IOFK 2GM5A 3DZCA 3NCTA 3I76A 2D2VA 5B58C 3B1VA 1T6XA 3OZTA 3KJQA 4MB2A 5IH3A 4CIAA 3DQZA 3TF5A 4QBHA 2C7RA 4XIGS 4DEYA 2DH6A 3UK1A 1JV2B 4CM7A 4RTRA 1FTGA 2D54A 3DLCA 2FJ0A 2WNSA 5TDHA 1MA0A 1R12A 2Q6TA 4M76B 1RZUA 5JWOA 1G38A 5ALKA 1CHDA 2RKWA 3PUJA 4J1NA 2E48A 3VYTB 1RKVA 4OBWA 1PL0A 3FWKA 1E4YA 1XOIA 5BRNA 1OI4A 2HRCA 2EDCA 1V0JA 5ERGB 2BOVA 2CJPA 1NULA 3GDOA 1PL7A 4GPZA 1U9ZA 1D07A 2Z2YA 4GX0A 2OAGA 1KEEB 3L49A 4OXKA 3QVTA 1RWVA 1YDFA 3D0KA 1TC1A 4YR7A 5I9NA 3EJ6A 3U1TA 1RQ7A 3DBHB 2FW0A 5JDIC 3K9GA 1FU7A 1ND6A 4FGJA 4NMLA 3AYXB 3HJAA 2ZYRA 5FJIA 4MUMA 1E2JA 1QR2A 2VWQA 3GLTA 4V38A 5KVVA 2H85A 3UATA 1KQOA 4R1PA 2CNWD 3JVVA 1E9DA 1YASA 3G6WA 4ZPJA 3DZBA 2Z6AA 4JYZA 1NUHA 9LDBA 2VHCA 3ACDA 4JIMA 2FSHA 3PGJA 3DE3X 1SIBE 2X0KA 2A67A 3UWMA 4R2JA 2H2DA 2AFHB 4ZANA 1NLFA 4EEXA 4OIFA 4MSUA 1H9AA 4NBRA 1DQSA 5LBIA 1MVLA 2YWXA 3FAKA 3OFKA 4EL0A 2OE2A 3EGXA 2OBBA 3OJXA 3GUZA 2AEFA 3SCZA 2QM7A 2V97A 5CDUA 1OFUA 3E8MA 4QNRA 5FBZA 1JYSA 4ECEA 2J5KA 4G09A 3W1WA 2VTBA 2IUTA 3BWMA 4F4CA 4PLHA 1QB7A 2ARKA 1T2AA 3HBNA 3U7FB 2O8FA 5G02A 3RUAA 1NLYA 3T1QA 1GKUB 4I50F 1RWMA 4R9SA 1C1DA 1WEHA 4EQ6A 1C9YA 2HV8A 5F5LA 5KCMA 5I45A 4N40A 3S0JA 3YASA 2GEFA 3SR3A 4X6XA 4NHOA 2FI1A 4YRFA 3PENA 4BMNA 3KFVA 1E0KA 2FG6C 3WL6A 1KJ9A 1U2GC 2QYHA 5AK6A 5FA6A 1G63A 4INZA 4NH4A 2CLKB 3KWJA 3EN0A 5EAIA 5CITA 2UZ0A 5ICFA 2D7CA 3DMPA 1JN0A 4LWPA 3SX4A 4C3UA 1GZUA 1G5PA 5DGDA 4FGSA 3W2TA 2CB0A 1RHUA 1NPDA 1P3Y1 2R97A 3FKSD 4JNKA 3LE8A 1QV9A 3FI0A 4L4YA 4LHZA 4UE2A 4YAOA 1AQYA 5CLJA 5KDOA 1O08A 3RRYA 1S3GA 5GJCA 4YXWD 2HDNB 4H27A 4BQEA 5IDWA 3MJEA 4R8VA 2EGHA 2B35A 3WGZA 2OCPA 4D9HA 4XB2A 1V95A 1MNAA 1SR8A 3HNRA 2HA2A 1HOXA 2OORC 4F6RB 5IAJA 3DBVO 4WSOA 3NTOA 4ZO9A 1HUQA 4M8KA 4P4SA 2C3MA 3SM3A 4D0SA 3H99A 5K6TA 3WQQA 1X38A 1M1NA 2VDKB 3EXEA 3GJ4A 1LBHA 2O2IA 3MAAC 4PRLA 3SBXA 3U1BA 4YJ3F 4Z4CA 1U7TA 4OB8A 3DCJA 2NAPA 2C2GA 3OHSX 2NV0A 3ERCA 3SF8B 2I2AA 4Z5XA 1VCOA 4LBWA 4DQDA 5C34B 4IYJA 3EIEA 3SPXA 5JO9A 2ZVJA 5F33A 1SU6A 2WAOA 1ZN9A 2JGJA 4LCBA 1BMQA 1KIFA 5ES4B 2H2GA 2WKPA 5EIOA 5JLJA 1E3WA 2WF9A 4RX1A 1B73A 3F0TA 5YASA 3GMSA 3UJ9A 2DSNA 3VYWA 8GPBA 2J9YB 2R7AA 3KZ1E 4JYMA 3NIGB 1A8SA 4CGZA 2CGEA 3ECSA 3PHGA 5H68A 3KSMA 1NVWQ 3COYA 1Q7BA 2XR1A 3S5UA 1A27A 5AJTA 1E3SA 4ZOLB 3WB0A 2CFSA 4PF1A 4ABYA 1K92A 1B4DA 4Y1EA 2VPQA 2BJHA 421PA 4EKDA 2IS1A 1R6XA 1UP4A 3HN6A 2H9YA 2VDQB 4KXWA 2Q4BA 3G7NA 2HQOA 4RZQA 4AJJA 2G5PA 4BU0A 1VJGA 1Q7RA 1MOQA 4DC0A 2H2HA 5KTYA 3WI7A 2EEZA 1U9IC 1A9XB 3I4LA 5JNRA 1F7UA 2PO5A 1EUCA 4Q1FA 1X8XA 5JCOC 4IAOA 1RZRA 1A8PA 1G64A 4LOKA 3SZMA 1L8LA 2L0XA 3BCHA 1EFKA 5KYUB 2JJQA 5E4FA 3OIGA 2WJZB 2XCLA 1L7MA 2ZFUA 4WVFA 1MJGA 1XK7A 1BQ4A 3KS9A 4G1MB 1KERA 1F8FA 3AR4A 4LYEA 3UQZA 3IA2A 2XT0A 3N2EA 1HRDA 3VGJA 3BB3A 2C4TA 3FKJA 4ALMA 2E18A 2MJLA 1XEWY 2H8GA 1D0VA 2BMFA 3HG7A 1OB5A 3N39C 2WIGA 4MKXA 5FF9A 4KLCA 2C5AA 2IE8A 4OHWA 5CB4F 2QE7D 2BZGA 1HFJA 1USUA 3R5JA 4Y6OA 1LDEA 1QANA 4LTNA 1TQ6A 1TT5A 1YR9A 5G3ZA 3N5CA 3V2GA 3R8FA 2YCBA 1KYXA 2FGJA 3DEHA 3NHPA 2W6ID 3KXKA 1UINA 4GYWA 4C08A 3AM5A 3GCDA 4TYYA 5I8PA 1M6HA 1PYOA 4BKOA 5LP6A 1GGNA 1PE0A 3AY0A 1ULHA 3H5AA 1NRJB 3D3QA 5BUSA 1PJBA 1YBFA 3T4EA 3M3DA 1YE5A 2D3TA 2K2QB 3EGWA 3VSBA 3BF8A 4EZIA 4HNVA 721PA 3OCUA 4XX0A 2OG1A 4M87A 1ZICA 4X95A 5CD1A 3ESZA 2OR3A 5LKAA 2JVJA 3HKDB 2QUJA 5M3BA 3NDBB 1GT91 1EG2A 3LCMA 3FTDA 3L8MA 3B85A 2CEKA 3EDRA 1XVAA 1IOVA 4KTVE 2OGUA 3NYQA 4R3NA 1L5NA 5GOTA 3WGTA 1SXPA 3TL3A 2RHHA 2QLLA 4KRXA 4OX9B 3QOYA 1KEKA 3L84A 2AYXA 1ZK4A 4MS3B 4UVDA 5IM4F 2AOUA 4OQDA 1CY1A 1ODSA 2JFQA 1VP9A 1WUJS 4R31A 5TPWB 5JDCC 1OU0A 2EJCA 1FFWA 3TYXA 3UJCA 3GY0A 4ED9A 1BDIA 4BNWA 3CG0A 4M54A 2IU3A 2ZYSA 3AFMA 5IBQA 3ZKAA 5KS2A 3M4JA 3A9RA 1I2AA 3O47A 2WMOB 4WFKA 3VPXA 3MJDA 4JOCA 1IBSA 2GBGA 3HY3A 5KU7A 4UREA 3G8CA 3K0EA 1EFVA 5EQTA 2E3JA 2FZ5A 3AY7A 2XA1A 4GQBA 4HWGA 2WDPA 1UC8A 6LDHA 1NF9A 2OQIA 4UMFA 2G8NA 4PWZA 5JTUA 4HWPA 1X9HA 2GLTA 4B33A 3L8YA 4L07A 1JPVA 1JHZA 3PDWA 3QPCA 4MH0R 5C4MA 2XMBA 5C53B 1QAQA 1WB5A 3SNHA 4MRMA 3OPVA 2DPXA 3E5HA 2G9ZA 2F9LA 3DDWA 4J2OA 4OVKA 5I48A 1KDOA 1LDGA 4FP9A 2Q2NA 4AZ0B 3CV3A 4YV1A 621PA 2IEGA 5JS1A 1GVNB 1UEIA 1Z2EA 2Q3HA 1NE7A 1KVSA 3AP1A 4ZAZA 1IZ8A 4G1UC 5GTDA 1FSSA 2HEIA 1DJPA 2QN9A 1R37A 3L6DA 4OYRA 1PZEA 4G9EA 1LZLA 2GBFA 2VL7A 3EOBI 3R8XA 1JI3A 4G26A 5LQMA 4KREA 3MCUA 4QVGA 4J76A 3WYBA 3GEEA 4DNXA 3PQ6A 2VJDA 4RY9A 3NTUA 5C80A 5HGXA 1KL7A 4DS3A 1Z0UA 1K8YB 4DIUA 3JPYA 1I3CA 1LPMA 2XGGA 3WHIA 2POQX 4BB9A 1FRNA 2AMYA 1Q17A 2AF3C 1ZAKA 2IE0A 2FSFA 3VR4H 2O4UX 3K4HA 4KE9A 1BQEA 2GF9A 3JQ7A 4W5RA 4C6RA 2I3AA 1ZHFA 1L8AA 1XSEA 4NECA 1L7AA 2R1TA 1XI2A 2WF5A 2DPLA 3H2YA 4L0QA 4MWGA 3D59A 2X0NA 5F4ZA 2IWHA 2QAJA 1B6TA 2FZLA 4PCLA 2IDZA 3AR8A 4JJKA 4B4VA 4B9EA 5A7HA 2G9UA 5LFAA 4XD2A 2R6R1 3RC7A 3VJKA 4I99A 1GU7A 4GPD1 2Q5CA 1YBVA 3DH0A 2CXSA 3E03A 3KRTA 4MW2A 1R27A 4TWRA 1CUYA 2WM8A 3ET4A 2JATA 3RIXA 5BV8A 1DRUA 4UDOA 4G07A 3ADBA 4KFTA 5TB5A 1O1YA 3A27A 2E4VA 4M89A 4OYHA 1I3KA 2XNSA 5KHLB 3EWNA 4EVSA 2G9NA 5CA1B 3LUGA 5CEJA 4XGIA 1NZDA 3ROEA 1V8OA 3HRHA 2H1FA 5DCYA 4KC0A 3CNQS 4MIYA 2HU7A 4QLOA 2DGDA 4F2GA 1AKRA 1OWOA 3DMGA 3NYRA 1M6EX 3MTDA 4CN9A 3THWA 3G5TA 5C3UA 2D00A 1U0TA 4B1FA 4X85A 5BVGB 2VAPA 3KQOA 4OHBA 1AM4D 3REGA 1NJ6A 1K66A 3WNQA 2W8ZA 3UMSA 1E61A 2IUFA 3BMXA 1HNXB 2XRYA 3BWXA 1XN1A 4OOFA 1R0XA 2DC1A 1TUEA 4OD0A 4Y9RA 3LLCA 5HR5A 4DUPA 4ZK6A 4KGXA 4PW0A 1Y8RB 3T7KA 2ISSD 5HBRA 3VV2A 3BFXA 2I4TA 4Y0NA 3JY6A 3U3KA 2A33A 1WDTA 2W6ZA 2XOKA 4GAEA 1WRBA 2BISA 1XUOA 3GYBA 3Q5DA 3V6LA 4B2LA 2REQA 4WZZA 3AT1A 2YQ5A 2EX0A 2VJCA 3BK2A 4C03A 5JALA 2I2DA 1YZQA 2C7BA 2NU9A 2WK1A 3IAEA 3MJRA 3ONEA 2J3LA 3R6LA 4UC0A 3U37A 3CVWA 1ZI9A 1ULUA 3REQA 4AKEA 1U4NA 3OC6A 4A26A 1U63A 3D8RA 3DNFA 4DCVA 2XCUA 5G40A 2PLNA 5AVRA 3R24A 2QUZA 4M9CA 4HY3A 3O0TA 1FVHA 4IF6A 4JROA 3WMWA 5KQPA 2BRUC 4WLOA 4BFLA 4C22A 4IG9A 4CKYA 1E79D 4WK2B 5ICEA 1Z06A 2C03A 1EBFA 3SN6A 2WHPB 1M54A 4EUEA 4MQEA 1M5RA 2NT3A 4IGKA 4MROA 4PZZA 1EUDB 4C7XA 1Z34A 1NIJA 1RLTA 3OOHA 3I9MA 3UHOA 3KQKA 3CLHA 3O1LA 4X1KB 4HNTA 1LX7A 3HCFA 2C82A 2PT7A 3GT0A 3UBTA 1VECA 3H2GA 4XJXA 4G8DA 3VC7A 2NXEA 1BD3A 1SK8A 3H5RA 2JGDB 2DFVA 1M2NA 5F1OA 1GCAA 4F2WA 2V6BA 4UXJA 4DIMA 3ZDAA 3CF2A 1G2OA 5EZYB 1D2MA 4RVOA 4LXHA 3GLSA 4FMDF 1IBCA 4D82A 4HDKA 3UWPA 1MCZA 1UH5A 3WO1A 3RRXA 5TMDA 5TVKA 2W93A 1BJRE 4W8GA 4AF8A 1Y3DE 1BDMA 1WUHS 2QD2A 2IYWA 3BXFA 1XQVA 4MR8B 4UOEA 2O8CB 2GA9A 4EX7A 4CM6A 4Z7OB 1QK5A 1YACA 1W8DA 2O8BA 3ZDFA 4TVBA 2F1KA 4JLPA 3BEOA 5FWAA 5HS6A 5LZ9A 1EUZA 2XTZA 5CDFA 1LKZA 3MUNA 1PR9A 3UUWA 4CU5A 4WADA 2I4RA 1W2WB 5ED4A 4KK3A 1JAXA 3KD2A 1XLTC 4N9WA 1TCCA 4AZ0A 2VKTA 3UENA 1MU0A 3DEIA 3IPRA 4RKEA 5ALOA 4EYGA 4BFYA 5LR6A 3EAQA 4GFDA 1U4SA 2P69A 3ZYZA 4EHDA 3EXEB 3CWQA 4KFCA 1M8KA 1XMSA 5KYWA 4GR4A 2VVTA 3ZHCA 1P77A 2QT0A 4RPIA 3EUWA 2ZBDA 4FQ7A 1R4MA 2BHSA 1FFSA 2UKDA 2YMMA 3F4KA 2PN1A 1JFFB 1TGYA 3ZWMA 1DKPA 3JS5A 4WA7A 4HLDA 5CH8A 4FYVA 4PLPA 3SC2A 4Z54A 2CVPA 4BVLA 1ZSVA 1FA9A 1ABEA 3UT0A 4TUYB 1BHQ1 2FR0A 1EG7A 1CUJA 4MJXA 1H0HA 1DX4A 2YTZA 4V3BA 1Y89A 2B4KA 1SKBA 4R6WA 3OESA 3P27A 3DHYA 5G3YA 3DD5A 1A5BB 3TW8A 3GMTA 2NZUG 5L7TA 2DSTA 1ZSNA 3LCRA 2Y6UA 2ZM6B 4RYLA 2QZ9A 4QNMA 2OV1A 4V2UA 1DO0A 3WS7A 3N8IA 1N2CB 3D81A 4ESHA 3T7TA 4FHZA 4BJ3A 2YHBA 5M2QA 1T6YA 4Z4HA 5U9CA 1GFSA 3H9BA 2J85A 1BKYA 1YR2A 3M5PA 3ZHBA 5JS8A 4M9UA 4GKKB 4LRWA 5KVQA 1C4XA 1C2TA 1KJYA 1Y8QB 1J22A 1M34B 2AXEA 1NMZA 3BSYA 1MTOA 1EX6A 2FZEA 1AQLA 3GUVA 3NIFB 3TTSA 3MTAA 3BWYA 3SFTA 1QPZA 3A4VA 3CO0S 3H4TA 2JASA 5I9BA 4IVNA 4L0CA 2X9QA 3KJFA 4REQA 5J4KA 3QEAZ 4XB6B 3RR2A 1VJ5A 4YCCA 3KAJA 2QB5A 1R15A 2WDZA 4JX9A 3FLBA 4EITA 1FX0B 3F3YA 2VHEA 3GRKA 3TINA 4P6VF 1V8ZA 1P45A 3EFEA 4XUDA 1M2GA 3FMPB 4MB0A 4DRXA 2G71A 1ZS9A 2OVBA 1BS9A 1K5GA 1XZHA 4HI0E 4X1YA 4XAQA 4INPA 2J46A 4DDHA 5A03A 4KH1A 4R8LA 1QYIA 2AE1A 3LUBA 3F8TA 4A5SA 2OV3A 2A1TS 4Y1RA 3AP2A 3UO8B 2P4EA 3BIOA 1SBQA 4QOFA 1G42A 3RVDA 1E9VA 1K88A 5CFRA 3KUUA 2O1EA 4KMRA 1P19A 4LGCA 4P3XA 4JOBA 3U81A 3PNKA 3E58A 4WECA 3V5NA 1Y9ZA 1LGYA 3RNLA 3LQ2A 4E08A 4B4KA 3W5CA 3FYUA 2FMXA 2O14A 3Q7RA 3R6DA 4MVXA 1NC3A 4HNHA 2WICA 2J30A 3PUIA 2V03A 4PG4A 2XYHA 1PEYA 4BMSA 2C4WA 3KL4A 4IJMA 2F90A 5P8WA 1QXSA 3B3FA 1N6PA 4Y9UA 4HH3C 5H5JA 3UPTA 3HWRA 4RO0A 5K4GA 4FFWA 4TTVA 2VHXA 1PVVA 1ODIA 3WLAA 2FPRA 4M1EA 3LC1O 3STVA 3K70B 5D2CA 3GEIA 3NHBA 4LISA 5FADA 1FS4A 2PKQP 5E9WA 3VDXA 3R5HA 5A5FA 1YRQA 2PGAA 1Q1AA 2IP1A 4P82A 4MHOA 1AGRA 5KYGA 1HYEA 2ZTLA 5TPZD 2CMKA 2YUTA 2WFLA 2XVZA 4QYXA 1A4IA 1WF3A 1T3TA 2YOHA 3L7IA 4IQ8A 1QQ5A 4KODA 5J59A 3RVQA 5FT9A 3GRZA 1PZNA 3BE8A 4P4SB 2VBFA 1T3GA 3F6RA 2JFPA 4YJHA 2YWGA 3HA2A 3ZV3A 2BDUA 3U3DA 4DV3B 3BXEA 4MKHA 4UBNA 1WCIA 3RFXA 1COWA 3GAAA 5CYOA 1AN9A 2P4QA 1ESDA 2WV7A 1LVHA 5BNIA 1DKUA 3W5UA 2LW7A 2PU5A 4A82A 2JCVA 5IANA 2JHGA 2ZSBA 4M0EA 4D5GA 4JQOA 2ROQA 2TRSB 1BTOA 2AEJA 1MGOA 4LDRA 4KXFB 1TIBA 1H2AS 3T94A 3B53X 1EFPB 1OR8A 3VHQA 3OFND 5A71A 3V48A 5D5PA 5KWEA 1U7DA 4NYJR 1NUUA 3HE3A 2OBXA 4HDRB 2LTAA 4HN2A 3T0FA 2SNIE 3GROA 4Z2AA 3SD7A 4EHKA 2CV1A 2JJ8A 2C9DA 3W79A 1NATA 4QOHA 5D1HA 5BYKA 4DRZA 2CNWA 1DT5A 3FB1A 5F21A 2ZIGA 3NHAA 3H83A 3V9PA 4ZKEA 4DLYA 3D7SA 2IOHA 2W6OA 3U7HB 3MB8A 4WDQA 4HNSA 2W37A 1DTSA 4MZXA 4CIWA 2OYSA 2WC1A 3ZLJA 2CL0X 1VIAA 4L8WB 4D9NA 1MQ9A 4GEGA 4NBKA 4OSEA 2CUZA 4UDYX 3STXA 1S7CA 3R3WA 1PKXA 3PLAE 2ZRKA 4DG9A 3SHQA 2GPBA 2QTAA 3E05A 4UU7A 4UTXA 2HCFA 3BRWD 3ENVA 1GRRA 4FFNA 2G07A 3D8BA 3ANMA 5D7NA 4BO7A 4OHFA 3K15A 4ZI7A 1ZRSA 2F4NA 2P68A 3EQ7A 3IKLA 4MGKR 5DGTA 4IMPA 5J40A 2ZWVA 4JODA 4TL9A 3PBKA 1H0KA 3BS4A 2ZSHA 1XPJA 3E9EA 3PIIA 5D84A 4E33A 5KO2A 1NQOA 3M89A 1V8BA 2JGKA 3I2FA 5ELMA 1IXYA 1KP9A 3EAGA 3OU6A 1XTTA 3D6HA 1LTHR 2WMDA 3HP7A 2ZAYA 3ISTA 1T34A 3NNSA 4FR2A 3RVJA 3TNDA 4OMCA 1Z4QA 5ALPA 3RQSA 2XD4A 2PSDA 3STWA 3BH6A 5EWMB 2H2WA 1DQYA 5EJ7A 3RVSA 1JWLA 4JI0B 5JI3E 3COSA 3IT0A 4LBVA 4ZDIA 3Q85A 2RHOA 3C3YA 1MP0A 4LI3X 3NJRA 5DZSA 5JS6A 3BF7A 2Q3BA 2B98A 2VK2A 4XPZA 4TTJA 2C98A 1JG6A 2NU9B 4MS1B 5IG2A 5A5EA 4DMMA 4BXOA 1S8FA 3T5GA 1NT4A 5TMEA 3PNPA 4TYPA 4F1JA 5C4IA 4Z9YA 4MI9A 3R7AA 2QMUA 3AQIA 5DF1A 5IDYA 1XNJA 3KR2A 5EA2A 1GTSA 1O0SA 1S4QA 2R7MA 4Y18A 1QHXA 4JWTA 4I1SA 4IDPA 3DFIA 2E82A 2OP0A 3DBLB 2I4OA 1Y3CE 3GFGA 3I4CA 3NBXX 1KOLA 2IS2A 4ZV7A 2ADOA 4A23A 2C84A 3OQ6A 1IPEA 4O8ZA 5P21A 3ER8A 3NVAA 2C94A 1I94B 1QRDA 3Q0IA 1GN9A 1OTXA 1X8JA 3GDFA 1HYQA 1U7XA 1PT8A 2GT1A 2DRIA 4J49A 3K0HA 3F7NA 4I19A 5IBPA 3NBYC 1E9FA 1A97A 2HNBA 2YXNA 5F2OA 4Z8XA 3ZI7A 3E9QA 3VNSA 4ZAWA 1T9BA 4ZCPA 5EESA 5FTLA 1GQOA 3HM9A 2E5FA 3OZAA 3LNTA 3CQ9A 1PT9A 4MEAA 3T3MB 3JQBC 4LVUA 1XTKA 4QDUA 3IALA 2CT8A 4GS5A 3NW9A 3EXIB 3V3KA 2HWXA 2ZUUA 3WJ1A 4ZYVA 2ECKA 2JLQA 1J9EA 3FNBA 4Q3NA 4AG5A 2UUOA 1GD1O 5C1OA 1ACMA 1LX6A 3T34A 1IHUA 2W98A 2QN8A 4MAFA 4NZMA 5JDIA 1ZAYA 1S1MA 2R00A 4R98A 3QF4A 4HAOA 4C6SA 4D6YA 1T10A 3EF0A 4GGPA 1V9LA 1ATZA 2VH5R 3BDAA 1W47A 3OEYA 3V55A 3LTNC 2B8NA 1Y5MA 1Y1QA 4E32A 1FXWF 3P9NA 5JH7B 2REXB 3OE7A 1PJRA 2PQ6A 4GYJA 1DFHA 3ND6A 3A0RB 4MQBA 5E4YA 5REQB 4I8IA 3VSAA 3OOWA 4NFLA 3MVEA 4QE3A 3ZW7A 2XBUA 4D9GA 3THXB 1YFKA 1ULBA 3F9CA 1V41E 3G7SA 3X2EA 1PHPA 1U1EA 3P0JA 5F78A 3KQWA 4M0PA 1A9PA 1XL0A 2X5OA 2XMSA 2QF7A 1LLFA 4G5SA 1CP2A 4EIWA 1C9EA 1NOKA 1ST3A 8MHTA 3OF5A 5ECDA 1QFZA 3AUJB 3OTQA 1UJCA 5AOBA 1X15A 1ZZGA 1I7NA 2P4HX 3NPAA 3OQMA 3WIUA 2FFAA 2FH5B 4BCBA 1C4WA 5JFGA 2ODQA 4PO3X 4K7JA 5T8KC 3TTXA 4OF4A 4JAVC 5FTJA 3ICEA 3D1VA 3W2HA 1A5ZA 1DKRA 2IITA 3HI6A 2AQHA 3QFTA 4IINA 3S2UA 2FOXA 2ZQ5A 4L3WA 1JXMA 4S1PA 5ER6A 3HSSA 4YWHA 5DM0A 4M99A 2UZ1B 3W2IA 1G9XA 1GTL1 4WFJA 4JXZA 1IOWA 3EVCA 4Z1OA 3INGA 2PLAA 1Y6GA 5ESRA 2YHAA 1QGAA 3A36A 4LHWA 3FWYA 4CWAA 1Y0BA 1XXHB 1LDNA 4UZEA 3VKUA 2BBOA 5A3JA 4YJDA 3SX2A 1OLOA 1YKGA 3FMGA 1TYZA 1XE3A 3CINA 3FPCA 2CCJA 3A1DA 3L0OA 3QHQA 3OECA 4RHCA 5BQPA 3IGFA 5HM8A 2GO7A 2IOYA 3U4IA 1WETA 5L3SB 4LE2A 4RVSA 3NMUF 3ONDA 3E1SA 3MWFA 2Q5FA 3BD9A 2B83A 4RY0A 2GAFA 1CS0A 1CUAA 5CJ2A 2HUNA 1U1DA 1XJ5A 3LVRE 4NX2A 3D5QA 4ZFNA 5I9IA 2NQ2C 1LY1A 3H4MA 1XMQB 2P2DA 1GLGA 1S2OA 1LDMA 2IYUA 2L42A 3FPAA 4AWBA 5K8VA 3RTAA 1EFVB 2BMJA 2ZJ7A 1OQAA 4J90A 3F96A 3D8SA 4CG2A 3M4NA 4JP1A 3IUNA 1JSLA 1JYFA 2FFJA 2UDPA 2NZ2A 4K6KA 1J2YA 4M0CA 1HEUA 1JEQA 1K6XA 2KWIA 3H5LA 1T9CA 2QT9A 1U90A 4NR0A 1GPKA 1JTVA 1A7JA 1X7WB 1Q0LA 3MWDB 3TAXA 3WK4A 1JR2A 3L82B 4JUDX 4IG4A 2IA5A 4Z8YA 1M0SA 1NRXA 4ZQIA 4G5GA 1O5IA 2QI9C 3P5SA 3ZD8A 4PG8A 1IU9A 1J2JA 3QFRA 1KZHA 4HQ6A 5BWCA 2UUCB 1ZMTA 4Q1CA 2LCFA 2QM0A 3DWFA 4TV9B 2CXPA 3PE3A 3O90A 3GCZA 5JAOA 3Q3JB 2Q8PA 3G82C 1J8VA 3JQAA 1TO2E 4YRCA 4NE7A 3ROKA 5JAIA 1TVMA 1G7RA 1DEOA 1KNXA 4I81A 3KZNA 1TMKA 4XQCA 1B2LA 2HSJA 4WESA 1O6CA 2JIZA 4HGPA 3WK9A 4YRZA 1DBVO 2G1JA 1GN8A 1ORIA 1XZBA 1A4XA 3B60A 3OX4A 3T0IA 4B3MB 3O94A 4M83A 3GCXA 4FLMA 3RDPA 3QUTA 1KAQA 2XBLA 4N49A 4RK5A 2I4LA 3JQBA 1OF1A 3JRXA 4LZAA 1R9JA 2P1ZA 3FCEA 1DARA 2G08A 1K7SN 2I1VB 5D5HA 2XV1A 2OPHA 4YS6A 2BF4A 3GNTA 1UXJA 2Q50A 3NFRA 3THOA 4DADA 2QI9F 2YMLA 3OT5A 4K9SA 3LC0A 2X7JA 3GVIA 4KX5A 3TB4A 1JNXX 1EA5A 1U2SA 4BP1A 1TEZA 3TAUA 2D5CA 2PUDA 2FUNB 2YN0A 5C1IA 1T91A 2MR6A 3KDPA 3U7QB 4E46A 2P6UA 3GJZA 1TM7E 1WR8A 3C48A 4G37A 1Y42X 4YK7A 1KVUA 1UF9A 4WINA 3WMGA 4C76A 2OCKA 1ADBA 1T4BA 2EAUA 3LYAA 3P52A 3Q41A 3HCWA 4HRYA 3S5JA 3SSNA 1PRYA 5EERA 2BBTA 1ZNWA 2HBZA 3HB1A 3S2ZA 4RTOA 2GK7A 3WDSA 1FP4B 1C0EA 2A7QA 2DFTA 3CXUA 4P9NA 4K6OA 4HH1A 2NUPA 1UZMA 4TL7A 1JEDA 4Y2PA 4MARA 4W82A 4URWR 5IARA 4ZZ1A 5HKKA 1E9AA 3GR6A 1BD4A 4IPTA 3LO5A 3PIRA 1TTTA 1JYEA 1QFXA 1M7BA 1U0JA 2BWJA 4MR9A 1NONA 1T0JB 4P5PA 5AKHA 4GPTA 3SAJA 4EO4A 4IXDA 2NW6A 2PT9A 4ZRMA 4RKQA 1JSRA 1QHHA 3SHOA 1P2UA 1P6UA 2FW8A 4RZIA 4WLVA 1JPNA 4UAUA 5FPQA 5IUNC 1XZCA 3AB3A 4P4NA 1WXDA 4TWZA 3V4ZA 3WYCA 4TSRA 5DCLA 1HK7A 1GV0A 5LU9A 3CLUC 4I0WB 5JSYA 4TTAA 2WTXA 1RAIA 1B8OA 1DC6A 1B6RA 2YL2A 4IBOA 2V6IA 1XD9A 5GV8A 5JSUA 3VA7A 2HI0A 1BGWA 3UAOA 2FMHA 4ZHSA 4ZCQA 4B46A 2WR8A 1JZQA 3EISA 3QXCA 2C97A 1NHWA 2J9FA 1Z4OA 2ASEA 3KV3O 3WIDA 3OFVA 2JLYA 5DBEX 3GU3A 1T1EA 1WXEA 3BXOA 3HVHA 4JJ6A 3AETB 4CQLB 3AW9A 3PTZA 2OZLB 1KO7A 1KY5A 2XTJA 3R9XB 1IY8A 2QQFA 1IB6A 1QB8A 3UK6A 2EFYA 4YMVA 4EL5A 4RADA 1GNPA 2H5EA 2JARA 4IF4A 4HK4A 4CQLA 4MGZR 4R9RA 1IWBB 1X13A 1EX9A 1WNFA 4DR2B 4BBAA 2JVIA 4GP7A 3C5WP 5IAOA 3U39A 3UTCA 4X24A 3C3MA 5TGTA 3WSWA 3WLPA 1BIFA 1WVMA 3PUXA 1Y4AE 3TLGA 4R9UC 3KALA 2XB2A 3F49S 4ZDWA 1S3SA 1T2EA 4I2VA 1ZY2A 2OQ2A 3ESCA 5F2NA 5GM2A 3V8BA 5CGZA 1HY3A 1PR1A 3WG9A 2OZKA 1BXRB 1UK9A 5ITZB 1BX1A 1WCIB 5DRTA 2G1UA 1OWMA 1SQ5A 4JC4A 3GFFA 4GP6A 4Z4QA 4RH0A 4LFBB 3CISA 3W5AA 3JQAB 4B09A 1R3DA 3IQWA 3MBIA 2P2LA 3OQIB 3QMVA 3HY4A 2KB0A 4RL4A 4UVHA 5FULA 4QZVA 4TROA 3INRA 1QAOA 3I3OA 4OY3A 3QMWA 1A4RA 4P0PB 3IAHA 3TE6A 2O52A 4BWGA 5D5QA 3D6NB 2QZZA 3L7DA 4LJ4A 4A8JB 2K7FA 2FLVA 2F8TA 1CR1A 3W5VA 1AN0A 4DXDA 1DTEA 1GUDA 3RT7A 3ZY4A 5FIUA 4PGHA 3M3PA 1V26A 5DCWA 4XVUA 1XNHA 3A25A 4V0RA 1IZZA 3AONB 5EWLB 4BBPA 4X90A 3I2IA 3RABA 5TLSA 2CHUA 1YGYA 2I6QA 3MJSA 3WY9A 1JBEA 4FILA 5DT2A 1MTZA 1XNGA 1RPAA 2C9YA 2GPSA 1T4DA 3JZDA 2V0GA 1WXFA 5FWYB 1GV1A 3L1HA 4J03A 4Q1EA 3VI4B 2FSIA 3NOOA 4QX6A 2Q1XA 3TSOA 2ZIEA 3CJRA 4LMAA 4R81A 2I29A 1ISHA 4RK6A 3MUOA 3QVGB 1YZYA 5K0FA 2UZAA 4I1IA 2VZ9A 3Q98A 2NXWA 3DCYA 3E2MA 3E9MA 4PYNA 2ZUTA 2J59A 2A5GA 3ESRA 3ZDYB 1NBWB 1L4GA 4Z7NB 4YRBA 1RYMA 3DCNA 2Y4NA 3IVCA 2WEKA 1N3BA 3IMGA 4BMDA 2H0QA 1EM6A 3VDRA 4HGOA 5H3CA 1AMUA 1U0SY 2PSJA 1EB9A 2Q9CA 3R7WA 2V6FA 2GCIA 1YZVA 3LVFO 2GTPA 5CNIA 3RTEA 1ONBA 2ATIA 4OK3A 3DYVA 2ADMA 1WOMA 3NCHA 3JAMA 3N05A 3U4QB 1JTEA 2YFQA 4E5YA 2AZXA 1RFGE 4DT1B 4Q9LA 1H1LA 3MMXA 2JJ1D 1NUTA 3MSCA 4PSAA 3R9WA 1ISFA 4QYIA 2CDRA 1W5BA 5D3KA 5LQNA 4DF3A 1ENPA 1D0IA 3H86A 1DBPA 4YPFA 2XEDA 4P86A 1LLDA 4MYSA 4M0MA 2V7GA 3FG9A 3WKEA 4BMOB 1UBLS 1G8SA 1IOLA 4BWFB 2EV9A 4URFA 3CH7A 5TGZA 1TCAA 5A9SA 1QH8A 4KLNA 1G6KA 1L5QA 1VXRA 2EHDA 2J4CA 3AL0C 1MO4A 4MR7A 5EIFA 3VR6A 2H9AA 3TPCA 5B53A 1W36D 1Y8QA 2H2IA 3F67A 3AVWA 4Q47A 1VLHA 3HCEA 5KOHB 4R6XA 1HV8A 2C4VA 4Q3OA 4BIMA 3I64A 4EF5A 3O1IC 1TKCA 2Q45A 1ZQ9A 4TPKA 1Q74A 1NN0A 3U3RA 3MUFA 2M32A 3LCUA 4ALIA 3AV0B 3NC4A 3MCVA 4I08A 2XZOA 5DHQA 4NULA 1X70A 5AUPB 6ABPA 4MGHA 4B43A 3VDMA 3R3SA 1Y8AA 4KN5A 4PC7A 4YQFA 4A6PA 1XZNA 4I9GA 3TR5A 4RSMA 1Z07A 3HHPA 4J0FA 4MQMA 4RM3A 3IKJA 3TW4A 2P0AA 3KQMA 3DOOA 4OBXA 4N0EA 1DO2A 3DKRA 2G1PA 3BD7A 1TJ4A 2W2PA 3A1VA 4PYIA 4X5OA 4CMEC 4QQFA 1YL7A 3DBHA 1FPQA 1E4OA 1V4VA 4Q7QA 3BGSA 3Q7IA 2A9FA 2PRKA 5TNXA 5FL7A 1RIIA 2GUGA 2GM9A 2PDAA 3HCBA 3KZCA 1L6IA 4CG1A 2HBRA 1TYAE 4KG7A 4YMIA 4ZO8A 2ZIVB 1GRCA 3RK4A 1M33A 4H2DA 2VDMB 5ALFA 4BNIA 2UXCB 1A77A 1GZDA 2OBLA 3DMDA 4FDVA 1GTG1 1B8VA 4LOHA 1IK6A 1S3IA 2IIPA 3RM3A 5K8JB 1VFNA 3LP8A 2W83A 3WMFA 3EQZA 4QG7A 3T6KA 1T6BY 3RCBA 2ZITA 4QO7A 3O75A 2CYCA 3LF1A 2QEQA 3PC4A 4OKNA 1DB3A 2RHGB 3DG9A 1EX7A 4DC1A 2WB4A 3KQYA 2QL6A 1LLQA 1G55A 1SZJG 2P62A 3LK6A 2AG1A 3C1TA 5G0VA 4D9MA 4EKNB 1CLEA 3E8SA 3AWDA 5JQWA 1F5NA 2WU3A 5AH0A 1U2TA 2ATEA 2M6SA 2FPWA 2GEDA 4EPYA 3GLIB 1OFIA 3ZNQA 2WJVA 4RW0A 1OGJA 2QXUA 3CFYA 2F6RA 1H5UA 1SVOA 3TL2A 3O4FA 3INYA 3P9ZA 5KC9A 2FQXA 4ERNA 4IDCA 2RH4A 1C4OA 1CY6A 2LDBA 2Y4OA 4IGFA 4UARA 3ZV5A 2PA3A 4QFCA 5CFQA 2PKRA 2QVXX 1T9DA 2V3WA 1NAIA 2VLIA 2E5WA 3PXAA 3L1IA 4DMCA 3RRFA 3AFGA 5D8DA 5HYVA 1QIHA 4CM8A 2WE8A 1U7OA 4FT4A 4EMTA 2DY0A 1HDGO 2O7VA 4PZAA 3ZGNA 4OLHA 1YRAA 1GTRA 2P9TA 1NKSA 3EIWA 2GMWA 2C1EA 2PH1A 1U28A 1UMDA 3FOFC 4UUMA 4PLGA 4GOOD 1V7CA 4L76A 4AN0A 1SOAA 5TMPA 2ZZKA 1QNFA 1Y4ZA 3AEUA 4E21A 3PSHA 4NYIQ 5LXTB 2XUKA 5K0SA 1EUYA 2PSHA 3AGQA 1J90A 1XXHE 3D3EA 5FLEX 4JWKA 3RE1A 3T4XA 5JPDA 1NXVA 5H9WA 1QP7A 1HLPA 3BA6A 4YAUA 3Q6NA 5TSDA 4CM5A 3H65A 3DEAA 3TTUA 3X43A 3L0PA 3TNLA 2QUBA 3ZE9A 1UAYA 5LJLA 4KQ1A 2VPPA 1HFEL 4FCWA 5EKDA 1X1TA 1ZONA 4LXXA 4NRDA 4K5QA 3ZXUB 1AV7A 1TFUA 2PD4A 5FUVA 4FKBA 1TRKA 5ARCA 5TXGA 4M9SA 2UZ3A 1T8RA 3PEVA 4ARUA 2FG5A 5L3RA 1UFRA 1VPVA 1CF2O 3TI9A 4FDLA 1N1DA 1SC4A 2QHXA 5BQOA 3ADPA 3I6IA 2CDNA 1G1AA 1T8PA 2GEJA 4FYIA 4KQ6A 5BSVA 1QRUA 4TT8A 4UD2A 5D3MA 2FZGA 1MAVA 5AVWA 1KZYC 3HJNA 2PUAA 4GBGA 3ZWBA 3HXOA 2PRZA 5FUXA 4HZUB 3ZGYA 4P84A 2XMRA 3I6YA 3TUJC 2RHWA 4FTWA 4FZVA 4DUYB 1IQUA 1I4DD 3MZ0A 2IS4A 3PPIA 2NO0A 3GJSA 3QVKA 1E64A 1DBSA 1VHDA 4FE3A 3R74A 2WU8A 3G02A 4KO4S 1PJAA 1WWKA 1VCHA 2AC4A 3AG6A 3O4IA 4GLOA 4G4SP 4G8CA 2IBSA 4HN9A 3DDZX 2BHNA 4RPLA 4AJKA 4OL0A 2CJFA 1F8GA 1GY8A 1TZJA 2OHGA 2PZJA 4GLFA 4II7A 3TWOA 4BV8A 2PL5A 4OQPA 4MP6A 1H42A 1THGA 5CM9C 5EIBC 3HACA 1OXVA 2FK7A 4A9AA 2NN3C 4G8BA 4QHTA 1SUIA 2X3FA 1TUIA 4F1WA 5CA1F 3RSQA 2M6KA 2CCGA 4UHJA 2ZRBA 3KV1A 1H9BA 3RYHB 3TVTA 4NBTA 4UD6A 5L4LA 1TOAA 3SI7A 3FTQA 1WS6A 3QTTA 2BGNA 3VV3A 1SBZA 3AF5A 1L8OA 1PS9A 3I32A 4ROTA 2QVLA 2IYPA 3SQMA 2HIMA 4M7WA 2XLCA 3QK7A 3SJUA 1FDRA 3VR4D 3NWOA 1MRZA 2ZSIA 5HFAA 4BVAA 2CDBA 3PDIA 1NBIA 4LZJA 4HL6A 4K03A 2QVBA 4ZYUA 3VJRA 4ZMRA 4BUJA 3KSBC 1TVKA 4EO9A 1YL5A 4IVPA 5E7QA 4CF5A 2W2MA 2A7XA 2VAMA 3I2HA 3K9NA 4E5NA 3CJTA 2C1ZA 4ABTA 1E3WB 1E2HA 4LBZA 2A86A 2WG1A 3CNBA 2V1XA 5G1OA 3L1UA 4GLJA 1JH8A 2BTEA 3UJBA 4HGNA 1GUYA 1QHEA 1W46A 3NV9A 5HQ3B 5EJ6A 1LTKA 3ZHSA 4R1SA 1H23A 5LA6F 3A06A 2HRDA 1NBMA 1Z6XA 1G291 4OHUA 4J7UA 3IJRA 1RXIA 1OB2A 3MTIA 1VLQA 3KPUA 3L6RA 2G82A 1YU9A 2CLDX 3OEEA 4EFDA 4R1LA 3KXLA 1P4AA 1XNQB 1XRJA 4EJSC 4ZJYA 4HLUA 2JIRA 2JHAA 1MB0A 5G4KB 1D03A 5CT9A 3RV4A 3PCRB 1EFCA 2O1WA 3OUUA 4LV6A 4J29A 1DAFA 4AFNA 1E5LA 2HU8A 1IY0A 1JIVA 1PGOA 4Y2JA 4IJ5A 2CXQA 1DJQA 4H6PA 4KDFA 3VHRA 4C2BA 2OOSA 4E5PA 4ZCRA 1HTBA 1W0CA 2CK3A 4G81A 3BH7A 2I91A 3VR6H 4IGAA 3IEVA 2Q28A 3OZVA 5EMNA 4TXJA 4BGIA 2ZVPX 3P1JA 4BN5A 4L9RA 1RJDA 1PDVA 1U2DA 1PT6A 3RVMA 1N3IA 1H2BA 1OI7A 4YALA 4BE9A 2QLMA 3K0KA 4RMGA 4J94A 4RK0A 4FE7A 4BDTA 1ULZA 4HYQA 2YQ4A 3I9OA 3CWCA 1Z35A 2QRJA 3NATA 4LWOA 1QKKA 3EMVA 4FDTA 4IH1A 1YT5A 5ALSA 4HUJA 3T5TA 2Y0EA 3FCAA 4O0MA 4EAAA 5TE9A 2D74A 3O8OA 4I9FA 5HK8A 5K45A 1J5XA 1H6DA 4GH5A 3V7NA 2ZUEA 3HCOA 2WT9A 3QE4A 3K6SA 3RHZA 2XW6A 4U2GA 4BQQA 3D6TB 3KK0A 2E6KA 3W34A 3ZGZA 3TTVA 3ZIDA 3OJEA 2GPWA 5COQA 4QPPA 4BU1A 4MV6A 2E21A 1WEKA 4POAA 4NOMA 4PR0A 2WZCA 1GSIA 1Z0JA 3SXUB 5HG0A 3CR3C 2O5EA 1XCPA 1VLVA 2UVPB 3M1YA 2PQ2A 1XKXA 3P2YA 4Q3KA 1KMNA 4IGEA 3OY7A 4H31A 4Q7JB 2NAFA 3QLTA 1GIAA 5C5IA 1Y34E 1FDTA 3N86A 5E6UA 5KSPA 1SY7A 1SUEA 2HF2A 2WM9B 3DWGA 3G9QA 3G2IA 1Z7WA 4IJQA 3R0XA 4JBIA 3RJ9A 2YWRA 1L4KA 1ZC4A 2PGLA 2V0NA 3DDSA 3L43A 2R2GA 1ETUA 5DHTA 4BFUA 4BX2A 1T35A 1ZCZA 4RD4A 5ENDA 3SYLA 1B8PA 4JP3A 1W4LA 1Y9EA 3A1TA 3O8QA 3E5MA 1E3JA 2IYZA 4FCTA 4Q66C 5F2EA 4FN5A 2DF8A 1TXGA 3OWOA 5EMKA 4R0NA 1PR3A 2UXBB 2JKZA 1U2RA 3GGCA 3L07A 3QPUA 4EB3A 4EG5A 1O57A 2HWUA 4L9WA 4DQUA 3VVMA 5ITSA 3O4RA 1G3MA 4IQ0A 4YAJA 3WL8A 4AMUA 1W0KA 5BP7A 5EJMA 2DERA 3D31A 1KSHA 1UJ6A 5IWAB 1RBYA 4D80A 4ZT2A 4B6PA 1X74A 1WXXA 3PNMA 4RPCA 4C7MA 7MHTA 3D3WA 3ZJUA 3ESDA 4GKVA 5FR1A 4IHAA 2VRCA 1LK0A 5HIIA 1P3DA 3Q6IA 3H2SA 1C9JA 4CHTA 1Y37A 2ZGVA 3EODA 4JYCA 4L08A 4C4XA 1ID8A 2G7ZA 4ZZ2A 3OICA 4GXQA 4KV9A 3C98A 3L8GA 3FTEA 3QPDA 4YJ2A 1SXJE 4OXNA 1JHXA 4FXOA 4ZJPA 1SMKA 2HK8A 5DH9A 4HAWA 2NSJA 3JWIA 4J3JA 1E1QD 2OP1A 3OUTA 2P35A 3E6AA 4WV3A 3SR0A 2P40A 4P3NA 5M34A 1Y7LA 2F43A 1NU6A 4X00A 4BRSA 5LLDA 1O96B 4JQZA 1GG2A 1P3JA 1RTTA 3CTPA 4U6NA 3HK2A 5BWMA 2AIRA 3U17A 2OFOA 3RADC 1H6AA 4FR5A 3D1LA 3JWHA 1F14A 3PC2A 1GG5A 5CXSA 4HVTA 2WFMA 2BCEA 1BWSA 2DPHA 4HAYA 4K6GA 4EATA 4W5OA 2Z08A 2QQGA 1CRQA 4JQCA 4RF4A 4AZTA 3OA0A 2NZVG 3BSWA 4AF6A 1KYQA 1JJFA 2G0TA 2HPZA 3F46A 1DAIA 3JD2A 2XUOA 3M1AA 1TQ8A 1C9DB 4HRVA 3I58A 4CKCB 2D0DA 3MHTA 1PGPA 2BFDA 3C3AA 2GK4A 2OXTA 1T2FA 3N7AA 4N48A 2WYHA 4Y2QA 5DTIA 2BELA 3B9QA 1OBFO 1C81A 1Z5NA 3QKWA 2E2WA 1RRKA 1WIWA 3A32A 4XWYA 1KRHA 2VNAA 3MTQA 5JCXA 1ZO8A 1G8MA 2PGXA 3EDMA 2C8VA 3WWZA 3INNA 2Y1OA 3DYBA 3BICA 2GKOA 4O2AB 3H5IA 4EWLA 5A3RA 3RUPA 2NQTA 2OEPA 2PSFA 5H80A 5K3CA 5CA1A 2V4MA 2HREA 4XR4A 2HN9A 1GNTA 2MYNA 1JDBB 3IAFA 4B40A 2FW9A 4YQYA 4ZOQI 2VTBB 4ICIA 5B1HA 3GJ3A 5FJJA 1N6OA 3UJDA 3RU9A 1E8NA 3TSYA 3WGGA 1GM5A 3AC0A 3DEZA 2GZ2A 2NSHA 3P9XA 4RKWA 5BV1A 4ZYLA 1AZWA 3DGEC 3EVNA 3PUKA 2QNBA 3IILA 4XLZA 4OK6A 1J7JA 1P1KA 3JARA 3G6KA 3LUDA 5K8TA 4LF5B 3OO0A 5K3BA 5CDSA 3AMVA 5G1NA 2XNCA 3WRYC 1BMFA 1J23A 1RQRA 1U3WA 3MTJA 2K5UA 5K3FA 4F9EA 3AR5A 1OHHA 4AYTA 5KKAA 1G20A 1AC5A 1JF8A 3PFCA 4QDXA 4TZTA 2VTEA 1UMCA 4ZOCA 2E4UA 5HJ2A 3OLVA 2AHOA 1E1CA 1M0WA 1V7QA 5T3YA 4LDJA 5AESA 2X6RA 1XU7A 1SNYA 3HBAA 3TSCA 4RK1A 5B6IA 3SQNA 4DA7A 4XJSA 4DDMA 5I01A 3FZNA 3GCWA 1ZGCA 1O03A 3JWJA 1JDVA 4B7CA 3QRWA 4X60A 3A28A 4DCNA 2WU0A 2IWRA 1JIKA 3IODA 3E70C 3PEWA 1LU9A 2P3SA 1NA5A 2BH9A 3EA5A 5I5GA 4EEZA 4Q3AA 2WW8A 5KWJA 1A1VA 5I7AA 2V7UA 4PC3A 4HXGA 2YDXA 3DV2A 4BCCA 3DE7X 1BWRA 3JSXA 3MYYA 2H4JA 4ZI5A 5K09A 4UHFA 2G04A 1GT6A 4KKVA 5T6BA 1GCGA 1OREA 2O20A 4Z0PA 1D6MA 3AERA 4OXYA 2CJYA 2JGAA 5IBRA 3CONA 2HYDA 3QFFA 3NEJA 1W34A 5A1JA 3LPAA 1K06A 1RYYA 2RCYA 3I9FA 3THYA 4WKBA 5IDQA 1F20A 4Z1MD 3UAGA 3CUTA 3PZBA 2C3PA 1BE0A 3I83A 3D2LA 1I1NA 1E9SA 1XFAA 3IAUA 3ASZA 4LYYA 4RL6A 4C0JA 1MJFA 1U7HA 3C7CB 1PLKA 2VPWA 4F3CA 4RNCA 2PNJA 1QHIA 4IJKA 4JB0A 4UKDA 3ECCA 3WJAA 4P3OA 1JLHA 3ORFA 2CFTA 3UMCA 5DTQA 3C3DA 3FPJA 3Q2OA 1N6RA 4BQOA 1M74A 4J7CA 1CQIA 5GONB 3W9BA 2EZUA 1YZLA 3Q7TA 1Y3IA 4AJ9A 3EPHA 4EPWA 2NP7A 3U3MA 3HVRA 3ITEA 4CQNA 3OE7D 2Q07A 5HOEA 4BFVA 1LEHA 2BM9A 4JR2A 3IUMA 3AJ9A 3SG0A 3B1ZA 1W1UA 1KYIA 3Q7SA 1MIOB 4RM2A 1DRWA 4AKGA 3QV1A 2BPOA 1MB2A 4KO1S 2YIMA 2UYCA 1JT9A 3BHJA 5E9JA 2RBKA 3OM8A 2J3JA 3MGAA 2FWAA 1VHJA 3NC0C 5CFMA 1BHJA 3RBVA 4UHHA 1M6VB 1OTHA 3I5UA 4N7JA 1OROA 4U0KA 4UEWA 1AGYA 4AN1A 1FFXA 5C8YB 5HIAA 5L4NA 3TD2A 4KGDA 1GZ3A 3CNOA 2NPFA 4A6XA 4JP2A 4U63A 3ZBTA 1KSFX 1FTWA 2QT1A 2VS1A 1TKRA 2HJWA 2WWWA 4Y6RA 3BA1A 1OFHA 3P0RA 2DUWA 3AUFA 3P2EA 1I5RA 4PSVA 3HMKA 3AHCA 5MGNA 5ALWA 5A5VA 2NSYA 2WU1A 3BD6A 3ZXIA 4FLFA 1C30A 1JBQA 1DP4A 1U8YA 1WKVA 3DULA 1TDJA 2JAQA 3PYMA 4HR7A 2LDXA 3TUIC 4BNVA 5J58A 5JFOA 2JGFA 2VUIB 5JANA 3KQHA 3FE2A 1V7ZA 4QAJA 2PMWB 1KWKA 2O8DB 4KYVA 4RS4A 3I23A 2ZWOA 2XGSA 5MF6A 3A1CA 3I0MA 2FSGA 3OETA 4BAGA 1U2GA 1UBEA 4KXVA 4QOIA 5EOVA 5H70A 3VYUB 4DCUA 1RFLA 2QLFA 4QFBA 4RQBA 3BWBA 2ZI5A 4OU5A 2QM8A 1Y7IA 1DJLA 3KFLA 3QNUA 4LX0A 3NVDA 4TT3A 2CZGA 4V0SA 4S24A 4O4LB 2CV0A 4FGLA 4FLEA 3O2QB 2Z58A 3WNDA 4TUYA 4Z4FA 2J4FA 4N5LA 2X13A 1PZHA 1WF6A 4L5BA 2GXQA 3RRMA 4DJEC 5I6DA 2GNAA 5AR1A 2ZK7A 3DT9A 1QX3A 1FXUA 2WIKA 2FMFA 2O57A 1TJYA 3K0AB 1LBIA 4KAXA 4R2IA 1A72A 3WTBA 2IGBA 1JA1A 1W4BA 4G5QA 3T35A 2HB6A 1NNSA 4P31A 4AD8A 1R74A 1X14A 4DCOA 4DSNA 1M73E 3DE0X 3IDOA 3L7KA 3CEMA 3UJPA 3P8ZA 1W5FA 3NDIA 1DRVA 4ISCA 2XZDA 5FHRA 1AKTA 2ZWAA 5L9AA 3CVYA 2IP4A 1YVRA 4A2QA 3SICE 4YDQA 4BPBA 1HO3A 5FO0A 4F5ZA 5CW2A 2XMCA 3NHUA 2ACEA 3N2KB 2MMCA 2VHUA 4CT5A 2ZCJA 3TVYA 1O95A 3ABOB 2ECQA 3DOUA 4Q9IA 3TQTA 1KEWA 1I5EA 3SMVA 1BDBA 3ITDA 4YRMA 2ORIA 1W44A 4J43A 5FPSA 1UBKS 4FYXA 1GEEA 2XT9A 2XZTA 3RTGA 4AAYA 2BZSA 1UJBA 3E53A 1J7KA 3P2OA 4HX9A 4ZREA 3DPUA 1SCJA 3C7AA 1E89A 1UDWA 4NAVA 4JLMA 1FDSA 1A98A 3F5SA 3GEHA 4NMHA 4AM8A 3FNGA 5SYMA 2G1KA 3N6XA 1LV8A 3TEFA 1A88A 3TR6A 4CQMD 5ELLA 4A73A 1KYTA 3O31A 2CL7X 5DM1A 1XZDA 5BQ3A 3PTAA 4C2UA 1JS1X 1XMXA 1VIYA 2KM1A 4LI0A 3UYKA 4QHSA 2J6CA 4ZARA 2J0EA 2EJVA 1CQIB 4PNEA 3PQ2A 5K05A 4M1MA 3C4VA 3F6PA 4QU5A 4F6CA 5CFZA 4LQDA 3S8MA 2Y9PB 1YIDA 2W6NA 1H2YA 3WA7A 3NDRA 1NMEA 1Y6JA 2PSEA 5AUNB 1ZJZA 3C0KA 2O3UA 3LHSA 5AWFC 2GFQA 4BUCA 1Z25A 3V1MA 3RC3A 1JHAA 3W9SA 4BP8A 1NW6A 2PAAA 4CTOA 4BVGA 2BEUB 1CD5A 3IQIX 2WU4A 4K9LA 1MRSA 2QJFA 4L2IA 1LBEA 3PLRA 3THRA 4A2WA 3E4DA 3ENNA 5I7FA 3IA7A 2JVKA 5JW6A 3QELB 4FFDA 3EARA 5DK4A 3WE7A 2H2FA 1V25A 4LCEA 4UBLA 2BSXA 3K2BA 1DJNA 1EKXA 4K3VA 3IUBA 1ZIOA 1DI0A 3BFVA 3G8DA 4JJ4A 1NLUA 3TTTA 2VWGA 4N8EA 1JIIA 1YJQA 2JLZA 4K9OA 2OHIA 1TA4A 1E1MA 1G17A 3V2HA 4HDQB 3I30X 3RYHA 1XRSB 4XYGA 5JHHB 4ID3A 2ZI6A 5EC8A 5EKTA 2H1RA 1PVDA 2FX2A 1S2LA 2Y0BA 1GP2A 2YS7A 5IEBA 1A8IA 2QSJA 4BL5A 1TLTA 1V1MB 3F8SA 2Y27A 3LSYA 1GG8A 1XJWA 3PE4A 5JZVA 4NZYA 1KC3A 4U3JB 1QHNA 4DLSA 2FEXA 5BVGA 3W1EA 4TWAA 3KE9A 4BZPA 2AEMA 2ZS9A 2BM8A 1A2KC 4FHGA 4IKOA 2IX9A 2AL7A 5KYNA 5LOVF 2DETA 1GPMA 3KG2A 2IH2A 2CVZA 3L8HA 2FUEA 3WGLA 2D7DA 5CFOA 2GCGA 4E94A 4GKAA 1T1JA 4FHFA 1JEYB 1QONA 4N5DA 2XCTB 1SHZA 3RYFA 1LBQA 2FZKA 3WKAA 1KZGB 3OPMA 1WUYA 2I3ZA 3EIUA 3NKFA 2GOYA 2OM2A 3KHUA 4JXKA 3VO2A 1KETA 5JXGA 5JXWA 4G1CA 2MINA 4RQUA 1PEAA 1SVIA 2ZIAA 1IE3A 3I1YA 3NNDA 4RGVA 4UM8B 1A69A 3GARA 3KKPA 4BO9A 2YHIB 5E2IA 3AFHA 2A1TR 1S89A 2X5JO 4P93A<