1XRRA

Crystal structure of active site f1-mutant e245q soaked with peptide pro-pro
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDQVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 105
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrrA00
1DQZA 3QVMA 4BVKA 1YAJA 3QITA 5YASA 4ZI5A 5FKJA 2BUCA 3JWEA 3LCRA 4B9EA 4ZV9A 4BTVA 5I8PA 4BP9A 3CN7A 3ZV7A 1EVQA 1MAHA 1ZI6A 1ORVA 4NS4A 1LPOA 2QXTA 5DNVA 4QZVA 1EI9A 2HM7A 2VJCA 4XJVA 1IUNA 3FLAA 5ALWA 4RE5A 3WL7A 3KSRA 5IVIA 2ZSHA 2DCMA 4WY5A 4FLFA 3LIPA 4D9JA 4TPKA 3IUJA 1CRLA 5CMLA 4DGQA 1U8EA 3WWCA 4FHZA 4GW3A 1K63A 1CVLA 3DKKA 1HKHA 3R3VA 1FSSA 1QIEA 3C6YA 2HHAA 1GKLA 4KRXA 2Z3ZA 5LZ4A 3D2AA 2ZYRA 1JMKC 4C4ZA 1H2XA 1C4XA 2WHRA 3DKRA 3O0DA 4QDOA 4DMCA 2WUFA 4W1QA 1P0MA 1R50A 3STUA 2X8BA 3ZLUA 4H35A 2RAUA 4X94A 2H9YA 3RKSA 2HFJA 1YA4A 5D7BA 3W05A 4FKBA 1QIMA 2Y6VA 4QDXA 1EB9A 3AZPA 1A8QA 1L7QA 3C5VA 3DL4A 3IURA 3WK8A 4G8CA 5AI8A 4UBNA 4BCCA 5DLPA 4UBJA 1Z68A 5DYTA 1JT2A 1MX1A 3KD2A 1CUVA 4GEGA 1ZGCA 5K3FB 2B9VA 5JAUA 2AJ8A 2YASA 1YS1X 2VJAA 2XUFA 4Y2QA 4C4YA 1LPPA 5HK9A 3C70A 4PNZA 4FFVA 1XZCA 4B83A 5HQ3A 3C45A 4B84A 1EVEA 5AIBA 1DX4A 3TGLA 4BVLA 3C43A 3IVMA 2PSEA 2BFNA 1YSCA 4QLAA 4FMPA 1TCBA 3FCYA 1K5PA 2DQYA 1HQDA 3M81A 4Z49A 3QPDA 2X76A 1BN6A 3STWA 2V97A 2XUIA 2AJLI 5EHXA 2AJCA 2DSNA 5IVHA 1KU6A 1MAAA 2QUBA 5CT5A 5D3ZA 2HA7A 1EH5A 2RI6A 3H17A 4PSCA 4S0XA 3DOHA 3G02A 2WILA 3I1IA 3D59A 2HL6A 2B20A 1XZGA 4X71A 3HABA 1Y7IA 3M3DA 3RLIA 4Y9SA 5C8XA 5CRIA 3I2GA 5HF6A 3WJ1A 4KE6A 1IVYA 3QPAA 1N5RA 4BZZA 4W63A 4ZRDA 1LGYA 5JAOA 2GYUA 4ARBA 1Y7HA 4I19A 3F9CA 3HXKA 5AH0A 2WIKA 3Q0TA 1VZ3A 5HFNA 2CBGA 4UPDA 5JIBA 3M83A 1VA5A 5LZ5A 1QJ4A 3W9BA 5H3HA 3PFCA 2DHEA 4WDRA 1W4LA 4EBBA 5CXUA 2CJPA 3R40A 4PF1A 4CIBA 4C88A 3VISA 2QOEA 3O4IA 3H19A 1TQHA 3VJLA 3ZWQA 3LS2A 2JGEA 2DQZA 3E3AA 1GPLA 4U2GA 3M82A 3C6ZA 4QWMA 1W75A 4MEAA 5E4YA 1WOMA 5AKJA 1H22A 1K6EA 3B3QA 2WQZA 4Y2UA 5KWIA 5LKRA 3ED1A 2XQIA 2EDAA 3G9UA 3WZLA 4G8DA 5ALNA 2X5XA 1ZI8A 3CN9A 4J0KA 4BATA 2ZVDA 3AZOA 5C8ZA 3F8SA 3IA2A 5LZ9A 1C7IA 3DCNA 3NWOA 2GBIA 1F0PA 3PUHA 4RGYA 1DWQA 5SYNA 1YB6A 1ZOIA 4X91A 2J4CA 3DNMA 1JKMA 2C5FA 5LZ8A 4G8BA 4Y2RA 4GWLA 2YH2A 3GROA 3OOSA 3RK4A 3U0VA 5E4JA 4BAZA 1ZGBA 2HU5A 2D0DA 5HKAA 4IQ4A 4HS9A 2VJDA 2CZQA 1U4NA 3V1KA 5AI5A 1MO2A 1L7RA 3ICVA 1F0NA 5ALIA 4N8DA 2XLBA 4O08A 5I7UA 2CMFA 1Q0RA 3HLKA 4QLOA 1OILA 2HADA 2VAXA 3W9UA 5JAPA 3G9XA 1YCDA 4ZV7A 4X00A 4EY8A 3AZQA 2VSQA 5AM2A 4UBIA 4HRXA 4CG3A 3FCXA 5AOBA 1GGVA 4CIAA 2K2QB 2WIGA 4UHFA 4DSAA 5CH8A 5AM3A 3FVRA 3AJAA 4H0CA 2GBFA 1VJ5A 3AUKA 4PO3X 1R1DA 4BC0A 5FXMA 4JYPA 3FLBA 3O95A 5EIHA 2ZSIA 1QGED 2WG0A 3D2BA 2XMDA 2RHTA 2OAEA 2OQIA 5DYYA 4CG2A 4DMHA 1ACJA 1GXSA 1GT6A 3FYUC 4DNOA 1CUZA 1UT6A 5EHZA 4X6YA 2HA4A 5AI4A 1ZD2P 3G9ZA 4H7DA 5AICA 5AI6A 5ALQA 3FOBA 5FV4A 5AP9A 3D2CA 1GQRA 4FNGA 3UUEA 3N0TA 2NW6A 3FYUA 1CUYA 4XVCA 1D07A 4Q3OA 1XLUA 1LPBB 5ALRA 1S8OA 2BCEA 4XWGA 1JJFA 4UHCA 4MWTA 4B9AA 4FNMA 4GLBA 3F98A 3YASA 5HK8A 1LPNA 4HRYA 4C01A 1FFBA 1DQYA 3H04A 4H7JA 4CCYA 1UWCA 2E3JA 1DT5A 3C87A 5KWJA 1ODTC 5HZGA 2ACEA 5ALOA 4LXIA 2QJRA 4PW0A 4EY6A 2UZ0A 4BCDA 5K3BA 1QOZA 1EK2A 4FBMA 1JI3A 2XT0A 1XRNA 4IH9A 1T4MA 4W1SA 2XQKA 1LLFA 1CUWA 5E4TA 4JH0A 4GBGA 3WWDA 3D7RA 2Z5GA 3L1HA 4NZZA 5AKIA 2ZJFA 3KDAA 1XQVA 3E4DA 4UHHA 3FYUB 3V1NA 2BAGA 3BDVA 3O4GA 1JJIA 1LBSA 1UK7A 4LXHA 2PU5A 4J03A 5A7FA 1VLQA 3A70A 2Q0XA 4MJ3A 1JMYA 3FSGA 5LYYA 4K6HA 4C4XA 2C58A 3F97A 1X2EA 1CIJA 2WKWA 3EQ8A 4AMZA 4BE4A 1FFCA 1MTZA 3QYJA 2GYVA 4RPCA 4B81A 1A7UA 2XI4A 4BAUA 3A6ZA 3STXA 2O2IA 2XB6A 1UKBA 2JGKA 2HA6A 4E14A 2CB9A 2DHCA 1P0PA 2J4FA 1DWOA 3H2KA 2VEOA 4Y2XA 5FP0A 4Y2SA 1WHTA 4EY4A 1LZLA 4KEAA 5T4HA 2EEPA 1BU8A 4DMFA 5C81A 1UOQA 1QLWA 1USWA 2PUJA 1A8UA 5LP1A 1EA5A 2H1IA 2HDWA 3MUOA 2FX5A 1VZ2A 1SCQA 4K2AA 3WYNA 3G9TA 1CQZA 4Q3KA 1J07A 4YX9A 4P9NA 2XMRA 4WY8A 1CUHA 2QJWA 3SX4A 3EBLA 4JEIA 2ZYSA 5AKHA 2V96A 4MWSA 5AM5A 4AZ0A 1QFMA 1NU8A 2QXUA 4KAAA 4DTCA 4EZIA 4WJLA 2ORYA 3H0CA 1UK6A 5EHNA 4J0HA 2HU8A 5DNWA 1XZLA 1BROA 1H2ZA 3W2TA 2RONA 2PSHA 4W1PA 1LBTA 3FBWA 2RIPA 4FWBA 4OUKX 4KE7A 1HDEA 5AK4A 2QTBA 4C89A 1W76A 2XUDA 4QA9A 4M0MA 1E3QA 3OPMA 3FAKA 4AO8A 1F8UA 4U2CA 1GQSA 2J3DA 4ITVA 3OM8A 2B61A 2QR5A 2BGRA 4X90A 4X92A 5JD5A 1OCEA 5CW2A 2GZSA 4IO0A 2WHQA 4IH4A 4Y2JA 1SCIA 4EA6A 3AINA 1YA8A 1C7JA 2ECFA 4PSDA 1HL7A 1SOMA 1YB7A 1MN6A 4BBZA 2JGJA 1XZKA 1W52X 5A7GA 1K8QA 4F60A 1ACLA 3DQZA 1AZWA 3WK9A 2WFLA 1CLEA 3BF8A 1VA4A 3CCCA 3WWPA 4X7BA 5D3KA 5AO9A 1T2NA 4MXDA 4UFOA 3K6KA 5JYCA 2XUJA 3ZI7A 1PFQA 1ZIYA 2WIDA 2BUBA 2JGFA 1NU6A 2GBCA 5DYWA 2OCLA 4DNQA 1XQXA 1XKTA 1CUGA 4M0EA 5AM1A 4BZWA 4UUQA 4E46A 4FBLA 4AO7A 4J0JA 4HXGA 1CUXA 2PSJA 3ZLTA 4BDTA 3QZUA 1AKNA 1XZAA 3STYA 4YASA 3EQ9A 2JEYA 5LIPA 3G0CA 4HVTA 2Z8XA 3GZJA 4X95A 5ALXA 1QO7A 4F0JA 1JU3A 4UHBA 4OPMA 4U2FA 1ZJ4A 4OB8A 1XRLA 5FPPA 2HFKA 1CUJA 1ZD3A 1BEEA 1HBJA 3H1BA 3F67A 5K3AA 3WKCA 4GDMA 3HI4A 4DM7A 2ZJ6A 5AI9A 3AIOA 3DOIA 3OG9A 2PPLA 3OURA 1VKHA 2I03A 4OCZA 3A2MA 2PKYX 5ESRA 1J06A 1ZD5A 4A23A 5HQ3B 3IUMA 1XQYA 4WFJA 4PQEA 2WU3A 2DR0A 4A16A 4KAFA 1CQWA 1LZKA 2PU7A 5AM0A 4Y2YA 5LLSA 1JJBA 3FYTA 4EB0A 3QM1A 5ALGA 3HYSA 5JD6A 3C8HA 2ROQA 4UHDA 4N5HX 2R8BA 3ANTA 5ALKA 4QNNA 2J3QA 2JGIA 2WM2A 2V9ZA 1QONA 4KYVA 3DD5A 3IUNA 3ESCA 3V48A 5A2GA 4J7AA 1E89A 4JYMA 5AKZA 1QIFA 1YS2X 1UOPA 4H7FA 1N1MA 1GPKA 1YR2A 5FUMA 2P8SA 4BB0A 3U1TA 4AX4A 5AI0A 3V1LA 5CXXA 1CEXA 4BYMA 5CH5A 2H7XA 1BRTA 5ALSA 5C8VA 4F5ZA 4UFPA 5DWDA 3CXUA 3G0GA 1AQLA 5EHQA 4FTWA 4FLMA 5FRDA 2OCIA 4NMWA 4RE6A 2XMBA 2FJPA 1VXOA 3QBJA 1TIBA 4X6UA 2BUAA 3ESBA 4UBMA 1E8NA 2WJ4A 4GXNA 1UKCA 2ES4A 2VF2A 3FWHA 3BIXA 2LIPA 2FUKA 5AKXA 4F21A 1E5TA 4MYSA 5AOAA 4Q82A 2WIJA 3WWEA 1MNAA 3V1MA 2QVBA 4BC1A 4Y2PA 4ZWNA 3MUNA 4H7HA 1N8SA 3KWFA 4ROTA 4UBLA 2JIDA 4Q05A 4BCBA 3GELA 5J3JA 4B6GA 2I3ZA 2WG1A 4B0PA 1CPYA 1JU4A 3WKDA 1UZAA 1R4ZA 1G66A 5ALFA 3PF9A 5A7HA 4DIUA 5AOCA 1RYYA 4HXEB 1LNSA 1WM1A 1MT3A 2QM0A 2Y2VA 1PJAA 1AX9A 5AM4A 5JADA 1AMNA 1QO9A 3AFIA 5IVDA 2HA0A 1WPRA 1TKRA 4C6HA 5AK5A 3DYVA 4X97A 5ALDA 4EY5A 3WJ2A 5ALHA 4Q3LA 1HPLA 4AZ3A 4LIPD 3H2HA 4C87A 4FDMA 4AQDA 4KE8A 3BWXA 1W1IA 1DWPA 1SCKA 4WDQA 2VQ6A 4QDTA 3G0IA 3I6YA 1UK9A 1L7AA 7YASA 3AILA 2Y2UA 4LYDA 2CUTA 2G5PA 2QMQA 2I3DA 1J2EA 3DJYA 5T4BA 4A5SA 5BWCA 3L1IA 1CUIA 6YASA 5HKBA 2VT7A 3WL5A 4TVKA 1O6GA 3I6MA 5EGNA 1EX9A 1EHYA 3IDAA 5JATA 4G4JA 4K5QA 3WA7A 1GKKA 4OU4A 1XZJA 5JZ9A 4X85A 2VT6A 1I6WA 3I2JA 4CFSA 3G0BA 5KBYA 1PV1A 4HAIA 2Y1KA 4J0CA 1MNQA 3TEJA 2XQGA 4Q34A 3O9VA 2XQJA 4G4IA 3WWOA 3K9BA 1TCAA 1P0QA 2QT9A 4N5IX 3RM3A 3P2MA 1AGYA 5ALTA 3BIWA 3UUFA 3B12A 2VAVA 4I4CA 1ODSA 4PV7A 4N8EA 1E8MA 2GYWA 5ALUA 4FFWA 1MPXA 1QFSA 4CG1A 2XMGA 2XLCA 2XUKA 3WIBA 4V2IA 1AURA 5CT6A 1IUPA 2G5TA 5AKEA 1U65A 5AKLA 1CUAA 4OB7A 3WL6A 1EDDA 5IVKA 1XRMA 4U2DA 2PL5A 3RARA 4BVJA 5CT8A 5D6OA 5AKYA 5CT4A 3WA6A 5AJHA 3HZOA 1DTEA 4EHBA 2XE4A 1CR6A 1XZIA 5AKKA 4DNPA 3DL7A 2YYSA 5AIAA 1M33A 4DLNA 1XQWA 2OQVA 2C0QA 2FJ0A 3OC0A 3Q8WA 3H2IA 3I28A 3JW8A 2WIFA 1VXRA 3ICWA 3GA7A 2WJ3A 1CUEA 1VOTA 4NVRA 5ALJA 2ZYHA 2QUAA 1CUSA 4ARAA 4CCYB 4DMKA 2VATA 2AXEA 1CUCA 3PICA 3WKEA 5AKGA 1BE0A 1CUDA 2XUPA 3R3ZA 5CURA 1ETHA 2OGZA 4BRZA 2ZYIA 3G0DA 2RGUA 2CKMA 3B5EA 3EF3A 5JASA 1WPXA 4MQLA 1FFAA 3DYIA 1LPMA 2WUGA 1AC5A 4HXFB 5A71A 1WB5A 3QPCA 1H23A 4AN1A 4WCVA 5AK6A 2PBLA 1JFRA 2ONCA 4JNCA 5K3EA 3WL8A 3A2NA 4KE9A 5BOVA 4FLEA 1XRRA 3H2JA 4LHEA 2VA9A 4CCWA 4LXGA 1EDEA 4UBKA 4BRSA 1ORWA 3O4HA 4H7KA 2Z8ZA 1XZBA 1XZMA 4RNCA 1MU0A 2BJHA 1TAHA 1Y37A 1EDBA 1G4HA 5EIAA 1MX5A 4H18A 2PVSA 3BDIA 5T4EA 1B41A 4QE3A 4W1RA 3QMVA 4J0IA 3VKFA 1DINA 4AB1A 4GHWA 3R0VA 2OG1A 4ZGBA 3IULA 4OU5A 3VXKA 2XUGA 2BKLA 4X6XA 3AIMA 1WCYA 1R9MA 1CUBA 2WJ6A 3IIIA 3WMRA 1EK1A 3WIOA 3PE6A 1RWQA 4AXBA 5EI5A 4UBOA 1QZ3A 4UFNA 1THTA 4ZXFA 5A62A 5ALZA 4LYEA 5K3FA 1ZJ5A 3IUQA 3I2HA 1ISPA 1Q84A 4QWWA 3WK4A 3MGAA 4G5XA 1XZFA 3S8YA 3N2ZB 3E0XA 5CBKA 1NX9A 3K2IA 5E2IA 5ALLA 1TRHA 3CCBA 2HA5A 4I3FA 2OGTA 2QS9A 3H1AA 5EFZA 5HF9A 1YAHA 3D5EA 3ILSA 1YASA 4L9AA 4X3CA 3H2GA 3DEAA 1QTRA 2B4KA 3I2KA 5FDFA 2O2HA 3X3HA 2PM8A 2XQFA 4E11A 5EIEA 3WKAA 1UK8A 3QH4A 4MQMA 2C7BA 4E15A 1WB6A 4BAGA 2HIHA 3VVMA 1ZD4A 1UOOA 4U2BA 1XKLA 3EIOA 1R9NA 1A88A 1W6RA 4U2EA 1IZ8A 4XX1A 4DYHA 5T4FA 5DJ5A 3FLEA 3ZLVA 3QMMA 1BS9A 2GZRA 4IHAA 2XMCA 1AUOA 2ACKA 1CUUA 3OTQA 5HCUA 2BGNA 3O4JA 5DNUA 4WFKA 4MEBA 5IKXA 1QE3A 5CT9A 2WFMA 2WLSA 4FOLA 1F6WA 5LKAA 3AIKA 3R3WA 2WFLB 4HTAA 5K5EA 2YXPX 2I78A 1THGA 3SK0A 4B0OA 2HRQA 2XUOA 2XMQA 5K3DA 4DNFA 3R3XA 2W6CX 2XUAA 4N8SA 1EB8A 1P0IA 3HSSA 4G1FA 3R3YA 4MYDA 3LIIA 2AJDA 3DS8A 4X93A 2V98A 5BWBA 1N5MA 3NGMA 1SC9A 1XRQA 3EQ7A 3PI6A 3LLCA 1H2WA 4Y7DA 1EXWA 1H2YA 2DHDA 4B7ZA 1G5FA 3BJRA 2WG2A 3KXPA 1SFRA 3HRHA 1KEZA 2PSFA 3R41A 5FPQA 1FFDA 5HFAA 4BTLA 2PUHA 3G7NA 3STTA 1J1IA 5ALVA 3C6XA 1KU0A 2XDWA 1O6FA 1VE7A 1XFDA 5AK3A 4TGLA 1TK3A 3VDXA 3WLAA 2H7CA 3T4UA 3PF8A 4GECA 4ZREA 1MJ5A 2C5GA 4EUSA 2JF0A 1CV2A 1X2BA 4P92A 4AN0A 2XUHA 3GFFA 1LPAB 3BXPA 3ESAA 4DSZA 2XMSA 4B80A 3T52A 2AJBA 2G4LA 2IX9A 1UKAA 3S2ZA 4AMYA 2HU7A 2QZPA 5ALYA 4XIIA 2OCGA 1B6GA 3IBTA 1DT3A 3WK5A 5LZ7A 4YK7A 3KWJA 3KOOA 3PDCA 3PFBA 5HF8A 2QRUA 5JALA 3SWWA 1BEZA 1XLWA 5CTAA 1GZ7A 2OXEA 3NUZA 2VJBA 3WZMA 1QIHA 4EY7A 4YPVA 1GPNA 3I1YA 1MX9A 4PSUA 3HJUA 3V9AA 1XLVA 1UFOA 1OXMA 2WFZA 3DLTA 4KRYA 3WQHA 2G63A 4BP8A 3C5WP 2PX6A 2CEKA 3GUUA 3GBSA 1TCCA 4B82A 1DX6A 3ZPXA 4QDZA 4JUIA 1RP1A 1X70A 1G42A 2HA3A 3D0KA 3HC7A 2HRRA 2OCKA 2DFPA 3VJKA 4OYLA 4UHEA 5JARA 1BCRA 1IZ7A 2RHWA 4KACA 4KJXA 5JAHA 3VJMA 1ZIXA 3I2IA 1CFJA 1XZHA 3FNBA 5A6VA 4G9EA 1IUOA 5JZSA 1DU4A 4Y2TA 4Q1VA 3W06A 5SYMA 3NOXA 3R3UA 3SC2A 4L0CA 1QIKA 3H18A 4L72A 1IMJA 1K4YA 1R3DA 1QIJA 5DTJA 1CUFA 2PSDA 4M0FA 5I9IA 3IB3A 5BV7A 4P93A 3LP5A 2WHPA 2JBWA 4LKOA 5K3CA 1WB4A 3D4LA 3L1JA 3QMWA 4QEKA 2OPHA 4KR0A 1FFEA 4G9GA 1Q0ZA 2WTMA 2W22A 3WI7A 3HACA 1ZI9A 3PUIA 2D5LA 4GI1A 3WKBA 1QTIA 2C4HA 2JEZA 2GBGA 3FSGD 3WK7A 1QIGA 1BCSA 2XUQA 2JGLA 4Y2VA 3G8YA 5ISMA 3JYHA 1HLGA 2R11A 5DTIA 1E8DA 3DDUA 2WHPB 4CI9A 5CH3A 2O2GA 3C8DA 5ALMA 4H7IA 3I6ZA 4J0DA 1U2EA 2HA2A 2OGSA 4L3WA 1Q83A 4AO6A 4K6KA 2WU4A 2XMZA 5ALEA 1UXOA 4HZGA 2EDCA 3ESDA 1QIDA 1XRPA 3D3NA 4H77A 3BE8A 3BJMA 3I2FA 2OAGA 1LPSA 1XZDA 1EINA 4OYYA 4BDSA 1E66A 1WHSA 4INZA 4G4GA 5C7YA 4OD0A 3C6BA 2Z3WA 4OSEA 3UMJA 3MVEA 2JGMA 4P08A 3W04A 3VVLA 4ETWA 5JD4A 2WUEA 5HF5A 4KAJA 1QIIA 4J0GA 5JANA 1FJ2A 3BF7A 3TRDA 5ALPA 4B85A 3FVTA 5JZBA 2VTVA 4J3JA 5KREA 3ANSA 5FLKA 3F96A 1BN7A 1VE6A 3STVA 2Y6UA 1XZEA 1A8SA 4BE9A 2QKYA 2H7YA 3BL8A 2OLEA 3WK6A 2C0PA 1ODCA 4OB6A 2ZJ7A 4K6GA 4H7EA 2O7RA 5F4ZA 3A2LA 4W9RA 5IH7A 3O9MA 2IIVA 1R88A 2O7VA 4IH1A 4QDUA 5LZ2A 3E1GA 3WYDA 2WUDA 2IITA 3HEAA 5FOQA 1XROA 1ZICA 2WSLA 5AHXA 4WFIA 2WTNA 3TJMA
chains in the Genus database with same CATH superfamily
3WNVA 4XM1A 1E63A 3FZQA 1D0SA 3RABA 3ZGVA 5CG2A 1ZN8A 1KDVA 1YAJA 5YASA 4BVKA 3AHIA 2DETA 4LOHA 2ZBEA 4OL0A 3QLVA 4GP7A 1T2FA 3SHVA 3SEZA 3TL2A 2XF8A 2BKEA 3EFHA 3PDJA 1WE2A 3EXG1 3S5UA 1TKBA 3K94A 2N9UA 2AOVA 3KNZA 1PKEA 2XGOA 4D2IA 3VNUA 4QVKA 4OKIA 3M0EA 4TYPA 2D5BA 3Q2IA 1K86A 1YH3A 5IJXA 3KAPA 4NJMA 4ZYYA 4PLGA 1C0EA 2QXTA 3I8OA 4Q21A 2HM7A 4XJVA 1IUNA 5F9MA 4WN9A 5BR7A 3GZNB 1ND6A 3C3AA 4RE5A 1BW9A 3ECCA 3MG9A 5DHTA 5DWQA 4I81A 1MIOA 4M0KA 3U7RA 4D9JA 1SOUA 2FWNA 3IUJA 1KOJA 1U8YA 1S1CA 3UC9A 3EH1A 3GHHA 1JLLA 4WJZA 3DTTA 4NHEA 5JLAA 4GW3A 3NHPA 1L1RA 5HOEA 1D8AA 1CVLA 2X9VA 1RACA 2IK8A 2YMLA 3F6PA 1P1KA 3TQTA 2YZMA 1CS0B 2GCOA 3C6YA 3DW3X 4R81A 1VBMA 5DP2A 4KRXA 2GVNA 3NTLA 4YUZA 2R6DA 3EGVA 4I8IA 3NNDA 5LZ4A 1F2TB 2CFIA 1SHZA 4HH3C 1NOKA 4CU2A 3D4OA 4EPYA 2MINB 3W7VA 2QUHA 1C4XA 2F1HA 2HZBA 1RJGA 2F3TA 3LK7A 2O4CA 2WV9A 3FSEA 4K81B 4N0DA 2WIAA 1ZBDA 3A27A 2HO5A 1G2IA 1N5OX 2C00A 2FR0A 3AFHA 3TB6A 2ZBQA 3DFKA 3PXUA 4RTRA 4PPNA 1EIWA 3DWFA 4YAUA 4JJIA 4JC4A 2FPPB 3ZLUA 4OXRA 2RAUA 3CINA 1P5JA 5J2TF 4YFVA 1DZ3A 1P1BA 4F4IA 2H9YA 4UQOA 2R8PA 3RYIB 3LXMA 5HVNA 2H5LA 4A1OA 2Q3HA 1PWZA 2PV0A 4QUAA 4ZHQB 2HFJA 3JQ9A 4F3KA 2A58A 3TW0A 1W25A 1T0JB 5D7BA 3W05A 4JLJA 1KO7A 1O4WA 3CB2A 4M1WA 1YS4A 1XTRA 5EOVA 2R6GA 2V4MA 3H1FA 1G3UA 3AJ8A 5F52A 4B3TB 2Z2XA 2ZS8A 3KRTA 4MV7A 4F1JA 1VL0A 4HP8A 1C0LA 4NOJA 5K0SA 3KR0A 4NV1A 4W8OA 1O94D 3PB3A 1Z73A 3A6JA 1CG6A 4JELA 4EVRA 3FNFA 4JOBA 5A6SB 3EXAA 4IV5A 3KOZA 3ID6C 2WD7B 1NIPA 5JU6A 4PM4A 5J58A 2EQ5A 1L7QA 4OAOA 3UVEA 1DEHA 2VYND 3EOBI 3DL4A 1XTIA 4KW7A 4ESVA 1MRZA 1NTOA 1XC7A 2OFPA 3BTSA 3FVQA 4PLWA 5C4IA 2D1TA 1UADA 1FDRA 3LP6A 3AVTA 3OM0A 2YXLA 4UBJA 2BOVA 3T9CA 1L7NA 1CY2A 1RXWA 1PLKA 1Y9EA 4GBMA 3FXAA 4IQ8A 4J3FA 1JT2A 4TTSA 1S3SA 3RVNA 1XBTA 5DASA 1FYWA 5IPFA 1PL6A 5GJWC 1YVDA 2HTFA 4GEGA 7REQB 2ZJBA 3O93A 5AVZA 5LQJA 4MAMA 1PJTA 1OWNA 4H15A 1JYSA 1XMJA 1PR1A 2P3OA 4L5CA 2UUPA 4XQGA 3C3XA 1RCTE 4P0PB 2MYTA 3N0VA 1V5GA 1F2DA 521PA 3M9XA 4L75A 3UXMA 4XYGA 3Q6IA 5JAUA 3T9FA 5JYBA 1JKJB 2VAWA 1I0LA 4OQXA 5BNFA 4PTZA 3NBXX 3IL2A 1SBZA 3UK0A 3DF9A 3V3TA 3ZQKA 4BNJA 5DRTA 1YS1X 5FPYA 3VZSA 3O9ZA 3QU7A 1RFLA 5KMGA 2ZFUA 4C4YA 3Q0IA 2G5CA 2P3LA 5AK0A 4H4CA 4E13A 5CDFA 2XV1A 4V0QA 3THSA 1XZCA 3KQYA 1I1NA 3FRHA 3S8MA 5I7AA 5CEFA 1EVEA 4X24A 5EVJA 1KGDA 2YX1A 1OLXB 1FNMA 1NJSA 3GPCA 3TGLA 1E60A 1GZSA 4LNUB 1E3IA 1XTJA 4UDNA 2BFBA 2ZI7A 2H1WA 4BVLA 8ADHA 5JZOA 2A7QA 2DE0X 3AUTA 3FG9A 2Z30A 2PSEA 4UCQA 1XEXA 2JHPA 3IOEA 2PGDA 5EZSA 2NO1A 1I51A 2A7XA 2IHTA 2QL9A 3OCUA 4FMPA 4Q3AA 1O7JA 5DHPA 3TDKA 3D8HA 3QJGA 3N0WA 1X39A 3TL3A 1ZJ6A 1H93A 3I9MA 4F97A 4A0FA 4YV1A 3IP8A 2GJ4A 3FKSD 4NMHA 4C7XA 1LTQA 3VO8A 4EJSC 4JQSA 3ZWOA 4LRSB 3CE9A 1IG0A 3M81A 2KX7A 1D9ZA 1A9PA 1SVLA 3MINB 1KVQA 4FONA 4RZQA 3CVYA 2Q46A 3QPDA 4LMAA 3PEVA 1ZZGA 4WRRA 5EFOA 4ZJYA 1X1DA 5JXGA 2KWIA 1N6IA 1P39A 3PQ2A 5H4HA 2D0IA 5FBVB 2XUIA 2G36A 5J43A 2CLFB 4D8YA 4D3DA 3GT4A 2C5EA 2HYIC 3JASB 4DN6A 4BB5A 3JAKB 1QOPB 3KALA 5DT9A 3VBEA 2ZI4A 1KMCA 3ZDYB 3KLBA 4CKWB 1GLGA 3E0QA 5TS3A 1QR6A 2AC4A 1I6LA 2VF7A 3OFJA 1YZFA 3G02A 3GGSA 2F59A 2N1BA 4MGEA 1DUVG 2HL6A 1IIRA 3FTEA 3TAUA 9MHTA 3AEUA 4X71A 4DMLA 4YRBA 2FCRA 3B2QA 4HS4A 4R69A 4R1SA 4ITUA 5JAIA 1LKZA 1B8PA 5F1OA 1OXXK 2F17A 3FB4A 3BSSA 3KKPA 3R5KA 3WJ1A 1SXQA 3TKLA 1BYIA 3IQWA 3L7MA 4CWAA 1L9KA 1G2PA 1RXEA 4DRYA 2WE7A 5JAOA 2I4IA 3RU3A 4FKMA 2QRGA 5JO9A 4TMWA 2YQZA 2LDBA 3R2JA 3CLKA 4GPEA 4K9MA 2HDNB 2WIKA 4PQGA 5KSPA 3H0EA 4EUKA 2JNWA 3KQMA 5I9LA 2R00C 1NNSA 3E7FA 3EF1A 2CBGA 2B99A 3EDYA 1WXQA 4Z1MA 3DLBA 1IY1A 2A8YA 5JIBA 1UKEA 3EA5A 3LQKA 3NPAA 4EENA 3TDNA 4RFSB 1VA5A 3GJ3A 3HU3A 4BNIA 1OB5A 3UF0A 3SDZA 5IDQA 1YV9A 5H3HA 5I01A 4HRVA 1DIOB 2H0RA 1HLDA 2VZ8A 3MBOA 1TL7C 4J49A 5K8IA 2OT3B 4TYMA 4KH1A 3CVVA 4DUGA 1L5OA 3K9HA 1HFKA 1SVNA 1NW4A 3CUVA 4II7A 4KPFC 3ZV6A 3LHSA 1K5GA 3MCUA 1CE8B 2AKAB 3FKJA 3JZFA 2E4XA 5IVPA 3FKSA 1A72A 3T1YB 4L9SA 2CJPA 1FNDA 3IX7A 1ZXXA 2BHNA 2L18A 3FFXA 4C88A 5ESWA 4HBGA 1AA6A 4MDHA 2VP2A 1I6MA 1M72A 2QOEA 2R68A 1ZW6A 3C98A 3C0KA 5TV2A 2VJKA 3VR5A 4DM4A 3ZHBA 1GPLA 2FWIA 1YCHA 1GGFA 5JQGB 4QWMA 3BXGA 5E2BA 4K88A 3UAWA 1OLUB 5ADWA 4XIGS 5AKJA 5C5EA 1T9GS 3BSFA 2XH8A 1KI9A 4NJOA 1MFPA 3S68A 2MWMA 3KPWA 1CDEA 2QNRA 4R6WA 2ZG6A 5HZMA 2WF5A 3GYBA 4LQ4A 3SI7A 3A9CA 3ICOA 5LBTA 4D81A 3ED1A 4CF7A 1RI2A 2XQIA 4PG4A 1X1TA 1I1OA 1XZQA 2EDAA 3E61A 1LWOA 2Q9CA 1U8UA 3I73A 4L7QA 1W6UA 4RK6A 1AQ6A 1GIAA 5C8YF 3I5YA 2ZT7A 4KZKA 1ZHFA 5A3SA 3CN9A 2VDJA 3H8SA 2P35A 1E6CA 2CL7X 4J0KA 4BATA 2QUZA 3H8WA 1QH1A 5DT2A 4QQNA 3AZOA 1YMQA 2J46A 3WE7A 3ZWNA 4B4DA 1NUTA 1P7ZA 4CDRA 1JAIA 3K6SA 3ESXA 1XQ6A 3NM6B 1X3SA 3IA2A 2QM7A 3RS7A 4Z4HA 5F35A 3PRHA 5HJ2A 3ETGA 4QIHA 1JSLA 4EH1A 3ELDA 3DCNA 1SBIA 1C8VB 3E27A 3NWOA 1J5XA 4WW0A 1OXSC 4KXLA 5GOZA 3OQIB 5EG5A 5FJJA 4B4WA 3TRHA 3I1FA 2CE2X 3OCCA 4YONB 3GFQA 3L6UA 4X41A 1MQ8B 2VDKB 4FEYA 3SFZA 1GSOA 3TEMA 2FN4A 3UMCA 1KAQA 4QGFA 1BMFA 1IJEA 1DWQA 3H16A 3PNKA 4YAFA 1H6DA 1FJGB 2FVXA 1JKMA 1SG9A 2C5FA 1SUFA 4G8BA 1K88A 4DDVA 1T8SA 4PLCA 4R3WA 1L5GB 3OZTA 3ESYA 4M2LA 2JARA 2IV7A 4FCTA 4EKYA 4J90A 4OQFA 5MGBA 5E4JA 4W7SA 2VWGA 3EIUA 3R0ZA 1O95C 2ZITA 3NO4A 2OUKA 3UKOA 3VDRA 3UZUA 4YCCA 4ZVRA 3A4LA 1OXVA 3PEEA 1NBWB 4IQ4A 5BV1A 3ZQ6A 2C95A 4HS9A 1JJAA 1EBBA 4JCCA 2P7IA 3ZWPA 3JVUA 1OH8A 1CF9A 4QUBA 4TQGA 1YBHA 3ZJYA 5KNDA 4KQ1A 4QOGA 3V1KA 1ZD1A 4ARIA 1A2QA 1UZMA 2QTFA 3ECAA 1RP7A 3A4IA 1K6MA 3EVEA 1DOZA 3DPSA 3L92A 4JEHA 1ISJA 1L7RA 1JWAB 1NVBA 1PG2A 2L69A 3VO2A 3AI1A 4PO1A 4BWGA 3EWAA 1IHOA 3ICVA 3L18A 3OUTA 1E9RA 3ZHTA 5GGYA 4O08A 1XVAA 1K6XA 4Y6RA 1V3TA 1WD5A 1XDWA 3BAZA 3SQDA 2PTGA 1QDLB 2CMFA 3AK4A 4FXPA 4YQYA 3ANXA 3KJHA 2FRXA 2GT1A 3HLKA 5KJ1A 2EGUA 3OX2A 5H81A 3ASYA 1X9GA 4FGJA 3AI7A 5G02A 5JCOA 1F6DA 3F7MA 2NVOA 3DCYA 3QXJA 4NJEA 1ZJYA 4CUZA 3FOFC 3FWKA 4QRHA 2JZOA 3IBYA 3SAJA 1KA9H 4DCJA 4B7XA 1YCDA 2PGIA 3OIYA 1QAQA 2ZRLA 3NFYA 1Z7EA 2CUZA 1C2YA 1SBTA 4I4TA 4KDFA 1ZVKA 4JL8A 1A5TA 3PFNA 5B2EA 1N6OA 4KBGA 4HDNA 2Q0HA 1O96B 4X1OA 2VP5A 1NVEA 5F3WB 1RWXA 4FOOA 2BBWA 2LWIA 3FCXA 3OLWA 1JR6A 3WMFA 4GOJA 5TARA 3I5MA 4O4HF 1XXHA 4CIAA 2QLFA 2WIGA 4UHFA 3QF7A 4PRLA 3TQOA 1II8B 2AKYA 2A5DA 4E33A 3HZZA 4PR0A 4UU7A 3O8CA 4BV2A 3VU9A 5AM3A 4JI8B 5K0JA 5J5VA 4CG0A 4A8PA 1T4CB 2DCUA 5AXCA 5SY4A 3HE3A 5LSAA 3B60A 2EKPA 2GRUA 3ML1A 4MQUA 2QSUA 4XTCS 5JXWA 3KK0A 3HDYA 3R7FA 4ZTUB 4LZJA 1PSZA 3BGVA 3O8DA 4PO3X 2Q9UA 3PR1A 1U02A 4ZVUA 4M9SA 4FN4A 1XQ1A 1KJZA 1KJYA 3MCZA 1R1DA 1H9AA 3NDJA 4LK3A 2HK8A 2X41A 3QBVA 3T3PB 3LV8A 1G7SA 4CKBB 3KS9A 1T8YA 1Z38A 4O1IA 3SS7X 3PA8A 3KAQA 1RS0A 1Z4OA 2Y4OA 1VI2A 3ZQUA 3O95A 4DR2B 1E1RD 1ZM9A 2WJGA 4K3UA 3QKTA 4PO9A 1LI7A 2AT1A 2XMDA 1VE5A 5IKMA 1OFTA 2IF0A 2OAEA 4ZO9A 3KBBA 5DK4A 4BVAA 3USCS 2WSYB 1W85A 1FLDA 3EXHC 4GZ3A 5AT1A 5JI3E 4LJ4A 1QZXA 1A9TA 4QOIA 4YB8A 4DNOA 2FX2A 3UA4A 5TIIA 1Y1LA 1EBUA 4AMYA 4AY4A 1RAAA 4BLPA 5EHZA 2ATXA 2P3SA 4RH1A 1YVPA 1AXEA 3ZZNA 4BKOA 1BCRB 1ORIA 2HA4A 3GD7A 4LY6A 4MVJI 5AI4A 4BX3A 4DMRA 5A4KA 1A4UA 2EKBA 3Q3VA 2FH5B 3RYTC 1GTJ1 3EEFA 2AZTA 4EG3A 1OXKB 3NR2A 4GKJB 3BMXA 4H7DA 2W2VA 5AICA 1ZK3A 1GAXA 1EDOA 1ZDMA 5H70A 3OX3A 5AP9A 5CB0A 4BQOA 2J07A 3ZWKA 2YWXA 2M6SA 4BO2A 2PX2A 2C3YA 3HVUA 4A91A 3T41A 1L8LA 1ZM2A 5KSOA 4WBNB 4ECEA 4E12A 1R9JA 3OQPA 1AV6A 1ULZA 1Z74A 2UU9B 1XYGA 5AJTA 2OXIA 5EE0A 3AEYA 3CONA 1XLUA 1YJ8A 2WSBA 3PNPA 5ALRA 3ZDFA 4YFYA 4HLCA 2OE2A 3IXQA 1HM5A 4EJ2A 1UMCA 2GESA 4PFJA 4URHA 1IZYA 3QVGB 3UHAA 2GR9A 1BMQA 1P62B 2I8CA 3IQEA 3ZWVA 2GN6A 3NDPA 3LW8A 3IT2A 4UHCA 3R5SA 1PSDA 4HSGA 3A6FA 1T4DA 2CVHA 3THRA 1WMBA 1CZRA 1TMGE 4DLWA 2XOKD 1FMTA 4K46A 2OFFA 1VB3A 1Z29A 4JODA 4HRYA 4LQLA 4HLUC 3ZDZB 5FI0B 5FX2A 2O8FB 4MUHA 5I47A 2ZRAA 4OLFA 4O4JA 5BUQA 1DQYA 1VYTA 4YGXB 3W6NA 5IU6A 1AUXA 3H04A 2WF6A 4LV8B 1GPBA 2VDWA 1KYTA 3AEXA 1KVUA 4QQFA 3WLPA 4YRNA 3C87A 4EEZA 4IIJA 4YRTA 3AF0A 3JQFA 3ZJ4A 4O4LA 1TI7A 4NV0A 4ALIA 4GO1A 1UXIA 2YHUA 3A1SA 3OOWA 2BP7A 2QL6A 3RHZA 4DSNA 5HZGA 1N77A 2ACEA 3ZD7A 3LBYA 3QUQA 4EY6A 3LUCA 2IU4A 2WSSA 1TD1A 1WZNA 2HW8A 4EECA 2C20A 3RG2A 1JI3A 1IQRA 1K9SA 1RQXA 2XVZA 3SQOA 4D6PA 1C14A 4CL0A 2W98A 4G0XA 1X8LA 4OIFA 3F8TA 3OKPA 4ASUA 4RPHA 3G6WA 1CUWA 2A4MA 3RC3A 4JH0A 1QGUA 1RYHA 5KJCA 3KYDB 4UUBA 2AWNA 2JH3A 1CZUA 2I1WA 4GL4A 4QGSA 5K8JB 3GWGA 5J4HA 1JMVA 4QELA 4ES6A 3H84A 3MTGA 1OX5A 4R1LA 3EXHB 1MB0A 4DFDA 1PWEA 3CKYA 2VDRB 4GYKA 1RE0A 4B3SB 3I39X 1D1SA 1C3VA 1KHTA 5ICCA 5EHGA 4JY7A 3KXIA 2X9NA 4YECA 5GOTA 2EVWX 4E2ZA 4G37A 5L3SB 2BVNA 1G6OA 4L50A 2MCFA 4LHZA 4NNJA 4CCSA 3BMOA 3SBOA 3GL9A 4MR7A 3UQZA 1R9GA 3H86A 5F7OA 1EFVA 1JJIA 4M1EA 4EMUA 4XLZA 1VTKA 3IAEA 2AEEA 4HDQB 3N86A 3AV0B 5KVAA 1U31A 3E4CA 3INRA 3OIDA 1KPGA 3PZBA 4LXHA 2PU5A 5SY6A 4J03A 1BKSB 3ZHQA 4DIKA 3KDSE 3P9ZA 4BQEA 4EJ6A 1ZK4A 5A7FA 5PGMA 3A70A 1Y3FE 3LO5A 1PR4A 1JMYA 2P40A 5EEGA 2R25B 3MB8A 1CRPA 3MWYW 3IAAA 1KJWA 1D2MA 1ZOSA 2YWRA 2QPAA 3TS1A 4U8HA 5TX7A 5EMLA 1X2EA 2WKWA 2FKNA 4ZCRA 2PJRA 4UD2A 3C16C 2I91A 3WGUA 3EZNA 3HVHA 3UT5B 4BE4A 2D1YA 1UDXA 3DZGA 5FH9A 3KELA 2OYRA 1E1QD 3F4KA 5A1JA 3H5IA 1XDBA 4RY9A 3JS5A 3I76A 2O3SA 3LC0A 3M1IA 4HQKA 1KJNA 4G01B 4HEA1 3WFJA 3QYJA 1ZRNA 2ZCUA 2O0HA 3IQZA 3N75A 3PDWA 1VLHA 2C97A 1L5VA 4DR5B 1Y8QB 1GTSA 4BAUA 1BZYA 1AN0A 5JG7A 5M2QA 2GXAA 1J2RA 1NNI1 2VWQA 1UKBA 4IMRA 4L3VA 2JGKA 3G8DA 4QSMA 2GAJA 5J4YA 2HA6A 3TZ6A 2XW6A 4JLOA 3U5ZB 3E81A 3FSJX 3ZZUA 2J4FA 4TS3A 4K40A 3P2JA 1DWOA 6LDHA 1MO4A 1ZWKA 3MJTA 1KYQA 3WL4A 4DA7A 2A94A 2AZDA 5FP0A 4HNTA 3NHUA 4UARA 3Q8KA 3L4BA 2I4TA 3DDCA 5EIXA 2B4YA 1WHSB 1RYZA 1WWKA 1GYRA 3GFVA 1LZLA 4AYTA 2Z9BA 2WA2A 5T4HA 1WXXA 1YR1A 5JT1A 3A6PC 1USWA 3FDIA 2J3KA 4QFBA 1WNTA 3I64A 3CRMA 4LRUA 3TYXA 1PWHA 1UM9A 2HDWA 5DI9A 1T0PA 1A4RA 1FU7A 3MUOA 1EWQA 1WF6A 4TQUS 3C7CB 4QREA 2PH5A 3F4LA 2AUMA 1BSVA 2QAGC 1VIDA 1FXSA 3IAUA 4LGVA 2V1UA 3B89A 1XZ8A 2EFGA 2MR6A 1CQZA 3UAXA 5DSZA 2LZ0A 4L8LA 3KJQA 1NXXA 4KCGA 4B74A 1U0JA 3W5AA 5LJIA 3OWXA 2XMRA 4RWEA 3QX8A 3B2EA 2NUAB 3BXHA 1Z26A 3QGMA 2VS1A 2LRHA 2A5LA 2VSNA 4XIYA 5LN1A 3IP6A 3DP7A 1A5SB 2H5JA 2WC1A 4RH3A 5AKHA 3CBQA 5I9SA 3CR8A 3DAYA 4MWSA 4U39A 5AM5A 1ZITA 3RBAA 4PZEA 2PKXA 3RUFA 4CEHB 1CSEE 4PRKA 4QXOA 2DBYA 4QUIA 1NSYA 4RPGA 3BRWD 4I2VA 3H0CA 4ZAGA 3SYTA 4HEQA 2H54A 4WJLA 2IDMA 1E0SA 2HU8A 3Q98A 4MICA 4HDRA 1JVBA 2YZKA 4A82A 2R1TA 4QYXA 1XZLA 3EA0A 4HXYA 3S6JA 3SEQA 1ABFA 4RK7A 1Q1EA 5CX1A 3VZCA 3PJGA 5EZ5A 3W2TA 3D6HA 3KD3A 3ZBQA 5LJLA 1XDZA 2VUUA 4DKXA 1W5EA 4HK4A 5F7XA 2YV4A 2X0IA 4LQCA 2GZDA 3PL5A 4DRXB 4EX7A 1NJ1A 1UAYA 3AG5A 4OUKX 1IN6A 4DDTA 1G8PA 1VKNA 2Z2JA 2A9JA 5FTNA 2QTBA 1RKQA 1OV4A 2JJ1D 2YQ5A 1FFXB 4HAXA 1WHTB 4GUDA 3LYLA 1W76A 3DMNA 2BTEA 1RLOA 2GK6A 5C51B 1OASA 3GUYA 1TX4B 3NEPX 3OPMA 5EKDA 3RK0A 1YS9A 1Z75A 1PEYA 4AJJA 4CR7A 3I9FA 4IZOA 4TT3D 5JVDF 1I0IA 2JIQA 2VHXA 5CK5A 1J0CA 1U80A 3B7PA 13PKA 5HA5A 1KEKA 2BYTA 3BE6A 1QE5A 5E1OA 4TKUB 4MW4A 3CRQA 4Z0PA 3FMPB 4UATA 1Q12A 4G24A 5F7JA 1T2VA 3TX6A 2G1JA 3OM8A 4M76B 2PYZA 2TMKA 3HZHA 5IABA 1LLDA 3OTWA 2DBZA 3B6ZA 4WECA 2WM3A 2X13A 3K1AA 4JUDX 1TUBA 3E7PA 3UWOA 1Q57A 4HYYA 1U9ZA 4NJMB 1N34B 3QLTA 3OQBA 2HCTA 4AZ0B 4QJ5A 1CFZA 1ZGZA 3D3WA 5CW2A 2VJYA 4FOPA 4ZARA 4QASA 3JAMA 1T9KA 1PGPA 1QP7A 1H3EA 5SY9A 4MYTA 2NV0A 4D0LB 4BKPA 5DMHA 3T5AA 1RHQA 4MO2A 3GQBB 3U7JA 5DHAA 3OTOB 4RHXA 1XTSA 1XOIA 1UR5A 2VLIA 3BHMA 3TTSA 5CFMA 1L4YA 3AINA 1W4CA 2IE0A 3D8SA 4CNBA 1JDJA 4REMA 2P1RA 5IC5A 1JFLA 2PCJA 1SOMA 4RAOA 4MPDA 5F5NA 1K3TA 1YB7A 2YTZA 3WICA 1HYEA 1MN6A 2C9OA 2WJYA 3GUCA 1Q7BA 2VVTA 3BK1A 3C39A 3QFCA 2EKDA 4JUFA 1CP3A 1W52X 2VZ9A 4TMYA 5D3MB 1B8NA 1Z4JA 2CJFA 4GR9A 1LB1B 1K8QA 2ZJYA 2ZU6A 3R09A 1BIFA 1TU3A 2LGJA 4KWTA 4R2JA 2QU7A 1ACLA 3B6IA 3IAM6 1KQ3A 2HD4A 3V8QA 4MV1A 2NQ2C 4MRSA 1EBFA 1AV7A 1RR6A 3DUFA 3EISA 4JL6A 4YUAA 3WK9A 3ZGOA 5CBPB 4JI3B 1BQ4A 2EARA 3U3DA 5K3OA 1KOFA 1VA4A 3C3WA 4PZZA 3OJOA 1DJLA 4JDPA 2FSSA 2OCYC 2OZLB 2O52A 5D3KA 4O2AB 5M34A 2MTBA 2WJIA 1E2LA 1M2KA 3U4QA 4GMHA 1J1UA 1J21A 1E4OA 4MXDA 1U0TA 3A0RB 5TT1A 4PZDA 4ZI7B 4KO3S 4ZMRA 4J0EA 4LWQA 1WZ2A 3VSCA 1ZMTA 1GTG1 1O94C 3N8GA 4KXFB 4TLCA 2Q5CA 2Q7XA 5JJIA 2RHCA 1FDOA 2P4HX 3A4YA 1PFQA 3UPDA 4NCJA 2RG7A 3GLHB 5AW6A 2WIDA 5EJFA 4P84A 1CLUA 3AOEA 2GBCA 3K05A 4I9FA 2OCLA 2W90A 2FETA 2C4NA 4HH0A 4OV6B 2C2ZA 4RDHA 5U9CA 3HM2A 3GOHA 1J8QA 1XKTA 2IA5A 4X61A 5AM1A 1TIKA 1U3UA 3ONWA 4UVDA 4E46A 1A9XA 1RD4A 1P75A 1XNHA 4ESOA 4HXGA 4QARA 1CUXA 2Y4NA 4IDHA 4M9ZA 4RF3A 1MH9A 2VYQA 4S1PA 1KKUA 1H65A 3HU1A 3VHLB 1A8IA 1NONA 5EIWA 4B45A 2GCPA 4BN0A 2C78A 4YASA 3TUIC 2J9FA 4TYQA 2XZOA 2DLCX 4HLQB 5CPBA 4NBNA 2JEYA 4PHGA 1SIUA 3G0CA 1Z6PA 3AKEA 4FEAA 2Z8XA 3JVIA 2NU7A 2GETA 3E5RA 2JH9A 4I5DA 1QO7A 3ZW9A 2FMIA 2D2IA 1T2DA 2I7DA 2JKZA 1KKLA 2RJ3A 2H2HA 4K9NA 1JU3A 3SU8A 1NVFA 4BHTA 4EJ0A 5LQNA 4YCNA 2QMHA 4EUHA 4E3WA 1J97A 4V0KA 1NVTA 3QKRA 3L7LA 3WNBA 1GOTA 3RROA 2HFKA 4FD3A 3KOXA 3WOHA 3REOA 3BWVA 1LQTA 2NZUG 2P0AA 3E03A 3EYWA 2I54A 3KV1A 2AYZA 3L01A 2GQ0A 1LSOA 2NXWA 1QQTA 3E3OA 1CUJA 1SHTX 3Q4GA 8ABPA 1CR1A 3H1BA 1R10A 3AL0C 1E62A 3F67A 5K3AA 1CR2A 3BC1A 3WKCA 4BTEA 3DOIA 2PPLA 3OURA 3LUGA 3PFIA 2GCEA 4RELA 1VKHA 1U3VA 3H3JA 3W5DA 1HG0A 4B17A 3FDFA 2PKYX 2X2PA 1QCCA 2QE6A 4WKNA 2VYFA 3BB3A 4NQZA 3W2EA 1ZD5A 4XDGA 1Y6GA 2ANBA 3AU8A 5CDYA 2HU2A 1G1AA 2ZB8A 3PQ3A 4WFJA 1JDVA 1PWXA 1XU7A 4BQFA 1IOVA 2B4RO 2QRHA 1DTSA 1YC2A 2CSUA 2R1VA 2ZOSA 1HC7A 4HDMB 3PUZA 3V8BA 3ZCQA 5CG1A 2BFBB 4J0QA 2Q2OA 2A88A 1XEXB 3I62A 1FX0B 1G9SA 4E51A 5EXXA 1JAYA 1ZINA 1L7BA 1YQUA 1YRWA 3OAAA 4Y2YA 3TTYA 3NHRA 1D5CA 1XMXA 1Q3KA 4CLHA 1E1LA 4R7GA 3FYTA 5HGJA 1GL9B 3D0OA 3QWBA 3F3SA 3GRKA 2OBXA 4JQOA 1FQWA 2H3HA 2PX3A 3QLEA 2NM0A 4QUDA 3RUAA 4D1YA 1SUDA 2QTTA 1GSIA 1XU9A 3VR5H 4UHDA 1CY4A 4YMVA 3UEOA 1ZNWA 3ABSB 4BGEA 1M2NA 3CNHA 5TMDA 2VYVD 4P82A 4QNNA 1OTYA 2WW8A 2CLSA 5TB5A 1V8OA 1NE7A 5AW2A 2B7BA 1T5HX 1Y8ZA 3RAEC 2JGIA 2V9ZA 2YFYA 3NCTA 4I9UA 1OU4A 1ZIPA 2DWOA 3QVXA 4IUCS 4L5JA 2OHVA 3TN7A 1KWKA 5ADVA 4KYVA 4ERNA 3AWIA 3N2EA 2IP1A 4GH5A 3EGDA 5FA8A 4K9DA 2DFTA 2VZEA 2XWPA 2XYVA 4LJSA 2C4UA 1TJ5A 5EUCA 2A78A 2CHGA 3TI7A 2XCRB 1P60A 1HNWB 1N1MA 3AEUB 1M5TA 1YR2A 2PZMA 3BTUA 4I1VA 2GHQA 3QOWA 5FUMA 2NSJA 3C4VA 1IN5A 1JJ7A 2RCNA 3VA7A 5JE8A 3V7FA 1O3YA 2GEKA 4G41A 3E48A 3ETEA 3Q9UA 1O08A 1EM6A 5EEHA 2JAOA 2YV1A 4G56A 3ZE7A 2H5IA 1D1PA 1RI3A 2UYQA 3N74A 3TFQA 1VI6A 5K03A 3V8RA 3SFVA 5CH5A 3U3ZA 4K9QA 2H7XA 3NB0A 1QG4A 3DBVO 2JAHA 2GJ9A 5ALSA 3O84A 4CF4A 2M32A 3KJFA 1KJIA 4F5ZA 3FW1A 4RXTA 3B85A 2XCLA 2Y66A 3A1DA 3HB5X 4C3ZA 2CHQA 3S70A 4RHCA 3CTMA 4I4TF 2FFBA 4QXQA 4RTJA 4MO9A 4R9NA 2ZTMA 3BIOA 4FMDB 2WVJA 3STHA 1YB1A 3RE1A 4UNIA 2BMWA 3BK2A 4NMWA 5TQ2A 2XMBA 2FQWA 2FJPA 4DPKA 2IEAA 3IMFA 2VAMA 5E4FA 3U80A 3HDJA 1Y1KE 5HIIA 3S4YA 4TTVA 4IIGA 2YJ5A 4JITA 2OFWA 3ILYA 4OFWA 4WZBE 4JUCA 2ZRPA 3ESBA 5DM2A 1QF7A 1NL3A 4UBMA 1E8NA 1I4EB 2F00A 2WJ4A 3NKLA 2MT9A 4GXNA 5A05A 2YCLA 4EA8A 4EA9A 3AUSA 3HP1A 1W96A 3ET5A 4FP9A 4F21A 5J2TB 3PFWO 3UB4A 5FTKA 4MDYA 3RJTA 4Y6PA 3KJXA 3GW8A 4F9EA 3A1NA 4DCOA 4FFSA 4MYSA 1V26A 4D8WA 1QRSA 3L7JA 1EWKA 2JFBA 3PT9A 4IV8A 5FA6A 4BJ6A 5A04A 3WWEA 1TPYA 4KDCA 2G88A 2LR0A 3W2GA 2Z4RA 2DWPA 1II9A 1Z56C 3F6CA 2GN0A 4Y2PA 3HQ4O 4YLGA 4BC1A 3EXFA 1NLMA 4MA5A 2NN3C 5EL0A 2WWYA 2RH8A 2XE6A 1PZHA 3L43A 1NI3A 4I1RA 3RV3A 1YVRA 5HPYB 5J3JA 2Z95A 2J9RA 3QOXA 4DV6B 3B3AA 5ITZA 2WG1A 2R60A 4OKSA 4RA6A 1CPYA 4NYJR 3WLNA 5EY5B 1RVDA 1KRXA 4ND2A 1ZQ9A 3FPFA 3JVEA 1V9LA 1R4ZA 2FPWA 1G66A 2ECPA 1JDBC 2IZ1A 5ALFA 1XTVA 1SC6A 5A7HA 4DOMA 3X44A 2VK2A 2OV4A 4TMKA 5SZKB 1AE1A 1NQAO 1ZH0A 1RYYA 5AOCA 2HK6A 1CRWG 2R44A 2BH2A 5H3LA 4RTKA 2PZFA 1QH8B 4G1CA 3O1HB 4EUNA 4DYDA 1KI2A 2QM0A 1SA0A 3T7KA 5IAOA 1ZMXA 2H3EA 3HU2A 3MRTA 4FZ5A 4GLJA 1E2DA 1WPQA 5H8WA 1A5AB 4YJ3F 3PE3A 3T3DA 1TM5E 3FF1A 4YRPA 2W8ZA 3K6SB 4G23A 3MNFA 2XRZA 5AK5A 4G5OA 4BS9A 1KH2A 4TVBA 2R87A 4R98A 3H87A 2E2WA 4F3YA 2C57A 1I3NA 1NLUA 2B36A 3GFGA 2H9IA 1DELA 3HCEA 2ZI5A 5F21A 1HL3A 2BKUA 2VJNA 1U1GA 3GO4A 3DB1A 1HPLA 2VP3A 3BZBA 3LL4A 3DVAB 1V8PA 2VC2B 2HWYA 3CJTA 3DG9A 1YR8A 4FDMA 4AQDA 4EG8A 1JB1A 3K5WA 4QPPA 1E96A 2YFQA 4L4XA 4MIEA 3TM4A 3FGOA 5EQJB 1NBEA 3FZNA 4RA9A 2ZJ8A 1CX9B 2GEFA 2F1JA 3NHBA 4UUAA 1OB2A 3PENA 3M2PA 2J9XB 3TAHA 3SJ7A 3GC6A 4WDQA 3W8RA 5CA0F 5HCIA 1NRJB 2I76A 1Y98A 2MU1A 4MH0R 2RH5A 2QSYA 1Z4MA 3JQGA 4UAGA 4PU0A 4KU4A 4N01A 1AUPA 3ORYA 1PL8A 1T6YA 5D8DA 1OBOA 3WGJA 4Z0TA 3ZY2A 3HCFA 4PCLA 3E7WA 1NJFA 4H4DA 1DGQA 3D6JA 3EK2A 3CU5A 3A1TA 4FE3A 4O4JF 5BR4A 7YASA 1E4YA 3AILA 1BQEA 2QN1A 3UK2A 3B5IA 1VIAA 3EHDA 1KS2A 1KYZA 1A95A 2CUTA 3CV3A 4LYDA 3BE4A 2VXCA 1D2CA 1VRWA 3IAFA 2KLHA 4LJKA 5TEVA 3ZHCA 3ORQA 2AFVA 1DJMA 3T9AA 5CLJA 4LJAA 5A62A 2VTKA 1R7RA 3VX3A 1RT9A 9ABPA 2JHCA 2R6CA 2ZE6A 2NTNA 4Q9LA 4HPXB 5D85A 3CMCO 4TV8F 3CH5A 3OZSA 1Z8HA 4QUGA 3U7GA 2Q4TA 2YZ2A 4Q24A 4BGVA 1NJ6A 2NVUA 1T8PA 2CUKA 5EGNA 1EHYA 2R4UA 4F71A 1HQYE 2W70A 1BRMA 4EITA 2ZT8A 4Y18A 3I4FA 1Y7TA 1ST3A 4KVZA 3WA7A 1A2OA 1JNXX 2VRNA 1DAOA 1XZJA 2ENUA 2FR8A 3GIWA 4OU4A 2VT6A 1YCFA 3I2JA 4TUYA 2GAAA 3LXXA 4CFSA 1I36A 1F8XA 2JD1A 5EJ7A 5KBYA 1JDBB 4F3NA 4MWOA 2ZB2A 4XGIA 4AZ3B 3TLMA 2WDZA 1NC1A 4FI3C 5FO1A 1FSFA 1FXWA 1SVWA 2Y1KA 3C3DA 3IP9A 2OEPA 1Q2UA 5G0VA 3REGA 5LR6A 3I61A 4WKPA 2OG2A 2XQGA 3EGIA 3EXIB 2Y71A 3N58A 1HF3A 4Q34A 2CSXA 3VU9B 5MN4A 4AW9A 4BNMA 2R97A 1J23A 4LDZA 3G2MA 2O7QA 2IZOA 3HB1A 3M1YA 3WWOA 2OECA 4N6GA 1ZONA 5DLDA 3FHOA 2E48A 4A6EA 1SHKA 2QT1A 1AGYA 3P2MA 3BIWA 4ZC1A 3UUFA 3FF4A 4J7UA 4KVAA 4CF6A 2HMYB 4LF4B 5UKDA 2OVFA 3JPYA 3MCVA 1J56A 1BVUA 2J1LA 3CRNA 3Q2KA 5JXJA 4DYVA 4L95C 1N7GA 2GYWA 4FFWA 1XCBA 3CSUA 4YC7A 4YALA 5L53A 4ZO7A 2R65A 3KO8A 2P6MA 2XMGA 1NTRA 5E1MA 5T8KA 2PUEA 1QV7A 3ZJVA 3D8NA 3WGMA 4BNUA 4JP1A 3F5DA 1V11A 3NT5A 4KREA 3WIBA 3CA8A 2O1EA 1CZNA 4IS2A 4MW2A 2DYKA 1N9GA 1W85B 2FXIA 3PHJA 3ODPA 5CT6A 5H4GA 2Q28A 1KERA 3IOBA 2Q6VA 3AR7A 1DIRA 4DR6B 1R37A 1RI5A 1TA4A 1JEYA 1VKZA 4PBRA 1TZBA 4L0DA 3LPCA 1Z0JA 4NBRA 1BXRA 1U94A 3O3OB 4S3MA 4Q1CA 3OETA 5TY0A 1KGSA 1T6BY 3EAGA 4Q15A 3RARA 4O02B 4EFKA 4J91A 4Z1OA 2WKQA 4RW0A 4CTKA 6NULA 1Z16A 2F3PA 2E6UX 3K0EA 4QFCA 4RMJA 1MIHA 1K7XB 1T24A 2V6IA 1NDHA 1YJAA 3RVKA 1X1AA 4XWYA 4RJIA 1IQUA 4D9MA 5BOSA 3VDMA 5IJ9A 3UGKA 4XUGB 3NNNA 3ZIDA 3CEPB 3VAYA 4UEWA 5IEBA 3ROQA 4A0RA 4EFMA 4ESEA 1KQPA 1XMVA 1CR6A 2ZQZA 3FMIA 3KB8A 4JT9A 4O1MA 3V7YA 5HJ5A 2RGNA 5JSHA 3C3YA 2RB4A 4Y30A 4F7DA 2YVQA 4ZGGA 5AKKA 2QTRA 4DNPA 5HILA 1ZHHA 4Q02A 4IVNA 4WXEA 2YYSA 4YP5A 4DVJA 1E9SA 2X5NA 5AIAA 2HTEA 1S8NA 1XQWA 1B6TA 1O8CA 1ZNYA 2WSMA 2ZSUA 4GWGA 4WZAA 4D0GA 4S1TA 2VUIB 3PG5A 1L4UA 1YJQA 3RSOA 4ZHQF 3Q1LA 4HRAA 4XCVA 3TIGA 5BYKA 3LGSA 3ESQA 4KQ6A 1KC3A 1L8XA 1Z2DA 3KB6A 3F5FA 1SHLA 3H2IA 3ESRA 3I04M 3MYYA 3OZRA 3I28A 4O4IF 1OZ0A 1VGVA 4OI4A 5DU2A 3WB0A 1HXHA 2DF8A 2V9PA 3P20A 1PP4A 3SJCA 1PVDA 4I1SA 4PE5B 2F4VB 3HKCA 1B6RA 3CMMA 3U7QB 2RAFA 3RIGA 1TJ4A 1EFPB 4DPLA 4FE7A 2ST1A 3FNEA 1CUEA 1Y1QA 4MKHA 3KR1A 1QVVA 2ZYHA 5EA2A 2Q3FA 2ZS7A 2VDWB 3D3JA 2WT4A 3IAHA 4EK9A 5BSHA 3WLJA 2VPWA 4IIJB 2AXEA 1G41A 1KFKB 4EHLA 3WLLA 4O4LB 1YFKA 1ZK0A 1HOXA 2GNOA 2V4UA 1HDRA 3D3QA 4EMBA 3CKKA 1KDTA 2J8ZA 1S01A 3PC8C 3MSCA 3DXFA 4KXYA 1W8IA 4QODA 2Q5HA 5CURA 1Y6JA 1PLJA 2OGZA 2FUG1 1HE1C 4HO1X 4KBFA 3RHFA 3KQQA 6ADHA 1DAMA 2ZYIA 1D2NA 2HK9A 1TQ8A 1V43A 3BJEA 3OJEA 1WRBA 2MYPA 4QAQA 4HX9A 3SF8A 4BFWA 2CKMA 4N48A 2O19A 4N54A 1JDTA 4V1CI 3QPBA 2XOXA 2BMVA 1EFAA 5JNWA 5EJMA 4C0QC 4OOEA 4WCDA 4E08A 3C7AA 2XIJA 4IIYA 1UFKA 2I4RA 4AKSA 1GNTA 1LPMA 2WUGA 4B2IA 1PEKE 1CVRA 1QGUB 2PMCA 3K5HA 1AC5A 1P33A 3CSDA 2NP7A 3PFGA 5AD1A 3ZCVA 4HXFB 2ISQA 2BZ1A 1XIVA 1Q21A 3IUEA 2AC7A 4LVUA 1FTSA 4JMLA 3QPCA 3IKTA 3FWPA 2O1SA 3L7IA 1JVSA 1VPDA 4X6LA 3NP7A 4WCVA 1JXMA 2E6KA 3TCKA 1JFRA 4JVMA 5JNUA 2G08A 2Q5OA 2IDKA 1LLQA 1V8ZA 3HG7A 3R8XA 1VPEA 3BEOA 4HDSA 4NP6A 3WL8A 1MGOA 4N6OA 4MR7B 1ZO8A 1ODJA 3JYQA 2AJTA 3QW4B 5F64A 1SCBA 5BOVA 1QQBA 1NFFA 4FLEA 3H2SA 1BS2A 1Z88A 4RHUA 4EABA 3U3RA 3ZI0A 2QRLA 2BD0A 4OHYA 2CNBA 3H2JA 1V7CA 2X6QA 5CDGA 3MWEB 2BEUA 2QPTA 5BQ5A 1PVOA 5CXSA 4BRSA 1ORWA 1PFYA 1RLMA 2Q9BA 3EAQA 3O4HA 3VFDA 1XNQB 5AVQA 1XZBA 3CM0A 4F9TA 5F3DA 3E70C 1CQPA 4NIMA 4NU0A 2VHJA 1NE2A 2P2YA 3HNPA 3CVUA 1MU0A 3WLEA 1UBHS 4WXRA 4I1UA 1KO8A 1TAHA 1JI0A 3DLCA 1GV0A 4PR3A 4Y0AA 3V1YA 1Y37A 4DQLA 2RHMA 5EIAA 2OC4A 4GOXA 1S2IA 5D5PA 3WLMA 1IWPB 3DQQA 3GRFA 4EDFA 5JAMA 3IDSA 3P9IA 2VPXA 3UOGA 1FBTA 5LUBA 5FPTA 3A36A 5HJ7A 1FRVA 4ZDJA 1JLMA 5AW7A 1KBZA 4XR9A 5JMPA 2A2ZA 4QE3A 2ID9A 2DQ4A 5E0OA 2Q49A 3IEXA 1XD8A 1ZXBA 1EQAA 2Q62A 4D9BA 2AN5A 4U63A 5B2ZA 5CB4A 2DPYA 1J24A 3WGZA 1DINA 2J3EA 1WZIA 2NZJA 3R0VA 4R2XA 1WA5A 1NMYA 1VHDA 1L5RA 2OG1A 4M46A 4RCYA 3IULA 2GPSA 4ZGBA 2WMOB 3BJZA 1GN9A 3IOMA 1UM9B 1HEUA 4NFLA 1PJZA 2BJWA 4CM1A 2IUYA 3T3EA 1TQ2A 3SPXA 3IIIA 3A0UA 4K6FA 5FL7D 5K4HA 1KK1A 2G77B 4PYOA 2IYQA 5D5HA 4AXBA 1OUMA 1E6EA 5KTPA 3IC5A 3DZ8A 2YYZA 3FPAA 2YMMA 1C8LA 4C4RA 2JKYA 1M8PA 2Y27A 2FEMA 3VR4H 3R23A 3RSGA 3ZHUA 3PNVA 4K05A 1M1NB 5FHRA 1ZJ5A 1FP4A 3IERA 2IZ7A 1D0IA 1Q84A 4R1QA 3A7EA 2O7SA 1VL5A 2H48A 4I50A 5CVJA 3RRZA 4D4GA 3DEFA 1JFFB 1GN8A 4PRZA 4LZOA 4F91B 2JAPA 3MGAA 4GLOA 2D4HA 3THYA 5KYTA 3UH0A 2CLKB 1CD5A 3IQFA 3NTVA 4BVBA 3B1WA 4Q9HA 8LDHA 1J33A 1EJ2A 1SPXA 3A1UA 3E0XA 1U6IA 1NX9A 3FUTA 4JR1A 3I23A 4HDRB 1U9IC 5E2IA 5CBKA 2R1TB 2Z83A 3D0QA 1NBIA 3EW7A 5ALLA 3ONDA 2YFHA 2PH3A 5F9HA 2HA5A 2PUWA 1Z5OA 2OGTA 2PQ6A 2QS9A 5DCWA 2NPOA 1C1XB 3BGDA 3FMGA 3H1AA 5IN5A 1YR3A 1YVUA 3X1JA 4MUAA 4NZMA 4TL7A 4E7OA 3N8KA 4NCBA 2G07A 1VC2A 1RLJA 3AEKA 1UZUA 4MRVA 5G3YA 5IM5A 1N6PA 4FX2A 4Q1BA 4BO0A 4J16C 4BU1A 4PANA 2FPGB 4M6WB 4UDXX 4ILEA 3K31A 4CGYA 1THMA 4CV2A 3DZBA 4IW3B 1Y7LA 4C14A 4WOKA 1NV9A 1WSBA 2O2HA 4O8CA 3W3AD 2C54A 5HUHA 2O48X 3WB1A 1UF9A 4NABA 4FFBB 4MQ4A 3VYUB 5LQDA 2AX3A 4MJ7A 5DV9A 3G89A 4AMVA 5HM8A 2XQFA 1Z63A 4TRJA 1GFWA 2W0SA 3PNBA 4U9HS 1L8QA 1E7SA 3NBYC 2M2IA 2D74A 3B3GA 4P4SA 5JZ9A 1Q1QA 4BV8A 3H11A 1FTQA 1WCWA 3GLGE 3OMXA 1X7DA 2C7BA 4B09A 1TVKB 2C2BA 4Z54A 4A2PA 5C3UA 4N3NA 5IDVA 4D3XA 3W7AA 2EFDB 2RJOA 2BHRA 5CA1A 2I65A 1DB3A 1UOOA 1G20A 2WVHA 5A02A 1BJKA 4OMUA 1K6JA 3Q5EA 2E5FA 2REQB 4N0MA 3S55A 5L7WA 1PQYA 3E2MA 2C2MA 2FW8A 4LYJA 4OQNA 4QXMA 4EYOA 2O07A 5EJ8A 2WHYA 3KOWA 3UC5A 1PRYA 2R86A 3AKDA 5KTMA 4DLZA 4C7VA 5J47A 3O47A 4AZTA 1DFGA 3CZAA 4DCVA 4UXIA 1HNNA 5AVKA 4BFYA 2BKXA 3N2GB 1N6KA 3W7BA 4D8XA 2NGRA 1RKXA 3D3WB 4TL6A 3BSYA 1L5HA 3WMGA 1W6RA 1IZ8A 1T3SA 1XD9A 4XX1A 4KR7A 1FVFA 1NV8A 1K06A 4R1PA 3GJSA 4AD8A 4AWAA 5FLXA 1C3LA 2HI0A 3U44A 5A3RA 3FLEA 2VPTA 4KQXA 5ARBA 1AF4A 3ME5A 4V0ME 2GZRA 1EWRA 1O97C 3GEHA 1U6KA 4DEXA 4O29A 3GLQA 1U2PA 4BN5A 3KZMA 3FUUA 3JXEA 3MMSA 1ODKA 4J3NA 4JR0A 1CUUA 2W93A 3H13A 1A76A 5EP2A 3BM5A 3X1KA 3TQFA 4X60A 5KJEA 5DNUA 3HCAA 4WFKA 4F8JA 4J43A 4ED9A 2AH5A 2J9ZB 4PEVA 3VPDA 1X7XA 4HY3A 3VR6D 5IZCC 3G5LA 3R3WA 2CNLA 3VR2A 2C5HA 1PF7E 2B2NA 2D8AA 3EQ6A 4FZJA 3UGQA 4XAQA 1CY7A 2CW5A 3AIIA 1VMDA 4FR2A 4ID3A 3ETLA 5AUQA 4KFUA 4EEXA 1CJKC 3LOPA 1Q3TA 2HRQA 3VHXA 5B3JC 3K35A 5MGNA 2DRIA 4E4YA 2E87A 1XEWX 4GMFA 2XOEA 4KLCA 5EMMA 5A3JA 2WYHA 1ZVJA 1N0VC 3NXKA 5M29A 1NQXA 1VLMA 4HLDA 4ZANA 1XZNA 1UDAA 1D3AA 1UQRA 1ZGJA 2V3CC 1NASA 5CIQA 2JLQA 1FFWA 3PUKA 1XI2A 1M0EA 1WETA 2GBPA 4ZK6A 2XECA 2CDNA 4FDTA 3R3XA 3VPHA 4Q4HB 2W6CX 3A14A 3OCJA 4CF3A 5JRZA 4FYIA 4TRNA 5EXTA 3FMFA 2C8KA 3FNIA 4JLMA 1A9XB 2DVMA 1OQAA 3M1LA 4DLVA 1TW3A 2WYUA 3BMNB 3A4MA 2O2SA 3HBNA 4V2UA 5IBPA 2XGGA 5ICSA 1ZMBA 3V7NA 3U19A 1DBRA 1PHRA 1NVAA 3R3YA 4HWKA 2WAYA 3E8MA 4XCXA 4LHYA 1CDZA 1F4VA 1NG1A 1E1DA 2V98A 3G8BA 3U9TA 1CQIA 3WTCA 1P74A 4BJ1A 5I4BA 2EBWA 5BWBA 5FBRB 2J9FB 4HX5A 4W7HA 3M70A 1WDTA 4ML3A 3H4MA 4A2QA 5HZKA 1VGRA 2QUJA 1J5PA 4PSKA 1XRQA 4Y9UA 3QUTA 1IFXA 2IEZA 1UQTA 2QW0X 2YN2A 2ZUUA 4V0OA 5EKSA 4B40A 4CV0A 3LLCA 3PLRA 4PWYA 5E6UA 2QVYX 3KKQA 4JEMA 3TOCA 5BP7A 4PLZA 5FIUA 1GPMA 1EXWA 2UZ1A 1KYYA 1YR7A 2WPDD 2EFHB 3ONFA 4R83A 5BVHA 4AQ7A 2V0GA 3D7KA 3N6VA 4K2HA 1E5XA 1DPFA 2VXOA 3CEHA 4CXMA 4JBIA 1Q15A 2ECOA 3AMVA 2R2GA 4P7GA 1NMEA 5SZJA 4GLLA 2AS0A 3U17A 1GADO 2CZCA 2WG2A 4CLRA 4E1VA 3LE8A 4M49A 3U6KA 5LFAA 4Q1EA 3KDPA 3DFMA 3KXPA 1SFRA 4IX1A 5FQNA 5ICFA 3RV4A 1KEZA 1Y3CE 4S2EA 3V7UA 3PXAA 4P2BA 3S27A 1BA3A 2GM9A 2FZVA 2NT4A 2PAFA 4B6SA 5HHTA 2VH1A 4K8RB 1UC4B 1X94A 2XITA 2DB3A 4EVIA 3WGQA 1NLYA 3KOYA 5LPNA 1WUJS 5ALVA 3WQQA 1KU0A 2GI4A 4NY1A 4EPVA 5KJFA 2XJ9A 1XFDA 5AK3A 4BFTA 2HSEA 1HT2E 1ULHA 3BAFA 2B82A 2O3TA 3WLAA 4B34A 3RJ9A 4MLCA 1YFZA 5EIFA 2G9ZA 2PT6A 2FEOA 4W4TA 5IAGA 1Z3IX 4ZREA 1NP6A 4LUCA 3EPHA 4CNQA 1N1EA 2P77A 2CN1A 4FQ5A 1U9YA 4AN0A 2BELA 3GEPA 3R1IA 3NATA 3J7TA 3M7IA 3ESAA 5TEWA 1H1LA 3SZOA 2LV8A 2XMSA 4JP2A 2LDXA 4AUEA 2EKQA 2AJBA 2QBYB 4V03A 2B37A 3GH1A 1GUBA 2WVAA 4KPUA 2H31A 1G18A 3JD2A 1F60A 4WBNF 5JECA 2XF2A 2NNWB 2OCGA 4XIIA 4EB8A 1CJUC 4BFCA 2GN8A 2PS9A 2X58A 1L0BA 3JD4A 4EPWA 1OT5A 1KYXA 2VP9A 1OD6A 4G2TA 4FJ2A 4LOAA 1EFLA 1B0ZA 4BMYA 4NV3A 4YUXA 3IP7A 1XJ5A 1V2GA 2WOOA 5HF8A 4DILA 1IY2A 3E2IA 2QRUA 4QQ8A 1YU6A 4GE3A 1R0XA 3PNSA 4LBZA 4P53A 1IRIA 1W93A 1XLWA 2IUTA 3LVFO 3VO9A 3L8EA 3OPNA 2IHKA 2AR7A 3O21A 1L9XA 2WPDA 4PZ0A 3ICQB 1PE0A 1Z2OX 3HXPA 5CLGA 1B73A 1T6ZA 3D6UA 1S8FA 1VPLA 3CLRD 3M5WA 4I99A 4LXXA 4NRDA 4I66A 1U2GA 4YPVA 5EXDA 3R6DA 2JBHA 3TECE 2XUZA 1MX9A 4CM9A 4W5RA 2WD8A 5IC4A 4TWIA 2OL4A 3BXEA 4MUKA 4NULA 3QEMA 4OX9B 3OA0A 1P5HA 2WP0A 2GZ3A 4MUBA 3C8UA 2RK4A 1KQGA 4Z4EA 2BM9A 5IARA 4N41A 2ZTHA 4G97A 1Q74A 4HVAA 2ECQA 4MJXA 4XVQA 2PX5A 3UYKA 3FNGA 3HO1A 4S1NA 1EM8B 4JR2A 4WV3A 1F7VA 4KRYA 2CVPA 3OJLA 1XCOA 2G63A 3M6FA 3QFRA 3C5WP 4IOJA 4NCIA 1WMDA 1WZEA 3PKIA 3L7OA 4PAQA 5FFNA 2JGNA 1ISHA 3BCHA 4RZHA 4TUYF 1UPTA 5EGSA 2WOJA 3B52X 3DSRA 2JJMA 2J0QA 1HE4A 2IGBA 4OXQA 1UPAA 1DC5A 3GBSA 2B30A 4A0GA 1JH9A 4C78A 3LI2A 1DSSG 1WO8A 2RD2A 4GAEA 1FQJA 3DFZA 1K5DA 4X66B 3IMCA 4QDZA 3VKWA 3M33A 3L1KA 3W6OA 4DSTA 4IJUA 2RGRA 2ZIUB 3FPHA 1ZLYA 5AUPB 4CPDA 1KP9A 2YXDA 4ZVNA 1TJYA 3DMGA 4J4TA 2HRDA 5CVCA 5JROA 2UYHA 1G42A 2HA3A 1O54A 3HC7A 1SQ0A 2ZRCA 3BFVA 3GR6A 1LY1A 1H2FA 1TM3E 2QN9A 4TS4A 4YT5A 5DHUA 1EWTA 4FHCA 3IJ5A 3VJKA 4GIBA 4EFLA 3ITEA 4AKGA 3KXLA 4JA0A 5CYOA 1JIUA 4Q6WA 3AH8A 4RYDA 3HSKA 4RHFA 4ZCPA 3FJYA 2G1PA 1OWLA 1IJBA 7MDHA 3AY7A 2OKCA 2YC2C 3FHLA 2EFCB 2LCQA 1ZVMA 1WSWA 3UB2A 4RVOA 3W5SA 5IZ4A 4KACA 4AY2A 2QR2A 1V47A 3ZK8A 5FTWA 1XLTA 3KQHA 4PZAA 2C7RA 4OXNA 3ZQ4A 1R4NA 2WTEA 2JZCA 4RA6B 2P4EA 3EZ9A 3M5PA 1E2GA 1GNRA 2RHLA 1X1RA 1NVGA 2IIBA 2PWPA 2ZRDA 3I58A 3N5KA 2A0KA 1ZIXA 1BH2A 4XQ9A 3I2IA 2VTBA 1DAKA 2OK7A 1CFJA 3FNBA 3OLYA 4UDOA 1BDJA 1OU0A 3PNLA 3EPPA 4FNAA 4M1SA 3WYEA 1VHLA 1AF7A 3NIGB 3WJ7A 1C1DB 2BTQB 3RH0A 3ZV3A 1DU4A 4IKEA 3VUFA 3N2NA 4HNHA 5MFPA 4FGUA 3K2EA 3C3BA 1I0ZA 1L5ZA 4Y2TA 5ELLA 2PLAA 4YJ2A 1OAAA 4F0JA 4QTXA 1LVGA 3HXOA 2P4SA 3K73O 1SA0B 4EGFA 4INJA 5LB2A 5K8LA 5LWHA 1TYAE 1QIKA 3H18A 3QWHA 2WF9A 3B9RA 3NYRA 4NH0A 5LP6A 3TWOA 3GJZA 1K4YA 2P2DA 1BHO1 4MUIA 2P3QA 4JI1B 3FOWA 2VPZA 3CF4G 4M1YA 3SYNA 2C7OA 2OV8A 4YV0A 4WNAA 4HWTA 2DWCA 1AKQA 1QHHA 1D4OA 2IHUA 2X1LA 1TA9A 1IIBA 1EZ1A 4RTOA 3FHJA 3UMFA 5I7HA 1X7YA 4TLDA 5BV7A 1TVMA 4P93A 4UU8A 5KWEA 2IYYA 1TJPB 2QY9A 1WULS 5ADHA 4HNRA 5EXPA 1PD0A 4DY6A 1VBFA 3K92A 4O2RA 5F1KA 1MO6A 4D43A 3BDAA 2X3YA 2IVZA 2JBWA 4EKEA 4P6VF 4LKOA 1QP4A 3ISVA 1LXCA 5SZHB 4RA9B 1P2UA 5BURA 1S2OA 3A1WA 4PLPA 2GPTA 3EGCA 2J33A 5SZIA 3PIDA 5ILGA 1AKYA 4LSMA 4MPTA 3JRWA 3V4VB 3H9BA 2ZWPA 2GBLC 4D3YA 4F9FA 4KR0A 3TNFA 3JQGB 4EHKA 3SNHA 3R3SA 2HBQA 4L6IA 3INTA 1R0RE 4MA4A 1QF9A 5KI6A 3NWEA 1J2JA 1QBKC 1XQ9A 1LW6E 1Q0ZA 5GIPE 2X5OA 1VL8A 3CRZA 4G5RA 4ZVSA 4FC6A 3MJDA 4JC8A 1QLHA 1JLSA 4FW8A 4Q16A 1NKSA 2CLHB 1VG8A 1J99A 4IMIB 4JLSA 3S99A 3TL6A 3DWIA 5CIYA 1N4AA 1HE3A 1Q0QA 1OXUA 2DUMA 1PJCA 3EQZA 2N3ZA 4S1WA 5AHWA 1ZNXA 1JIIA 5DM1A 1B76A 3PUIA 3CUSA 4G4SO 4JCOA 5JZMA 3KLOA 2HKIA 2IUUA 4RIIA 4TYNA 3PGMA 5DGCA 3GFRA 3HA2A 4YT8A 1QTIA 4BPBA 4GPTA 1Z6QA 2A0UA 1USKA 4TMXA 3SC2B 1TZMA 4PXAA 1TXGA 1GITA 4PAWA 2NVUB 2O8DB 4GI5A 1OX6A 3UB3A 5BSTA 2JVIA 4C0AC 1K2WA 2IXGA 2HF8A 4NBLA 4E6PA 2GK7A 3EDRA 3GNTA 2F1RA 4W5JA 5KJ6A 1ZSVA 2JGLA 2VTEA 4V0LA 1CZHA 1YZUA 2VP4A 2R11A 1T5SA 4C7OA 3T8YA 1E8DA 4ARUA 4IDNA 2XZDA 1X19A 4O3MA 2Q6LA 2GTHA 1QG0A 3QFHA 1D5WA 4R8RA 1KZ4A 1NBHA 1OVMA 2WHPB 4Y0NA 5DLQC 4AUMA 2KPOA 1KS9A 1QGYA 2XDQB 3VH3A 2OGWA 2WV7A 3GCZA 1E6UA 4YY3B 4FK8A 3CZ5A 1WEHA 2JFQA 4LZWA 2JA1A 2YN0A 3MZ0A 5CH3A 2O2GA 3WGIA 1M2FA 1WLYA 4MI3A 5ALMA 1MDFA 3C1TA 3PIIA 5FOWA 1QHXA 2V7EA 5F1PA 3F8WA 1U2EA 2HA2A 1XTZA 3VTZA 5C7LO 4KTTE 3PFHA 3PCTA 3WP1B 1GUYA 1S7GA 2V7TA 5CJPA 1F8YA 4AWXA 2FSGA 4TRMA 3DH0A 1KAMA 1XALA 2XMZA 5CFRA 4FVTA 1WL8A 3R0XA 1IPEA 2P91A 3UO8B 4ABTA 1SUIA 1QX3A 5G0UA 1JF8A 3O1IC 1A98A 4DC1A 1YUNA 4HZGA 1ZD8A 2EDCA 3C8ZA 1G5PA 4QGHA 3A6LA 3H2YA 1QIDA 1XRPA 1JSCA 2VXBA 3DOFA 1Z4QA 4X9XA 2E7ZA 3D3NA 1GAQA 4DDMA 5FLYA 4ICIA 4Q6BA 1TTTA 3M6UA 2CEAA 4ZVTA 2V4ZA 4DCGA 1ILEA 3FCOA 4JGGA 1V11B 4DVGA 3P9RA 5L51A 1ZH4A 3R8FA 4HMPA 1ZM3A 1DCTA 1LPSA 1ENZA 1EINA 4OYYA 4PS1A 3GLFA 1DKPA 1N9GB 4BMNA 5LLDA 3ZZ1A 1A7AA 2C5LA 1GU0A 2CMKA 4MZXA 2G7ZA 2FK7A 2BFOA 4FIZA 4DIMA 4ENVA 4WZBB 1JEYB 3AFNA 4I36A 3C6BA 4OD0A 5CHYA 1GG9A 5EHIA 4Z3OA 3TR6A 4A8JC 3RUHA 1G5HA 3HCBA 4DAOA 1AK2A 3L40A 5K01A 5KDOA 1Y9JA 2G4CA 3T06B 1KDPA 1O5TA 4U7FA 3WO1A 4HWOA 2D5AA 1T1EA 1WUHS 1ZA2A 2C2WA 1TF7A 4ZU3A 4LECA 3VZRA 3DMRA 2YS6A 3EB9A 4MKRA 3SSNA 4DLAA 5IAEA 3VVLA 5BN5A 1HT0A 1G291 4Q9IA 1YBFA 2I2FA 1XAJA 2WUEA 4PC7A 4AJLA 5LQKA 2AQ8A 3LT2A 3QPVA 5BOSB 5IJ9B 3NUGA 1E58A 2CWDA 2HC9A 4FM9A 2FPLA 4MYRA 3WGNA 3Q5GA 2DM6A 1BWRA 1EFRD 2FZ5A