The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
67
|
sequence length |
229
|
structure length |
212
|
Chain Sequence |
KVQLSFTLPLKNNERSAEAAKQIALKMGLEEPSVVMQQSLDEEFTFFVVYGNEILSMEETDEYIKENIGRKIVVVGASTGTDAHTVGIDAIMNMKGYAGHYGLERYEMIDAYNLGSQVANEDFIKKAVELEADVLLVSQTVTQKNVHIQNMTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTLNDRMN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
D-lysine 5,6-aminomutase alpha subunit
|
publication title |
A locking mechanism preventing radical damage in the absence of substrate, as revealed by the x-ray structure of lysine 5,6-aminomutase.
pubmed doi rcsb |
source organism |
Clostridium sticklandii
|
molecule tags |
Isomerase
|
total genus |
67
|
structure length |
212
|
sequence length |
229
|
ec nomenclature |
ec
5.4.3.3: Lysine 5,6-aminomutase. |
pdb deposition date | 2004-10-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF02310 | B12-binding | B12 binding domain |
B | PF16554 | OAM_dimer | Dimerisation domain of d-ornithine 4,5-aminomutase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Defensin A-like | D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Cobalamin-binding domain |