1XRSB

Crystal structure of lysine 5,6-aminomutase in complex with plp, cobalamin, and 5'-deoxyadenosine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
212
Chain Sequence
KVQLSFTLPLKNNERSAEAAKQIALKMGLEEPSVVMQQSLDEEFTFFVVYGNEILSMEETDEYIKENIGRKIVVVGASTGTDAHTVGIDAIMNMKGYAGHYGLERYEMIDAYNLGSQVANEDFIKKAVELEADVLLVSQTVTQKNVHIQNMTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTLNDRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-lysine 5,6-aminomutase alpha subunit
publication title A locking mechanism preventing radical damage in the absence of substrate, as revealed by the x-ray structure of lysine 5,6-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Isomerase
total genus 67
structure length 212
sequence length 229
ec nomenclature ec 5.4.3.3: Lysine 5,6-aminomutase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF16554 OAM_dimer Dimerisation domain of d-ornithine 4,5-aminomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.60 Alpha Beta 2-Layer Sandwich Defensin A-like D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain 1xrsB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1xrsB02
1XRSB 3KP0A 1Y80A 1FMFA 1ID8A 4JGIA 3BULA 1K7YA 3KOXA 3REQA 1E1CB 3REQB 3KP1A 1E1CA 1CCWA 1BMTA 3KOZA 3IV9A 4REQA 5C8DA 1I9CA 2REQA 2I2XB 4HH0A 2REQB 3KOWA 1REQB 3WHPA 1BE1A 1REQA 1K98A 4Q37A 2YXBA 4HH3C 4HEHA 4HH1A 3BICA 1CB7A 2XIQA 5REQB 5REQA 7REQB 7REQA 6REQB 6REQA 3IVAA 4R3UC 3EZXA 3KOYA 4REQB 1B1AA 2XIJA
chains in the Genus database with same CATH superfamily
4HADA 2H57A 1KZYC 1J70A 2YFHA 1EDDA 1G6HA 1H8EA 2PMEA 5BV1A 1OCEA 2J3JA 5ELLA 2LKDA 3GCDA 2GDJA 3QK7A 4K87A 1KVSA 1KYXA 2EV9A 2PX5A 3C1UA 5JQGF 1KJWA 3N6RA 1V6SA 3HU3A 2XJ4A 5AHKA 1KY2A 4TMVA 2QJFA 3ZBUA 4DCMA 1CR4A 2HRCA 1WZ2A 3H1GA 4KIGA 5J1TB 2QM3A 2ZYGA 4E88A 1RC8A 3PP8A 5E6RB 4DM4A 2C7GA 1E3MA 3DBRA 2ODNA 1VI2A 2LY5A 1IDOA 2H9IA 4YQYA 4WJZA 2QVGA 4DMUB 4NMHA 4M9UA 4ASUD 4C3ZA 4DA6A 2ZZNA 1T1TA 2V03A 4H27A 1I2MA 3O26A 1CR1A 1DC8A 1ZRHA 2EEZA 1Z3CA 1Z83A 5KWVA 2V5UA 1C14A 1PG2A 5AW7A 3NEAA 1SUAA 4EPRA 2EL9A 2IUTA 2WHPB 3OTWA 3R7NA 5AW0A 4G0OA 2IODA 1OYYA 3H2YA 5EJIA 1SY7A 3BILA 4YCJA 2BOVA 3TQCA 2CJPA 4H1UA 4M9QA 1XTSA 4DRZA 3F6BX 1J8VA 2BGUA 1NKSA 1B0ZA 1RHRA 2ZUTA 1HR0B 1E6CA 4D57A 2CFRA 5KWEA 2WBLC 3QKRA 3VMFA 1PNVA 1GJRA 3LLSA 2J7PD 4R8LA 2H7CA 4Z0NA 2QR2A 3KLMX 4KHZA 3K9CA 4ZIRA 1K0UA 1WQ4A 1YJBA 4UCXA 4WOCA 4LYDA 1NGFA 3HBAA 3O2NA 2YMPA 4CMJA 3U9TA 4F46A 1Z6PA 3C5VA 4W99A 5IAEA 3GLRA 5LP6B 4OBWA 2BE7A 1U02A 4WK6A 3LHKA 3O47A 4M54A 5AQZA 1NFFA 1Z3IX 3N74A 1VCIA 2IV2X 4D4MA 1KTIA 2OXIA 2ASVA 2PCLA 3CF6R 4O4HA 1KMHB 2YS7A 2CLFB 3V4VB 2VAXA 4FMDF 4BNXA 5J4HA 2FFHA 3PEFA 2ZBUA 1U80A 3MOIA 4XM2A 5EE3A 4HXGA 1T10A 3T3GA 3V8PA 2RAVA 3EF1A 3WMGA 3PE3A 3PRKE 1DTWA 1ST2A 1YAHA 4R2WA 5EZSA 2J0EA 6LDHA 4MQFA 4WLUA 5G1PA 5J23A 3MTAA 4WA7A 2DJIA 2GLXA 2GPSA 4X64B 4CKCB 2HH9A 4CLOA 3WIBA 3TDMA 1D2EA 1ODIA 2VPXA 3KCQA 4QFBA 4BNGA 4D9GA 4OBBA 4UTXA 1O3YA 3UT6A 2G04A 5C2JB 4MMZB 5DH9A 3AY7A 2XOXA 3EFBA 3K5IA 4L16A 1JHPA 2XQJA 1OT5A 3NM5A 3GA5A 3A3YA 4BVFA 1SKYE 1MNAA 1SCAA 1CYDA 4RCZA 1Q11A 4ZOBA 3STVA 2M6SA 4D3DA 4F86A 3IPLA 2CDAA 5ALXA 3O9MA 5B3JC 3D59A 3CRQA 4DKJA 1QG4A 3EXEB 1USWA 1M2NA 4MKXA 1N36B 3DMDA 1UXHA 3RYIB 2FSVC 4JJAA 2A5LA 3GFVA 4KFRA 4UEJA 2OYRA 2WIAA 2JDIA 4NHEA 5HE9A 3SBEA 3J81A 3DAYA 4A36A 1W76A 2W6ID 1N3YA 3T9CA 1W19A 1ZM4A 3CLUC 2HREA 4NCXA 3USES 3PD0A 4BC0A 2CSXA 2ZJZA 4LY9A 5LQUA 3NFYA 4MMYB 3TIVA 4BLPA 4HEA1 1D2MA 4LZPA 3L4KA 4UTOA 4CL0A 2C7OA 4GOJA 2WHPA 2WIFA 2VSYA 3G5LA 4ISCA 3ESAA 4ABYA 5ILQA 3KJZA 2Y68A 4JN6B 5BQ5A 1LBSA 1KKLA 2K6GA 2RGNC 1B8PA 2IZ6A 1XXHB 3BHIA 4DT1B 2OZVA 4F5ZA 1U5BB 5BUSA 4MV6A 3KEMA 1BNCA 1BA1A 1H0SA 4HX9A 1ODTC 1ZM2A 2X0JA 2WWVD 2WLTA 3SWWA 2I65A 1LSOA 2R25B 4IMIB 2ZRBA 3QKWA 4OL0A 4QPCA 1J8QA 5F9HA 5FBVB 3HM9A 1QFZA 5DX0A 3KTDA 3L7AA 3QIAA 4V1DC 4YX9A 1NATA 1O96B 1LX6A 2Y0EA 2BR5A 3OE5A 5LP6A 4KPYA 2SKDA 1MTOA 1ZG3A 1M6HA 5IUKC 6YASA 5H1YA 1NT4A 3EEIA 3ZVLA 1P4HA 4IV5A 4Z9XA 3FPLA 3R3WA 3EARA 1PYDA 1HQCA 1BE6A 5IBRA 4CBVA 3IKTA 5A4FS 1KMHA 2REQB 1UFOA 4GMDA 1H2BA 1G38A 1BFUA 1G66A 2W0SA 5ER9A 4B2YA 3QTBA 3PNKA 3OX4A 3GLHB 2ADOA 1PJCA 3DF7A 1NJSA 3G8CA 2H2IA 3QFFA 1NC1A 5D7NA 2ZUSA 1ML4A 5B1DA 3P0EA 3KZKA 4MRSA 4ITRC 1X14A 2B1IA 4ZODA 1T8WA 3RJMA 1EJ0A 3U31A 4RCYA 2B68A 4ZYLA 1X6VA 5BRAA 5JNUA 2WSYB 1DNPA 3ZKWB 4HY3A 2R4UA 1J8MF 1LCIA 1TYEB 4YONB 5CM8B 4OREX 1WDLA 1V37A 2FB9A 2E3JA 1VGRA 2Y8EA 3TUJC 5K2OA 5GGYA 2ZKIA 4G1BA 2PX0A 3PZBA 2PPLA 3BFJA 5THXA 1YZKA 3W2EA 3FWYA 4OXQA 5IBCA 3HJUA 1PJ2A 4H60A 1A5TA 1NI5A 4ZANA 3EXEA 1I4DD 3C15C 4J16A 2M1XA 2NZ8A 1IQ0A 4KGZA 4O8ZA 2IYLD 2Q3JA 5HPYB 3DBIA 2B99A 2ZJAA 2ERCA 1L4GA 3QU7A 1K4YA 2W43A 4LXQA 3RYIA 1XQ9A 4HGNA 2YV1A 2V96A 1TRKA 3FWZA 5FR2A 1W1UA 1DRWA 4E2WA 2M1ZA 5LWQA 1Z47A 1SD1A 1Z6YA 2Y0CA 3EWIA 3GLUA 4YCNA 2ZYIA 1G20A 2WWTA 1LS1A 3OLXA 2Y27A 5KTMA 2Y76A 3QVJA 4XWKA 2WIJA 1J06A 1WY7A 2FHSA 3HGQA 4N3BA 1FQKA 1NW8A 5FTLA 4AKGA 4A23A 4CU2A 5T4HA 3K31A 1ZRMA 2F48A 5J4LA 5SZHB 2WWYA 1Z4IA 2Z08A 1JTFA 4ZZIA 3FSRA 4G67A 2A88A 4DT1A 3G89A 1XXHA 3U1TA 1U5BA 4HAIA 5I7SA 1JR3D 4IJ6A 3M6UA 4DLBA 3KLOA 4EDHA 3DZJA 4ZREA 4ME6A 3PJEA 4WWHA 4KAAA 4LMBA 5H0IA 3DPSA 3MJEA 3GJYA 2C54A 1VKHA 3K1JA 3OESA 4UASA 4UDNA 5CXSA 3O4GA 4E22A 4MX8A 1ZC4A 3CQ9A 3UWOA 4PGAA 3P4XA 2PRKA 2WB2A 5BSKA 3PENA 4O4IF 5JXIA 4N41A 5K3CA 4EA7A 2J3MA 4WN9B 3V97A 3CF4A 3PXDA 1O96A 1JIIA 2W5UA 2PHZA 3P4UA 4GD3Q 4R69A 4X7BA 2Q7DA 3WO1A 4GLJA 4F5DA 4M88A 4LJKA 1M1UA 4MVXA 1R6XA 5KQRA 4UEOA 1XRRA 4IF4A 4A10A 1WPRA 4Y9DA 4AX4A 1IN6A 2VDPB 3U44B 2Y1WA 3Q12A 2JCBA 4MDHA 3DVSX 2OZLA 4B0OA 4TZ0A 2PR2A 3BUSA 1WKCA 1RRMA 3GLHA 5DBHX 3OD5A 3DL7A 2XY4A 1K3UB 2EXXA 2H18A 2Y4NA 3UC9A 4C7BA 2YIDA 3MPUA 2O6HA 4NSNA 3QNMA 3E8SA 3EVGA 5ECGC 1Y5LA 1GZ3A 4P4GA 2X0NA 1VIDA 1WHTB 3I9NA 3SQOA 1KZ6A 1KI6B 1RHMA 1OY1A 3UW1A 3R09A 1HF3A 4P4SB 2UYCA 2XTMA 3BCSA 1QTQA 1U8UA 1NMZA 1C4KA 4H7EA 3WLFA 3ZKWA 1G5FA 2PXCA 3PNQA 4FFSA 3AR8A 5AXCA 1EIZA 4LOJA 4DJDC 2VN8A 1U5AA 4ECEA 2D6FA 1MMFB 4K03A 5JHHB 1D4OA 5DGCA 1N6IA 1PEAA 2YEOA 2Y05A 1X7YB 1X9IA 3G5UA 3MZ0A 4M87A 4XCXA 5MN6A 5T4BA 3REFA 4BO1A 3ED5A 1YR9A 2AUTA 4FS3A 1I4LD 1VKNA 1RWMA 1SC4A 1T4BA 4WKCA 3VNUA 5AOAA 5TPWA 4ZGBA 3L9XA 1EWTA 2NXCA 2GUGA 1XQ6A 4KGXA 4OJQA 3MERA 3JZIA 4QUJA 1HOTA 3HXMA 3KJNA 5F0XA 1QK4A 3DMRA 1ID8A 1MXFA 1DTEA 2V3CC 2A30A 2YJNA 1E7YA 3DV0B 4AW9A 5IULC 1BA2A 3AI2A 4TSFA 1YMVA 1E9SA 4C0KA 1P39A 4MUXA 3SYRA 1Q92A 3I53A 2XX3A 2PLRA 3GUHA 3RIEA 4Q4AB 4K05A 5DHRA 1WD7A 1JILA 1JS1X 5IXJA 1FFGA 4KQ6A 1YV9A 3HWWA 2TSYB 2FE4A 1E7QA 3BE5A 4KLCA 3DE1X 5HOQA 1P5FA 5LYYA 3WC4A 1DXYA 4JUAA 5ADWA 3KC6A 3NNNA 2PX6A 3AVOA 4D3FA 4DEVA 5EP2A 4K9KA 3RB8A 3R44A 2J45A 2IU4A 3SHTA 2L17A 3O83A 3R8XA 1QQ7A 1SVWA 4B87A 3U3ZA 2PUJA 4EJMA 4WUVA 4WN9A 1JEJA 1KK2A 2GN6A 2X76A 4B9EA 4EYSA 1U81A 4YROA 3FGNA 1JHYA 1CJKC 1IJBA 1SCQA 4G9EA 3BH6A 4C3OB 4J0CA 4J0GA 5F5NA 4GX1A 3DMTA 2QN8A 4MPPA 4OP1A 5JARA 3ONNA 5E4FA 3HDGA 3BK2A 2FW0A 4R0VA 3SHWA 4DDTA 1PG5A 5EYPB 4Z3OA 1FJXA 1ZVQA 3JSAA 4QAQA 2CZGA 1X94A 1NGIA 3DMNA 4JU8A 4IX9A 4MUBA 4ZAFA 4AMYA 1LJUA 1LK5A 1M74A 3K09A 3OC0A 2C9MA 4RJJA 2P68A 5FBHA 2JATA 4RTQA 4IUYA 1RAFA 4OOFA 3UV6A 4QYSA 5JH7F 1QNFA 2RAPA 1CY6A 5WRFA 1KI6A 2UZ0A 4MB6A 4P4SA 3UANA 4U9IS 3BC1A 1Q91A 4IS3A 1YZNA 3EIXA 3L1KA 2Z4TA 3RAJA 1ZMRA 1F0YA 4F60A 3RS8A 2HRRA 2AJDA 5DLQC 3G2MA 1W35A 4ZRMA 1FL9A 3V4SA 3G17A 3QTTA 4NWIA 4XGKA 1FFAA 2DF8A 3GEPA 1XEXB 2GJ9A 5H70A 1TU3A 1N7IA 2B94A 4XWOA 3QVWA 4E1AA 1BD3A 1RE1A 1WL8A 1XRJA 1ZU5A 3NIGB 3QOYA 3WKAA 1EB8A 3LU1A 1MW9X 3RRNA 1EQUA 1FRQA 1RZRA 2ILTA 4ZOLB 3DEAA 4MVJA 4EY4A 4IXDA 2WYVA 4P34A 2DM6A 1RRFA 4HR7A 2ANCA 3KVOA 1ULBA 2CLOB 3KQVA 3RBVA 4JLNA 3DV0A 3UXMA 2CB0A 3T3MB 1ZQ9A 2BJWA 5A2GA 5AJXA 5DEIA 3IAAA 2IGBA 2NU6B 4NYMQ 5HIMA 3VSEA 4HE7A 1IB6A 3H04A 4Q4AA 2C7VA 1M2WA 3ITKA 3ZWBA 1UGLA 4JEIA 3U3DA 1OLXB 3I6ZA 4R2IA 2FUKA 4MRVA 4E5KA 5JJBA 2K87A 3TZ6A 2C03A 4NMMA 5C8YB 2CLKB 1SZJG 2B82A 2WJGA 2V7GA 2YN4A 2Q0SA 1YHNA 3DOFA 3RRJA 1A9YA 5HYVA 3SQDA 5CDSA 4EY7A 4OO3A 5IJWA 4AYXA 3TM5A 4NICA 3CHYA 4YA6A 5FOUA 1EFAA 1J2EA 4Q3AA 4LI0A 1DOHA 2FWJA 1WLSA 4OQEA 1G20E 2IHJA 3L7LA 4RY0A 3LI2A 3S5JA 1WB9A 4YCAA 1XGKA 4JZYA 5DNEA 5I8ZA 3U48A 5FO1A 1EIWA 1DIBA 2DOKA 2YJTD 2AZTA 3OKFA 4UKDA 5JS1A 5KSZA 1I1NA 4U8HA 1OB5A 1VGQA 3F1LA 4PYOA 5EHQA 5EYPA 4CMIB 2QE7D 1HG1A 4BZZA 1D4AA 4ZMBA 1XXHE 3T9EA 3V2GA 3T1QA 3ZWCA 4BYMA 2W7TA 4CKCA 3EPLA 1ZUWA 5FOSA 4BO5A 4NPAA 3FVTA 3BWYA 1B4DA 3WLJA 2P27A 4IJ5A 1PTKA 1DP4A 1NP6A 3GRVA 3P9QA 2YH2A 4HZIA 4DLXA 1E2PA 3FCSB 5T4EA 4TYYA 1GPDG 2H7VA 3AZPA 4MW7A 4D5EA 1XMXA 3VV2A 1V48A 1X7DA 4GU5A 2O19A 3IMFA 4FE4A 4HDCA 4YJ3F 3SICE 4NIMA 4K9NA 3IR5A 2ZE7A 2IC5A 3P2KA 4Y1RB 4O3MA 2AOTB 2PSJA 2JVIA 3RVMA 1UK6A 3Q10A 4PTYA 1OX6A 1XEXA 1TUBB 2WFZA 5LP6F 3C39A 2J5KA 1T9HA 4FB5A 3RM3A 2QTZA 5KMGB 4IGEA 3GLHE 3BVPA 2RE8A 1MBZA 1FP1D 1ZLXA 4R2MA 5GVSA 2JNWA 3ZDCA 4RZHA 3WKEA 3B1JA 4YJKA 4ZOLA 3THRA 1ND6A 4D9JA 3PITA 3V8BA 1VP9A 2JD1A 3WK9A 3JAKB 4IHJA 4OKNA 3TAHA 3ZTTA 1E2EA 5T3YA 1AV7A 4G9BA 3OAAA 1TCBA 3G0IA 2NU6A 3FCOA 5TGZA 4ZVPA 3R5TA 1DKOA 3P9RA 5I5EA 1K98A 3VH3A 4RHUA 2YYYA 4WVFA 3SEQA 3TNLA 1PW5A 3A58B 3IPRA 3PQ2A 4HDMB 4OQQA 4PINA 4QQNA 3HR4A 3UAZA 4ZEOA 3RSQA 5JDIC 3U26A 3GVCA 3W5AA 1JZAA 1LDEA 1CQXA 1DBWA 3NWBA 1NIJA 5C8YA 4DLSA 3WFJA 1UXOA 5DM2A 2XNDD 4ZT3A 1GOTA 1FQOA 3RASA 5K03A 1ZNXA 3S0JA 1T8SA 4RL4A 3A6FA 1K3TA 1YKSA 5JSYA 1L5SA 4JVSB 1QPZA 2VDMB 1OWNA 4OFXA 5AM0A 3RYFB 5EXDA 5G2OA 2BW0A 4PHHA 5CAEB 1UBEA 1YH3A 3BM5A 4P5DA 4R8VA 4L4YA 4GPTA 5F78A 1KRHA 5K8TA 2JJ1D 2RB5A 1I24A 3ENQA 1PCXA 2GAJA 1X3LA 4RH3A 4Y2VA 4CMIA 3NOVA 1L7QA 4YUVA 3HL0A 2GBCA 3CIFA 3AI1A 3IDSA 5F1YA 3WI7A 2HT1A 1DS6A 4JI1B 3NTUA 4DA0A 1FNMA 4ED9A 4GM4A 1KI8A 2NY8X 3E53A 2WSMA 4FN5A 1DB3A 1FNSA 2DKNA 1ULUA 3STTA 4ARSA 1CR6A 1SJ9A 2OCIA 3CSUA 2Z3WA 4Q02A 2N66A 4PZ9A 5CT8A 1VSBA 2J5RA 4JQOA 1GG2A 1A4IA 1NXOA 3NMUF 3QEMB 1DAEA 1GYQA 3FBWA 1EQ2A 1XJWA 5FI3A 2H4YA 2YNMD 3P96A 3J7AC 3GVHA 3U60B 4BVAA 1Y42X 4H3HB 4Y1RA 2AOTA 5AQUA 5AI5A 3FCEA 2Q45A 5SICE 5I8WA 5DT9A 3IQDB 1WEKA 3WMFA 1IE3A 2JIPA 3OZVA 5TEVA 5BVGB 1TUBA 3LUCA 4FFMA 1U2EA 3HUFA 5DBOA 5IVPA 4A73A 1CUAA 1HZJA 4HFNA 1JTVA 4Z0HO 3EPPA 5CTJA 1XJCA 1ATRA 5TQ2B 5TQVA 2ZJ2A 5A4MS 5KMGA 2D7DA 2Z1DA 2QXLA 1GA4A 1HDYA 4FCTA 5F23A 1SCDA 1LPAB 1OFTA 2HHHB 2YIJA 1M72A 2A92A 2B1JA 3INYA 3R8CA 4QM7A 3JALB 5F4ZA 2W6NA 5AQPA 1M6WA 3OP1A 5T41A 5CT9A 1Z75A 3G2HA 4C5AA 3U9LA 1NP7A 3JAKA 1L4NA 5AFSA 3JW8A 5SYNA 3ZIAD 2IIBA 3S55A 3HEAA 2GXUA 2G71A 2JGDB 2HPHA 3MWKA 3O38A 4JH0A 1NDQA 3AFHA 1N0HA 3AR2A 4FYVA 3Q8KA 1E4YA 1PV4A 3O0TA 3LKDA 3AUUA 2EZUA 5EZQA 5CX1B 1QF9A 1I4EB 1TC1A 4H7HA 4MGKR 4HDMA 1ZH8A 4MQMA 3D3WA 3NEJA 1SIUA 3HDHA 2PNFA 4FL9A 1U9IA 2B7CA 4JQZA 2P3SA 2A9KA 2WC1A 3CNNA 4IIYA 3TZHA 2WZDA 2NXNA 3PJRA 3TKAA 2PYDA 2BFDA 3L6BA 4FE3A 3M33A 2POQX 3L8MA 5TJ9A 5I01A 1U2PA 4MVJE 2XGJA 4OJYA 3TLXA 4PXAA 2LIPA 4GPIB 5IC5A 4QXQA 1YB2A 2MSCB 3D7KA 3RYFA 5C80A 2Z5GA 5CAEA 4DV6B 3U7GA 3Q2OA 4DIBA 4CTNA 2GILA 1D0SA 2UYGA 3HNOA 2IQ5A 3PEUA 3A1VA 1HT3A 1NPTO 1INLA 3ESBA 3EHEA 3QVXA 4Q1VA 3A8YA 4QOEA 1OT3A 4HB0A 4A0HA 3I12A 1POIA 2CKDA 2OD7A 5KNCD 3Q40A 1FDOA 3VSBA 4D9MA 3TZLA 2E5FA 3DTNA 3L1HA 1XXLA 1G60A 3V1MA 4EUEA 3AF5A 3AB8A 1CUSA 4I19A 1FPMA 4ABTA 2X0IA 2GN9A 3QJ5A 1JKXA 1IHUA 3AZQA 5DKFA 4X1YB 4MA4A 1JEQB 4V0SA 4CR6A 4P08A 3X1DA 4KSBA 5HDQA 3MYYA 2XE6A 5EI5A 4WECA 4E5MA 421PA 2X7XA 3ADPA 3NW9A 4M21A 1CF4A 2ZCUA 2BFEB 4G81A 1E64A 2H9YA 2QRUA 3QUCA 3W3AD 1L5KA 3QEMA 5GY7A 2Z2JA 2ZDHA 1AU9A 1T91A 3QJYA 3QM1A 2Q3LA 4LI3X 4IIBA 3FTPA 4EI8A 1RC1A 3P26A 4U2FA 1KAMA 3L7YA 3GROA 1WMSA 3MNFA 4LY6A 4C4YA 5I7VA 3RLIA 2VDLB 3GRYA 1ZGJA 2I7XA 2F2TA 2YUTA 2NSHA 3RVJA 3QPWA 4JLPA 2DGDA 3Q7RA 3SZGA 3IQZA 1ORVA 5BVGA 3A1CA 4BNLA 3DFUA 1NXTA 1KDRA 1D5CA 3FCXA 4EL5A 3ENZA 4B4KA 2I4OA 2QTLA 5TQ2A 3O31A 4COKA 2VLIA 1AHHA 1K6IA 4U2DA 4I46A 3VKHA 2B8EA 2H2DA 1Y3CE 3F96A 2ZTHA 3HXLA 4IIUA 4K8OA 1AQ6A 4FDUA 2NXWA 5LXTB 3JALA 2EG9A 4BB6A 3PHBE 2JVKA 3UICA 4MO2A 3E27A 4HDQB 2B98A 3WK6A 3ZHVA 4DDHA 1GR0A 4PHGA 3KETA 3QUTA 1DRJA 1FF9A 1SWVA 1VM6A 4AUEA 2VOEA 2G09A 1UFKA 4AMUA 2JGDA 3CSDA 1XZLA 3WGHA 3N59A 4HFRA 1C0KA 3FOWA 1YDMA 2ISSD 4FDVA 5ICGA 3MWJA 5CX1A 4DB2A 2DBVO 5HCUA 5EEHA 3UJAA 4PR3A 1Q0LA 3SG0A 2QN9A 3UMGA 1GZHB 4YFVA 1K27A 2Q50A 4ILEA 2HV9A 1K86A 3QXGA 3H0KA 1VJDA 5A06A 1YDWA 1YKGA 1TCAA 3IUBA 5B2FA 2C96A 1Q1ZA 1O1YA 4HGOA 3EA4A 3PQ5A 4KXUA 2GJKA 2CT8A 4H7PA 3RT9A 3KZNA 5CH8A 1QTIA 1JE0A 1C2TA 3I9V1 4AJEA 3AP3A 1M8JA 1NR5A 4JOQA 3H97A 4ZPJA 2JFGA 1HWYA 2HA0A 1EESA 3VH2A 5KTPA 4EABA 4ZVMA 4NG4A 3VYRB 5ADHA 4M7PA 2FMFA 4R1MA 3ZDAA 2OO5A 4JOCA 4GOKA 2BGMA 2RH9B 2QD1A 1CEEA 1BDMA 1LPOA 2PJZA 2JFZA 3SJ7A 2EX4A 2H2FA 4UBIA 1JEQA 3J7TA 1UIRA 1DELA 1AGRA 2GXAA 5KS2A 4B82A 1YBFA 4GE3A 5E7MA 4C6RA 2FZCA 1M7BA 1AMOA 3WB2A 2BFEA 2DWCA 4WBNA 1O0SA 4CCYB 2VUSA 5HIIA 1ZGGA 1UZUA 2PMDA 1H2AS 4MDYA 2VHTA 2E6KA 4XKJA 5I3CA 4URFA 3JQEA 1H9AA 3TLZA 3A8TA 4R5HA 3HCAA 4RK1A 4PZAA 4WCDA 1F9AA 3VQTA 3KXKA 5F7JA 4B7XA 2PUAA 4JB8A 4I8XA 5E9QA 4ARAA 4CLXA 2MWMA 2R7NA 1WSWA 4G1VA 4MEBA 4PG7A 2BHRA 2LTAA 4C22A 3V4FA 1QHSA 3PKIA 5T6BA 1QX4A 1W47A 4U6QA 1G64A 5BWMA 4OHXA 3EULA 1H3EA 3P7MA 3ZV4A 3MCTA 4CMBA 1CFZA 2AWOA 5H4GA 3V7YA 2MMGA 4LE0A 4XTRA 1PQUA 2DFKB 3DQQA 1QGZA 4F4JA 5LXTA 4FJ2A 5IM4F 2YNMC 5DNYB 3DOUA 4EB3A 1GNVA 1P17A 5F51A 2F3UA 1IY1A 4M0MA 4V0NA 5HZKA 3T6KA 2JFFA 1X9HA 2GYWA 1SXJB 1GYPA 4MWTA 5EKSA 3JAMA 1OX4B 3EBPA 3L9WA 3INNA 1NJ6A 1GPAA 5DN9A 3RGGA 1F4LA 4HHFA 3A36A 1KVRA 3PFHA 5KJEA 1XEFA 3S1AB 4CKZA 3BK7A 3TI9A 4CTJA 3IULA 1AY0A 1G8YA 1Y7HA 3H7AA 4LHEA 4UHFA 4BNWA 4YUWA 2EBHX 4QXPA 1S1MA 4NE2A 2B9EA 4X61A 2ARKA 3SXPA 2B6NA 3ROEA 5B64A 2ZM5A 2KLBA 3GKUA 4WXYB 2EP7A 1WZUA 4PGMA 1EK6A 3OZEA 3OCZA 5AKIA 2P2DA 3H9JA 4KWEA 5EAIA 4YJ2A 2QWOA 2OC4A 4OJNA 3RDPA 3UK0A 4BNUA 4D45A 1WXGA 1B8OA 2DPYA 1H2XA 3GA0A 4RVOA 3B53X 4F71A 1O89A 1Q20A 1T0IA 5AQQA 3KLNA 4OXNA 2AMVA 2JAPA 3RANA 3HSSA 3WP1B 1K8RA 3GBVA 4JROA 1VMDA 1R0RE 4FJ1A 4BQSA 1TKAA 4MNTA 3ZGLA 1NVAA 5JAZA 5KX5B 4DYHA 2X15A 2WP0A 3K0HA 4N18A 3W4KA 2QTGA 1HK7A 1N2EA 4LRUA 3F8TA 5HJEA 4QPJC 1P5RA 3LUFA 3I5YA 1FRFS 4PVCA 1ES9A 1GXSA 3FZMA 5IX8A 3SQLA 4D0RA 1V4BA 4WY8A 3NHSA 4QFMA 3LVQE 2O05A 3TR6A 5JO0A 4XJXA 1IQUA 4CCYA 1Y8CA 5KTYA 5BR4A 2ZVPX 1U0LA 4JLDA 3VISA 1ITZA 4RTMA 3AH8A 4Y7CA 5FNVF 5LDGA 4BCCA 2I2XB 1AKQA 4LV6A 1H6DA 2FSFA 5BQXA 2R8ZA 3DEZA 3GGDA 5IAKA 4HYTA 1ZO8A 2QTNA 3AUSA 3TLEA 3KUXA 1K2WA 2ZPAA 3DAOA 4UCWA 4TV8F 4Q1CA 3WSTA 5T5QA 3RUHA 2GO7A 2P2YA 3H99A 5ECDA 3LQQA 4RJIA 1P4JA 5EKUA 1USKA 4MR7B 2FZVA 4LZLA 3TW8B 3EVAA 5FUYA 1CKEA 3KL2A 2H8GA 4FBMA 2FEXA 4AK9A 1QOPB 4IH1A 4PY2A 3DE5X 4NH0A 3ZNQA 3C7NB 3A3KA 1QAMA 5DGIA 2DR3A 4ZXPA 5K45A 1HEUA 1SXJA 4JVMA 4YAOA 3SOZA 4A3SA 5KOIA 3G2OA 2XYVA 3GJ4A 3OVMA 3D2AA 3AKZA 1NMSA 5AVKA 5L4LA 1JECA 1GPMA 1NH5A 2EJTA 5TR9A 3GY0A 1ZNYA 3HA5A 5G1NA 3RFXA 3S1AA 3UUFA 4EPXA 4GOOD 1ENOA 3Q1KA 1LY1A 1RZVA 1K63A 2BELA 4JJZA 5C1DA 1LDYA 1T8UA 2OUKA 4KAXA 2YRXA 1L4LA 3EEYA 3N0RA 3ZYZA 1Z5PA 4NPCA 4B6JA 2XUGA 5DBGA 3ZE0B 4LDZA 5GAJA 4OU5A 4TVBA 3BIJA 1OW3B 3MC1A 1KSHA 2ZR8A 3OPVA 5AK5A 4DM7A 4DV7B 3AM1A 4CODB 3UYKA 4F3KA 1P4AA 2L0XA 1V5IA 3T35A 3ULKA 1H4TA 1A8HA 1LQQA 1DQYA 1HURA 5D5QA 2VPPA 3RS7A 2BEWB 2FLWA 2WFLB 2QPOA 4HVAA 3GEHA 2IYRA 2X0KA 1WZEA 4XSHA 3LH5A 3RH0A 1BMDA 1EPUA 3CCBA 3OZBA 2KS6A 3RTEA 2EW2A 3I73A 1H5UA 4RX1A 1ILEA 1HDIA 3INRA 2O7RA 4GC5A 4MUGA 5KX5A 3BTUA 1YUMA 3IA2A 3AF4A 1TM7E 4WERA 4JL8A 4EGSA 3O7MA 3FYCA 1YS6A 4O3FA 4US1R 1CJUC 3IMGA 5JC1A 1CDZA 1M2GA 2H17A 3KX2A 4KIUA 2IDZA 2EC5A 4E5UA 5LFAA 2IHNA 4ZFNA 3KFLA 4D8TA 4FHCA 2WV9A 5C51B 1UDWA 2Y66A 3UFXB 1TGYA 3ORRA 5EJEA 2QT1A 2QMQA 2NUAB 3JD3A 1FFWA 1KU0A 3OQIB 2VLBA 2A84A 5BPFA 3RIYA 3GW8A 4OGLA 1WEHA 4M1SA 3DFFA 5JS6A 4IJWA 3RQSA 1F12A 3WYDA 5KINB 4U39A 4ERNA 2TRSB 4FGUA 3KQNA 3VZBA 2RI6A 4KB5A 4UE3S 5B7PA 3OX2A 1ZH4A 4DDKA 2RJ3A 4DQDA 1EFHA 1QE0A 4YP0A 4R1LA 2FJUA 2Y4OA 4H3SA 4MPTA 3W5SA 1XA4A 2OXCA 4QVGA 2G1KA 4MLCA 3HP1A 3FROA 3D9QX 2YCBA 1BWPA 3H6KA 1L7XA 4MR7A 3TW8A 3ZK8A 1S1CA 3AVXA 4Q9NA 4EHDA 1ENZA 4YPOA 3UCFA 2F1OA 4DA4A 4V0MA 1II0A 1QOZA 3PGLA 3WGLA 1H6AA 1QQ5A 1RQLA 3G23A 4L57A 5BWBA 1QTNA 4QVIA 1V1JA 1LI4A 4O29A 2J46A 1F5SA 2OV2A 2R7AA 2WM8A 4HEJA 5CURA 3C7NA 1JPNA 3LVBA 1L4FA 4GPD1 4ITUA 5AM1A 5FPKA 4U0KA 3WDKA 2OQ2A 3HUEA 1XN4A 2W6JA 3LP6A 3NONA 2MT9A 1I6FA 4W9MC 4A2CA 4OYYA 1FFYA 3F7TA 2H0AA 2BSQA 1SURA 3GIWA 1BQ3A 1RXYA 4RFSB 1G55A 2ZUWA 1ZL0A 2Y1KA 2GN4A 3IVXA 4BKPA 1DCMA 1XELA 2EJCA 3LZCA 2OCBA 1DBRA 1OIVA 3FDXA 3ORFA 1M66A 4DSZA 4Q9AA 2JGAA 3DCIA 4S2UA 2VJNA 3HLTA 4OLJA 4AQYB 5AIBA 4HRYA 2NV0A 3CV3A 1UDRA 1I32A 4U8GA 1E6KA 2B8JA 2HMUA 3KFXA 3MLEA 1KAOA 3COSA 1GTJ1 1QO7A 2BEWA 2WFLA 4WVLA 3RO7A 4NARA 3SZRA 4L5CA 4UBNA 4CR8A 3SU8A 4FZ3A 5I9LA 2Z30A 4QPZA 4B8YA 1YJCA 3MQ2A 1VJCA 3C24A 3ML1A 1Y9AA 2CFOA 3ZHCA 1ABFA 1JWAB 4PONA 1L5GB 3SJUA 5BMOA 5EXWA 5B58T 3EVNA 3O1LA 1VLMA 1E7WA 2Q6IA 3LDAA 5DHPA 4B83A 3FHLA 3VR4H 4LN1A 3I9V6 2W42A 3CVXA 1NG9A 3QITA 3BRWD 1K4MA 3QNUA 3PRYA 4LYYA 1NGGA 3F2IA 5FPSA 2ZT6A 1IBRA 3KDSE 2PKYX 5JG7A 3NX4A 1ADJA 4UM9B 2CD7A 3E1SA 2NUAA 4QT4A 1X38A 2G0AA 3BMCB 3ETHA 3NBMA 2OZPA 4R41A 4O4JB 3MINB 1RI5A 1TMOA 1GT91 3PT5A 4R1OA 4II7A 1JWLA 3SSAA 1HDOA 2VKTA 3P9ZA 2IUYA 1NQTA 4AROA 3ROZA 1DQRA 4EHAA 2CN1A 4BV2A 1F17A 1X7XB 1ZVJA 3PX3A 4BX8A 4MVJH 4FYMA 5ES4B 1E2MA 1NYLA 4WACA 1XTJA 3CG0A 3GGCA 1F1BA 4R2XA 4ZAYA 5B7NA 1GZ7A 2MINB 3FFWA 1JWBB 3ZV6A 1EVLA 1QX3A 1TKBA 3K5WA 3NCTA 3HJFA 4TLDA 3UH0A 4EG8A 4DS3A 1V9SA 1QRTA 4ARIA 1Z2AA 3TOXA 2OORA 4B1FA 2H1FA 3CCFA 7REQA 5AVSA 2GRAA 1OX5A 3H3FA 4NULA 1L5VA 1W25A 2I2DA 2QV7A 1GRVA 3AFGA 2UVDA 4PX3A 3ANMA 2DY0A 3FVVA 4RD4A 4ZI2A 4LJRA 1R1DA 3EVDA 3VOAA 4CM5A 1U65A 1AZTA 1XZPA 2FDXA 2H63A 2V6JA 4R01A 4UEQA 1PUIA 4GX2A 2H4HA 2W8BB 3OEHD 4QEZA 1XU9A 3DL0A 4N7BA 4RGQA 3C0KA 3EASA 4Q1BA 3LQYA 1UBNA 1DCKA 4RFSA 3M6VA 3THWB 5JD6A 3HLKA 1TZCA 1ACLA 4BN0A 4ENQA 2XKAA 1UBGA 3EZ2A 4OHUA 5KJFA 3FI9A 7MDHA 5PGMA 5BNIA 5ALVA 1MAVA 2Q5IA 5CVJA 3EVTA 4ZKDA 1MW8X 3M5WA 2D2EA 4LGVA 5GOTA 1DKPA 5L45A 1KH2A 2HU2A 1TYZA 3BORA 3LIIA 1N33B 3DZIA 2CDNA 2DPMA 4W9RA 4LA4A 4O8CA 4XR9A 4QBFA 1RVDA 3G5AA 5JADA 4YGXB 5KQMA 4X65B 5JCOA 3DYBA 1IXKA 1P5ZB 2D2FA 3TLGB 4LDJA 1VYVA 1W6RA 2OHGA 2QJTA 3N75A 2OLJA 1RQGA 5IT4A 3RIMA 1SXJE 3N76A 5THQA 1PEDA 1R8SA 4DDVA 3ELUA 1N5IA 4DUGD 3C14C 1NGBA 4J9UE 1MVNA 1JQ5A 4OAOA 1JHQA 4CIYA 3GPBA 1Y1QA 5JCZA 3GCZA 2TMKA 5IMBA 2K4MA 3OIDA 2BEUB 2IU3A 4KWHA 4BFXA 4NENB 5FUBA 5K3AA 4EGQA 1N2OA 2WMNB 2XGGA 3BWVA 4E07A 3O1JC 3ZHRA 1WW8A 5LIRA 3PFCA 5ICCA 4IDFA 5J4YA 2XRZA 1UJ2A 3PHGA 5HUQA 3T3PB 3V42A 4X6YA 2SKEA 1QG2A 1AURA 1WVIA 1YACA 2PBFA 3BXXA 1ZK4A 2DP4E 1I4TD 3MINA 3B13B 4KK3A 3UJ7A 3WB1A 4E2FA 4KRFA 4H5WA 1MENA 2X1LA 4K3VA 1FX0B 1UM9B 1W0CA 1X7XA 1M2OB 4H4EA 4TTQA 3ZU6A 2I0FA 3B6EA 3EAFA 2OZEA 5HF9A 1D2CA 1DAPA 2O07A 2VDOB 3EB9A 3G6WA 5AMXA 4FMPA 4OM8A 4OI2A 5ALYA 1Y3BE 5DHQA 2MINA 2X3YA 1JSZA 1RIIA 2HCFA 2ZS9A 4IQFA 2QLJA 1ZGCA 2E7ZA 1XQVA 5B36A 3C7TA 4CKWB 3FPJA 5K2MA 3ZZ1A 1P5HA 1V47A 1J33A 1OXKB 1B8VA 1DAOA 1A4XA 4G0YA 2G8LA 3EDOA 3NGXA 5AHOA 1DI0A 1JQLB 1U1CA 2OPBA 3EXIB 3I30X 4OX9B 1U8AA 4JXZA 4KPGA 4XI9A 3RF6A 1SEVA 2IUUA 3TIXB 1RPAA 2W8BA 1Q22A 2REBA 3N8DA 1TPZA 4FHDA 4X94A 1FU7A 4BUCA 5EG5A 1BDBA 2H4FA 2DQ4A 4FSHA 4G23A 1ZCBA 3STUA 3THWA 3KM0A 3VNVA 2FPOA 5DYGA 3NHRA 2ZVDA 2WAAA 3HBMA 1Z4JA 3HDTA 4KE9A 1YDFA 5KYVA 2FK7A 3TZBA 3UT0A 4D41A 4DG8A 4UFNA 1GGJA 1XALA 3KJEA 1T7AA 4XFKA 4BLOA 4JUDX 1OPXA 3GQVA 1UBHS 3U7FB 3NHKA 1XAGA 3VO9A 4PIPA 1PUXA 2O0MA 3KPJA 4NU6A 4L85A 2H1IA 4S2EA 5GZ3A 1WF6A 1Y1RA 4FIDA 4RJ2A 1EGVB 3H4IA 4QDTA 1D7OA 1G19A 1STOA 1LW6E 1M9NA 2O7QA 1ODKA 3AHFA 3FNBA 4IRMA 4I4LA 4KODA 4TT3A 2KE5A 4V0ME 3UO8B 5GTDA 1RQ2A 2NP6A 3G59A 3F5QA 3TLGA 5E7JA 2CMHA 3S6JA 2DY1A 1Z0FA 4OXRA 1R88A 4PSVA 2OOKA 4PM4A 2QTMA 2IYQA 2Y9PB 4RIFA 4ENVA 2V3WA 1GARA 4G5QA 4JMLA 4NZMA 5FUXA 5HUHA 3CO5A 2CMKA 2YN0A 3B9PA 1CSEE 5JMTA 2D5BA 4AF8A 2BGGA 2UYYA 3DULA 1BGXT 1F2VA 1NRXA 5B2EA 2BEUA 4BUJA 3JRNA 1CUBA 1TVKB 3V3KA 5GINE 1CIPA 3CC8A 4NENA 3OCYA 1ZUTA 1NE5A 4ZVUA 4OP3A 2X14A 3WG9A 3N3BC 3PC7A 3ZDRA 5IT5A 1KZ7B 2FFQA 1XDGA 1T0ZA 3GVIA 4MRRA 4X20B 2RCNA 2A57A 1YQ9A 3RHZA 4L9SA 1DL5A 4V2UA 4DL9A 3PSAA 1AT1A 4F3CA 1FX0A 1UM9A 3THYA 4H9GA 3QSYA 3QUQA 2BJHA 2YBRC 4LKOA 4H1TA 1M2OA 2IT1A 2WMYA 3PC8A 3N8HA 3FX2A 3H83A 4ZVLA 3RVQA 3ICQB 1YCFA 3AEUB 1CUHA 3MGGA 1C5KA 3UPDA 2ZI5A 4EO7A 4MYTA 1ESMA 2XLCA 3VVBA 1SKMA 3CISA 2KLHA 1XLVA 4QJBA 4CKWA 5EIBD 5E7QA 1KIAA 2AJBA 1JA0A 4QKQA 2VVTA 4QUEA 1N7GA 2QF7A 3S1SA 3O0DA 3C3AA 2B1QA 3ETGA 3EXIA 2QMUA 4GBED 4AJHA 4AQ7A 3DHNA 1TW3A 1U94A 1CB0A 1L8LA 4DAOA 5KSYA 3PE6A 4ZAVA 3TKYA 2N47A 1X1DA 3GJ8A 5JZ9A 2A9VA 1VKOA 1YBAA 2I2WA 1FDWA 2YL2A 1ZITA 1L7MA 3GJSA 5E2IA 1Z2CA 1E98A 1OTXA 3M9LA 1XZBA 3OPYB 2YYSA 4UQOA 4DR1B 1KK1A 3AVVA 4GO1A 2QUZA 3IEIA 4GKJB 2ZRQA 2K7ZA 2E48A 1AKYA 4RS3A 1C9KA 1E4OA 5G0UA 2HJSA 5AOVA 3GU3A 4IQGA 3NGMA 3DXFA 1DRVA 2P1RA 4FGZA 1MFZA 2JGFA 4BX9A 2DR2A 1J25A 1QC5B 3QX7A 1LDMA 5EESA 2JIDA 2R8YA 4U7PB 2GKGA 1E9DA 3Q3HA 2CXQA 3L7NA 4ZQIA 5EP4A 2V6GA 1G17A 1QIDA 3ZC3A 1XG5A 4J0QA 2B4YA 4MUJA 1DDIA 1T2VA 1E3DA 2RIRA 4FM9A 3UJNA 1BCSB 1OD6A 3FI0A 3HB1A 4PSCA 5TT1A 3TTTA 3VVMA 4RD1A 4RLFA 3AOGA 2XIQA 3KE9A 4LNAA 4B6PA 3KRTA 5K8CA 2YJ4A 1RMTA 1EX1A 5CGQB 4A8TA 3PQEA 2N0SA 1DDGA 2JA1A 4NAVA 4ZN6A 2HHCA 2ZP1A 1EFTA 1EGQA 4G84A 3A6ZA 4MAAA 1FYFA 4YUZA 4AECA 4BQRA 3LT0A 1I0IA 1TVKA 4OPMA 2BTOA 2Q9CA 1PR0A 2O2GA 3GYBA 5IK2D 4EHIA 1AA6A 4II3A 3OJ0A 1SPXA 1XP5A 3L46A 1JDBB 1YC2A 4R9VA 5HMLA 3EIFA 4FP9A 3L0ZA 3W2TA 2VP9A 4EQ6B 3PDJA 4KE7A 2FETA 2WWHA 1AZSC 1RCFA 4H77A 4X20A 4XAQA 3QX3A 2VYVD 1OYWA 2WD7B 4C2BA 2VK4A 3SR0A 1VI6A 2IXAA 4TXHA 3X1XA 1HYBA 2XGSA 1MZPA 3FH0A 2NP7A 1CUJA 1CULC 2FJPA 2PFGA 1NNUA 2YQZA 3GH1A 3AHIA 2JI4A 4HWTA 4XGNA 1AUXA 2N3ZA 7YASA 2BM0A 4ZTUB 2B7LA 5CIYA 4P8RA 5LU8A 4K28A 2DCMA 3UGTA 3ZXXA 1K97A 3AEUA 3W9UA 5JPDA 3IOBA 3TW4A 1CDOA 1CK4A 1ORDA 3CZMA 4ZU3A 3VGPA 1V9CA 2FFJA 2WYIA 1MQSA 2R87A 3NJRA 1SUBA 2FQYA 3SBOA 5JLAA 1GNPA 1H2EA 2GR9A 2C9DA 4XASA 2B1RA 3JR7A 2PH3A 4EH1A 4HPJB 3LVRE 1BGWA 1RAHA 4CM6A 1E1NA 1GTMA 2NZJA 1HE2A 2DH6A 2XEDA 2VSNA 4A0GA 4RPHA 4MXDA 3WGNA 5D6OA 4M98A 4KQ9A 4ZHSA 5DYTA 5AKJA 2B2XA 2I22A 1RYEA 2PY6A 1FUUA 2FPKA 3EYWA 4P3PA 4RWEA 4UMEA 3U3KA 5BYAA 2A4KA 3P2EA 4DWJA 3CZRA 4GPEA 4OK6A 3LG2A 3RVDA 4AZ3B 1FLAA 1Z0SA 2W71A 3EGVA 5TXGA 3AHEA 1P6UA 1XZDA 4G0VA 3EN0A 5FFFA 2NZVG 2ZVJA 1QZTA 2Q1TA 3QP9A 4MVJG 4AAYA 1QC5A 4OSOA 1SUEA 2UV8A 4LYEA 4R81A 4CM1A 3Q7EA 1QAOA 1JBKA 2CLIB 5KYNA 1XRQA 2A3RA 5BW5A 1VMAA 5LZ5A 3CF0A 4CF7A 4CF5A 3OE7D 3GPLA 3DF9A 2PPVA 2ONKA 1JQKA 4JBWA 3LBFA 1BCSA 3FGOA 4HGQA 4KYTA 1P80A 2GM3A 1UH5A 5F2KA 4CCWA 1NOIA 1L5FA 3NBUA 1PJZA 4NZ9A 4BMNA 1W4CA 1CRZA 5CM9C 4ROTA 4BLUA 4G0QA 1XZEA 3C6BA 3KWLA 1DAFA 1ULAA 3BD6A 4CV0A 1F3LA 5JCJA 2WJVA 1U7WA 4F9FA 4EW1A 1MB4A 4FFRA 5SY6A 1JHAA 3FMFA 1Z0UA 2ONYA 3RAGA 3UOGA 1YS9A 1DAGA 2WJJA 2E0HA 3PJDA 4TWJA 5H8WA 5BSMA 2A9PA 3ETDA 3LS2A 2QSUA 2I33A 1FOEB 5DPMA 1D6MA 5C8ZA 4KIJA 2HMWA 3GAFA 3AHCA 1ORTA 2IW1A 2R6R1 4GSKA 2WTUA 3K0EA 4OLBA 1Y6QA 2Y1XA 2V7BA 2WD7A 3W8DA 2Q3DA 3EEBA 2PFSA 4OBXA 5FPHA 5JEEA 4IRUB 3OQ6A 3VMMA 4BLWA 2BEKA 5DJ5A 4PHCA 2G1JA 3FFBA 3ZQ4A 4E13A 3ONEA 3ZCSA 5BXYA 3AERB 4ERXA 2FPUA 4DC9A 1JKJB 1EB9A 4A7PA 2H06A 5KPDA 2XVYA 4X95A 1NGDA 2YDYA 1TD1A 4B6SA 1FUIA 4JNKA 2HV8A 1G0NA 3MCAA 3KVGA 4TRRA 3FVQA 1Q0QA 4HNTA 3DAGA 4KNYA 2P9HA 3R3JA 2O3JA 4JC8A 3DMGA 4M9SA 4F4HA 1NJGA 3U6KA 2PS1A 1NW3A 1CW2B 3I0NA 3ZIDA 3L5OA 4U7FA 4G4SO 5CPBA 3TEMA 3UEOA 2Z4SA 4HH3C 2GF0A 1N5JA 5B5SA 2I7DA 1CUUA 1LI5A 3S7ZA 3VU8A 1PR5A 3CT4A 3JRXA 3QV1A 1P6XA 4I1SA 1Z2OX 5KHLB 221PA 3LT2A 4RSRA 3NKVA 1S6YA 5EIBC 4OJKA 1U9JA 2A67A 4BZXA 3MWLA 2IE0A 2V7UA 2R2GA 1MDFA 2VF8A 2GD1O 3RBZA 4AZ3A 3CW8X 3AVWA 3RBXA 1WXQA 4Y1FA 2FUG1 1E2IA 2AJLI 4RVSA 1L2TA 2CHGA 3ZJ4A 1E3JA 1IONA 1WP9A 2EHDA 1EXMA 3A3NA 3AUYA 2FVXA 9ATCA 3HI6A 4FLMA 5IN5A 3HADA 4IW3B 5BSRA 3GR6A 2Q4BA 5GM1A 5EMLA 2XMRA 3LK7A 4ZVRA 3GPDG 2GKSA 3SNKA 3UT5B 3GLGB 4D2IA 1Q7TA 2GN1A 3K0SA 4XJTA 3G0GA 1E5LA 3QUSA 121PA 1E9RA 2A2ZA 4UDOA 4AF7A 4B7ZA 4P2BA 1X8XA 4FKBA 2WPNA 5L53A 3ZDBA 4TZ6A 1CLUA 4ENUA 2KBEA 5B6JA 4A6EA 1T36B 3HQ4O 5EPOA 3QIVA 1CU1A 3JQAB 1L5MA 1MF7A 4H7DA 2GS9A 5IEJA 1J5PA 4HI0E 5FR1A 2HNBA 1X19A 1UC4B 1UKCA 1DLIA 3MFQA 3QBDA 2WEKA 3SJAA 1SZCA 2GAAA 3IP9A 5AXAA 2CXNA 2YZ7A 2B3DA 5I4CA 1G5RA 1MZVA 1QUEA 1T5TA 5D00A 2CXTA 3DA8A 3ZV7A 4EHJA 3IUEA 1J0XO 4M36A 1M5TA 1BD4A 4PZCA 5SY4A 3PWKA 1V3TA 3O4IA 5HFNA 4ETIA 4BJHB 3OTGA 1WU8A 2E5LB 3QY0A 1VPTA 2AHRA 2PL3A 2WG2A 4F5WA 4IHKA 3STHA 3KQOA 5CVTA 1KJJA 5EHXA 3PFKA 4P22A 1E9VA 2OAEA 1R9JA 3R2JA 4BX0A 3OQMA 3AERA 4D0LB 3D6FA 4RTRA 2ZBQA 3EZXA 3H1AA 1JKJA 3C98A 1F0PA 5EHGA 5EXTA 3G0BA 1GSOA 3WJ2A 1K8YB 2PT6A 3NFRA 1GQOA 2AX3A 2JH8A 3PICA 4F5YA 1Z35A 1OU4A 5BVHB 1N57A 4IV8A 1HZZA 1JHVA 3FUCA 1O5IA 2ZRHA 4XW2A 2AEMA 4Q7QA 2HZ7A 1TQ4A 1C9EA 1XLUA 1T8PA 2HL6A 4JP3A 4B4VA 2OHJA 1WOMA 3RSLA 1NULA 4A6PA 3V00A 3B9BA 3DMFA 1UC5B 3FNRA 4PLTA 3WAKA 4E11A 3E3AA 4MARA 3HG7A 4Z2YA 1QP0A 1UP4A 3IBTA 4CE6A 1MU0A 2WABA 4JC0A 3DLHA 5TPZD 1V43A 1NONA 4UDXX 1TA9A 2AYZA 3AU9A 1ATSA 3OURA 4NOLA 1A2QA 3OJXA 1J9GA 3IXLA 4RULA 2IZ1A 2CL0X 2XYHA 4DWOA 4YUXA 1BCGA 1PD1A 5K6AA 2JF0A 3FOCA 3HCDA 1I3MA 5CFZA 2QDKA 5JSKA 5LN1A 5C7IO 4XWTA 3GVPA 1RYHA 1ESDA 3QEKA 1ICAA 2DSTA 4R4JA 1GV1A 4JOSA 3GA7A 2GEFA 3IDOA 3UT5A 3GLGA 4JZKA 3W6PA 4B5KA 1BWQA 4Q3NA 4RTKA 3V8MA 2Q9UA 5U4QA 4DJFC 1C2YA 4PAOA 1SVSA 4H6WA 4CQKA 1JBEA 1H85A 2ESRA 1Q0PA 2NO9A 2WICA 4PO9A 3HO6A 1FTWA 4D56A 3S8YA 1T36A 2HSWA 4NE9A 4WPGA 1SFRA 4KWIA 3JQAA 5TMBA 4NEQA 4WKPA 3W04A 5TRTA 3W9SA 2AWNA 1QH0A 1Z88A 4JOBA 4Y67A 5IKEA 5ITSA 5L3SB 1LF5A 2R97A 4RQAA 5DCUA 3ZWPA 5JSZB 3IUYA 3W05A 1VIYA 5TEWA 4Y6PA 4JI5B 3I2IA 2D8AA 2F43B 1AKWA 2H0QA 2O1EA 2WJWA 4MV5A 2YC1C 1BE1A 1JH8A 2IYSA 3A31A 2RKOA 5JZMA 4JJGA 2O5CA 4LSMA 3WLHA 1AMUA 3R2VA 5IVDA 3IILA 4FNMA 4OI1A 2PT7A 3W79A 1XZMA 2REXB 4WDQA 2HF2A 3N3AC 4V02A 3I1FA 2GRUA 3AQ4A 4OQLA 4BGIA 1M1YB 5AW2A 3L0SA 1PJTA 2HDHA 3HDQA 4OXKA 4NX2A 3KPYA 4JJKA 4A0RA 4DA7A 1S3IA 3BB1A 3OU7A 5DP1A 1BH2A 5FL7A 3UJCA 1L4KA 3EVCA 3GAAA 1OZHA 1RI3A 1U04A 4RVUA 2AFIB 3WWCA 2O20A 5C5IA 4H18A 1XPUA 5BVHA 3I62A 4X6XA 4HAUA 1VJTA 4FFPA 4NVRA 3G68A 2IZ5A 3H2KA 2D1QA 1F5NA 1EM8B 4S12A 2O0HA 1KA9H 2W6MA 1K0FA 2AI2A 2WJAA 3BSWA 1NUAA 4RW0A 5BYBA 4EI7A 4M37A 4PO8A 3ZZMA 2IP1A 2E2WA 2VJOA 2Z5FA 3A1SA 4KH1A 4E94A 4GRIA 1XVLA 3BICA 4MYRA 5BUQA 2PZLA 4KDFA 3RVSA 1KDPA 1FS5A 5ELXA 2JHGA 1Z0IA 2JLUA 3RK0A 4F1JA 4XIIA 5BQPA 1AG9A 4EJSB 1JJBA 1GY8A 4S1PA 1PNQA 1Y4DE 2JIBA 2DFVA 2VJYA 4INOA 3MT9A 4J07A 3OCVA 4P53A 2O7NA 5JWHA 4BMCA 4EW3A 1KVTA 4GRDA 2PE5A 1ZMXA 2V45A 3ZEIA 4C0HA 1GL6A 3H2IA 5M7EA 3GT3A 4L02A 1OFHA 3MAGA 2ZIAA 4FHGA 5FD8A 3RR2A 2CDBA 1P19A 2I29A 3K53A 4QFDA 3U4GA 5T4FA 1U0BB 1RXUA 1AYJA 3QGMA 3ONFA 4L95C 2V4UA 4PR0A 2X1VA 1G21B 4WASA 4CTKA 721PA 1Y1SA 1FSPA 5DNCA 1JHRA 1KYZA 2R00C 3HDJA 3MMSA 3OA0A 5AQHA 2J4FA 4DILA 2DTXA 4D44A 1JDNA 4JVNA 1VPDA 4DMFA 3GPCA 1SU4A 2G77B 1DAKA 3SI7A 3WS7A 4EI2A 2GM9A 2JGNA 3AGPA 4K0KB 3RFTA 2NVBA 2QLLA 2V7PA 4IILA 2J9FB 1IUNA 3HVHA 4W9NA 3STWA 3NXSA 4DCJA 1KAXA 3LDHA 5KIAA 3HR8A 3HGMA 3UWDA 4Q00A 1NPDA 1BXGB 1KZ9A 5ERYA 4B5LA 4BDTA 4CRWB 2JDID 3WWZA 2OGUA 2MSLA 5L3SA 4UHEA 1DFGA 5JSZA 3QBJA 2P2CA 1JE1A 1MABB 3IV9A 3FZFA 1SCIA 4YRTA 4ZVSA 5FAKA 1GLVA 2F43A 3M1AA 3NANA 5DTMA 5G3ZA 4EX7A 10MHA 3ZCQA 1IIRA 1RACA 3H6GA 3OZIA 4HUQB 1ZUIA 4FILA 4NNJA 3S44A 2FFRA 5DK4A 5DWQA 2QNIA 1JU9A 3LX6A 1V8FA 1Z0AA 3O5AA 1TEZA 1K88A 1ZBDA 4ID9A 1V3UA 4AICA 3A2KA 1M1YA 1F14A 4JLJA 1Y4SA 4YAUA 5L7WA 4FYIA 3AM4A 4DSOA 3B1XA 1ELOA 3ND6A 1GL7A 1UAGA 2V58A 2WKQA 2YZGA 2HGZA 3MUOA 3OIWA 4HYYA 4LQ4A 1HE3A 2AFIA 4ZYXA 4GW3A 2NX2A 2LDXA 2Z5LA 4GKKB 3G2KA 3FPHA 3Q7QA 3FPGA 1PT9A 3FPSA 3H9QA 3UATA 1EM8A 3O3NB 5CYFA 2I8LA 3FKQA 3S7TA 2DQYA 4NLLA 4WZBB 1GPKA 1QGAA 2VTVA 2HA2A 5IZCC 2PZKA 1MO6A 3AX6A 2GK6A 2VWQA 1KJIA 1EHCA 2AF3C 3P2OA 3DGFC 3WZ2A 1IHDA 4NMWA 1PWXA 4GYJA 2O23A 3B60A 3KQWA 3ORSA 4Q1AA 4EJSA 4AUKA 1ZOLA 5EHZA 3GRCA 1SCUB 3FXAA 1NPYA 13PKA 3BWBA 2DLDA 3VZPA 3G0HA 5JQWA 2BN4A 4RWZA 3CTPA 4WNYA 4REMA 3D2FB 3GNLA 4MPRA 3TLAA 3KKQA 3CBGA 4G56A 3REQA 4ND8B 1K8ZB 4GM0A 4C21A 5K09A 1C4WA 3HUTA 1KWKA 2W4IA 1PL7A 3HH8A 1TB4A 1ZIXA 3KWJA 2OHOA 1G21A 3K9QO 5L6MB 1YI0A 2I1QA 3GYGA 4KRYA 2RGDA 3LD9A 2VT2A 3RARA 2LD4A 5B6IA 1PL6A 4MA5A 3RI3A 1ABEA 4MYCA 3PTAA 4XX0B 1K8BA 1F7UA 1DC7A 2AG5A 4N0QA 3D8NA 1BMRA 2FUG6 4LRWA 1PR2A 3VPAA 5DHFA 2J9FA 2J4CA 4N7MA 3L3BA 3ZTWA 3S81A 3EEQA 4DLWA 5LMNB 3K2BA 4RHXA 2P40A 4AP5A 4RIGA 2VQ3A 3GUCA 3ZI7A 1V11B 3D6HA 1YHYA 2IV7A 1UBKS 1BXGA 1H1DA 3QVUA 1ZYWA 1ZDMA 1ZK0A 2GZRA 1VBNA 2HIMA 3CUVA 4H59A 3OIFA 4QTXA 3RU9A 4AB1A 1MABA 5ENZA 1Z7EA 2FPMA 3WYEA 2A14A 1FNNA 3OLVA 5LYJF 5FL3A 2EFDB 1A0OA 2BGNA 2I4LA 2N2RA 2OCGA 3HPRA 4AIIA 1C8BA 4HUQA 3E2PA 4IIEA 3CZ9A 3ZS9A 3GLGE 3R7WB 2ZFUA 2D54A 1IB0A 3ZGOA 3VPBA 4DQVA 1P2VA 1NSFA 1R7RA 2GPJA 3P45A 2QZPA 3QNWA 4R8RA 4F1WA 3AUTA 3ESRA 1VPLA 1Z62A 1II9A 5CG1A 2B3CA 1IIBA 1Q6YA 1Z34A 4MW0A 2XA9A 4N1AA 4YI3A 4QTZA 4NBWA 4B76A 4F84A 4HNUA 4D46A 1WQ1R 3DMHA 4J1TA 1TVCA 1JRLA 1K7YA 4R2KA 3JQ6A 3O8LA 3C85A 4LGCA 1E9CA 2XCIA 3R5FA 3TD9A 3O8QB 2B4TO 2CZQA 1M7GA 4J29A 1HLPA 2HUPA 4H0NA 5KSPA 4BL5A 4B2LA 3AEQB 4WZBA 2XADA 2QZ4A 1FRVA 1Q1EA 1NGJA 3UMSA 5F2NA 5IG2A 4YRPA 3ADBA 1B7DA 1Q1NA 1JQBA 3KYBA 3L43A 5FA5A 4EELA 1N7HA 2ZSAA 2V8OA 3EIOA 3HFSA 1U0JA 4Q19A 4AAZA 1DFHA 3TIIA 4TN5A 2QWRA 3H2SA 4ZT6A 3ZCPA 1ZD1A 5A4AA 4KIWA 2BTQB 3FETA 2UUPA 5AI4A 2ZTMA 4TT8A 3SMVA 3OA2A 4Z9AA 1SCUA 5DLEA 1QH9A 3DOEA 4D3ZA 1PGJA 1R50A 1NVFA 2OBXA 2ZREA 3ZDFA 1QFSA 1PU2A 2E21A 2GBLA 4V39A 2VPYA 5AQVA 2W4MA 1SIWA 3D2FA 2P1DA 3EJWA 2QZSA 3G0DA 4B6RA 4B32A 4BNZA 3I5XA 1V7ZA 4AJLA 5I7WA 4Y2UA 3M4XA 5ALNA 1I4WA 3LW7A 4UFOA 5I3ZA 4YYEA 3WJ1A 3AL0C 3GUZA 6ABPA 1E6WA 4YH1A 4GBMA 4WBNF 3K72B 2Z98A 5LA6F 4E2ZA 1BKDR 3UGQA 3UV3A 3R3UA 1VE3A 4GSLA 4XX0A 1AQNA 1ISGA 3OSUA 4K9SA 1OZFA 1KFCB 1WJGA 2HMSA 4P0QB 3N2GB 3B78A 1M6YA 5IDVA 4G8BA 4KPEC 3F9RA 5ALZA 2Y99A 2WVHA 4EKGA 2X0FA 4L4XA 3EEOA 1H05A 1KJZA 2YASA 4HYEA 2P9FA 4KDRA 2CJXA 4O4LB 4AO6A 3I2GA 3WLMA 4BMZA 2JFNA 4WEQA 1H5QA 4BB5A 1U5CA 1II8B 3V1TC 4YCLA 2G9RA 5LM3A 1YTLA 2G72A 3KKKA 2W2LA 3L8FA 3MUNA 4IH4A 4MTLA 5H81A 4DQ0A 4PSKA 2R4QA 1CY4A 2PXAA 4QNRA 1AXGA 4BAGA 4IDQA 1WLYA 3G8DA 1KSFX 1SK8A 3FFTA 1RJEA 4AT1A 5BRJA 3C6YA 1M2KA 3QPAA 2EKBA 4KVAA 2HHLA 3KZXA 5FA6A 3LP5A 2OV4A 3R7WA 3SBDA 2AV6A 2QRHA 4G1CA 4GI7A 4CF4A 2ZXFA 5K0BA 1Z33A 3NHFA 3R5XA 3AGQA 1RNLA 2JI7A 5GP1A 2D8MA 3CX6A 4EMSA 3BFKA 5THKA 3MGBA 2EKLA 2R1ZA 3GCGA 3WMRA 3NI2A 5C8XA 1KIFA 5DGTA 3EMDA 2Q5FA 2XW6A 4PRKA 1X1SA 4M1ZA 4TL9A 1LGYA 3LOPA 1RDFA 1EK1A 2C00A 3Q6IA 2LCFA 5F9MA 2Q4EA 4BO9A 3CLSD 3KB6A 3OM0A 4GZLA 4TS9A 4AJ1A 3GFSA 3O8QA 8ADHA 4Q4LA 1HMYA 5EZ5A 4XYLA 3IKJA 4S1VA 4JBHA 5C46F 3D3JA 3AEQA 5TB5A 3D8SA 3OZCA 3L8ZA 3QU2A 2MMCA 4F9TA 4OXIA 1IBLB 3GD5A 1ANKA 5JQGB 5TMPA 2C2ZA 2J3DA 3B2QA 1KAYA 1JJVA 1KMNA 4DJAA 2ZSDA 5FHRA 3LWZA 2H2HA 3ZJVA 3FZQA 1I7LA 3FE2A 2BTQA 1KH3A 3TIGA 3KYCB 1IWOA 5JASA 2G3YA 4FSXA 4E5YA 1W8IA 1M1YE 3I34X 5JS7A 3DJYA 2W6PA 3VC1A 4TKMA 2VF5X 4C7MA 4QU5A 4WX2B 1UZMA 4ZO9A 1V71A 3O4HA 3GARA 3HNPA 4C05A 2OVFA 2TMDA 4KXNA 5FPQA 1E6MA 1EBUA 2AFIE 4EL0A 2FDRA 3TRJA 5C1PA 2XKBA 3E9RA 4PLWA 2PD3A 4GOND 4OHBA 4IYRA 3VR4D 5TF4A 1WCXA 3ZLTA 4I81A 4PWZA 4UMDA 1W1WA 1TFRA 3GEEA 3WLRA 2LPMA 1W7AA 2ET6A 3CRNA 4F8JA 3ZOZA 2ZWOA 4ES6A 2B2CA 4Q4CA 3CO0S 2I99A 4ZC1A 3ETJA 3N2GA 2YXLA 4RHYA 3FYTA 2GEUA 2HU5A 2W2XA 1AGXA 2NPOA 2PVPA 4OIMA 1OVGA 3GLIB 5DASA 1Y8ZA 3HK2A 2GH1A 3NHPA 1VJ1A 4W1RA 5TF0A 2ZE6A 4DCCA 4YFYA 4O4LA 3KU1A 2I4MA 2OHVA 1V95A 2XCSB 1WUTA 1II8A 3UXYA 1O95D 3GGJA 3H4VA 4OA8A 1GZ5A 4HNRA 3A3OA 1GCUA 2W2MA 4GWGA 4MUMA 4UM7A 2JK0A 1YFZA 3COYA 3DVRX 2PT9A 3F47A 3I5UA 3ILXA 2I76A 1SZDA 1YI8A 3A10A 4KAFA 1G21E 2OILA 3WTBA 5JBIA 1T4CA 4O63O 4CQMA 2C8JA 2BAGA 1S3XA 3F3SA 1QYVA 3H2JA 3QA3E 2Y6VA 5AUQA 3E58A 4CM9A 3P0RA 2I6XA 4I50F 4FMDB 3PI7A 4DEYA 1XZCA 1YIDA 2KWIA 3L8DA 3C74A 5J59A 2IH2A 5L8VA 1QF7A 2ZJYA 2A0FA 3V3TA 3AVPA 1GZ4A 1LPBB 3L01A 3X2EA 3DTTA 4HNHA 4TQGA 3AVYA 3KUDA 4HXEB 1ICEA 1W0KA 5KNBD 4EENA 3GO4A 1QCZA 2YMLA 4KUEA 3WHKA 2FRDC 2F3QA 1KJQA 4LJ5A 3Q0TA 2WQ6A 3AR9A 1DIRA 5CNJA 1DE0A 3WHPA 4NFSA 4MPJA 3ND5A 2GBFA 1NLFA 2CD9A 2WF5A 3NB0A 2XQVA 4XFJA 3BJMA 2GD6A 4I6EA 4Q5IA 2ID8A 2Q99A 3VDRA 5JQGA 4WCFB 3CE6A 1VKRA 2O57A 3BHNA 3IQIX 4XTCS 5AW9A 4CT0A 1KQFA 3CINA 1T24A 5CMLA 3CKLA 2C5LA 3L7MA 4C6SA 1TU4A 1KS2A 4EZIA 1T3TA 3KYCA 2VSXA 1UMKA 1H2RS 4OB7A 1VNAA 1ORHA 4GZ5A 2CCKA 5F7XA 1MT0A 4P7FA 1L7DA 1G8AA 1VKJA 5KNDH 1KVUA 1ZIOA 1C7IA 4NK5A 3TTWA 3FJOA 4Z8XA 3TZEA 3D81A 4G2TA 1FY2A 2GJAA 3M4ZA 5MFPA 5HK9A 3PGVA 3OOEA 4FI3C 5ALKA 5CY0A 2FZ4A 3EXG1 4LJYA 4R7GA 3AJAA 1UDCA 4HQOA 2HO5A 1Z6QA 4PRYA 2CMGA 2IDKA 2JVJA 1OZZA 2YXBA 4MP6A 1VSTA 1M2EA 1TT5B 2IKSA 3LPMA 3M3HA 4WZBE 3WYBA 4Q9KA 2Q0QA 2W9XA 3L5KA 3I58A 4JI7B 1E79D 3K0BA 2ZETA 3DLBA 3NV7A 3LPLA 3ELWA 2BMAA 1U1FA 3S70A 3HS3A 2WI8A 4MGEA 4P35A 2IX3A 3WGTA 1KSJA 1PWYE 4TMZA 1PTXA 1N8KA 2FSSA 2ZAOA 1BMQA 1NDUA 2R8BA 2X4IA 3DC7A 4TMTA 2WPDA 3PJGA 5D87A 4BO7A 1R5OA 1SUIA 1THMA 1HL7A 2IYOA 2O1XA 3NXKA 1FEZA 2P5YA 4C4XA 2P8SA 1H1TA 2JLWA 3LTEA 3LL7A 3M34A 3CJQA 4M0LA 4RK4A 4UADE 3IT0A 4M0KA 5DYIA 1ORIA 5LLSA 2XSZA 4DTCA 1KHTA 2AE1A 1T9GS 3A6PC 5JT1A 4O59O 3UHFA 1AXRA 2O3QA 5D3MA 3PEVA 3V2IA 4ZEXA 5K05A 1LH0A 3M82A 3RJ9A 3T99A 4U7WA 3ZVRA 2E18A 4U7HA 3GNSA 3DDSA 1RHJA 3ADDA 1NNSA 2JFOA 5EWMB 1R0WA 3D5EA 3KAPA 5HKBA 4EUFA 2CLSA 5DYYA 4W5RA 5IXSA 3EQ9A 1GIAA 1E1CB 2DHEA 2FSHA 3GAZA 2PH7A 4Y7DA 5A5EA 1NHWA 2N46A 4OHFA 4F0JA 3NDJA 4G4SP 3WRWA 1V7CA 2R85A 5EVCA 4I08A 4W5NA 1BCRB 3N07A 5HKKD 2FMIA 5T8KC 3CGGA 2NAFA 1E1QA 4JSTA 2YVLA 4EB0A 1AKNA 5CYOA 2V7QD 4AM8A 4CL2A 1XVUA 2HR1A 4B7UA 3QFHA 1PQ4A 2JL1A 1C9JA 3BG5A 3FPKA 3KG2A 4YDQA 1FVXA 3KB8A 3B2NA 3NBAA 1MR4A 3AG5A 1QH8B 2W2OA 5EERA 3AZOA 3X1ZA 1RYMA 4LKRA 3E18A 1S89A 4WKGA 5FPTA 1SBNE 1XTPA 2KPOA 2FF5A 3CLSC 3D1VA 3STYA 3T7JA 5HRUA 2OA0A 2VG8A 2WKPA 3BULA 1NQVA 3VKGA 4MCAA 4EG3A 1UDXA 3U09A 3CNHA 3FOFC 5HMMA 1J24A 3T1NA 2A9OA 1HDCA 1Y1LA 2ZCVA 3LY7A 4FE7A 4PCLA 4QLOA 4RF3A 3IJEB 5UKDA 4JJ6A 3BCRA 2BFMA 2I6TA 3EG5A 1JSCA 1RYNA 2XDYA 4TUYF 2BCJQ 4BRUA 1TT5A 1NVVQ 2C94A 2O3TA 3ABRB 1T6YA 3IV6A 1W0JD 4LBZA 4TXLA 1NQXA 1S3FA 2CK3D 3AIKA 2SBTA 3N6XA 4M0PA 2RC5A 4WXMA 5FI1B 5FO0A 1QFMA 2CNBA 5A4DA 1MJHA 4JYZA 1V26A 2VP2A 2G80A 5ADUS 2FXIA 5ALWA 5C3MA 4QVKA 2B61A 3EZYA 1OROA 1A2KC 1L5OA 2Z56A 1UXKA 4EVQA 1GGNA 1LPSA 1LBHA 4PLGA 3S2GA 1O7JA 1EGAA 2O50A 3D4PA 3TZQA 5BSUA 5C4GB 5LQDA 4C0XA 1ID1A 4QGHA 4EB6B 4XD7D 4O4IB 4HCJA 3DXZA 2PBRA 4RA9B 4ETWA 1ZJJA 1TM4E 1W49A 4GZ6A 1D9XA 1S8OA 5KVAA 4FN4A 3H1TA 1A69A 1MPXA 2YXDA 2HNKA 4MYUA 3NNSA 3K9NA 3F5DA 3JYLA 4J3FA 3AFNA 2QEQA 3N2ZB 2W6ZA 4Q82A 4R1UA 3EZ7A 3MJDA 4MR9B 4X8OA 5I4IA 5JHGB 4FC7A 1KL7A 4CT5A 1NBIA 3BSSA 4MQ5A 4W8HA 3CWZA 3PFFA 1DIGA 5HF8A 1RBQA 2CSUA 3O9VA 1UWLA 1O95C 4GOXA 4LHSA 5EWMA 3SFZA 4KX5A 4BWGA 3Q3IA 3NU1A 3SC2B 2Q2NA 4D0GA 1GP2A 1UBTS 3VTKA 2BGKA 1E1CA 5KTNA 2X2FA 1AQJA 2ORVA 3RIXA 2AFVA 1SKUA 1T0HB 4LJ8A 1IBSA 1SOVA 3T54A 5BSGA 1ZEJA 1Q0HA 3OT1B 2BD0A 1BCRA 1L5HB 4MROA 1BDJA 3C97A 4XWWA 2XECA 2P4UA 3IX7A 4JT8A 2FQXA 2V6IA 3HVKA 4A0SA 4TLAA 2PMWB 2I6GA 3IEUA 2D1YA 5JUWA 2RHHA 2UVPA 2ZB7A 4HN9A 1Z73A 1QH8A 1YRHA 4NP6A 4OQZA 2UXCB 1NXSA 5AQXA 2FWAA 5AW5A 1BQ4A 1KNXA 1MB3A 2FW1A 3HLYA 2Q8NA 3N8IA 2AJCA 2BZ0A 2YVAA 3MCWA 2YJGA 3RV3A 4O08A 3PS9A 2Q4DA 3QLJA 2V97A 5J5VA 1W34A 1D1TA 5I5GA 4CFZA 1ZSVA 3WK5A 4BKQA 2QV0A 2ZIEA 1Z37A 3FYDA 4XARA 5AM4A 2DECA 1CHZA 1Z18A 2XBLA 1PJ3A 1SXQA 3WQBA 2UXDB 3AILA 2XB8A 3ES9A 4G5FA 5B12A 2ANBA 2BH9A 5EJ6A 1S8NA 2BKXA 2DPXA 3CWQA 5G4KB 1XEAA 4WKNA 3H5WA 3ZU3A 3T5CA 3M9XA 2IZOA 3PXXA 1E1KA 1A76A 4LRXA 5EE1A 2EP5A 1M1NA 2AK2A 3EVBA 3GGOA 1KDOA 5C81A 1XVVA 2VAMA 4MS3B 4GI3A 3WHIA 4N03A 3QU4A 2E1RA 2VJPA 4KBFA 1YQEA 4ZT5A 1RLJA 3FLBA 1A9SA 4PPFA 1DWPA 5AHWA 1HYEA 3U4HA 4X62B 1AM4D 3MT7A 3PK0A 3ZWYA 4D1YA 4ARCA 3EGXA 2Q6TA 4LDRA 4BZWA 2QROA 5KNLA 4EB6A 1ZPDA 5ALDA 4O4IA 4GT1A 3CUWA 5FAXA 3F8WA 3WK4A 4Q4JA 4RA9A 1QCDA 3GUUA 4JBGA 2I54A 2B9VA 5ALUA 1XQXA 3PDCA 4G8DA 4R84A 3BIXA 3UUWA 5CEFA 3FLMA 2BZSA 1Z4OA 5ALEA 4YRZA 1AN0A 1N2CB 2NG1A 3G7NA 1VKZA 3MTQA 3PUHA 2Y2UA 5D51S 1YBMA 4FOTA 1ZOSA 4IIFA 4MR9A 4TZTA 3N8NA 3NAMA 3G2LA 1NI4A 1GU0A 4HL6A 1W4AA 3EJ6A 4PLCA 1QRUA 1HT2E 3EEFA 3L8YA 4L75A 5TSDA 4POOA 2KYRA 4XJSA 5JTUA 3QHAA 1NBME 5AQKA 1ZJ6A 2XRFA 5DNUA 3GLIE 4IEIA 3SC2A 3EX7C 3EY4A 2RGEA 1LXCA 2B7BA 3I28A 1D6SA 1HNXB 4N12A 4YK7A 2WSSD 1SCJA 3JYNA 2QRVA 4NF2A 5F1PA 2IU0A 3TINA 3DHEA 1A8SA 4IIJB 2R79A 4DRXB 3UWMA 2YICA 3HKCB 2YWDA 1I01A 2DWOA 3OIYA 4OHKA 1VPWA 4UNSA 1L5HA 1JXAA 4DY6A 1L6RA 1NSTA 5C37A 5LQAA 2FYTA 1RLOA 1KRWA 4Y9UA 1XU7A 1PR4A 5EHNA 4QGSA 4QECA 1QZXA 3D8HA 2X5OA 1FBTA 4LCEA 1K6EA 5E4YA 1JMVA 1WD5A 1WXXA 1V35A 3C5CA 2RHWA 5CGZA 4I5FA 1KORA 4Q7KA 3O82A 5DF1A 5A6VA 5FUMA 1R00A 5B30A 2IXTA 1KP9A 1NBMD 3U61B 5EXEA 4N54A 4BX2A 2Y1GA 4MI1A 3VZSA 5AW6A 2WWWA 4Q01A 1N8SA 3VJLA 4Z7QB 3QBVA 4MMXB 4UVDA 2FN7A 1XZQA 3ZXIA 4GLLA 2VYNA 4RGVA 3ZLUA 3Q3GE 4YRCA 1X8JA 3PLRA 4YLYA 5B4UA 2NO0A 1HDEA 1KPHA 1M6VB 4WTOA 3QBTA 2AA3A 1M54A 3B3JA 5G4KA 3EQ7A 1QRDA 3ROPA 5JAHA 4EHHA 5L3ZA 2TECE 1ECPA 1ZN2A 2ERYA 3F71A 2LP4Y 2A7TA 3GFBA 3HVUA 3H0EA 3ILVA 1IOZA 1HEYA 3ENKA 1GRCA 4MS3A 4KQEA 4N0EA 4R1QA 3HKBB 1G41A 4OFWA 3T61A 1RI1A 5CFMA 2Z6AA 3I92A 5CYGA 3BZWA 5EJ5A 1PK8A 4Q21A 1EDBA 4EM6A 1EVKA 4ZI7F 3LLUA 4HLUA 4GBJA 2D1SA 1MJNA 4M9XA 3DKKA 4MKFA 3A06A 3ND8A 4X7MA 4RJTA 3DVAB 4ER7A 2FZEA 3IUMA 3ZN2A 5JZSA 1VA5A 3DL2A 4P4UA 4E1BA 4WW0A 7ABPA 2XOKA 3ZY6A 2P4QA 3P5SA 2EKQA 3T0FA 2O8BA 1BXRB 2FGKA 1N2CA 2HQSA 5JNVA 2V3VA 5C34B 3JQBA 1HDZA 2ZTUA 1AZWA 4FD3A 4KLAA 3DAFA 1L5YA 2ABWA 3BXHA 2IEZA 4TMWA 4WK0B 3EGDA 4F4UA 2BFNA 3F3YA 1NJFA 3SS7X 1BG6A 3MMZA 4NONA 1O97D 2J41A 3S2ZA 3TX2A 1ZA1A 3K30A 2ZUVA 1F20A 4KRXA 4M7RA 1EE9A 4PCVA 2OFFA 1T2EA 3RTAA 2HXGA 1IXSB 4X1IB 5MF6A 3K5HA 1GR1A 2RGCA 1OWMA 1LLQA 3A1WA 1FUEA 3WMEA 1UKAA 3CR8A 5AQFA 1PDOA 1DC5A 2HRBA 4IIJA 1JSXA 4NABA 3TRHA 4DRXA 4EA9A 5CB4B 3ADCA 2NUBA 3NC1C 1DUIA 1E8NA 2AQHA 3R0JA 1R74A 3NDBB 3QEJA 4UUOA 1R64A 2FWBA 5HCNA 4MW4A 3TVYA 2HSDA 4PANA 2HEGA 2C0CA 3B7PA 2J9YB 3G85A 4RQBA 1FH3A 5K0NA 3AU8A 3D7SA 2YV5A 3DH0A 2GERA 4N7JA 4HQRA 1D5WA 2C88A 2O48X 1XAHA 2C2BA 2NIPA 3VHLB 5BN3B 2G6TA 1P2FA 3LFTA 4WOJA 3TLKA 2PBLA 3DNMA 3BEOA 1EDZA 3N39C 3Q9UA 1ZH0A 3JXUA 2G9UA 5EJ7A 3LSYA 1JNXX 1V7QA 3VDQA 4E5PA 3M6WA 4F21A 3C87A 3EBOA 1NOKA 3PVSA 3KOWA 4GR5A 4JT9A 1JHXA 2GN0A 2X1HA 4JA2A 4TVSA 1AKTA 4HUTA 5JD4A 5HG0A 2B36A 3G79A 1HYQA 2OUIA 4EUNA 2P3LA 2DWUA 1M6VA 1G8JA 3TSZA 1ULHA 2G7MC 3H5TA 4FXPA 4NBNA 4J91A 3E35A 4N0PA 1QHYA 3OCUA 1A5ZA 1PI3A 3L40A 4RY2A 4XVUA 2GNPA 4DABA 3HKBA 3EHDA 3LAWA 2E4UA 2CLLB 3WYNA 2YTZA 2EHJA 4RVFA 3R9XB 1C9MA 1SRRA 1WV0A 2BGTA 3MEQA 2PH5A 1NRIA 2JI8A 1E5QA 1OJ7A 1NM5C 3PUIA 2XITA 1D6JA 2Q1UA 2HXSA 4DUPA 3KQMA 4XR4A 4HMPA 1F0NA 3DVAA 4IVNA 5JDCC 4BMOB 4NU8X 3H05A 1V8OA 1R5JA 1Y7PA 4TKLA 2Q7XA 2CGEA 1Z7BA 2XMSA 3S1LA 2OCPA 4X6LA 5CLIA 4MQUA 3OUTA 2Q5HA 3KQYA 3LVFO 5B3LA 3MK31 1MO3A 1E4EB 4RZSA 4ZU1X 1R2QA 2Q9AA 1BXRA 2KJQA 4PFQA 5AHRA 1R4MB 1XF1A 1E2KA 4JT2A 4W7IA 1V96A 4EHFA 4IP0A 2WDPA 5BPLA 4TVKA 4LBYA 4O4JF 1L5QA 2QD5A 2XF2A 1UPTA 3QVGB 5CVEA 4LFAB 1GSHA 1UBOS 4FZJA 1D9ZA 4H17A 5J5AA 4HFMA 2I2BA 5DISB 1NI3A 3KKLA 3JR3A 5H16A 3TFOA 1IPFA 3WLEA 1DKMA 2V7VA 2Z2KA 2J3HA 2WT9A 3BBPA 3ESQA 5CH3A 1JLSA 3TK1A 4JCCA 1U8FO 3A1NA 3JPWA 2FEWB 1P33A 4TRJA 4X1IA 5L3VA 1U0FA 1JG7A 1Z0DA 3GDQA 4NK4A 5DULA 4ZV7A 2ONCA 1LK0A 1NYTA 3LBNA 1DEOA 3JQFA 2QAJA 1SD2A 1TLLA 3QU9A 4PVDA 2WHRA 2NQ8A 4FEEA 5TLSA 3IJPA 4L15A 3RG8A 7MHTA 1M1ZA 4BP8A 1NMQA 2PR7A 4YJ3A 3ICPA 2G1PA 4XUGB 2HQOA 2QTTA 6REQB 2PUEA 2XJ9A 1C3XA 1V39A 2N1BA 2QWXA 3R9WA 3NO4A 3W6UA 1H69A 2HPAA 4I9GA 2YZMA 1Q7RA 4W8OA 4E5VA 2P69A 3VPXA 4MKZA 5BN3A 2ZUFA 3LCMA 3ZTYA 2HLDD 1HT0A 4I5DA 3UJHA 3NEPX 2PWYA 3II6X 3BTOA 3DZFA 4RE5A 3DTVB 4PLFA 4PZPA 3WBJA 1Z4NA 5HP4A 4MA0A 1P2TA 3LNCA 4Z9BA 1XQ1A 4D3YA 4Z49A 2VAWA 5CFQA 1G59A 2GNOA 2X3FA 4AWAA 3KELA 1YB6A 4AJ9A 3UJ3X 5KO2A 2HYDA 4IIXA 4RHCA 1K3FA 2PYIA 2R751 3HCEA 3KT3A 2IBSA 1LNQA 1RC0A 1FDVA 1GPYA 2YZ2A 4LRSB 5G41A 2WHQA 1FVOA 1O94D 3BJRA 2O5VA 3JQ8B 2JCYA 3UUEA 4HPXB 1SQ6A 2WQ7A 2HFKA 4I8DA 3VR1A 4MO9A 3R9XA 3LPAA 3SFVA 1CN2A 1YUWA 1U99A 3NBFA 1XZKA 1SHJA 2VNKA 3R5JA 4AYWA 1KMQA 3BGIA 3B1FA 3OZXA 2PM8A 4INJA 1VQ1A 2WMOB 3EDCA 3WNQA 4PC6A 3V1NA 4DNFA 1PK7A 5GIPE 1JLRA 1SWWA 5JALA 1ZN9A 4FQ8A 4G25A 4DCGA 2LE0A 4BQEA 2QSYA 1BEZA 3JQGB 2BM8A 4CU5A 3MFYA 3FE1A 1GPUA 4I3GA 1EFPB 1ZA2A 2HMYB 1E4EA 3NRBA 1Q3KA 4K88A 4RSGA 4URZR 5I48A 1R4MA 4F7DA 2NZXA 1ODCA 2C2WA 2YV4A 3LXUX 5CW1A 1YRLA 5U9CA 1RW4A 3ZNPA 1EFKA 3QVGA 2Z6QA 1TF7A 2ZJOA 1ZMTA 4EUSA 5DCLA 4G1FA 5A05A 1A27A 3A4YA 4XOIA 3I9KA 4B3MB 4RXMA 4A03A 521PA 4DW8A 1NMXA 1BUPA 1UMDB 4GG1A 1Z5UA 1VG9B 4GKAA 5ILGA 1U6JA 2WM2A 3IEPA 4JP1A 1GFWA 1ZVKA 5J4VA 2AN3A 3C8ZA 4ESOA 4BVJA 2XB9A 4