1XRSB

Crystal structure of lysine 5,6-aminomutase in complex with plp, cobalamin, and 5'-deoxyadenosine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
212
Chain Sequence
b'KVQLSFTLPLKNNERSAEAAKQIALKMGLEEPSVVMQQSLDEEFTFFVVYGNEILSMEETDEYIKENIGRKIVVVGASTGTDAHTVGIDAIMNMKGYAGHYGLERYEMIDAYNLGSQVANEDFIKKAVELEADVLLVSQTVTQKNVHIQNMTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTLNDRMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-lysine 5,6-aminomutase alpha subunit
publication title A locking mechanism preventing radical damage in the absence of substrate, as revealed by the x-ray structure of lysine 5,6-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Isomerase
total genus 67
structure length 212
sequence length 229
ec nomenclature ec 5.4.3.3: Lysine 5,6-aminomutase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF16554 OAM_dimer Dimerisation domain of d-ornithine 4,5-aminomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.60 Alpha Beta 2-Layer Sandwich Defensin A-like D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain 1xrsB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1xrsB02
1CB7A 2YXBA 3KP1A 6REQA 1REQA 1REQB 3KP0A 2I2XB 3BICA 1E1CA 1E1CB 6REQB 4HH0A 3BULA 7REQA 7REQB 3KOYA 3IV9A 5REQA 4JGIA 1BMTA 2REQA 4HH1A 5REQB 1Y80A 2REQB 3IVAA 4Q37A 3KOWA 5C8DA 1FMFA 1BE1A 1ID8A 3WHPA 1K7YA 3REQA 2XIJA 1K98A 4HH3C 3REQB 2XIQA 1CCWA 3KOZA 4REQA 4REQB 3EZXA 1XRSB 4R3UC 1I9CA 3KOXA 4HEHA 1B1AA
chains in the Genus database with same CATH superfamily
4TV8B 3C98A 1SOVA 4WNAA 4YECA 3NKVA 4HXGA 4W63A 3WRXA 4ML3A 1CYDA 3C5WP 721PA 1F06A 3ES9A 4ZREA 3Q3IA 3D4LA 3PXCX 3UJAA 1OBVA 2J6IA 3C48A 3Q0TA 3R74A 3MA0A 1UXIA 3SF8A 4AL4A 2Y0EA 4X8HA 2QZJA 5CTAA 4OQQA 1JQ3A 4I36A 2VSXA 3T12A 4BP8A 4DSAA 4DCMA 4HQ0A 4CEJA 1D2NA 4ZP1A 5DHPA 4OXXA 3FROA 1QV7A 1UBMS 4PC7A 1C1DA 1JXMA 3PC7A 2KLHA 2WJHA 4GZMA 4O4JA 5AYVA 4M60A 4DDKA 4RDIA 3VPDA 2REOA 1DKUA 1G9TA 3VKWA 5MHTA 4N3BA 3ND5A 4G36A 3S29A 4DNFA 2YIPA 4LYYA 2BF4A 2C9DA 3DFFA 1KVQA 1MVNA 5AJUA 4Z8XA 3S2SA 5GP1A 1M6EX 1FXWF 2BP7A 5E6SA 3SZLA 3VNRA 2ZQZA 3QYJA 4MV0A 4H5TA 5BSVA 5GZ1A 2FPPB 1K3UB 4UEQA 3ZV7A 1N1GA 1E98A 4AG5A 1C3OA 1R88A 3GDGA 2FN9A 4KDRA 1JL3A 5E9WA 3NMUF 1ZA1A 1WUIS 3DHVA 2AXQA 1N0UA 3ZC3A 2C92A 3BOSA 4K6KA 1K2VN 4AYWA 2BBOA 3Q7IA 2YIJA 3IFSA 5FCDA 3GRYA 3DQQA 4LFCB 1TXGA 1V9LA 1WSAA 3QI7A 5EE1A 4RAOA 4D80A 4RVOA 5EZ5A 1K4YA 4QASA 4REMA 3F6YA 2OMEA 1CQWA 1QFSA 2CYBA 4QAQA 3UJ8A 4DIKA 3W2GA 2EAUA 5I01A 1IG3A 3JCZA 3JQAA 4R1NA 1IBCA 1QH8A 2JFZA 2RGEA 3G2PA 2MBKA 3ICVA 4ALKA 4HN2A 2J0UB 4M54A 4P4SA 4JDPA 3RFCA 3ZS8A 3IP3A 2OOKA 1VGQA 2XB6A 3FCAA 4CMIA 1MB3A 4OB6A 3R9XB 4WZAE 6ADHA 5BUZA 2OVBA 3DO6A 3KXDA 3MZ0A 5CT5A 4BX0A 3AJ8A 1QQTA 3FPBA 1NV8A 3QXHA 3ZXIA 2JLWA 3JWJA 3M1IA 4OU4A 2BUPA 2VBCA 3KUKA 2ZT5A 1W44A 3MUEA 4AKTA 3D4OA 4BX9A 5K09A 3THYB 4MEBA 3PLAE 4XE5A 1O77A 4FD3A 1RAGA 3AUUA 2FPIB 1A2KC 4IJUA 3N5KA 4DIEA 4A6DA 4UAUA 1GNRA 4GG1A 3SX4A 1YVUA 1FYFA 2QMUA 3MRXA 4P0PB 1IOZA 1T0IA 2PGAA 2OGTA 2WMOB 3CIFA 2EF0A 2ID7A 3ADDA 5KJFA 2PWPA 1VYTA 2PIDA 2X1VA 5IAGA 2E3JA 2RAFA 2XITA 3TH5A 5BN4B 1CVLA 1N7GA 3ILHA 2YR0A 1M2VB 4AIRA 1PR5A 2CFSA 2JAWA 2G0NA 2LIPA 2J6HA 1YJQA 2GOYA 2Q1TA 2GCIA 3C4QA 4D9CA 1G41A 2CHGA 5F77A 2FYTA 1NVWQ 1VL0A 2A6PA 2V45A 3AXTA 3K7EA 3KUXA 2DP4E 1ZINA 3I0ZA 4Q9DA 2B21A 2Z95A 5I9TA 4RVUA 5AQSA 3Q7EA 2G1PA 2WJYA 1W76A 1WAMA 2C2HA 3R3UA 4DYVA 1U2TA 3W5AA 2JBWA 4X65B 1P5ZB 5FFFA 5CFNA 3IT2A 4ZYLA 3QBEA 2XHZA 4TRRA 5J9FA 2GHTA 4D6YA 4LOKA 5GIOE 1ZFUA 3V80A 4XB1A 4DUYB 2V3CC 1SBZA 1M0WA 4QICA 2F1JA 2VJDA 3VJLA 3FVRA 4EB3A 4TS4A 2QTLA 4QGGA 4EUEA 4L3VA 2ZM6B 1YJAA 4B3FX 4B48A 2QTVA 2FSUA 2BFDB 4EHHA 3TXAA 1A7JA 1CV2A 1F60A 1H6CA 2W11A 2I3GA 3EODA 4HN4B 4NCJA 4P3NA 3WHKA 1ZR4A 3N2NA 1E64A 4Y2VA 5KOYA 4PZEA 1DS6A 1OXUA 2XUDA 3GI1A 2E2WA 1Q95A 1L7VC 1L5RA 4IXMA 4JN6B 4TMTA 4Y2PA 3RE1A 3T5DA 3WTBA 4DCSA 3NTXA 5F3RA 4MWTA 3OX2A 1SIOA 4HP8A 2VCEA 4E94A 3KKEA 1P18A 3RBVA 3NTUA 1EQAA 3A9CA 1UMDA 2KPYA 1AQLA 1TF7A 1V4NA 3O4RA 4KV9A 5E6RA 3UA3A 2QDXA 1D1TA 3P0HA 1G2IA 3Q40A 1A82A 4WUTA 2IZ7A 1BYIA 4BNTA 1KZGB 4GOKA 4WNAB 2W8BA 1M8JA 1U7PA 2J5QA 5IK2D 4I3GA 1JEAA 4RVSA 2HMVA 2Q1WA 5TX7A 1ZITA 4B47A 1G2OA 4JJAA 4PX2A 2A67A 2XVXA 3FWZA 3H17A 2B20A 2RBGA 3MMNA 4M22A 3HJHA 3SF8B 4A8HA 5BPHA 4UOEA 2C84A 2RHMA 1XHFA 4PIPA 3HXLA 1XCMA 3JARA 3QX9A 2VP9A 4B5LA 3A6ZA 4H5VA 1U7XA 5D5QA 1EX7A 3RI3A 1D4AA 1LA2A 3CWZA 4F4CA 3GEIA 1R5JA 5E1OA 3WVNA 2GETA 3EIOA 2WIAA 1CT9A 3LQFA 4WFQA 4HT3B 3U7FB 1NJ1A 1T4BA 5AFSA 1KEPA 3GP3A 3RVKA 1B14A 4FFDA 2AUNA 2Z4TA 3FAKA 3KALA 3TQOA 3ZGYA 1E3IA 5JAUA 1RKXA 2UZ4A 3R8FA 4FGSA 3JYPA 2J0SA 5BQ3A 1DT5A 4C7KA 5J2TA 1C7EA 2PUCA 1ZVGA 4NOLA 3PRKE 4AU1A 3FDZA 5EJ2A 2ERCA 2PRSA 2CE2X 1YQWA 2WTEA 5IYZA 5KYTA 1C3EA 3U4CA 5AIAA 1Y89A 4L2IB 4YCDA 3V46A 5SV2A 1EDZA 1QSGA 2WKWA 5K3CA 4ZTUB 1NXXA 4LK3A 5AW0A 2JRLA 4M1KA 2J3IA 4X63A 5TVKA 3ETNA 4FXPA 3LUPA 3WL4A 1XU9A 5B30A 2BGMA 1UOEA 2A2ZA 3TQCA 3RVLA 4UAEF 3EZNA 4AFNA 4CF7A 3R75A 5YASA 1MO3A 4BQIA 1XCLA 2YASA 5B4VA 3I6QA 4W82A 1BVUA 3JQAB 3ROFA 2MJLA 4BZQA 1IBKB 1IQ0A 3FPHA 5AI8A 1NXWA 3A10A 5CB4B 4O59O 4R8LA 1STOA 4CMIB 3TSAA 1L1QA 5GINE 1XMQB 1KDOA 1CUAA 1JI0A 4H4EA 3VU1A 2GCPA 2ZIVB 3TI9A 1VLVA 4BNLA 1E2DA 2FCAA 3PQ4A 1CUXA 2I5PO 1PFKA 1VLHA 2JA2A 2Y67A 4JFAA 8ABPA 3X1XA 5EYPB 1W93A 3KIPA 1BW9A 2OAEA 2QVYX 4IGIA 4D6PA 2J7KA 1E32A 5ESRA 4QYSA 4Q9LA 3T5PA 1H2ZA 3NHKA 2YC4C 4GPEA 4LAFA 1T7BA 3EYAA 4QVIA 4Z6KA 2B7BA 3LYLA 1BRMA 1CE8A 1AA9A 2CBXA 3OU2A 3RTGA 4BO8A 2D0PB 3F97A 4CKYA 3QELB 4YUYA 4Q48A 4MJXA 2I6FA 2OD9A 3VPSA 1A88A 1CR2A 1V5GA 2GGSA 6GPBA 1ZMTA 3TLEA 3CLSC 3F0TA 2Q6IA 3PUYA 4AN0A 1GSIA 1H8HA 2YBDA 1O95C 3DYVA 4GYYA 3G8BA 3WIEA 4CM6A 4D41A 2ZE6A 1R6DA 3GLUA 4F3KA 2BDEA 3WQQA 2W4QA 5G0SA 4HGPA 2J41A 2V5UA 3DE0X 2CV2A 1X80A 1PS9A 2OSVA 5IJAA 5K8IA 1MV8A 2ZT7A 4JSRA 1IATA 4EA8A 1AHHA 4BU1A 2Z5VA 4U00A 4L5YA 4ND6A 4RKEA 2NO5A 3AZQA 3RABA 5JSHA 1BVRA 5EESA 4MQ6A 1G8FA 1KVTA 4G0PA 4PSAA 2ZCJA 2POCA 1H8HD 4LX0A 3E4DA 5DRYA 3KAKA 4AN1A 5T6BA 4EHDA 3RUCA 5LCXA 3WKAA 1HE3A 3G0GA 3OF5A 3IP8A 1MDBA 2X58A 2ZJFA 2EFEB 3PUKA 2ODPA 3PQ5A 2X7XA 4YRJA 3UWPA 1DAKA 3VQTA 3GW8A 5LQUA 2B5VA 4JITA 4V38A 3WWPA 3U7RA 1NLYA 3GFQA 4RKWA 2P5TB 4JQCA 4AXXA 1AD2A 1XEFA 4IO1A 3FHTA 4KKXB 1M6VA 4BBJA 1N5RA 2GXSA 1H93A 3AVUA 1E7RA 3K0CA 4ECEA 5AQEA 1FBNA 1OLXA 3ZIAD 3GUYA 3B78A 2EQBA 3ZDRA 1H2BA 1P1HA 2JFVA 2X76A 1LI4A 1JLMA 2XE6A 4PTZA 1PFWA 1P0FA 5EIBC 3ELDA 4PZYA 1JKIA 1SVSA 4FNOA 3RH0A 3TL6A 3NZEA 1HORA 4LV5B 1U6JA 1NMYA 4N0DA 4GE3A 1IHUA 2PT9A 4YAEA 2BMVA 4HX2A 4P7FA 2OZVA 2Y2UA 2WFLB 4QTXA 3GVIA 1G9SA 1EFPB 4K46A 2W8BB 1APBA 2WNSA 1Z68A 1O87A 2G8NA 2Z2IA 5EHZA 2AHOA 3AWIA 3B6MA 4G5FA 1LTHR 3RBZA 2PMWB 3HR7A 4BV8A 2D3WA 5EZYF 1JPNA 1RDFA 1NUTA 1Z4QA 2BEUB 2QR2A 4P33A 4ZEWA 2OBMA 3ZYZA 4NBLA 2ZBGA 4KBOA 3O8OB 4AURA 3OG9A 3UAOA 1I2AA 1R16A 4MS1B 4MV8A 4OATA 4UNSA 5E38A 2VJMA 1MMFB 4IRXA 4IVNA 3I04A 4CG0A 1KIAA 1F4VA 1BQEA 2GK7A 4QDZA 1T2UA 3M6LA 4ITVA 5FR1A 3SSOA 3ZV4A 2UXCB 4LF8B 4DWVA 5JANA 4DQ0A 3QX7A 5CYPA 4QD3A 5K0EA 3GVCA 3UMJA 3TGLA 1WPGA 1GA4A 4UE6A 2YZ7A 1R4NA 3WQRA 2F3QA 4R1UA 3VH2A 4EY4A 5J2TB 2BH9A 3GNTA 3AIOA 3ZE7A 2AMJA 3FDZB 4F11A 4YQFA 2WP8J 3HWX1 4LOAA 5FBLB 4IDPA 4LPKA 3F8SA 1H1LB 3P0JA 2DWOA 1CXZA 5AI5A 1XDUA 4U5QA 2YV4A 1XRMA 4M8IA 1ZXXA 2MSKA 4WVLA 2R25B 3MT0A 5AHOA 3RPEA 2PZLA 3CLVA 1ZW6A 1FNNA 4ZANA 2NSYA 2JGDB 3HKDA 3GJQA 1T29A 1UKAA 4MUAA 5DRTA 5K3AA 2ZXUA 3F1LA 3PPWA 2X19A 1GFZA 1XQ9A 2DFDA 3UMRA 3DJYA 1KJ8A 2EJCA 2PBRA 3VAAA 1YS1X 4CM4A 1EKXA 2DE0X 3RIMA 1OBOA 1NX9A 2IXAA 5LM3A 5I9NA 3X43A 3ZQUA 4BVEA 4CKEA 2UZIR 1PWEA 3QLUC 3KELA 3QG1A 4FX5A 3C8DA 1XZFA 1ML3A 3KJZA 4JA2A 4LSWA 5AKXA 3WYAA 2RGRA 1JKMA 5DHFA 1EYZA 2EHDA 2GK4A 3HXOA 3F8TA 4ZVMA 4D9KA 3F1KA 1RWQA 3KEFA 1RAFA 1EA7A 4GYKA 1CQJB 1TEXA 4MZXA 4U2EA 4UCQA 3A1SA 3RC3A 4D26A 2CB9A 1F9EA 5AW3A 2IYSA 2ID4A 6ABPA 3TRIA 4HX5A 1CE8B 5H3HA 1SUDA 1R6VA 4RZIA 3S27A 3QVJA 1I7QB 2PMCA 2R6GA 5EHGA 4HVCA 5I7UA 3FYHA 3NP9A 2Y4NA 4X92A 4TQAA 2F8SA 4OB8A 3DE4X 5F73A 5A71A 4BVKA 5K6TA 4OX9Y 1JFTA 3NRBA 3AP3A 2PRYA 2RKOA 3C3EA 4K88A 3EZGA 4WLNA 2JEOA 8ATCA 3IE1A 3OPYA 1SIWA 2I33A 1ECBA 3T7TA 3B2QA 5A4MS 3QYPA 4IDHA 4R2IA 1K7XB 1M34A 2AN4A 1ARZA 2GAAA 2ORIA 4L16A 3RVOA 1Z0KA 1JXQA 3PNQA 5HCIA 4B31A 3N53A 5C5IA 2X77A 3MCVA 4X9XA 3VTKA 1PS8A 2ETVA 2GPJA 5TPZD 4FINA 3EUAA 2B7CA 4NLLA 3UT5A 1PL6A 5ALLA 3RFXA 1PP4A 4X6UA 3V55A 1ODIA 1NVGA 4JR1A 3R5XA 1UKCA 4AZWA 4RX1A 3F7OA 1O9GA 4K6CA 1XKXA 2A57A 4GI3A 1K27A 4KEAA 421PA 3KSAC 1I9GA 2BM9A 1MA0A 3KKQA 4IIBA 4D97A 1FPQA 1VE5A 1D0SA 3OURA 3W9UA 2RKBA 1CFJA 1JDJA 1M6VB 1G2PA 2ADMA 2K2WA 1H5QA 3OEHA 4YACA 5DM0A 3V4RA 3TL2A 1FYVA 3AHJA 3ST7A 2IOFA 2BTQA 1V7ZA 5TQ0A 1C3LA 1NWCA 1J1IA 1QGUA 1Z0UA 2X9VA 4LJ6A 5IX8A 1WXGA 1ZGHA 2WIFA 5L3SA 3L18A 4C0BA 3H9QA 4XGRA 2I2AA 1W5FA 4WECA 4RYLA 4KWEA 2ZUWA 2YQZA 1NMQA 3K94A 1CUZA 1OROA 2ANBA 2D13A 1OVMA 2ZR0A 4GKBA 3O91A 1IPEA 3IBYA 4Z3DA 5A5FA 2IPXA 4C07A 3RWOA 3OEHD 4RTQA 4KXVA 3O73A 3HB5X 1I13A 2WAXA 3UGTA 3AHFA 3EFOA 1KAEA 3NP7A 4CJXA 4BX8A 1HBJA 1TQ2A 1QQ5A 2HMSA 2JLBA 2O6LA 3S2IA 2W2XA 3H2GA 4ZN6A 4I14A 2EKBA 3H04A 3R5KA 2Z98A 2BJVA 3A1DA 4I46A 2ZQ5A 1IJBA 3PS9A 1QYWA 1G3QA 1CJSA 2VJMB 2WJ6A 1JFVA 4W5JA 3H4VA 1KEWA 5DP2A 2YVUA 4IDOA 5CLFA 1YOBA 3O4FA 4P93A 5HS4A 1RXVA 3FTQA 1U2SA 2XMCA 3PEUA 1GPLA 2ZG6A 3RAGA 1DO0A 3MT8A 3K4PA 2QRNA 2H1OA 2C0CA 1PLKA 1S89A 1G7RA 1G42A 2BI8A 2I87A 2Z5GA 1SG6A 1ZU5A 1R4NB 2F3SA 3DC2A 3KJHA 4OP1A 4JI8B 3IP5A 5F3WB 4L9RA 1FFXB 3F98A 1OX5A 1Q1BA 2XT0A 1Y4SA 4H7DA 3KJIA 5LLSA 4H35A 2O19A 4GPD1 1ZIXA 3OZVA 4JSTA 1GZHB 4KGVA 3LQYA 4YPFA 2CJFA 4Z2AA 4UBKA 2J4CA 4MQMA 1RLUA 3TCKA 4DBLE 4L95C 3FZNA 1XD2B 3OI7A 3K2BA 1FUEA 3LFUA 5DW0A 1OR8A 3HKDB 2QGFA 2QVLA 3D31A 2VXYA 5BV7A 2NMVA 1L5NA 3IB3A 1RQNA 4ER6A 1KE1A 5CPBA 3C41J 1GNPA 3P9SA 4EMSA 3OJFA 4X8OA 2J3EA 3WRXC 5K5EA 2OKCA 3E53A 4TL7A 5TQ2A 5CVCA 3CCFA 5TF4A 4RYDA 3GA5A 4W4TA 3D0QA 2GMWA 1YOVB 1B2LA 1DIBA 1NLMA 2XY4A 4K03A 4RIEA 3N8GA 4FBLA 4EA7A 1G21A 1DJPA 4WZBA 5DHSA 1Z4MA 8GPBA 1PJQA 2GWHA 1N75A 2P41A 3H1BA 3OZSA 2P3OA 3TM5A 5A4KA 1KDPA 5FAKA 2WJ3A 4BCDA 2J5XA 3NNNA 1Q6YA 4O25A 1JQJC 2G5CA 1HLPA 4AROA 4EUSA 1W47A 1J33A 2H08A 2OO7A 5IKXA 1H42A 3HB1A 3U7QB 2PKXA 2PSHA 3JVIA 1USKA 4ETIA 3QVGA 2NVUA 4LXGA 1YULA 3T5TA 3W4KA 3LC0A 5L3ZA 4G0XA 4PHFA 5JNTA 1SVOA 1NIPA 1UWVA 2GVZC 4W6QA 1Y4DE 4G0ZA 3EXFB 3E7WA 4UVGA 5F5XA 2C88A 3I9NA 3GF4A 3P8ZA 3S8EA 2I1WA 5JJLA 2XE4A 2JVKA 4R8MA 4P38A 1IK6A 1M1YB 2YOHA 3HK2A 4CV1A 4G24A 4JLKA 4KIUA 4RD2A 4UMVA 3B6JA 4HWRA 4Y98A 3S1SA 1N2SA 3VNVA 4DUZB 1M34B 2QAGB 2CUZA 5E9AA 5JMWA 4KO8A 3P5BA 5DHRA 3EYWA 3D1JA 4FTWA 4JC5A 4J91A 4LJKA 3BMNB 2D54A 2HXGA 3CTMA 4RD3A 4XIIA 5AKHA 3UUFA 1C0IA 1M6YA 2A1TS 3PGA1 3BAZA 3HYCA 4GXTA 1DIHA 1MZVA 4F7DA 2D2XA 4QOJA 1XN4A 4YAWA 3C3KA 1QAQA 2BCJQ 2HQ1A 4NENB 2VWQA 1JQEA 2IHBA 2FVXA 3BXEA 3GLHA 3ISTA 3JTMA 4FKZA 4J2TA 1G64A 2EP7A 2Q5CA 2ZRAA 2ZSBA 3ZWCA 4NJOA 2FQWA 1H85A 4RTPA 3FDJA 2IZOA 3ABSB 1YJCA 5ESXA 5B1EA 1CULC 2ZI9A 1W5BA 1YDWA 2CL0X 2WOOA 2H0QA 4LCEA 4BB9A 3ROGA 5IKOA 3TZLA 2E3FA 4CM8B 2AFHE 4DSNA 2RGYA 1VJTA 2JJ1A 3QMMA 4C78A 1P8JA 3NATA 4B7ZA 2WW8A 2AFIA 4HYQA 2MMCA 4YROA 2OC4A 1IUKA 3CG0A 3MJHA 5TQ0B 2VAWA 3JALB 1XKQA 2WDPA 3LRPA 3NNDA 5TB5A 3NHRA 4EGQA 3MAJA 4F56A 2WWWA 2R65A 3B70A 3NXKA 4ZMRA 1HFWA 1JHVA 3MCTA 1A8SA 2QG4A 3KLBA 4QOGA 1VP3A 2ZRJA 4BC1A 2AXEA 3DAFA 5HBGA 3H11A 4L8YA 5E3HA 1XZIA 3RAFC 2YJNA 3V8RA 5K3BA 4DDVA 1WMBA 2JJ1D 1VYHA 2ZIEA 3D2LA 4MQUA 4AY5A 4FGLA 1C3XA 1VDZA 1BWPA 1R27A 3ANMA 5HFNA 3A9WA 3HBJA 2XQGA 2PVCA 4Q19A 5F78A 4JHLA 1A69A 4XVQA 3O4HA 5BVGB 1UZUA 1IQRA 2R96A 1KORA 4TTSA 3AH8A 4R40A 4O6VA 4WASA 2FSFA 2X0FA 3WO0A 1DU4A 2DZDA 4Q1CA 4MUJA 1IOWA 4NU8X 1HJOA 3TRJA 4RVGA 3O8DA 4IFTA 2VJYA 5BWCA 1T0UA 2B92A 3UA4A 1XJWA 2C1EA 3IPAA 3H13A 1YA6A 4L6AA 3EGCA 3NYRA 2GDJA 4KXLA 1GUDA 1M1ZA 1U0FA 5AQIA 1V95A 1KYIA 3ND6A 3TUJC 3UK1A 2AMYA 5LMZA 2H16A 3BYZA 5J4LA 1UXGA 2X6TA 4HS4A 1RRCA 3SJBA 4CKCA 1WSBA 5BWBA 5I4CA 3E9NA 5D5HA 5FPYA 1E9VA 3W3AH 1TU3A 5C4MA 1AN0A 3FDIA 5EJ4A 4XIGS 3WLOA 4EY8A 3INTA 1DOAA 3IQIX 1CRQA 3U3MA 5DSZA 5IAAA 1IONA 3AEUA 2EEPA 3DXYA 3ADPA 3N8IA 4PS1A 2CL6X 4UUPA 1KPHA 2GZ2A 4HQOA 4NFHA 4PRLA 4TUYF 4TSRA 2Y0CA 3SK0A 4WJLA 1T2FA 3AF2A 3FOCA 3GJ8A 2QM0A 3MM4A 1Z6YA 3DHWC 1NN3A 4XDYA 3FETA 3FCXA 1BJRE 5LYYA 2VR1A 3QKRB 4IL5A 4NJMB 5E0KB 5CA1A 3HWWA 2B36A 3OO0A 4HUTA 4NCXA 4RD0A 1DFIA 4I1RA 3EVDA 4IH9A 1RAIA 4Z86A 3JR7A 4DTIA 1CHZA 4HUJA 3RO7A 3KS9A 1C0EA 2GEBA 2O8VA 1SWVA 4K40A 4DW8A 4D4HA 2XJ4A 2XH8A 1U31A 3F9CA 5C34B 1GN9A 3MD0A 1G21B 1SR8A 1WA5A 1SXJA 2BBWA 1QUEA 3I53A 3MS7A 4W7HA 2M8BB 3B1ZA 3SDSA 4ZVKA 3LGSA 2VPIA 2C2XA 1SOAA 4TWJA 3QQPA 1OBHA 4KVGA 3HL4A 4CM9A 4QPDA 1C9NA 4Z8YA 4D0RA 1SQ0A 1VM6A 4I5EA 2KBKA 1W73A 1K8XB 4QQRA 2CXSA 3QOFA 4WN9B 1PJSA 1F5NA 2W58A 4JVNA 1QWSA 4YPOA 5FTJA 3IAM6 2D5AA 1XNQB 1Q1QA 2DJ5A 5HILA 3HU5A 1NYRA 3OEWA 5I7VA 4MZDA 5HZMA 4HYYA 5BMVF 1T1RA 1AB6A 2P30A 3FCSB 4QTUB 1SXJD 5JPDA 4ONEA 2QTFA 4C05A 4YCNA 3KAJA 3FYCA 3COJA 4OHXA 1QK3A 3WMRA 4EKIA 4CM9D 1F8FA 2E9SA 2LZ0A 3QE3A 3WE7A 3ZVMA 2KSKA 2R68A 2HJGA 1A98A 3QE4A 3A2MA 5FUQA 4DSUA 4ZZ3A 2Q5OA 2ZE5A 3PNPA 1ULTA 4O1IA 4E30A 2C99A 2VSYA 1NI5A 3BWDD 2HH9A 3WAJA 1I6GA 2RGAA 3KTAB 3SE7A 2I3DA 1NVBA 1EI9A 2ZB3A 5FPTA 5FUYA 5C1OA 4YI3A 5A0VA 1OFHA 5HFJA 3M83A 4L8GA 3VDQA 4YTEA 3PE3A 3ER8A 3WP0A 1RXIA 3JV7A 2P69A 2VWHA 4RK6A 3E3MA 4IVPA 4TVKA 4D8TA 5JTTA 3RTDA 1U2PA 1PAUA 3QV1A 1BCRA 5L9AA 3T5MA 3PUJA 3V8VA 3GN1A 5L3QB 1ISGA 3P9RA 4AJIA 4JLDA 4LMRA 2QRKA 4M86A 1AGNA 1E61A 2B1JA 4M8KA 3PJRA 4HWGA 1RR6A 2AFIB 4XRRA 4Y67A 4RL4A 3RNOA 3W90A 5LP6F 2DQKA 1HLDA 5FUBA 2HLPA 2HL6A 4ALLA 3NTVA 1H6BA 4L4XA 4QFBA 1TQ4A 5EHXA 2W6IA 1L8XA 3N86A 4M0FA 1U1GA 4QYIA 4NMLA 4G1BA 2QM8A 3CUKA 2VH2A 3OHPA 4D4KA 4YCMA 1A4UA 2QI9C 2WJIA 4HLCA 1Y3FE 1NUSA 1VB5A 3WMFA 5FA8A 5BT8A 1QQOA 4MARA 1KP2A 2P68A 5EJAA 4JS0A 1DEKA 1ISSA 5BP7A 1GXSA 1D4ZA 1UK8A 2BGTA 4JX8A 4LJ9A 4YRMA 2ATCA 1AUXA 2OILA 5CNIA 3WFJA 2W6ID 5D86A 4ZYTA 2VK8A 1JHUA 1GGNA 1NN0A 3DH0A 1PBNA 3N2KA 5DDIP 1TM1E 3DNFA 2J30A 2BEWB 2C7GA 4YUZA 5JC1A 2X86A 1WBDA 1OLUB 2ODNA 4F5DA 2BY4A 1D4OA 2ACWA 2OB1A 4NNPA 4UDOA 3TAHA 3I2IA 2Q28A 1V45E 2YQ5A 1A77A 1JSLA 1NGEA 1W5EA 2RGXA 5DBEX 4DGSA 4PPNA 1WDKA 4G56A 4I4TF 4L7VA 4YRRA 4OLBA 2PX3A 4Y0NA 4MVJM 4HPXB 3WMXA 1YQTA 2LVBA 4DILA 4QPNA 4B40A 3GL1A 4JQSA 1NT4A 5HK9A 1M8GA 2R48A 3KZMA 2VAVA 1U3DA 2M32A 3HZOA 3L92A 1JR3E 1B2RA 1Z0DA 3HY4A 3QVKA 4TN1A 4C2BA 3K0CC 1DO2A 1FNCA 2HPVA 3DM5A 1UCFA 3DFMA 3I8XA 1W8IA 1Z4LA 2Q49A 2HF9A 3OD1A 1P9RA 4LDRA 2BISA 1JKXA 1MG5A 1HE1C 3O7MA 2GTIA 4UAGA 4UE2A 1G5HA 3WNCA 1EBFA 3C5HA 3DLBA 3SVTA 1N2OA 4H0CA 3R6GA 4FNMA 2DPXA 3KU1A 4RDHA 3A9RA 4F8JA 5JATA 4Z4EA 3KUDA 1EUYA 1BEEA 4X6LA 4C1BA 3TBKA 3VMMA 5CA1B 2XNHA 3UATA 4HVTA 4AUNA 3P9KA 4PPFA 2QX7A 9MHTA 2ZR8A 5JVDF 1CUSA 1E6CA 5J4HA 1TYBE 2D7JA 4I8IA 1ULSA 2BFMA 1RJWA 1ZD4A 4ME6A 4J94A 3D8RA 1CDEA 2G5GX 3A6HA 4HMOA 4D3FA 1OXXK 2HGSA 3VJRA 1LBIA 1IUPA 1DTWA 4XTRA 2FJPA 3NIBA 4INZA 4KACA 5AQXA 4DOMA 1WLSA 1ULZA 1V7CA 1TIPA 3KOXA 2CMFA 1VSBA 4P6VF 2CFTA 5KS2A 3THXA 4JC0A 4WINA 1V25A 3RTBA 4QJIA 3H4MA 1FB5A 1MZPA 1IUOA 2WF7A 1W0JA 3CRNA 1RRVA 3CE6A 5ILOA 1XZNA 3F73A 1WS6A 2ZZMA 5CGZA 5A1JA 3IOYA 3RC9A 3FIUA 1NGSA 1P77A 3N2LA 1DBVO 3ZWVA 4E5UA 4K8RB 1GDTA 2AG5A 2NOAA 3H5WA 4DQDA 1AU9A 3JQ9C 1E6MA 3LQKA 3WDLA 1K7YA 4N82A 1KAMA 3E1SA 3M33A 5TE9A 3M4YA 2VP5A 5LNK6 2XUHA 4YYEA 3JWIA 2DPHA 2XD4A 4BP3A 5FUXA 1DJOA 1YUNA 1HX7A 1QCZA 1OHHA 4BKMA 4Y6OA 1QB7A 4KRGA 1ACMA 1BG6A 1NP7A 5A9SA 1ADBA 2H4WA 2C7VA 2PMKA 4KN5A 3X1MA 1F5SA 2I55A 3R2VA 1MB2A 3AFMA 3SZRA 5HUHA 3OT4A 5SZIA 4I1PA 4OHVA 4WFJA 1NHWA 1UBJS 3MELA 1K68A 3NUGA 4CLEA 5CBPB 4UJ3A 1QFJA 2N9UA 2GEUA 5GIPE 3IYLW 4P53A 2QWPA 3OD5A 4HAZA 3UV3A 3K9HA 3UXEA 3LBHA 3F6SA 2I99A 1JG6A 3QTLA 1KV0A 5JUWA 2JFXA 4Z4FA 1OHHD 1A4RA 5JJKA 3INYA 1YR6A 1DAMA 2FSGA 3C43A 3PA8A 3JQ8B 2A0UA 3TIIA 2GJKA 3BKXA 1P2FA 3DYBA 1D3AA 1U7OA 3KKPA 4OBWA 3PL1A 2HSZA 3IHWA 3ZDQA 2UKDA 4Y9RA 5TMPA 3AHEA 3LUHA 3WK4A 1QP7A 3ROPA 4DCVA 3I4FA 4GMDA 2I8LA 2LD4A 3SQNA 3TZBA 2QG9A 4IO8A 3WLTA 1R18A 4BLVA 5H82A 3O3CA 1RVDA 3ANNA 1Z29A 3F7TA 1ZNQO 1PDOA 1NI4A 5AK3A 3I01A 4QUAA 1Z7GA 1OXTA 1Z6XA 2AYXA 2IPOA 1ZCBA 3ZJYA 2C29D 2NVOA 2GBGA 4HEA6 4XQ0A 2UYHA 2AUMA 1GXSB 3AL3A 4Y0AA 2F55A 3EA5A 4AYXA 3B6KA 4KXNA 5EA2A 4BKOA 3NGLA 1TO6A 1ZY2A 2CD9A 4GRDA 4LSMA 4X54A 1TAGA 1VRCA 4MHTA 3GMDA 4K28A 2GN9A 3GFFA 3PDHA 2ODTX 2C5SA 1BE8A 4GW3A 4TWAA 1E2FA 4LRTB 2PQ6A 5LU9A 5K0GA 2YWGA 2LY6A 1FSGA 4KJXA 3I73A 5ED0A 2Q7DA 4INAA 3I6IA 3V8MA 1FTGA 1NHGA 2VZEA 4URWR 4A15A 4HFNA 3WWCA 3HM9A 1X1DA 1PV4A 1UAYA 4ZQBA 3EWNA 3K16A 4G0YA 2O50A 3D0OA 2YJ3A 2WJGA 3V1UA 2IH4A 2NNLD 2P4SA 2G1KA 1BVYF 1GRVA 1W581 1ZRSA 2PKQP 2V4UA 2ZU6A 3MWGA 3DE7X 1N7IA 1E2HA 1KS2A 3MOSA 2C97A 1H1TA 1E2KA 4REOA 3NALA 1ZJZA 1KRWA 5ALQA 4IYRA 1TJYA 2X0IA 1Z7WA 4CT5A 2DFNA 1UM9A 1J90A 3LGAA 4E6EA 4D4IA 5AVRA 1PTJA 4CM7A 5DK6A 2Q3BA 4DS3A 2YIDA 4OH7A 4NG5A 4RO0A 4NZPA 4XGNA 3A1CA 4OYLA 2FPRA 3FPJA 3P2EA 3B7PA 2BL4A 1VI6A 1FYEA 2WSMA 1EM8B 4C43A 4XPIA 1G6Q1 3ICCA 4R2MA 4BVFA 4WXMA 2YBRC 1U7TA 1YL6A 1XMXA 2FSIA 3ENKA 3ZWDA 4HXYA 5CB0A 2HNKA 2CZCA 4F0JA 1G8MA 1O03A 1E79D 3C3XA 3FZGA 4CLXA 1SEPA 2DFPA 2PD3A 4IP0A 1QQBA 1KY4A 2AG0A 4J7AA 3IILA 2PYZA 4ESHA 1BX0A 2GF0A 3ZK9A 5EJEA 4DNQA 4PSVA 2N1MA 1YZYA 1DTWB 1YRQA 4MKXA 2VJLA 4GZ3A 5KKCA 1G6OA 4KO2S 4U63A 3DAPA 4I1OA 4O4IB 1BWQA 4DNPA 1HEYA 1DWOA 3K15A 2H07A 1HQKA 1FMLA 1XU4A 4MIOA 3RF7A 5D7NA 2QRPA 2ZAIA 5LZ4A 3AIMA 2RG1A 1Q57A 5HS6A 1RFGE 3RKUA 1RJFA 2G83A 1K5DA 3SVLA 3SDBA 3QW4B 1U81A 2GBPA 3WK7A 1B93A 2BDTA 5JCPA 4ZAWA 3UHFA 3V4ZA 1LX7A 2E7ZA 1E5DA 4J1QA 1E9BA 3USCS 3K6KA 1TYAE 4IHQA 3DHEA 2P3SA 4JT4A 3F96A 2J4DA 1XYGA 1X19A 3IQHX 2PL1A 1PF7E 3SHFA 4NBVA 1U9JA 1F8UA 3TAXA 1NM5A 1SCDA 1X15A 2E82A 3GOQA 1JVBA 1XQXA 1XCOA 1Y9JA 2CNLA 1GRNA 2HKIA 1BYUA 2HPAA 3BE4A 4JI6B 4A5OA 5G3YA 3OM1A 3VYWA 3MLBA 1Z5VA 3DUFA 2XKJE 1AQ6A 1WVMA 3BERA 5CGQB 2SNIE 1OPRA 1R8XA 2GEFA 3SEZA 1EXVA 3TF5A 1J8QA 1JMYA 1XG5A 4PAOA 1GT6A 2I91A 3HNOA 1DAFA 2REXB 3NNSA 1SXHA 1I6KA 2Q2VA 4J9VA 5JAPA 2ZI7A 2Z83A 1W2HA 4BAZA 2CK3A 5A03A 1A5ZA 2O4UX 4XEHA 4Q47A 3IIKA 1NBIA 3V1LA 4L7QA 1KGSA 4FUQA 2MR6A 4XJVA 1QDLB 1GR0A 2AJLI 4A8TA 4CMEA 3CIOA 1KZ4A 3G1TA 4OM7A 3CH5A 4L9WA 4R3WA 3TSZA 3NBKA 4LMBA 4BATA 5A6VA 4EG8A 5BY2A 4X1YB 4YXWD 2FMIA 2VS1A 4IEEA 4V3CA 5KNBA 2QPLA 4J0QA 1SZCA 4MI6A 4PLHA 5FOTA 4C7OA 3JR3A 3NKLA 3CH4B 1YMQA 3VH1A 4E5YA 5AM5A 2NV2B 3B82A 5FNZA 3S6JA 1BRTA 3EQ7A 4A8PA 1EQ2A 4B3SB 4OGKA 4AMYA 3EIQA 5B7QA 2JEZA 2QENA 4N5DA 1I24A 3RWBA 3KL4A 3WGIA 2AZ4A 3UGQA 1J25A 2OV1A 4L07A 4IUBS 1TCBA 2ABWA 2KM1A 2ARKA 2JHFA 1UC9A 3UHAA 2VYCA 4V1CB 3R5FA 5KNBD 4LVOA 1VXRA 3FMOB 4LWZA 1ZH0A 3ESAA 2J9GA 4C2UA 4MP6A 3OZRA 3HCDA 1P5HA 3Q72A 4FLMA 4QGHA 3I9JA 1BDHA 1SEGA 2GYYA 4A16A 4TYYA 1R6TA 4QOEA 4W5WA 2IYFA 4LBWA 4IQ4A 3K2IA 5FAXA 1C7JA 1D5WA 4I50B 3LWZA 3TQFA 1SWWA 4QJBA 4DEXA 1XTTA 4PYIA 3AXSA 2WIKA 2QWXA 3BXHA 2FRXA 1V3VA 1BJTA 3DMFA 3M4XA 4Z7QB 5A02A 4XD7D 5I7FA 3M34A 4BFTA 4AAZA 3DWIA 4QOSA 3ZDZB 1WXFA 2P91A 2W70A 2VAMA 4GOND 1B15A 3MTQA 5ALMA 5HJ7A 1W36D 4MR7B 1FL9A 4M3NA 4IS2A 3T7SA 3PUVA 3C6XA 5BWNA 2PRZA 3BHIA 3G49A 3O84A 4I2VA 5C4GB 1BMDA 2DKNA 5T3YA 5SYAA 1S4MA 1UM8A 1KWGA 1B7DA 3KVOA 1T5IA 1TLLA 1IZ0A 2G4LA 1EFUA 1XRLA 3MAAC 5FTMA 4C4XA 4UNRA 3IAS6 4HNGA 3RT7A 2JI4A 1S1CA 2A0YA 2UDPA 1YBAA 3G68A 2GLXA 1RD4A 3LLCA 3L5KA 4BYGA 3J81A 2C0PA 4YP6A 2LCIA 3ND7A 1X1RA 4JIMA 1F8YA 4JKIA 3ZY6A 5ITZB 5F5NA 3SQDA 1IBRA 3OQ1A 3U3JA 2X4DA 3ZXSA 5LLTA 1WDTA 2GVDC 4HFMA 4W5NA 2GAJA 3G0OA 5GPBA 5JD4A 3H86A 2B8WA 5FP0A 2QGZA 2XSZA 4LE0A 4YJ3F 3SXJA 3W5UA 1H8EA 1OMOA 4OFBA 4PG6A 1NKSA 2IRWA 2AYYA 4DA6A 3GDOA 2SKCA 3KV1A 4RHTA 5B53A 1OFGA 4JOSA 3PWKA 4JOCA 1ISMA 1PEKE 2PQ2A 1H1DA 3D3WB 1TQDA 4EW1A 4A4DA 5JFTA 1KDYA 4Q3AA 2FLKA 1CG6A 3HB0A 3ZS9A 2JI9A 4QU0A 3L06A 3G17A 3EH2A 5JSKA 2Q3FA 4KFSA 3GCZA 3SDZA 4TRMA 1TX4B 1LU9A 2ZATA 1HQYE 3QE0A 5FQOA 1WX1A 3V5NA 5JZOA 5GM2A 4FYMA 3FWHA 2DWCA 4RMIA 4FPXA 1H8ED 1P4AA 2VQEB 1QVZA 3PT5A 3C3MA 1BXZA 4ZYZA 4WBNB 3STVA 3EPJA 3L7JA 3VOSA 1WLYA 4H31A 1WTCA 2FQXA 1C0LA 1NBAA 5JIBA 3B20A 1JMVA 4XWKA 1TZBA 5J3JA 1RM5A 3KYDB 2O1WA 3IBCA 1QQNA 2VXBA 1HDGO 1N2EA 3CU5A 3F2IA 3QJYA 4JWKA 3H4TA 4XWAA 4B80A 5KQMA 3J81k 1CF4A 2QSYA 4N39A 4D25A 3GP8A 3ML1A 4OSEA 2AE1A 3INNA 2HM7A 4YCBA 2DT8A 5HK8A 3ZEAA 3TQHA 3LFTA 2REQA 3SXUB 3E81A 3DKVA 4MRRA 1FFBA 5FJJA 2HBZA 1MQ8B 1XEXB 2G4VA 1RQPA 3B5EA 2ZDQA 3L7OA 5HUQA 2GSWA 4IGKA 1SQ6A 4G8CA 4BAGA 1ODJA 1DLJA 5JARA 1Z06A 1HSZA 4AXBA 4Q0MA 4PSUA 3DMYA 3OKAA 4MYCA 4JL5A 2ZVPX 4MJLA 5C52B 2L0XA 2XDWA 1SXJC 3PB3A 7ABPA 4GPTA 2B2CA 4RELA 3CB4A 2GD6A 4D6XA 4M1WA 3TBFA 1VE7A 1UWLA 4J2OA 1KR2A 2PPLA 4M6WB 3RRJA 3OEED 1RKBA 1QYCA 4YAFA 1I4DD 3UHJA 3K1ZA 1TCUA 1T1JA 2HTFA 2R85A 2X9NA 1OQAA 3C6ZA 3LYAA 1I4WA 4JBNA 4KN6A 4EVIA 5DCYA 5EPEA 5DHQA 5C37A 3ZCUA 1LQQA 4X20A 2AN5A 3ICPA 3P2IA 2JH3A 1E4EB 1IDOA 3FVVA 4FYVA 2P0EA 3UK0A 2NO9A 1YZGA 1DXYA 2YWXA 4J90A 5BW4A 4CEIB 1XVTA 1M7BA 2O7SA 3LKBA 5TMEA 3I4CA 4RKRA 3CVYA 3P9ZA 2YNMA 4C6TA 2PKWA 3BXZA 1VPWA 4KQMA 2ZTUA 4GWLA 1BZYA 1JJFA 2J7PA 3KL2A 4JAVC 3S1AA 4GMXA 2O2HA 4IQ0A 5HE8A 3RVMA 2IUFA 3BL8A 1IM5A 4KOAA 4HHFA 3EDYA 4EI9A 1I5EA 3C24A 4CM1A 2PUGA 5LN1A 2GX6A 3TCXB 1IJEA 2XB8A 1RBQA 4JJFA 3LDQA 1EMDA 2HIAA 4G26A 2BMJA 2J9FB 5JWOA 4QKQA 3C6MA 4Q03A 4RHUA 4WY8A 3ZZ0A 1XOIA 2CE7A 2DR0A 4K86A 2HPZA 4EI2A 4LXHA 5ITWA 3AO0B 4HJRA 2AOTA 2YNMD 1S8OA 3E84A 3FNBA 3LY5A 4TWRA 1GU7A 3DTYA 3RSCA 4S2EA 3STHA 1ZW1A 3BH6A 4P0QB 4F85A 3B5IA 1XYVA 1CY1A 4LDZA 4UTRA 2R6DA 3EGXA 5ENDA 2QSJA 1N7HA 5I3ZA 4CXMA 3ATUA 4TS3A 2QYHA 2ZSAA 1O57A 3D3QA 3QUAA 3T7CA 1VECA 2PL3A 4L15A 2RARA 2EQAA 2X3UA 3Q3HA 2R751 4YRCA 2V0NA 4NAUA 1F12A 1Z4JA 3UPDA 4LTMA 2LN8A 4QT0A 1EXMA 3PIRA 3GFBA 3OE7A 4PYLA 1MAHA 3G5UA 1TJPB 5FWDA 5LWQA 4TRNA 5CK4A 5ELLA 5HP4A 1SHLA 2X8JB 2WFZA 1J0AA 1EBUA 4IOMA 4E31A 2ZUSA 2QTBA 2ZWMA 5CW2A 3BZBA 1OYWA 3OAAA 5H3LA 2C3UA 2N3ZA 2BSAA 4YDQA 5CB8A 3CUWA 4PX9A 1SVUA 1F8XA 1PQYA 1UOPA 3H19A 3IUQA 1LUAA 3HO1A 2ZANA 4ZAYA 3WO1A 4YP9A 3R9IA 1HI9A 1JZSA 1ZN2A 3QBTA 5B3LA 1ZA2A 3EIEA 2IT1A 1PV1A 1REQB 3B3JA 3FD8A 2NZ2A 3BA6A 5JSYA 1W46A 3BXGA 1BQ4A 4OFWA 2HU8A 4JEMA 1C9JA 3OAAD 1NTOA 4M38A 4QELA 5DTEA 1RQ7A 2Q62A 2AZXA 1O5TA 4COOA 2XNDA 1NNEA 5EZ6B 1QV6A 3ESXA 3PXBA 2C95A 2FP3A 1KPIA 2JCXA 4JEIA 4RS4A 1OI7A 2C2YA 3ZGVA 1QB8A 3KC6A 3E8SA 2R6JA 4RJJA 4TOIA 1N2ZA 2B3CA 1NF9A 1OZ0A 3UFXA 3V8PA 1EM6A 13PKA 1QAMA 2E37A 3LT5A 3VZQA 5KMGA 5LQMA 3DBRA 3QU7A 3WGTA 2N42A 2QRJA 3AP1A 4HDOB 5EIWA 1P6XA 5LYJB 4DLTA 2A9OA 2HSDA 3IBSA 5AI4A 4PE5B 3GXBA 4DPLA 3QWFA 2EHJA 1DUVG 4FONA 2XNDD 1DWPA 3C8UA 3F7MA 3JY6A 2QZ4A 3QPAA 1OI2A 4UULA 4MAAA 5JCJA 5KCZA 4RTRA 2RC5A 2JIMA 1AOXA 1MABB 5CR9A 1N3YA 3G9TA 1EGAA 4BE4A 2OXFA 4P1ZA 5BYJA 2EKZA 4BEBA 4ECAA 4CLDA 2REQB 4DDWA 3L6DA 4UAVA 1POWA 1T9KA 5H16A 4J0JA 3WFZA 1MIOB 4ZOLF 5F4BA 5COQA 3AF6A 3KFLA 4LJ7A 4FYKA 4X7PA 3G8DA 2X2EA 2OAQ1 3AUFA 2O0JA 2GTHA 4G67A 3P96A 4PRYA 3ONFA 5EJ7A 1YCHA 3KYIB 1LLFA 4QXMA 2QD3A 3L7MA 5JCJD 1AK2A 3L8CA 2VPQA 3VTFA 5HSGA 5I4IA 2BJHA 1PTXA 2ZTSA 1N92A 2Q4EA 2FEMA 3ITNA 4G1CA 3GFRA 1F6DA 2X8BA 4KK4A 4JP1A 4M8LA 4KN9S 4BJHB 1X94A 2NACA 4IY1A 4HDKA 3VKHA 1TIBA 1Y7IA 4ZVPA 3BFJA 3U40A 4FJ1A 5DV9A 3D7MA 4ARZA 4R69A 3UO8B 4DZZA 1L4VA 5IJ0B 4X94A 1QZZA 3MTIA 4L5IA 3VJKA 3DP7A 5GY7A 1DOZA 4UZSA 2FW7A 3DT8A 3O83A 4XX0A 3VUEA 1WB9A 3VC3A 2DAPA 3FUXA 2G4CA 4AF8A 4RH1A 5BSEA 2Z2KA 1DIGA 1R4ZA 5DCLA 3SC3A 1GTJ1 2WKRA 5HZGA 3MILA 1C41A 1FS4A 3I1YA 3NVDA 4FQ5A 4ND2A 5FBRB 1PEDA 4RU1A 4NX2A 4G37A 2VIIA 4H7JA 4CGZA 4ZK2A 3P52A 5DLEA 2P9TA 4KUEA 4H1UA 5ALEA 3T3OA 2CLLB 5HOEA 5EMJA 4PC1A 5IC5A 4J3NA 4MV9A 2ZK7A 3FZEA 3GNSA 4KNVA 1PHRA 3WNZA 2FDCA 1NW3A 4N18A 2F9FA 3IAM1 2JKZA 2Y66A 2OZLA 3CZ9A 4IJ6A 5D7BA 4OHFA 5J63A 1QKJA 2ZUVA 2V0GA 1TI5A 3LSYA 2FPGB 1XD9A 4EMBA 2H1HA 2WF5A 4H4CA 4MDYA 3H9JA 1WPQA 4IUYA 1ZIYA 1VHTA 2JAUA 4O2RA 4ZOAA 4Q7QA 3A1NA 2Q3CA 4R2WA 4HRAA 2IOHA 4Y2YA 5CXXA 2VTVA 4B7CA 1U3TA 1ND6A 2OQIA 4TKUA 2HMAA 2G77B 3FTDA 1BOOA 1X3LA 1YS6A 4QRDA 1J56A 3EW7A 4J0FA 5IEJA 3ZVKA 1RP1A 3IEIA 3TLZA 2A9KA 3PJGA 1RJ9A 5IF3A 2C4HA 1QTRA 3QSGA 1GTMA 3O95A 1SCJA 1DX9A 3KE9A 4M49A 3TOCA 3VI4B 1Z36A 2C98A 2H59A 1AKWA 1ZMXA 1D9XA 3DZCA 1RHJA 2P6OA 2I03A 1UKBA 3OY7A 2OHJA 4BKQA 4POOA 3Q6MA 5KOHA 5IXSA 4B3RB 4MGKR 1DJNA 1BS9A 4RJIA 2HHLA 3DFIA 3AM1A 3KTFA 3K9QO 5T4BA 3PWTA 2TMDA 3A06A 4BFXA 4FJ2A 3ZCTA 3CW9A 2E4ZA 1RWPA 4MDFA 1O8BA 3UXMA 1N5OX 3A6LA 1U3FA 2P11A 3ESRA 3LF1A 3GEBA 3QYAA 4FOPA 2M9MA 3SZ3A 1KOGA 4QZVA 3F5SA 2I4OA 3IJEB 4B34A 2EBHX 4PR3A 3AVYA 3ESBA 1JDNA 3HRIA 1LV7A 4UHKA 5DP1A 5LD2C 1UBSB 3KB1A 2BCGY 1RXUA 2JGLA 3F7NA 4Z51A 5INTA 1BN6A 4R98A 3ZY3A 2PXAA 2ECKA 3QVLA 4E1BA 2ZRQA 2GLTA 2NU9B 4NNJA 4IMPA 3WQHA 3F5QA 4FE7A 4BZZA 1HDOA 3U7EB 2NU6A 1TD1A 3DBIA 5AKIA 4AZ3B 1MOZA 3RG2A 2BHLA 1ZLXA 1M5RA 3IVGA 2XWSA 1OB5A 5MN4A 4UVEA 3IPCA 3A6DA 3DBRB 1U1DA 1EJ0A 1YS7A 4UMEA 2C2ZA 3SKVA 2CXPA 4A0QA 2HHAA 3HMQA 3S2YA 3PGLA 3U48A 2QW0X 1PTJC 5T4HA 1D8AA 4O63O 3D6AA 1K5PA 1OTYA 2HLDA 1LPSA 2OZKA 4HFJA 1ZUTA 2QX9A 4JJGA 5GTDA 1HQDA 2JFBA 3NHJA 1YD7A 4V0NA 3AKYA 5KJ1A 1WNFA 1ZEMA 5DO9A 5IULC 2CD7A 8MHTA 3RJMA 3BWYA 4K9KA 1E2IA 3BREA 2YZNA 4RY2A 1HY3A 4IJ5A 3ZDEA 2J3LA 3IH5A 3GGDA 3NC0C 4O3FA 5J1SB 1II9A 3KO8A 3KZCA 3RVNA 1QCYA 5HTOA 4X00A 4RV9A 2KX7A 2PV0A 1NX6A 2AR7A 2YCLA 3IUNA 3W7BA 4D5EA 2ZJBA 4REQA 3H2KA 4R7ZA 3EGEA 4XSGA 7MHTA 3F3MA 4BLRA 1K92A 3VDXA 1FLVA 4GQBA 4AG3A 1CJKC 1PR2A 3IUBA 1YT5A 2F17A 1HL3A 1OUMA 4G5SA 4D8YA 3E3LA 3LCCA 3PCRB 5B3AA 1QHHB 2O8DB 1CZHA 4GPIB 1FQJA 4LVCA 1WVIA 3G2IA 5EL0A 4PHCA 2O2YA 5HEKA 2YOFA 2OBLA 3RNLA 1DAPA 1JP7A 3FUTA 3K72B 3PL5A 3CGWA 2GZ1A 4YNBA 3BHJA 4M53A 4ZO9A 3WLIA 4ARZB 1GNQA 4QBGB 3ZU4A 3MD9A 3UFBA 1GNVA 4KQHA 1H2YA 3HEAA 1RRPA 3QKSA 4XX0B 5EXSA 5EWJB 3RC8A 2H0AA 4C0SA 3GIWA 4WK0B 1FA9A 3MJSA 2FWMX 4HNUA 1BXGA 1I3NA 3BUSA 4EHBA 3GIDA 5A7FA 1GZSA 1U5AA 2BC9A 2LPMA 1NM5C 3OZAA 4LHVA 1G1MA 3FPCA 4Q7MB 3DEKA 2XADA 3TR6A 3EXIA 1U4NA 3M2TA 4LZJA 3SHQA 1ULAA 5DZSA 1TPYA 3ROZA 3ND8A 4XLZA 1OXSC 3D8SA 3UK6A 2Y0DA 4EKDA 3HCAA 4HEJA 1FFDA 2C3MA 1MYNA 1Q1GA 3FFXA 2AYZA 2GZDA 4FOLA 4IGAA 2Q5IA 2LNDA 1XA3A 3JAWB 3KDSE 4LZOA 2GL1A 4GR5A 4RS3A 3TIFA 1T3TA 4O4JF 3KSUA 2D2VA 1RQRA 1T4GA 4W1SA 5LMUB 3ZTTA 1NV9A 3FW1A 3TWOA 2CUNA 1EGHA 3HEBA 4FE3A 2J08A 2H29A 2H31A 1JQKA 3PUXA 4GRIA 1B3CA 2IC5A 3CEAA 4L3OA 1PDVA 2D5BA 1R0KA 2OPHA 3BG5A 4XQ9A 5LNK1 1B6TA 1V4VA 4OH1A 3RU2A 3MJEA 4RXTA 5CJJA 1L7PA 1J49A 1E1QD 2FEKA 3AHDA 4TKUB 1X2EA 4IIFA 4IICA 4CMEC 3S70A 1DFHA 4QU8A 1UMBB 4H5NA 5CLHA 2TRSB 5DEIA 4ENQA 4A36A 4L5AA 4DB2A 2QTHA 4Q7JB 4FHDA 3JD3A 4V1DC 4B71A 3G7SA 1GPDG 4DR1B 3HL0A 1X1QA 4R51A 4OSOA 1ECLA 5AQGA 3AVQA 3T8YA 3R3JA 1Y8RB 3JVUA 1H65A 3UMFA 1TK9A 1LWNA 1KJJA 2CF5A 2ZIXA 3A6GA 3RG8A 4F72A 1X1EA 1HG1A 2DX7A 4Z0PA 4PGMA 1FDIA 2W2MA 5KCMA 2WP0A 3RRNA 4S04A 5E95A 1N0IA 1GSHA 4X1IA 1XTJA 4JMLA 1QZTA 4X3PA 2C2WA 1HT1E 2QYOA 1DNPA 3H1TA 3EIXA 2CXNA 3LC7O 2J85A 2V3VA 5DYIA 1PSDA 4FWTA 1OXVA 2YYYA 4FDVA 4WFKA 5AHKA 1X7YB 2JGJA 1UDCA 2IHKA 2PEZA 3BDAA 4JU8A 3SC2B 1W36C 2H48A 3JD2A 3WLRA 1OXBB 3D2BA 3ESCA 1PEAA 1VE9A 1VL1A 3OIWA 1O4WA 4JCCA 3P19A 2VJCA 1BIFA 4RFSB 4TMYA 3HJFA 5KYKA 3GGOA 4FQ7A 4PNZA 1II0A 2ZSDA 1A9ZA 2VDQB 4KC0A 4F60A 3PNOA 1QPBA 1RPNA 3PQFA 5HJ5A 3HC7A 1UPTA 2V4ZA 1MB0A 2WJAA 1R6BX 3KPVA 5FB3A 3LBNA 1U0LA 4GGPA 3T7KA 1J8DA 5F2EA 1XKLA 5T7BA 4XA8A 4DMHA 3EARA 2CXOA 1PG2A 3VR6A 3WDKA 3ZEIA 1R0BA 4YMTA 4LJRA 1RRKA 1WF3A 5I8ZA 1L9KA 2D2FA 4X90A 3KK0A 1GO2A 3LF2A 3AJ9A 1MC5A 2XZLA 3CGGA 3L8MA 2H4XA 1HOXA 4LOIA 4QHSA 1NDUA 3C15C 3V3TA 2OZPA 4WXYB 1AGRA 4YX9A 2PH3A 3HA2A 4DJDC 2FUKA 1OYYA 3UBMA 3CM0A 3OZFA 4RPCA 1GIAA 1XVUA 4J0IA 3ZI0A 3QH4A 4E11A 4XWOA 5FI3A 1BHO1 2GNAA 3NFYA 4L4YA 4KR0A 1W1IA 5DTRA 3I72A 3WSWA 1BMRA 4F12A 3RS5A 1OWLA 3C5CA 4YMIA 4BO6A 2QTTA 2WR8A 1DKMA 2IYQA 5CDGA 2QD4A 2ZB2A 3C0KA 1M67A 4G81A 2YJ6A 1KU6A 3O8QA 4YN3A 3RCBA 3UT6A 1SKQA 3PVZA 4A6EA 5I4BA 4KUHA 1EFVA 1XTKA 3F6BX 4XVHA 1G8JA 1SULA 2Z1DA 3E23A 3E5RA 3NHFA 5AUQA 4EP1A 2AEMA 2ATXA 4CMAA 2C9OA 1SCUA 3NGXA 1I2CA 4LECA 5IVIA 2XKAA 4Y9UA 3U09A 2ESRA 3OQJA 4P54A 3B12A 4E7PA 1U8UA 5C1DA 4DV2B 4WRRA 5C7LO 2HK6A 1LVHA 4KX5A 1XN1A 3EQ8A 1PJAA 4EAAA 4NZMA 4OG2A 1WMTA 1GPH1 1VG0B 4AIIA 1TMGE 4LUCA 5AQRA 1Q3TA 1RCUA 3MGGA 2QN9A 3BWVA 5JNVA 4DIUA 3DONA 3EUWA 4G97A 4MS3B 4TWBA 5DHTA 2PTHA 2ZWVA 4FFWA 3TGWA 4B5KA 1DJQA 1TOAA 1W7AA 4WY5A 4DWJA 4ILEA 3U3XA 2G1JA 4OVKA 3DEIA 2VDPB 4Y6PA 3S5UA 3T5CA 2VLIA 3ZE6A 4E4YA 4IDEA 4N6NA 1J2RA 2Q4DA 3VYRB 3OWXA 4OYHA 3ZV3A 4QEKA 2BHTA 3ACBA 4MB0A 4DV5B 2CWDA 2A7TA 4A8JA 1J4AA 1XNHA 3HI6A 1ZCJA 3ILYA 3MUFA 3OIGA 2CDCA 4HLNA 4TYPA 3ZQ6A 1AKYA 1RHUA 1SVWA 1QYDA 1X1BA 4D9EA 3OCXA 4EG6A 2RONA 4ZK6A 1PZNA 3LVBA 3COZA 1E6EA 1DRUA 4YDHB 2H2GA 2Y1CA 4CEHA 1HNNA 1SVNA 3G02A 4QG3A 1JIJA 3OOEA 2X8AA 1HOTA 2GRUA 2PT5A 3B1WA 4P8RA 2CLIB 1QC5B 4U6QA 4YUVA 4R0VA 4RUKA 1DARA 5J2TF 1V1RB 4K26A 3GJ0A 3TLCA 3VVCA 1G19A 4P08A 3ZBTA 3HVKA 1RRMA 3M89A 2WSLA 4B3GA 2PIAA 3J7TA 4OCZA 3W8EA 1JALA 2WAAA 3DBHB 1RZVA 2W2QA 4C2AA 4ZDIA 2H4ZA 3W5DA 1G3RA 1M8KA 1I7SB 2GZ3A 1VE1A 2AXNA 1UBHS 3K9LA 4MKRA 1SUCA 3C2QA 1WU8A 2PZKA 3AW8A 3WBBA 1CR4A 2YMPA 3VPFA 3O4VA 3M6IA 3IDOA 4DQXA 4X1IB 3T9AA 3R6TA 3EZ9A 2BLNA 3W8RA 5AVUA 1E1KA 3O3NB 1OH5A 2YNMC 2DHQA 3EG9B 4HQFA 2P90A 1NP6A 2CMGA 2AT1A 3ZWKA 1RACA 4OMCA 5E1DA 1V16A 4YRZA 3OTQA 5CT9A 3TQQA 4BCBA 4C30A 2XXAA 2BHNA 2D1RA 3U7HB 2VTBB 2G1AA 3GZNA 3ATVA 5JAHA 5BN8A 4MPJA 3OMWA 1RQLA 2WT9A 3OZWA 4HCJA 4JH0A 3SCZA 4A0RA 1I5RA 3NVAA 1TZKA 1EVZA 4JBIA 4NL4H 5BN5A 1TL7C 1CY2A 4KFCA 1WXXA 2BFPA 2G07A 2QN7A 4HATA 3LI2A 4EYEA 2AEEA 5IEBA 4EX7A 2B25A 2QI9F 3B2NA 2LDBA 1ZVMA 4DN6A 3KPUA 2EOAA 2PKEA 4KWIA 1ELOA 1C4XA 3ITDA 2O57A 1UMCA 3L07A 5HIIA 4N65A 1IH8A 3IBTA 1IXRC 1XCGB 4D4GA 4NCHA 3OFNA 2GEKA 3PQDA 4OQYA 4MCJA 2SECE 3UKOA 1I3LA 2GPBA 3BDIA 4EO9A 2YV5A 4YGXB 1MJGM 1VA5A 2G7ZA 3N28A 4P7GA 3QFRA 4NABA 5B36A 5IJZA 4TV9A 4JT8A 2BE7A 3I37X 1P7CA 3IODA 3C3PA 3QIVA 4BLWA 2UYQA 3LXUX 1P0QA 2KW5A 3U39A 2V7VA 3GPBA 2W2TA 4D9BA 5CH5A 3HBMA 3LC1O 4F4UA 1JIVA 1OJLA 3FLEA 4U7WA 1ENOA 1NBWB 1R9NA 2FNAA 5JALA 3ZD8A 1ZM7A 2IXGA 2O48X 5DIZA 1KFBB 3X1KA 4IIYA 4CF4A 4CL0A 4W7SA 4BX2A 4CRWB 2UXDB 1ZYWA 1PJBA 3QFPA 2KWIA 2PJDA 2Y68A 5FH9A 3JWHA 4FT2A 1LQ2A 3VPXA 1Y1PA 2JBAB 1YU6A 1UKZA 4P4UA 2NYUA 3O1IC 1U8EA 1EDEA 1SCUB 3QOWA 4ZT5A 3WK5A 4B9EA 2BMEA 4HOYA 3IAS1 3DGFC 4N7JA 3B52X 1SIBE 3FCEA 4KQGA 4PZPA 4DQUA 3BSSA 1G3MA 4PY2A 4DIOA 3T54A 1DZ3A 1I80A 4Q3EA 4UU1A 3KM0A 5CTJA 4OJNA 5AK5A 3NC1C 3I0NA 5IM4A 3MN1A 4O4HB 4LGVA 3A25A 3GJZA 3HN7A 4MB2A 5G1NA 2ECPA 3LCUA 4OHCA 1UZNA 4C6SA 3HI4A 2E87A 2C78A 1PVDA 5CX1A 3DTNA 4EEZA 5KSWB 5LFAA 2EG5A 3KWMA 4MICA 1EXWA 1HZJA 4CLHA 5HYVA 5LZ9A 1Y9AA 2JD1A 2XUPA 1C4OA 3DDNA 1FDWA 2GPWA 3G5LA 4U2BA 1PNQA 3RS4A 3ZD9A 3PNVA 1RAEA 1XAHA 3I58A 1WQ1R 2PX0A 3DUWA 2ZRIA 4KMOA 5HX7A 3NWBA 4HS9A 4QIHA 2YHIA 1ZK0A 4OXQA 5LUBA 4A8JB 3JD1A 1X70A 3O6VA 3UQZA 2G2KA 2OGSA 3AF0A 3QJGA 1SBIA 1NVFA 4BFVA 5LP1A 4CUZA 3U4QA 4OXKA 5TGDA 4BC0A 1WCYA 3Q3VA 4FR2A 2G9UA 2UAGA 1WWNA 3H4IA 1TFUA 2IZ6A 2JANA 4DBZA 1C50A 2FV8A 3W1VA 5TSDA 2G71A 2HN9A 2HO5A 1X87A 1DXHA 5DXAA 3UC9A 4UNIA 5AM2A 4Y9SA 2V6BA 1T6NA 3OE5A 1K7EB 2EYUA 1KA9H 3MGKA 4GVXA 3R7WA 3TNDA 3ZHUA 3QWAA 3ULKA 3B85A 5BRJA 1KP3A 2H8GA 5D01A 2BZ1A 4RDCA 4B6EA 2ZLBA 5LQSA 2CMHA 2YXNA 4ESEA 2QT1A 5HMMA 2X0NA 1L9XA 3HGMA 4WZAB 3A37A 1KF0A 1ZHFA 3CR7A 5FHQA 1Y7PA 1I94B 1JXAA 2EWVA 2IBTA 2CFCA 3KYBA 2HJSA 4L8LA 2O3QA 2OESA 2HI0A 2W6PA 4D9NA 2BGIA 4Z1MA 3UENA 1XDSA 3WKCA 3B7WA 4J0DA 1CP2A 4AJ2A 4V2UA 4RSHA 4N49A 2EFYA 4CETA 5CY0A 3A1FA 3G89A 1R6AA 2IEDA 1Z47A 4KO3S 3GBVA 4WNYA 1QO9A 2QWOA 1G59A 3F6RA 2O14A 2JIDA 1BMQA 2NSLA 3BE6A 5AK0A 3LHFA 3MTEA 5KSYA 4H08A 4EO4A 3THWB 3A1VA 4LTDA 1YFKA 3KPYA 3GZNB 4LQDA 1IXYA 1VOTA 4Y3UA 3NX4A 2FW1A 3DVRX 5T4FA 2PGDA 3U80A 4DADA 2AF4C 4EH1A 4BV2A 4U0JA 2AX4A 2J6CA 5CB6A 1GCAA 5AOCA 2RHHA 4HGQA 1A76A 2GZMA 2I2DA 3HFRA 4CUJA 4U7FA 1Y5MA 3O1HB 5BWMA 1PUIA 1X7ZA 3TW8A 1GKUB 3AESB 1HDZA 3I32A 2H1CA 4YQYA 1DOHA 2YH2A 2IU0A 1XAGA 2ZJ1A 3ENWA 5AM4A 1N8SA 4K6OA 3HZRA 3CO0S 5JTUA 2V6GA 2V8BA 3FTEA 3FKJA 3CR3C 1AQJA 3BHMA 2XX3A 4M9RA 5C53B 2QGNA 4BOYA 1VHDA 1JFLA 4RCYA 5EP3A 4MK4A 4MR9A 3TB4A 2ZZNA 5EWMA 3PWZA 5E6UA 4OLHA 1CQIA 4L9AA 3W0LB 4H2DA 3F8WA 5KU7A 2X2PA 2VZLA 1JG4A 3MINA 4WKBA 2IPLA 5GWXA 3WK8A 4LWOA 1PFVA 3ZQ4A 1R15A 5KNCD 5L7YA 2G9NA 1O0BA 1W5AA 1W88B 1Y5NA 1GPMA 2VQDA 3LVRE 4YCCA 2HA5A 1G60A 2J33A 1S3GA 4JLBA 3L05A 1F1BA 1B8UA 1FK8A 1LDMA 2B9EA 4JKOA 1U99A 5F1XA 4RNCA 5ENZA 1VKJA 3W1WA 1XF9A 2RHWA 2QRGA 2D0IA 3BGWA 5ALYA 1AG9A 1TC1A 4H60A 5BV1A 5MDHA 2C7PA 5G0VA 1S8NA 2O1EA 3GPLA 4IFEA 4KIFA 4ZI7A 4N48A 1VQ1A 1FX0B 4XFJA 2EJVA 2IF2A 2NO6A 3QOXA 4OHZA 4CE6A 4G0NA 4LSGA 1DO8A 4WKNA 4CNBA 3I6ZA 4YDRA 1MRSA 1WULS 2MINA 1V9CA 3Q6IA 1GA1A 1I0IA 2JIPA 1H3EA 1I2VA 4LRQA 4DUPA 2QP9X 2J32A 2IV7A 1ZJ5A 3DKIA 3MWDB 3VGPA 4JQZA 3QFUA 3HV0A 4YS6A 4M0LA 4DWWA 1N36B 3IJRA 3O4JA 4Q4CA 3VR3A 3U44A 1IOLA 1N6PA 3L6QA 4DLKA 1FS6A 1E0DA 2MTBA 3NTRA 3QQ5A 3MMPA 1GG5A 2WUFA 2NN3C 4P82A 4PIVA 4Y9TA 5F35A 1N2CA 5CX1B 4C3ZA 2EG9A 5CG2A 4CKWA 1LLCA 3ZH9B 1H94A 4ASUA 4RDXA 5LXTB 4HWIA 3GJ5A 4HLQB 1ORWA 2A92A 4CODB 2JGFA 1I1HA 1JIQA 1WW3A 1M66A 5LDHA 2E4VA 1N5IA 2FSHA 5EVZA 1D09A 1P9OA 4PYQA 5FT9A 1HDYA 1FNDA 1QKKA 2P0AA 2XDYA 4R2LA 2FFJA 3FPSA 4INPA 4ID9A 3Q3JB 2FQYA 5KYUA 3RQSA 2LY5A 4PQEA 3E1GA 1S0UA 3DOIA 5DW3A 3MJTA 1RYEA 3TOVA 4BY9E 2FUEA 4BL5A 1ZC3A 4YT2A 1ZN7A 4OXIA 1KAYA 1LCIA 2P3LA 3AIIA 5JHHB 3JQ7B 1KS9A 2VN8A 2E4XA 3ZZMA 1U0RA 4ASUD 3COYA 3OJXA 2F9MA 3OA2A 3SR4A 4LNAA 4D9MA 1LBQA 5DGHA 1SY7A 1T8WA 4O8ZA 3I4LA 5ETJA 4GQIA 4DDUA 1D2HA 1T5DX 1OAOA 4ZT6A 1JRLA 2A7QA 3IAXA 1DVRA 4BV3A 1I4OA 4FS3A 4YJ2A 1W8DA 1RWOA 1VJ1A 1F8GA 2FH5B 3M8KA 4QRHA 1O58A 2AFVA 2QJFA 3SAJA 1DTEA 2DPMA 3OKCA 1LD3A 3T34A 1L4FA 3LXMA 2C3OA 1VNBA 3BGSA 1DKPA 2R6AA 1U0TA 1UODA 2HA0A 1VKHA 2IYLD 1ZGBA 1E1LA 2XRFA 2ZI6A 3MOIA 3OJOA 4Z5XA 4XWYA 4Q24A 3CNBA 3WRVA 4JXZA 2P4EA 3Q7TA 2GN0A 1OZZA 3TIVA 4EGFA 5AW2A 4H3SA 3GARA 3TOXA 5JRZA 4ZAXA 4MULA 1BFKA 2E49A 1C55A 5EHQA 5BPNA 4OOEA 4LJ5A 3JD4A 4QA9A 2VAPA 1UC5B 2I6TA 2ZUDA 2VG8A 1R10A 2PR2A 3IALA 3L41A 4K3UA 2PK3A 4L4UA 1ATIA 4GX2A 2ZDHA 4QPZA 5IKEA 4GE0A 5BRNA 5H81A 4UEWA 2NTNA 2ZBEA 3N8DA 1E99A 1UAAA 3OPXA 2WWGA 5A9RA 3OC6A 1UDBA 3GEGA 4PPYA 2KYQA 2C8KA 2CEAA 3ZIUA 3EY9A 4C0XA 1XDWA 4P80A 2XCOA 4HPWA 2FPKA 1GT91 5D1NA 5AXAA 1A9QA 1SUEA 1QGYA 1X7ZB 2FZEA 2QUJA 3TW8B 1ENPA 3HDGA 4IR7A 4KQ1A 4PYRA 3VO2A 1NNSA 4H17A 4OREX 4X8MA 1XXLA 3MLEA 3SEQA 2BR3A 4LYHA 2P2NA 3HBFA 1TJNA 1B23P 2I7DA 2C0QA 3R3XA 3WIDA 5B7NA 2G1UA 4BO3A 2PUTA 1NW9B 2FE1A 5EP2A 5SICE 4ZCLA 2FR0A 5EQJB 3BVPA 3DD5A 1T4CB 4MGIR 4MRSA 1JEOA 3KZVA 4WZBE 4RIFA 3NTQA 4I0WB 3I12A 4N4AA 3M9XA 2CVHA 1CQIB 3L4BC 4B6RA 1KI6A 3PUWA 4E5VA 5KWVA 1CRPA 4YJHB 4L9SA 5NULA 1Y8AA 2PZ8A 2FW0A 4L72A 1PX0A 3IA7A 4NV3A 5JYEA 3CVUA 4NZOA 2VJBA 1LXCA 4IHKA 1NFQA 1C3VA 4NH4A 3GGSA 1V2GA 2VA9A 2BFEA 3U6KA 5FPDA 5EXPA 1EESA 1HMYA 2VDVE 3FZQA 5FPSA 3M4JA 3BL6A 3PHLA 1RAAA 4AK9A 1U8YA 1P1IA 1QO7A 1GA6A 4WKOA 3HDHA 3O2SB 4MP8A 4M8NE 2BFWA 1EVEA 2VDWA 1RLIA 2RH5A 3C1TA 3KVYA 1ZRNA 1LW7A 5JASA 1RQGA 1V5EA 2FFRA 4M1MA 1OILA 4IVRA 3GYGA 1UPBA 5KVAA 3LMKA 2YYSA 3TD2A 1WKVA 3E7FA 5EJ6A 2ATIA 1NPIA 1EX1A 1H0SA 2OE2A 2Z2YA 4NCNA 1JHPA 1RCFA 2WTNA 4OB7A 1YKGA 4YP0A 5IXJA 2QX8A 3FDXA 1THZA 4JUAA 1NKTA 5FNVB 1IK4A 1DZIA 1F7VA 4ZOEA 2GAOA 2JIBA 1NE7A 1N2CB 5BSHA 4OKSA 3R7BA 1GRQA 3KVGA 3GLHE 4BMOB 2JHGA 5BYBA 2PRIA 1Q11A 2HA4A 3SMQA 2HUPA 4XARA 5JS1A 4E4TA 5TEWA 1JQ5A 2I9PA 2AR9A 4UASA 1OVGA 4YV1A 1UDAA 3MT9A 3LT1A 2MWMA 2FDXA 5EMNA 2WJZB 3T5GA 5I9IA 1VIDA 4YY3B 4XKJA 2AFIE 3B38A 1BH2A 3DR5A 3O2JA 3KFXA 1XTPA 1JKJB 3A6JA 3IP1A 2PX5A 3HB9A 4HAVA 1TEHA 4HY3A 3KHWA 2ZTLA 5D51S 5F4ZA 5J40A 2D8AA 3QPWA 4EYOA 2XJ9A 5A6SB 1XSEA 2HQRA 2QZPA 5EIAA 1HTWA 5CT8A 2WABA 3IPXA 5U4QA 2QVZX 1W1UA 3QI2A 3PDIA 1XTSA 3A9UA 4YJ2B 2HRQA 3GLGA 4MTCA 2WTMA 4LGYA 4U9HS 4EATA 1HNXB 4QUIA 2HIHA 5IPFA 1JA9A 3M6WA 3L46A 1Z8NA 3PFCA 3M3PA 4NBNA 5KNLA 2Y3IA 3ZHSA 2E48A 2Z6UA 3TPFA 3S55A 3F3KA 4I8XA 2QV7A 5ICSA 2H00A 3OZTA 4B73A 1JFFB 3IE2A 4DM3A 1MEJA 1RC0A 1BEZA 2Q4RA 1FU4A 5L40A 1KQGA 5H9WA 1JG3A 2OBXA 4QDJA 3P2KA 3GJRA 4JUFA 1E5QA 4DMCA 1IJKA 5CA1F 2P1DA 3AERA 3HM2A 4BTVA 4E15A 4U7PB 5DEOA 3NO4A 3UICA 3KEOA 1J6UA 3PKZA 4TMWA 5G1OA 4DJAA 3JZIA 1SN1A 4JL8A 1LZLA 4HGOA 1OZHA 4O2BA 2GJ9A 3EDCA 2R4TA 2FU5C 4BNKA 4PFKA 1Q7CA 4CCWA 2PKQO 5TMDA 4MDEA 2PL5A 1GKIA 1Y8QB 2R8PA 3WBKA 4C4ZA 5ES4B 3ICQB 4A8JC 5K8VA 4AP5A 5AVYA 1BEUB 4CTNA 3H5NA 4HYTA 2VP0A 4AMGA 4US0R 3SHTA 3BTUA 1UBNA 2GHIA 3EZ7A 1VHLA 3DWEX 2AOUB 3KEGA 3Q5GA 3DCNA 3KLPX 4KG7A 3HKEA 4BNZA 1NGIA 5AUNB 2P5UA 2UV8A 4FWIB 4GF5A 4RLHA 1N8NA 3UAWA 5JNSA 4MVJI 2R5FA 4X0EA 3GY0A 4BMYA 4ENSA 5C3MA 4YLYA 1VJDA 4DV7B 4NVRA 2AS0A 3AL0C 1AO0A 2VHXA 2DGDA 3UWMA 2OUKA 3ESYA 5JFOA 3C3WA 4EITA 5IDVA 2M6RA 5KTTA 3H16A 1L5LA 5EXEA 1KRHA 1R66A 1SXJE 2EGUA 3CFYA 1NE5A 3H8WA 3NM5A 1KMHA 1YACA 4TMKA 4X45A 1XFDA 4XWGA 1SU4A 2NVBA 1DADA 1AT1A 2CHUA 2XVMA 5D85A 3MFYA 3RRXA 4ZARA 3ZV6A 7MDHA 1IYZA 2IEBA 2Q3JA 4QYTA 1TUBB 2R1VB 4JIGA 3ZWNA 4U6NA 3P0IA 1IBMB 1P2UA 1X3SA 1JBEA 1WOMA 1YE8A 3GRCA 2BR5A 3F67A 1EG7A 4UTZA 4AO8A 1Z6TA 4ZD6A 1TU4A 2Z6QA 1YKFA 3UV6A 2IP2A 3UV7A 3B1YA 1U0EA 4IBOA 4G86A 1M2JA 3IC5A 3OE4A 3ZH2A 1TLFA 2DFTA 5C7OO 1AKVA 3ND9A 5IUJC 3QEBZ 4XWTA 1ZNZA 2OQ2A 4BBAA 3E05A 3AEYA 1ABEA 3FHLA 3FUVA 4IW3B 3F9RA 1UMKA 3UWDA 2QPOA 2R8XA 2MR5A 3RBXA 2OCAA 4GDFA 3G2KA 3BFVA 2OO5A 3REQA 3ZJTA 1U65A 1T7AA 1JB1A 3HBNA 5H5JA 4KR2A 2XBLA 1PUJA 4L4SA 4IRMA 4P9NA 4PVCA 2ZM5A 1XROA 3O8RA 1PL7A 1CJVC 4Y1GA 4JNKA 2OA0A 1CZRA 1LC3A 3ELYA 3GQBB 3NCTA 2GEJA 3G3EA 1HK7A 1RKQA 3D5QA 3ZTWA 3U5TA 3KYCA 1VCNA 3WRWA 3DQZA 1K6IA 3PR1A 1RRGA 4NYIQ 3VHRA 4KLZA 1WR8A 3KOYA 2ADOA 4DAOA 3D43A 4B4OA 3V6MA 2Z6VA 2HCRA 5GZ6A 4LRUA 1PD0A 3VZPA 4M87A 5JY1A 1CUHA 2YY5A 1SUFA 2B83A 4FMCB 4B44A 3ZNOA 5KNDD 5DTJA 1S2NA 4RIIA 1KNXA 2XIJA 1SA0B 1LZKA 4B35A 4N3AA 1B74A 3GZJA 1KQFA 4B3IA 2IY9A 1DXOA 4DJEC 2BFOA 3WB0A 2RAVA 3O47A 3U2QA 1I3CA 1J2TA 4JVLA 2V3WA 2WVJA 3SSNA 1JEDA 1EUCA 3RKSA 3T4PA 4P3YA 2J67A 3F6CA 1QFZA 2XUQA 4UKDA 1W5SA 2PLWA 2DCMA 3PDIB 3GLGB 1NZJA 4K3VA 4M98A 4A2PA 2X7HA 2MMGA 4LYEA 3OCZA 4QL3A 4Y2TA 4JBXA 4G09A 1KEKA 1ZX1A 4Q39A 5GOZA 4M7WA 1I32A 2JCGA 4PZUA 3UT0A 2OHIA 2PJUA 5CMLA 1YI1A 1XMPA 1WCV1 2BWJA 2Q5HA 1TM4E 2Z3VA 2Z2XA 1VMAA 3KWLA 4Y2HA 3AJDA 1C8VB 2FZWA 2WLSA 3G2NA 3ZHBA 5L6LB 4KE6A 1N9ZA 4F2DA 4Q93A 1G16A 3SIRA 3RFFA 3VAZA 2V7BA 4HXEB 3R0VA 4TL9A 2CT8A 3KQSA 5JXGA 4KI7A 1PJ8A 4CN8A 1NJ5A 5ALJA 5FWYA 5GAJA 3IDAA 3EULA 2V96A 1GGMA 3RYFA 4L0CA 5IT9A 3AC0A 5HZHA 1TUEA 2QPTA 2MZ0A 2LR3A 3ZDBA 5CUQA 1IWOA 4ABTA 1FMTA 2IZ0A 2VEDA 4FB4A 4C4SA 1NC1A 3M3DA 2EZTA 3I9V6 3OZCA 1IM8A 1QZUA 3HJBA 4BN5A 4YUWA 3FHOA 3K5PA 5K0FA 1GPJA 1E2MA 2VBIA 3OLVA 3T3PB 2JW5A 3T41A 4DDTA 1YRYE 2FEOA 4XYLA 1RZRA 2AEFA 2B8NA 3BFPA 4LNUB 1XPUA 1E8MA 1HDCA 2JRCA 2PHZA 1L5HA 4B3CA 1YI8A 2JH8A 3SU8A 3OJ0A 1YTLA 3FAZA 3CJRA 4HFRA 1JU3A 4XJTA 1GILA 3AI2A 3UMSA 5ITSA 2PGNA 4Q21A 4D8VA 1E1DA 2FG5A 1CNFA 1N6LA 3RAPR 1Y42X 2EXXA 1SCQA 4U02A 1N3IA 2PUBA 2QJOA 4Z9FA 1P75A 1ZL2A 2I6GA 3PZRA 4IHJA 3I34X 4HC4A 5D00A 3DOOA 5EWLA 2HEIA 1F14A 1L8QA 2W0MA 4X64B 4WLVA 1E58A 2XAAA 2EW8A 2ZPAA 3AJAA 3DDCA 4JLJA 1RTTA 5FI0B 3E18A 4HZUB 3WA6A 4IQ8A 2VUIB 5G53C 4BNDB 3VC7A 1W85B 2VJPA 1F9AA 2AFHB 3HR8A 3OOJA 3UJ3X 4R54A 1KMHB 4KR7A 4DUGD 1DC3A 1FRZA 2Q4TA 4CIXA 3H65A 3IEUA 3PFWO 1XVLA 4NJEA 5C7IO 4Z99A 3FNIA 2KYRA 3HABA 2ZIGA 4KZKA 3NTLA 3NAMA 1ICEA 1NUPA 4J4TA 1IL0A 1JHQA 2ZJ3A 1KOJA 1L1EA 1QGAA 3DOJA 4S1NA 1J8FA 3VTAA 5E7IA 2HFJA 2WMYA 4QUBA 4DL9A 1D1QA 2O2SA 1UT6A 4UTNA 3CA8A 3MB5A 3BJRA 5F7ZA 4M9SA 2NY9X 2Q5FA 5F1KA 5J23A 1PR1A 1UIMA 3VSDA 1WHSA 2QE7D 1C9MA 3BD8A 4DABA 1UANA 1FDRA 3OUTA 1P2DA 1BC5A 1QLJA 1FEZA 3M2PA 2XB4A 5G40A 2A3RA 1GYPA 3REQB 4BB6A 3RUFA 3D6UA 3R7AA 2CZQA 1B0AA 2BELA 2EJWA 4FEEA 4GGMX 1FP1D 1B6RA 1YIOA 1QFXA 2JNWA 3KXIA 4W8HA 2ETXA 3BFKA 1USVA 2PZMA 3CEJA 3ZE2B 1D2AA 4HRVA 5BSUA 1T3SA 3SJ7A 1YR9A 2YN4A 3JWEA 3P2MA 1JAZA 3PJEA 1F4LA 1XTIA 2ORWA 3KYCB 5F1PA 5K0LA 2XYGA 3GFTA 3ZU3A 4FYIA 5F1YA 2W71A 3SYKA 2RGBA 2E2FA 2EDAA 2EJUA 1QG2A 4DJFC 1E2EA 1VCHA 3GMSA 1M2HA 3UMCA 3JXEA 2BV3A 5E2BA 3VHXB 5KO2A 3CLKA 4WXEA 3NAZA 4XI9A 1G4HA 3DHNA 3H2SA 5JCOA 4BQSA 2I4MA 2ZCUA 5B7GA 2P8JA 3LO8A 1NZFA 4C4RA 2R8BA 4H9GA 3VSEA 1J20A 2V58A 2V1UA 3Q5EA 3L82B 3UAZA 3O92A 1PYGA 3X1ZA 1C9YA 5ADWA 2KHZA 1L7RA 3KAQA 3RIEA 2W6OA 3SZMA 1LDYA 1LX6A 3A9VA 2ZJ4A 3ILSA 4FLEA 4I50F 4V39A 1UR5A 2BGJA 2A14A 2AR0A 4QO7A 3U9TA 2ZWPA 1C5KA 1AMUA 2GFHA 2K6GA 4B32A 1WMEA 3LTEA 4EJ2A 3UHPA 3U81A 1H05A 1OYOA 5BOVA 2R1UA 3TEMA 1GZ6A 4AD8A 2Y4OA 5AQJA 5AQFA 2SCUA 3MFQA 1ESCA 2ZVDA 2HLNA 4H3HB 1GL9B 3HU1A 3BKWA 2OZEA 1XTZA 4G8BA 3FMIA 4P5DA 5IAKA 1KYQA 1HFKA 2G9QA 1YC2A 2Q2WA 1UWCA 4UEOA 3VPBA 1ORHA 1XNJA 5ICEA 3C7NA 4B81A 4ETMA 3VDRA 4ARUA 5AQQA 1PJLA 4B8YA 1DIRA 4B6QA 1Y3AA 4MA0A 4TUYB 4EW3A 1KI7A 3FNHA 4UREA 1II8A