1XRTA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
422
structure length
369
Chain Sequence
MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLEDRLALIEGVKRGIIDCFATDHAPHQTGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 137
structure length 369
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrtA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrtA02
2E1WA 1DPMA 3EWDA 4AQLA 1S3TC 3GG7A 4XD6A 3ORWA 3ICJA 2QS8A 1WXZA 2PGRA 4IG2A 3IV8A 1PSCA 1V4YA 4CEUC 4B91A 3OQEA 4HK6A 1R9YA 1EJXC 4NI8A 3QY7A 1KCXA 2FFIA 3ISIX 1A5MC 2ADAA 3S2NA 4KIRA 4PCNA 3LY0A 3LNPA 2PUZA 2QPXA 2Z29A 4INFA 1EYWA 1EJWC 2IMRA 4G7EB 4XD4A 1KRCC 3SFWA 4GXWA 4I6KA 4C6JA 4LCSA 1GKPA 3IARA 4XAGA 4BY3A 4ERGA 3GIQA 4L9XA 4GY1A 1YNYA 3ID7A 1A5KC 4H01A 4CNSA 3DUGA 2VC7A 4R88A 2VM8A 3MVIA 1RK5A 3UPMA 3GU9A 4DYKA 1UMLA 4EPBC 2DVXA 2Z26A 4C6CA 3IGHX 1RA0A 3A4JA 2I9UA 2WJEA 2VUNA 2HQAA 4QROA 1UIPA 4DLFA 4YIWA 1NDYA 4IG2B 4PE8A 2HPIA 4C5YA 2YB4A 3WZ0E 3HPAA 2UZ9A 3CJPA 1RJRA 2EG8A 3AU6A 4C6FA 1PO9A 1XGEA 4Z42C 3PANA 2OOFA 4J2MA 1FWEC 4CQCA 1J6OA 4KETA 2Z4GA 4IQJA 4KEZA 4R85A 2GZXA 1V79A 1YMYA 4ERIA 2D2GA 4C6DA 1RA5A 1BF6A 2HNHA 4LEFA 4GOAA 3GTFA 1XRTA 3CAKA 1ZZMA 4C6QA 3RHGA 4IF2A 3URAA 4OFCA 4KESA 1K6WA 3E38A 2EG7A 4KERA 4D8LA 1I0BA 4J5NA 1EF2A 3FDKA 3PNUA 4GBDA 3D6NA 4LH8A 1FWDC 1A4LA 1NDWA 4GX9A 3WYZA 4GYFA 4DI8A 4WHBA 2E25A 3E3HA 3T1GA 2ICSA 3B0XA 4DZIA 2Z00A 2F6KA 3GTHA 2FVMA 4DLMA 1ONWA 4KF1A 2WJDA 4KQNA 1UIOA 3LS9A 2R1KA 1V77A 2EG6A 3B0YA 1XWYA 3UR2A 1YRRA 2AQVA 3IPWA 4UBPC 1RK6A 4G2DA 3R0DA 4HK5A 3LGGA 4NG3A 1KRMA 3GRIA 3S2JA 2R1PA 3KM8A 1P6BA 3IRSA 2HPMA 1O12A 1EZ2A 1FWHC 3A3XA 2W9MA 4H9XA 4GC3A 3LSCA 3GGMA 4C6NA 3NQBA 1YIXA 4C6KA 2WJFA 3LU2A 2DVTA 2QVNA 4V1YA 1J79A 3T8LA 4BJHA 3MDWA 3F4CA 3F2BA 1FKWA 3S2LA 4DNMA 4IFKA 2OODA 1FWAC 1PTAA 4F0RA 3F4DA 1EJSC 4AC7C 2YB1A 1UBPC 3N2CA 4E3TA 4PCPA 2D2HA 3O7UA 1FWFC 3GTIA 4WVXA 5A6TC 1A5NC 2D2JA 4C6IA 4DO7A 4F0LA 3URNA 3TN4A 4BKNA 4GX8A 3MVTA 5FSEC 2R1LA 4NP7A 4QSFA 1I0DA 4HK7A 4CNTA 4GZ7A 4C6PA 2PLMA 1RJQA 4XAYA 1ITUA 4H9VA 1WXYA 3OU8A 2PGFA 1FWJC 4QS6A 2R1MA 5LXXA 1POJA 4LALA 2Z25A 3TN5A 1FWBC 2RAGA 4C6BA 4B92A 5HMEA 3MTWA 3RN6A 1GKQA 2Q01A 4EPDC 3LGDA 3HM7A 4EP8C 4IGMA 1EJVC 2FTYA 4ZSTA 3HTWA 1P1MA 3PAOA 2VHLA 3URQA 3FEQA 3GU2A 4H00A 4M51A 4KEUA 4IFRA 1A4MA 2OQLA 4DIAA 2Z27A 2AQOA 4IFKB 4LCRA 1POKA 2UBPC 3NURA 3URBA 3EWCA 4C6MA 4LANA 1K1DA 1ADDA 2G3FA 1NDVA 4H9MA 2BB0A 4ERAA 3ITCA 1PB0A 3B40A 3OODA 4QRNA 1FWGC 1XRFA 1VFLA 4CQBA 4DI9A 3UR5A 4R7WA 1E9ZB 3IJ6A 1M68A 3LSBA 4H9YA 4H9TA 2YXOA 4JOMA 4RDZA 3UBPC 4P5UA 3MPGA 3GU1A 1M7JA 2AMXA 2R1NA 3MJMA 2KAUC 1KRAC 4CNUA 5HMDA 4C65A 2Z7GA 3FDGA 4C5ZA 3A3WA 3S4TA 1EJTC 1QXLA 4WGXA 4MUPA 3V7PA 1YBQA 4C60A 2QT3A 2ZC1A 2OGJA 4DZHA 4RE0A 4LAKA 3F2CA 4UB9A 1J5SA 1M65A 1O5RA 3EGJA 4GY7A 1JGMA 4XD5A 3GTXA 3GUWA 3S2MA 1EJUC 4RZBA 5HMFA 2VC5A 4LCQA 1V7AA 3UF9A 2Q09A 4C6OA 4ICMA 2FTWA 4IGNA 3E74A 2P53A 4RDYA 2O4QA 3K4WA 4KEVA 2CZVA 1RJPA 3QGAC 1R9XA 1HZYA 5E5CA 4LFYA 4IH3A 3OVGA 3OOQA 1EJRC 4C6LA 4GY0A 3CS2A 3E0LA 2FVKA 3AU2A 3K2GA 4QTGA 3MKVA 4RDVA 4RDWA 4F0SA 4C6EA 3E0FA 4LAMA 4B90A 2Y1HA 4L6DA 1IE7C 2VR2A 1FWCC 1W1IE 3F2DA 1NFGA 3OJGA 1KRBC 4ZSUA 2YZ5A 4CQDA 4H9ZA 2GOKA 1YBQB 5G4HC 3IACA 2WM1A 3JZEA 4PBFA 4B3ZA 2GSEA 2HBVA 4PBEA 3SO7A 1J6PA 2A3LA 3BE7A 2Z2BA 3O0FA 5FSDC 3QY6A 4CEXC 1QW7A 3MSRA 4EPKA 3TN6A 1A5OC 3E2VA 3PNZA 1GKRA 2OB3A 2O4MA 4XAZA 3K5XA 1K70A 4V1XA 2P9BA 2GWNA 3T81A 2Z28A 4H9UA 1V51A 5AKQA 4I6VA 3AUOA 3NEHA 3WMLA 1E9YB 4XD3A 3C86A 2I5GA 5CH9A 3G77A 1R9ZA 3RYSA 2Z24A 1A5LC 1RAKA 4TQTA 4G7EA 1FKXA 2BGNE 2PAJA 4LAOA 1ITQA 1NDZA 3MDUA 2XIOA 3DCPA 4XAFA 2HBXA 3DC8A 2P50A 3QGKC 4GK8A 2Z2AA 1P6CA 3LA4A 2DVUA 3QY8A 4EPEC 4HA0A 3TNBA 1ONXA 3GIPA 3RCMA 2GWGA 2ANUA 4J35A 1FWIC 4HJWA 3TN3A 4QS5A 3PBMA 4IFOA
chains in the Genus database with same CATH superfamily
1R46A 3TMQA 8A3HA 3GB6A 3IV8A 2FFCA 3V3WA 2GSHA 1TR9A 2EJAA 4XB3A 1K1SA 2DQXA 1W17A 3O15A 1OK4A 4UTWC 2E9MA 4NKCA 1DQWA 2ADAA 5KFTA 3IGUA 1QHPA 1MNZA 1XKYA 3SCSA 3MT1A 4GXWA 2H9AB 1W3HA 1RALA 3RB4A 1JXKA 4ZQMA 5FJUA 3E0WA 1S5TA 3CZGA 3I68A 3A4WA 3AQUA 3TWAA 3INPA 4GNJA 5F4WA 3B0VC 1XXXA 4LTSA 3RLUA 5KFDA 3GDLA 3KOWA 3VCRA 4QLKA 1N55A 2E3ZA 1C8VA 4LU0A 2Z26A 3MHGA 2YDAA 1EPVA 1V6YA 1BYDA 1GUVA 2UVUA 1JVNA 3SI9A 4HGXA 1ICQA 4BK9A 1HKIA 2YFOA 2DT0A 4ML9A 1IEIA 4UR9A 1RJRA 4YQWA 2ZRWA 1FA2A 3DC0A 4Z42C 4HHLA 2OOFA 2RJHA 7ENLA 2OSYA 4LUTA 4GIYA 4YN5A 3AIQA 4A35A 1TVNA 1JDCA 4NXKA 3BLOA 5AYXA 5K9DA 1BF6A 3LENA 4MB3A 3RHGA 3HG5A 2WWDA 4ASTA 1HNYA 5I3GA 2J6SA 1K6WA 5L1KA 2R82A 4FLRA 4NNBA 3O6AA 1RXOB 2F7FA 3NO5A 2DZTA 4N9EA 1W3KA 3C2YA 3SGUA 3I4KA 2RDIA 1EF2A 4CQ8A 1RSCA 2GVEA 2W7OA 1S2VA 2PDGA 3D6NA 3WH5A 1QPKA 4Q8EA 2TRSA 3BG3A 4GE8A 2PDYA 1I75A 4DLMA 5DT7A 4E38A 4S2BA 2YLLA 2J24A 3WD1A 3WUBA 4CD4A 4J4KA 1W5PA 1TRIA 3IPWA 1HF6A 3R8RA 4NRSA 4X0NA 4FI4A 3GNPA 4EEYA 1SZEA 3IVSA 2NXIA 1QDSA 1JG9A 4HYRA 1Z42A 1O60A 2ZWYA 1OT2A 3S1UA 1EPXA 2VR5A 1XUZA 4I9MA 2VDHA 3LU2A 5GJPA 1G4TA 4U33A 2XIQA 2X41A 1VCFA 1UC4A 4K68A 1VJIA 4J28A 3OBKA 3VIMA 4XK2A 5K4XA 5FACA 1P0DA 1XLLA 3IUDA 1H1YA 3MVTA 5FSEC 3WDPP 4Z2LA 1DV7A 2WPBA 4CNTA 1K9FA 1GG1A 3KZPA 4BEUA 3N2TA 5A3HA 2V30A 1EXPA 4ACZA 1ZNNA 1AW2A 4LGXA 3T40A 3EB4A 1E0TA 2G3NA 2ZCGA 4GIRA 4J9SA 3LLDA 4ZBCA 3PB2A 1T3NA 1Q5MA 3WL1A 4AC1X 2WAGA 3FJ6A 2ZUVA 3B05A 3GDKA 3LZ5A 4GWEA 3GILA 1XBVA 5LIWX 2V5DA 3CB3A 3UNDA 3BK0A 3ITCA 1OY0A 3PUEA 1WX0A 1KTBA 3M0XA 1RV8A 1KBJA 1LL7A 1UH4A 1FP9A 1R7OA 1XICA 2PDBA 3D47A 1EL3A 1XRSA 3GV7B 3AYRA 2VRKA 1UB3A 4W9TA 4ZVJA 3A22A 4JFWA 4GYPA 5BROA 4CNUA 4MDOA 2WZMA 1IXOA 3EPOA 1IM4A 3ME3A 5AZ0A 1JFXA 1HFBA 3NL5A 5FEPA 2WNNA 2OSWA 4L5ZA 3T08A 4WOQA 1J5SA 4YTTA 4GCXA 5BMXA 1V0KA 1W9DM 4O54A 3SFKA 1VFTA 1KM1A 2C15A 2RDWA 2BHZA 3TR9A 1F3XA 1H49A 1IR2A 4IWWA 3ITGA 1KKOA 5FF4A 2R8HA 2ODOA 5KFWA 4ZO6A 3E74A 4KEVA 4JGDA 3RK8A 5HPOA 1TG7A 3KHDA 4FXRA 4IZGA 4IH3A 4YXGA 3OOQA 1FDYA 2PP1A 4QGCA 2NSOA 4A4AA 2WQPA 4M8UA 4B90A 2ATSA 3IVTA 1R3TA 2OZ8A 1Q8AA 4K8HA 4UZUA 3B8SA 4EF9A 1W6TA 3MFHA 3VNYA 2XSXA 2R8GA 5G4HC 3QLDA 3RR4A 3LRLA 4HPNA 1UWSA 3AUJA 4NZ1A 5T9CE 1E6QM 3Q8PB 1W5OA 4US5A 4HB7A 3MB9A 1D7KA 3GDMA 4HPJA 3DN5A 3E6EA 2E4TA 2ACRA 1G01A 2DPJA 3BLIA 4O13A 3W4RA 1O68A 5EYWA 3QMRA 2DSUA 1DJYA 3AJXA 4O12A 4JS3A 3T7VA 1W2PA 4F4XA 2HJPA 2J27A 4XVDA 3VIKA 3YPIA 3M7SA 2IQ0A 5AYIA 1CB2A 1UR9A 3GVGA 1L2QA 3LDVA 4G7EA 5D8ZA 5BMWA 4QITA 4W88A 1HL9A 2HCVA 2X8RA 3CU2A 4ECXA 3OGVA 4QWDA 5LNSA 4F9DA 3WLMA 4LUIA 2W63A 1ONXA 2G95A 3PSVA 4F2BA 5JBFA 1WE5A 3UCQA 1W1PA 3KCOA 3C6CA 3Q58A 4HJWA 3MV11 3TIMA 3PBMA 2BV9A 2XWEA 3EWDA 1E6NA 3G8RA 4XD6A 3AZSA 5DELA 2QUNA 4IG2A 5IBXC 6TIMA 3PZTA 2CLPA 4AD2A 2QUTA 4XKYA 4RV8A 1YXCA 1ZQ5A 3UQNA 4NT0A 4R7OA 3M07A 3UW6A 4H19A 5D4YA 5F2MA 2Q6ZA 2YL8A 3COTA 4BI6A 2ZVRA 5FI8A 2CBJA 4TX9A 3F4VA 3WQDA 3H2FA 4EWJA 3DFNA 3NZPA 2VO5A 4LVDA 5AVNA 1FRBA 1NQKA 4DWSC 4GXPA 4XAGA 1E0UA 2RHGA 3UZWA 4ALDA 1DJNA 3KXQA 1X6UA 1IR1A 1U22A 2D22A 1E1CB 3CTLA 3ZWTA 3MVIA 3QKEA 4JL1A 2XUCA 1UMLA 3PZ9A 2ONEA 2BDQA 4C6CA 1XYBA 2JBMA 3OGRA 3W53A 2E8YA 3DFPA 2X05A 2PRHA 4J9NA 5BWFA 1BGGA 3OW1A 3S1VA 1N8IA 1WAUA 4DF1A 3F4WA 1H7OA 2XH0A 2W27A 4YTRA 3OQ8A 3CMFA 2NUYA 3L7RA 3XINA 2W61A 1ZSXA 3LCLA 3UD6A 1SZFA 1XGEA 4DL6A 1DWHM 1GVRA 3GM8A 1UBSA 3HOJA 1KO0A 3FKRA 1BXCA 1SFLA 3PUDA 4HZ7A 1A47A 5REQB 1CWYA 3OG2A 1ZAHA 1JCLA 3E2QA 4L6HA 5BWAA 3GTFA 5DQHA 4CCCA 3WDQA 4DYJA 1M7OA 3HPZA 3S5ZA 4UMCA 3VDAA 1GYLA 2EG7A 3RFAA 5E0FA 2UVRA 1I0BA 1SW7A 4CKQA 4WCJA 2Q8ZA 4J5NA 3CUHA 2QCDA 5H8PA 3P62A 3GY1A 3EAUA 3P8JA 1FWDC 3S2CA 4GYFA 3B03A 1F7BA 3B0XA 2D69A 3SCOA 2NZLA 2VJXA 4HHPA 4C91A 4ZR8A 2W5FA 3VMPA 3LS9A 3CQIA 4YR0A 4YP3A 1GEQA 4Q33A 3LB0A 4ZMGA 2R91A 3R0DA 1S97A 4Q4RA 4LUTB 3S2JA 1VJSA 2R1PA 4UQEA 1WAWA 3B8TA 1F9CA 2WCAA 1KFEA 3OLEA 1W3NA 3R58A 5CGTA 2V4RA 4L56A 1FKWA 3AMCA 2A7PA 3LHUA 3TJXA 5CC6A 3VIPA 3GBEA 4F4WA 1EJSC 4REQA 3R7MA 2VVSA 2V2CA 3W86A 2C28A 2OOGA 3H12A 5EMKA 3PR4A 3URNA 3Q8QB 3VAVA 4P7OA 5E93A 2VEPA 2PSNA 3NQFA 5JH1A 3NWRA 1I0DA 3W2JA 4HK7A 2QJMA 3UT0A 2QNEA 1JUEA 3VKJA 3RLGA 5TAOA 2EO7A 4P8WA 3M0JA 4RZ5A 3M0ZA 3PJUA 1FWBC 1KLYA 4GO9A 1BFNA 3UNTA 4JY8A 4LAUA 3QFWA 4JQ4A 3W0KA 5HJYA 1QNOA 3UERA 4MKNA 1X39A 3LOTA 5BOOA 1Q7QA 3W00A 1H50A 3GIYA 1TYGA 3G1RA 3H23A 2ZZ5A 3ZIZA 1DIEA 1ISXA 3ITXA 3S5YA 2AQOA 3GAKA 5LNRA 3BH4A 1G0CA 4LCRA 4M1RA 4BS0A 1W5NA 2XFFA 2XVLA 1QNSA 3B40A 1XW8A 1MRQA 3BZJA 4K38A 3VIJA 5DRIA 3NNTA 1AH4A 1VBHA 4IMAA 5FF7A 2GPTA 2J7DA 5FOOA 3W2MA 4XO7A 4JKMA 2D1ZA 3F5KA 3TW6A 2YLAA 3EWBX 1KRAC 1EC8A 2PODA 1I2OA 5DLCA 5C9RA 3EPIA 4ACZB 3W24A 1QXLA 3WF0A 3C2OA 3G6MA 3AHXA 1FUYA 1R2RA 3P74A 2YBVA 1T0OA 3MP3A 2A2IA 1HUVA 3AO0A 2AGQA 1EP1A 4LT9A 4AF0A 4XD5A 4DF0A 5HBFA 3V0TA 2WNWA 4P7LA 4L64A 4ZQRA 3CASA 5CG7A 3L12A 4Y9MA 2NV9A 2E40A 3CO8A 3C52A 1TB3A 4GO8A 1KWGA 4XISA 3AYVA 4U7CA 2ZX7A 1OGSA 1AD1A 3RUBL 3QGAC 2JGYA 5E5CA 4LFYA 3QZ6A 4GLEA 1V3KA 1NAL1 3PM6A 1GK8A 2Z0IA 1XSJA 3VE9A 4ADTA 2XG9A 4IICA 3HN3A 4UUIA 1B3VA 3V5CA 4ZEPA 2PDUA 4HYVA 1DXIA 3W7NA 3VNJA 3WLSA 1T99A 4W93A 3PN8A 4HVXA 4NHVA 2YJQA 4JYDA 5KFMA 1VJZA 2DW6A 5EFDA 3U0HA 5C54A 1ZUAX 2NLIA 4FAMA 3TA6A 4HQVA 4BWLA 1CGTA 3QY6A 4GIEA 4NYUA 4HZ8A 2FJUB 1PWLA 3LERA 4D6HA 2OQYA 4ZO7A 1MWOA 3PNZA 1JZ2A 1AMKA 3ZXWA 4XZHA 2XU2A 3PWAA 4GXMA 1V51A 1HIZA 4RUAA 3C0LA 4XD3A 3KHRA 5CH9A 3CHFA 1WZAA 3KVKA 4J3TA 1NU5A 3PB0A 2OYKA 4ECYA 4BZYA 2PAJA 3W07A 1CLXA 1B4EA 1R0MA 3N2MA 1VFHA 1SW3A 4WKHA 3LMZA 3S83A 2PCQA 4GK8A 3BQ6A 3LA4A 5HNUA 2QMKA 1ICPA 2P8BA 3USBA 2ZICA 5AC7A 5J8LA 1VAHA 3LXBA 3TONA 1KWKA 3VFCA 6TAAA 5D30A 1YE4A 4RR4A 4GHRA 3OHAA 1RD5A 3N9SA 2TAAA 4POCA 3VOIA 4QDWA 4IIFA 4N9BA 5KG4A 5I3HA 5HJLA 4HMEA 3PJTA 1OFPA 3UYCA 2J9ZA 2YCJA 3UWEA 1BKSA 5A2CA 1TZZA 2IXUA 4ZFCA 4YHEA 1UHVA 3OBEA 5KZMA 4FR1A 1J0ZA 4G7EB 3EPMA 3VGEA 3WK1A 4HCLA 5HR6A 1F6PA 4I6KA 3LCWA 3FYPA 4GVFA 4ERGA 5C5JA 3GIJA 3KOXA 1S10A 3WL0A 2B81A 1E5NA 2J6VA 3W2UA 3AXXA 2RDTA 1JYXA 1ZY9A 4V27A 1GW9A 4GYKA 1NF0A 3IIOA 3W7OA 1JPDX 2ZE3A 1RA0A 3DAQA 3ALFA 3BW2A 4PMRA 3N11A 3PR2A 3NSNA 5AC4A 5D2YA 4IG2B 5J04A 2VA3A 1HX0A 4XKYB 4PMVA 3TQVA 5DG9A 2WK2A 2UZ9A 2AMGA 4M6QA 5BRBA 2E28A 1JYWA 2YW3A 4OZOA 4AHOA 1CXHA 2QMJA 4J2MA 3F5LA 3QLLA 2XGQA 4KETA 5KG0A 4IQDA 2Z4GA 4LV9A 5DANA 3MSYA 3P8IA 4QE1A 3T2PA 1HL8A 3OYXA 2OVLA 1PX8A 3RMJA 1Q2RA 1P1XA 2CHOA 3G1VA 2E7FA 3W22A 4RJEA 2AQWA 1TFVA 2GUYA 4NJKA 1VFOA 4GBDA 3GDBA 2QYGA 1Q2SA 1ECQA 4XZIA 4YVPA 3OHMB 3UGVA 3L2MA 2F6KA 4DZIA 5IHSA 1Z41A 4Q8FA 1EF3A 2WJDA 3T0AA 5AYZA 2YOCA 3DIPA 3DYOA 4K1WA 3LHWA 4W5UA 3UCDA 4H1ZA 1HO4A 1PWMA 3ATYA 1N82A 5E70A 3LRKA 3PJXA 1Y8BA 4I5XA 3V6HA 1TA3A 1UR3M 3IRDA 3UEQA 2REQA 1UQYA 1FY6A 3BJFA 3FYOA 1QRQA 2Y70A 4NXSA 2WOQA 2PLCA 2OX1A 1WV2A 5JBEA 5DLFA 1PXGA 2VWSA 2P8CA 3ARZA 2OCZA 2JEGA 2ZBTA 3UCCA 3LHYA 1PV8A 3QZAA 4DNMA 3NZGA 5FF3A 2QCDB 5ECVA 4MFDA 1MUMA 3N14A 3MMUA 1QNPA 2IKGA 3CV6A 4RCXA 3BOXA 3XIMA 2Y8UA 3RM4A 4FXFA 4DAIA 3SUTA 1JXLA 3WNNA 5D04C 3L66A 1TR1A 2CPUA 4IPPA 4O1BA 2ZQ0A 4QISA 4NZCA 4GCAA 2FJKA 4I9JA 1OVDA 3PZGA 2PTZA 2IPWA 1J12A 4EP8C 2YZRA 1W9PA 3QR1A 4GZEA 5D33A 3HPSA 4LJ3A 2W0UA 4JBRA 4BFAA 3MI3A 4XSLA 1XBYA 2RKXA 3FA3A 4S2CA 2DH3A 3S5NA 4H8VA 4C6MA 4REQB 3QFEA 1ADDA 5AC8A 4ZQCA 2BB0A 4CD8A 1IT7A 4O53A 4QW8A 1PTDA 4HA1A 3WNLA 3UR5A 3Q65A 3I4EA 4WDXA 3MUAA 2Y7EA 5CLWA 1RCQA 2B7PA 1IHIA 3W6LA 1QFEA 3AS2A 1FHVA 2VOTA 3IAPA 2JQXA 1HGWA 4G3IA 2ZA3A 4O1CA 3A3WA 2OEJA 4OV9A 3W1LA 2XIJA 4WGXA 3LV5A 1S0NA 1K03A 1RH9A 2ZC1A 5M17A 1V6WA 2WM0A 4IIGA 2DT1A 3DH7A 4WF7A 4AD1A 3S5SA 4JKKA 3WLIA 2WHMA 3AWOA 3FSUA 4FLSA 3BL3A 3FA5A 3FY1A 4Q4PA 4UFMA 4WSKA 1GJUA 3NO3A 3BO9A 5KT6A 4RKAA 4Z17A 2VUYA 1S1PA 4J40A 1O6IA 1EGMA 2J74A 3GNRA 1KQYA 5LKYA 1F4AA 5BCAA 4GUJA 5I3IA 1XYCA 2ZXBA 3WK2A 3K2GA 1IZJA 1W1B1 4PRTA 4H8NA 1VH7A 4P7RA 5HINA 4UIOA 4UNIA 4DYEA 2C6QA 1JL8A 4JZ5A 1E73M 3F2DA 5J5RA 1NFGA 4ZSUA 4L4LA 3NXFA 5CSSA 1EUAA 3SUWA 1W8GA 3VUPA 4JFSA 3N6QA 5D9MA 4KWWA 4Z1YA 4AZIA 1FCUA 4AIBA 3Q8SB 4ZOAA 2V5BA 4B2DD 2OO6A 4RNJA 1FQ0A 4AF0B 1T5AA 4F0MA 1XLCA 2INEA 4E4UA 3WNMA 1T41A 2X2YA 2I1OA 3UZJA 3BLLA 1V3MA 1A0EA 1K9EA 1MRAA 2OU4A 2F6XA 3SECA 4NAEA 1O5QA 2V4QA 2J6XA 4XAZA 4UR8A 4OT7A 4S3FA 3N9KA 2PDPA 2DZPA 2FGBA 2I5GA 2IW0A 5HPCA 1V6XA 3AFBA 4LRSA 1KA9F 4N02A 4CUCA 5IFTA 2NWSA 3M7WA 4D8ZA 5DRCA 1U1JA 2XM2A 4LYPA 2WQDA 4JTJA 1QWGA 1ICSA 2HVMA 2XIOA 3ECQA 5K2ZA 1YNQA 1VFSA 2P50A 4O1FA 1XKJA 1PIFA 3BDKA 4J3VA 2VXNA 4MZ1A 4AZCB 3VM5A 4PTVA 3KBWA 3IK4A 5LIYX 4AVNA 1B3WA 3BSHA 4UQAA 4QS5A 1T8QA 2NW0A 3OIXA 5CAKA 3BSMA 1W1A1 1KLZA 1C7SA 4IFOA 5FEWA 1FHDA 2E1WA 4MNMA 1PX4A 1P7TA 2QS8A 1R38A 3W1RA 4PN2A 4AUBA 1XC6A 4RW3A 4W86A 2ATMA 4QW9A 2WKJA 2I7GA 4DM1A 1C92A 1GONA 1VRXA 3ISIX 3EOLA 1CENA 1SFJA 4NL1A 3V0SA 4F0KA 1XYMA 4PUKA 3R0UA 3SFWA 1JXJA 1OX5A 9RUBA 2CZEA 4ILSA 4J9LA 4HNTA 5AOUA 5KEZA 1EDGA 1KFJA 5DGAA 3OEXA 4U4MA 2ZZ2A 4NNCA 2TSYA 1EEXA 2VENA 4KRTA 4V2XA 4JN7A 4D2JA 3ES7A 3C3UA 3KZSA 4CD6A 3H4WA 4QAWA 1X1ZA 4QROA 4DLFA 3WDRA 1HKKA 4ROPA 1S5NA 2A85A 3UXKA 4BQ5A 3W1MA 5BXRA 3MI6A 4WQ6A 3FS2A 2PC4A 3HPAA 3LRMA 2PTWA 2G8ZA 2NQZA 3CM4A 4OGZA 4CQCA 1Q6GA 3BG9A 4XAPA 5LZLA 3GWQA 3WLRA 4GOAA 1SSDA 4C6QA 4MY1A 3GZAA 1OX6A 2TPSA 3N12A 3B8WA 2F38A 3BAKA 1RP9A 2JIWA 3TTSA 4B15A 4PMUA 5LIKX 4AZ5A 2PMQA 4LH8A 1A4LA 5G5IA 2WMHA 2VX5A 3VGDA 3GHUA 4DBEA 4PMXA 2FVMA 2NX9A 2X42A 4AWUA 4KQNA 4PMOA 3AOFA 4PUEA 2BBFA 1EQPA 4E8CA 4ZQPA 2ZRUA 3TCSA 2AAMA 2BGQA 4ICNA 1W31A 2BS9A 4M56A 2CWXA 2QCMA 4B5NA 3PY2A 4DJDC 3WQOA 2W9BB 2V6AA 1MW3A 1IYXA 4EXAA 1J9YA 3WUGA 1N8FA 2P0OA 3E9AA 5CBIA 4JTRA 2QGHA 3SADA 5KT3A 3K8KA 2H6RA 3RM9A 2QVNA 2MANA 3P80A 4EANA 1VCVA 4IFKA 4OE7A 3DKLA 4PCTA 4AC7C 4ZE4A 5MF5A 2GDQA 1OT1A 1OC5A 4IMFA 4F4YA 1XI3A 3G0SA 4HHHA 3MKCA 1T94A 1YPIA 1PIGA 3N3MA 4HIBA 1OIFA 1MMFA 3T0DA 1FFRA 2XN1A 5TF0A 3NQDA 2TYSA 3VGHA 2ZE0A 3SR7A 1LG1A 5MKGA 2JEQA 4JTCA 1H11A 1OGGA 1TA3B 3M5XA 5JMUA 2BTMA 2REQB 1HKMA 5FL1A 4IUOA 4DHGA 3L4ZA 3ZM8A 2RAGA 4U6PA 2B7QA 5KITA 2CETA 2QJIA 4PSRA 4ZZ9A 1HTIA 3Q8RB 2WVTA 4GRSA 3ZQ9A 3BAWA 3VNMA 2BNJA 1X96A 1LTDA 2CLFA 2YCLA 2YKKA 3UP8A 1LT7A 1KXHA 1YEYA 2OYMA 2QCCA 4ZB0A 4ECWA 3LPOA 2Y6ZA 1XRFA 2GJNA 3WJZA 4CQBA 1H0GA 4Q8MA 3IJ6A 3O06A 3POCA 4AZHA 4TU1A 5KFEA 1EQCA 4Q22A 1B3OA 1YHTA 3MPGA 3GUGA 2DFAA 2BY2A 4Z1CA 3E49A 5M2FX 1M7JA 2R1NA 3S9IA 1BVWA 3R8HA 5K7JA 3VX0A 2DZSA 3H24A 1J93A 4MTVA 4LC8A 2OGJA 4P7QA 5FAGA 1H7PA 3E12A 2NT0A 1CGWA 2VFFA 4L6OA 1E3XA 4F2TA 4HCDA 4JEQA 1H1NA 3TFXA 3M0MA 1Q63A 2VZSA 4LF2A 1V7AA 2CHNA 3V75A 4J2PA 4AMAA 1NP2A 3JW7A 4M6UA 5CKSA 1UA7A 1Y5VA 4W4QA 1KFBA 3B0PA 4ACYA 2DIJA 4HNOA 3W1UA 4OECA 1C3FA 4WJXA 3AIUA 3MSDA 1BKHA 1IT0A 4ZQOA 4RNNA 3C3NA 1W1IE 3O6CA 3DBNA 1IXPA 4ECLA 1EHNA 4XZNX 1G5AA 3U6WA 1F76A 1WZKA 2GOKA 1AG1O 1JNEA 1UOKA 2JKPA 1YLVA 1IWPA 4PBFA 2XN2A 4S3BA 4B9YA 1TPWA 5HUOA 3BLPX 3FXGA 3TA9A 3RR1A 2A3BA 3SEPA 2OSXA 4HMNA 3H22A 3NQ2A 4ICCX 4GINA 1TCDA 3BJTA 1LQ0A 1XD0A 1FWWA 3W7JA 4V33A 4ZA0A 4DJFC 3HB9A 3N25A 2DU2A 4UTMA 1P0EA 1Z3NA 3EPGA 1K8CA 4ED1A 5JUVA 3W88A 3L9CA 5DQGA 4A05A 5I3JA 3WMLA 6ENLA 4D6GA 1JAEA 4N42A 1SFTA 4MYAA 1KBLA 3G8EA 3R89A 1V8EA 3PTQA 1RYSA 4U10A 5CGQA 4UNKA 4YU1A 1IT8A 5C9ZA 4DY1A 3TZFA 5GNZA 3HU7A 4ORIA 1R3RA 2GQAA 4IPLA 4Z1AA 4NZ3A 4PRRA 1N48A 2RGLA 3VDGA 2VC6A 4L4PA 1MNSA 4YWIA 4M3PA 4F79A 1YDOA 4A6GA 1XX1A 2P5NA 1XIHA 1TPC1 3CZKA 1WXZA 4UCGA 4NAEB 1V4YA 4Y90A 4GC6A 4QSHA 2D0FA 5IXEA 1C8XA 3RU6A 3CLMA 1R9YA 1TKKA 3KEHA 3WFLA 9CGTA 2E5BA 1QT1A 1TIWA 2PDWA 2EPOA 4RE3A 2QPXA 5KFNA 1CX9A 1EJWC 3D3FA 3VOGA 1OINA 3GSMA 4XD4A 2L5HA 4PULA 2IA6A 4B5TA 1DP0A 3KOFA 2Z2UA 1V6VA 1BWVA 2O56A 3CPRA 4JHZA 1V02E 2XIIA 3NVTA 4BF9A 2VM8A 4NX5A 1G6CA 2OH2A 2BVTA 2DP3A 5BW6A 3GH7A 3FW6A 1JPHA 2FPTA 4S3AA 4MNKA 5EMYA 1C93A 1P7TB 3BW3A 4MKSA 4OU1A 4Q6XA 4OTKA 4GABA 5JUMA 4EBEA 5M03A 4A2SA 3W29A 4J9MA 4IT1A 2QIWA 2VRJA 3CAWA 3G24A 3GIIA 3PG8A 4D71A 1VP5A 3U57A 3U7VA 4PH6A 4C6FA 2O9PA 4IJBA 2WLZA 4S3EA 2NXGA 3BGAA 2ASLA 5KFHA 3EEGA 5JIWA 2GYIA 2VD8A 4DF2A 5FJIA 1H7WA 4FEZA 3EWXA 4IPNB 5H2ZA 4JYEA 1OFBA 3MA8A 1K4HA 3TU9A 4PMQA 4F4ZA 4AVOA 4D8LA 2DSVA 2WSYA 3IVUA 2CLMA 3DHDA 3SUVA 4I3GA 1DWIM 3IK2A 3BVJA 3GTHA 1SW0A 1JFHA 1I2QA 2CLIA 3EA3A 3IUHA 3PZUA 5AYBA 3W7DA 1K3UA 1IWBA 4D8AA 1NH6A 3W26A 5DX7A 1PCKA 3HQPA 1WQ5A 5LYRA 4AEEA 3OVRA 2YPIA 3L4WA 4S39A 1ZAIA 3F4NA 3P14A 4KFOA 3TLLA 3WEOA 3KL0A 5I00A 1W1TA 2R9RA 2X2GA 4H9XA 1K9TA 2Y0FA 3A3XA 4FOKA 4C6NA 1KB3A 3P5ZA 3U2ZA 2NQ9A 3A3HA 3K1DA 4H7ZA 3THUA 1UCWA 3ZMRA 3HMJG 4Z0SA 3NYDA 3PW2A 3RBDA 4PCPA 3M9MB 4H7CA 1ZENA 3R10A 5KTLA 2YCIX 2B7OA 1BWKA 3AHTA 3MANA 3W7LA 3KBMA 2Y89A 2V3DA 4GZ7A 5D2TA 4PEEA 3PUGA 4DB7A 1Q6FA 4Y7EA 1TVPA 5BU6A 3OU8A 2ZUUA 1IEWA 3MP4A 1QJWA 1RQEA 3WLJA 1AH3A 4K37A 1CXKA 3FKKA 3F1QA 1X7FA 5XIMA 1U2YA 3QMTA 7A3HA 3UZ5A 4QLJA 4HOXA 1DORA 1P1MA 3WENA 1UD8A 3B8IA 2FZ8A 1E0XA 2RFGA 3EKLA 5CAHA 3BICA 5FIPA 4A3RA 4HNVA 1WNOA 2Z27A 4IFKB 1VHNA 3TYDA 4FOUA 1POKA 3NURA 4AY7A 3NQ6A 2OXNA 1A0CA 1I4NA 1W3JA 3RAQA 5L6UA 4J7RA 3V18A 1L6SA 4NU7A 3OVPA 2HWGA 3M9NB 2EBNA 5HQEA 4JPGA 1BG4A 3TYUA 4YTUA 3HF3A 3FV9A 5MKGB 4AB4A 1EDQA 1ALDA 3EYPA 1OABA 4KRZA 5IM51 1DJQA 4OOUA 3PTKA 2G5WA 4LEQA 3S4TA 5E1QA 2V9DA 4LVBA 3FIGA 2DV0A 4PMYA 2J8TA 3EOEA 2UVVA 4YMZA 2EKGA 1O5RA 2DIEA 1EFZA 5T14A 1ME7A 3GUWA 3C56A 4I8YA 1KR0A 5KFIA 2YCLB 3W2NA 3IJ7A 1Z8AA 4RZBA 3GG0A 4JDYA 3ARSA 3DDMA 1NFPA 3IIZA 5CC3A 1DKWA 2W66A 1LCOA 3PBGA 2PWUA 1DQUA 4ICMA 4S1FA 3DZ1A 2ZX8A 2WNQA 3OVGA 4IP4A 1BYCA 4FMVA 3SGGA 1J11A 4Z08A 1E4IA 3BTNA 2D73A 4US6A 1DJIA 4I7WA 4L6DA 2YBUA 4PC8A 4EOUA 4FBUA 1GZ1A 1OWQA 4HOWA 2VR2A 4GVIA 3NL2A 2GJXA 3VKAA 1TMQA 3U48A 3WH8A 1EA0A 2R6OA 1SGJA 2VFHA 4MB5A 3GNXA 3GO2A 4AYSA 4PMNA 5C9XA 4QE4A 2NX1A 4NZ5A 2WCSA 2V5LA 4OWGA 3WQCA 4DL2A 4ZXOA 1M01A 3MCMA 3QH2A 4GQBA 2WPGA 3OLDA 2CESA 1I9CB 3LQLA 3H4DA 4Y8EA 4L61A 1XLGA 2PDQA 1DHKA 2P9BA 3SN1A 5EFFA 7CGTA 3T81A 2DZXA 2JKEA 3FGCA 3PZIA 4E2VA 3N6HA 3H7UA 4TTGA 1JGIA 1OX4A 4LWWA 4YJ5A 4Q7BA 5KFBA 3LQGA 4QM1A 3TTQA 3EWYA 3CQJA 3W9ZA 5T8GA 1XIDA 4LS2A 1X1OA 4RW5A 3QW3A 2HBXA 4ECQA 2HISA 3BQ2A 3UWQA 1AJ0A 3SCNA 3L2IA 5CPTA 4FALA 4P7NA 2HZGA 1ZCCA 3GDRA 3VD7A 3VFLA 4FP1A 1QOPA 2YL6A 3T5KA 1UQZA 2WSPA 1JX4A 2C19A 1YTKA 3MUXA 3M46A 1XGZA 1S3TC 1B9ZA 2WANA 3DHUA 4GMEA 3LTPA 4UTUA 5EMJA 3GC5A 1VEMA 1XJBA 2J78A 3STEA 5BYWA 1MVYA 4A22A 4L1XA 1UG6A 1D8CA 4UTIA 3E0IA 3KDOA 5D2XA 1W3LA 5CG0A 3LY0A 3MI2A 3DHFA 3QF0A 2IMRA 4DUXA 5C2XA 3B3DA 4GD0A 3IJLA 4UQ9A 3WQWA 1OEPA 4S3KA 4PTNA 5HUPA 1N2VA 1TTQA 3VD5A 2ISWA 4L80A 4JN6A 4H01A 5I3KA 2VEIA 4U5IA 5A2BA 1D3CA 3GG1A 1H62A 3C2FA 4OHQA 1A53A 3GU9A 4UCFA 3W71A 3IIPA 3S1XA 2W67A 4K8EA 3EKZA 3I3BA 4NZFA 1QPRA 3CYJA 2G4FA 5CSYA 2CW6A 2PBGA 5CZTA 4LV4A 1UD5A 2XCPA 4E8DA 3P6LA 3BMXA 3N18A 2YW4A 3T42A 3TOYA 4ZCWA 4HSOA 1VENA 4WSJA 4GZIA 2NVDA 3EKGA 1ITCA 1WUFA 1OZMA 4O57A 3GC2A 5K3VA 5L1JA 4HP5A 2CLEA 4PYSA 3QRHA 1R2SA 4O0QA 1Q6CA 1B30A 3WF2A 4RLIA 4GKLA 1XRTA 3K4DA 1TJ2A 2C22A 3KOYA 2EHHA 2OMAA 2G97A 1EZWA 3CV7A 4G5DA 1E3ZA 1JZ7A 2QIIA 3F03K 2PWVA 1SR0A 4LBRA 4GI6A 4Y9AA 3OLGA 3NQEA 1SYTA 3O6YX 5KFAA 4J27A 3UY8A 4GUIA 2P0IA 3I6EA 4JV0A 3VCCA 1T96A 1TMHA 1W54A 3DERA 3I10A 4EX4A 3S3GA 2V2DA 2IPFA 3SQSA 4HD5A 5AHMA 4M29A 2GGHA 3UR2A 2VEKA 4WK9A 3ARVA 2ISDA 5HR7A 3MWAA 1E6ZA 2QW5A 4HK5A 1PJ9A 3E96A 3P3BA 1KTCA 3EPNA 1WDDA 3VIIA 1CLVA 7TAAA 3IRSA 1CT5A 1EX5A 2VC9A 2W9MA 5CJNA 3LSCA 4MWAC 3MR6A 4A3QA 2ZYFA 1A80A 1MXDA 5I07A 3U7BA 1FHLA 3ZFHA 3SN4A 4E8GA 2W92A 3RO8A 4AIOA 3HQ1A 1MUWA 2YB1A 5BZAA 3PPGA 2D2HA 3O7UA 1FWFC 3CHVA 3NQAA 4WVXA 2W9CA 4AIEA 5KFZA 4XVEA 1DXEA 4AY8A 2E6YA 3LYEA 4YYCA 2VP8A 4GX8A 3M9OB 4WSHA 2IKJA 1EIXA 2YGYA 4JDBA 4Q32A 5CZJA 3BQ1A 4NY2A 2F2HA 5EDWA 5CBJA 1EB3A 4LF1A 3W28A 2UWFA 3S1GA 2E9LA 3P82A 1UPPA 3A5FA 3RAXA 3KBJA 2GSJA 1YDNA 1A5BA 1GHSA 1XFBA 4B5UA 3RN6A 2EKCA 1A49A 3UWYA 4GQGA 3STPA 4P8XA 2FTYA 4WY0A 4NQ1A 4LNYA 4MAZA 3URQA 2V5KA 3FEQA 3ITOA 4H00A 4GYJA 3RG6A 4GNKB 3GIMA 1B2YA 3NOEA 3AS1A 1Q6OA 3U2OA 3PZMA 5DXYA 3T55A 1K1DA 2Z6IA 3CQHA 3NGJA 4FB7A 2OLHA 1UZ4A 5CZ0A 5KFQA 4XZWA 3N3TA 1FWGC 4QEHA 1AQ0A 1B5TA 2QR6A 5CGMA 2YXOA 1XFCA 3GHTA 1UWQA 4B5XA 1PL9A 1YTDA 2FGZA 3RLVA 3CWHA 4NUWA 2QJGA 1G94A 3RJYA 1TTPA 3WLNA 2PDCA 1LZOA 2OQHA 3JRKA 5LXEA 3B8UA 3GH4A 1JD9A 3CXOA 2Y61A 3FDGA 1VYRA 4GUHA 4M7SA 3DBPA 5FL0A 3V7PA 2AGTA 4WY0F 3T5JA 3VUSA 3WEZA 1TSIA 1E70M 3RLHA 2PA6A 2BQUA 3HBLA 3VGBA 3WJWA 2Z1VA 5H8MA 3KVLA 1EJUC 2P10A 4XO6A 4CNNA 2AKMA 3SQMA 3SW6A 2CZ5A 1UWIA 5FJOA 4RDYA 1RZMA 1PPIA 4CU6A 1R9XA 3GYEA 3VABA 5G1MA 4AG0A 3PG9A 2PI6A 6REQA 4RDVA 3CL6A 4PZVA 3T09A 4CD5A 4F3HA 4NJIA 2YZ5A 2QEZA 4JX4A 3T4CA 5KG7A 1H1ZA 1H63A 4PUWA 3O0KA 4MMWA 1H51A 4PUDA 1HGYA 1XLMA 1FWNA 1PZ2A 2VZOA 3WBAA 4NZ4A 1SMDA 4EYHB 1IEQA 3QEZA 4O3SA 2X1SA 5FSDC 4H3DA 3MZNA 3WH9A 3P0WA 3EDFA 3H2CA 2WO5A 3MBDA 3TE9A 2VTFA 2NWRA 3V5FA 1DIDA 4HPHA 2NQJA 5A69A 2XTKA 3FA4A 4QIUA 4YS1A 4PTWA 9XIMA 3AUOA 3TSMA 2VDIA 3QHNA 1B4KA 3G77A 2A4AA 1ME9A 4KCTA 1ESWA 4LB3A 1A5CA 2DSZA 1MDRA 4FO4A 1OCJA 1JPKA 1K6AA 3H4XA 4RXGA 4K7VA 3QSRA 2GJXB 3DCPA 4DUOA 1OD8A 2Y85A 3AI0A 1VC4A 3SJ3A 1NTHA 4PUMA 5HK4A 3UJSA 3MFIA 1J8VA 3WQ4A 4UFLA 1KM6A 2VQTA 3N1AA 1DJWA 4FS2A 2X1IA 2NUXA 1A50A 2DPEA 5I79A 4GJJA 4I7VA 1WZMA 3A4AA 4RK8A 3TYAA 2JEIA 4ED8A 2PDMA 3FGCB 2F8QA 4Q7IA 4HK6A 1TE1A 3SZ8A 4DELA 1OYAA 1OX4B 3S6TA 4R27A 2Y7DA 4AZ7A 4PCNA 2PRLA 4RNOA 3W25A 4JFTA 2PWGA 1CXFA 4K6AA 4M19A 4IGSA 1XUUA 4PCFA 5C9WA 1GKPA 4BA0A 2IKHA 3U2CA 1LOSA 2WHLA 1Q7MA 1YNYA 4LOCA 4MIMA 1FX6A 1V0NA 2VC7A 3HMCA 1QHZA 3I3EA 3GW3A 2ZKMX 4DJDD 2CEQA 1Q3NA 4O0KA 1GVQA 2PGEA 1UIPA 4MLRA 3E5BA 2VELA 3OZOA 3CMJA 3ZLFA 1GG0A 1UWUA 4TUFA 2V9WA 4ECRA 1YW1A 1F2JA 3CJPA 4JTIA 2X0HA 3AU6A 1PO9A 4D6DA 3L4YA 4FNUA 4CGTA 3PANA 1UKSA 4MDPA 1FWEC 4W87A 2YFNA 4JTQA 1W5QA 1J6OA 2WC3A 4Z0JA 1PKLA 1GZGA 4UOJA 5AYYA 1YMYA 3BAXA 1YX1A 1S2TA 2BHYA 1XS2A 3H70A 1FBAA 2R8IA 4IMEA 1OCQA 2XPKA 2QF8A 4MB4A 2WVVA 2KX9A 1ODZA 3KUMA 2C91A 1MW0A 1H2JA 2A3EA 4H04A 1LT8A 1S46A 2I14A 3T5HA 1GVEA 3E3HA 3BANA 5LHEA 4MWAE 4I9AA 5GPRA 1SU5A 1US0A 1HT6A 4OJYA 4ZODA 4IL0A 3AMGA 2XH7A 2YA2A 2PDNA 4HKPA 3VGGA 1C29A 1OCNA 2E1DA 1QMLA 1CECA 3LGGA 1G4SA 5U4NA 3IIVA 4O4VA 1KRMA 2PC8A 2D20A 4AEFA 1V0MA 8XIMA 2PWDA 1OF6A 1U5VA 3R94A 4FNPA 5GNYA 2HPMA 1TWSA 1PKMA 2A7NA 2HVOA 3STGA 1ME8A 3P0XA 3H8AA 1TUFA 4U2YA 1CPUA 1TZ7A 3F4CA 1RPXA 2OT0A 4RL3A 4QE5A 2OODA 4M6PA 4F0RA 4CU7A 5EWEA 2P76A 3ITLA 2VCCA 4JD4A 1XIIA 3OBAA 4C6IA 1U1UA 3G1SA 4F0LA 4G1KA 4CCDA 2OG9A 1TWWA 4GVHA 4FBTA 4S3DA 5JIPA 3LTYA 3QQ0A 3BCFA 5DBTA 1WXYA 1LQAA 4PEKA 3WLPA 5FAJA 3KCJA 5LXXA 1B0IA 4QBXA 1M7XA 5HJXA 4KMQA 3VZYA 4AY1A 4B92A 4N9CA 1XCFA 4BR1A 3REQA 3TYEA 1TUXA 1B57A 2V69A 1X8FA 3ZSTA 3LXAA 2Y7GA 2Y24A 4HBKA 3THCA 1D7FA 4U2ZA 4B2DA 3TAKA 2PS2A 4UTLA 2PBOA 3RITA 4WKFA 4H9MA 1GPWA 2W9CB 1C7TA 2J7HA 1G67A 4C7FA 4TTUA 4I7UA 3SCPA 1M53A 1E9ZB 4FPSA 1NWTA 3U8GA 1Q7ZA 4RDZA 3AS0A 3WO8A 4C1LA 3VIOA 1EC7A 3TH6A 3WF3A 3LXCA 4UTFA 2J7EA 3UPBA 2ZVIA 1G4PA 2YYTA 3A24A 1H5YA 2ZDSA 3WBYA 5FD0A 5G1TA 1L6FA 4UOZA 3NYZA 2ZUWA 2XWDA 4Y9OA 1VFFA 1Z48A 4DJFD 4WY0B 3RGTA 1W0MA 5BXTA 3PTMA 5AHIA 5K4ZA 3S47A 3LM7A 3V6JA 4AWEA 1JF5A 1VEPA 2CZDA 4JTDA 3MUIA 2FTPA 3S2MA 4RU9A 4UQCA 3W7EA 3CQ0A 3BAJA 3M5YA 3BQ0A 3H53A 3BLKA 2YDRA 4LYRA 1TTJA 4HU4A 5HMFA 3UJRA 3O6DA 2FZBA 2WCGA 1QHOA 2HE8A 5DLGA 1PZ1A 3VKCA 1TJPA 2YDSA 2A1YA 2DUZA 3UPWA 1WKEA 2FTWA 4S3CA 3K4WA 2PWEA 2JE8A 4CCZA 4MADA 1HZYA 1U5HA 3UXAA 4KEMA 1VIWA 2Z1WA 1BVZA 5A8GA 1U5JA 1E4NA 4YR3A 1QVBA 3DI0A 2HMCA 4ZE5A 3NQGA 1C9DA 2FHCA 3SCTA 1D3GA 1LL6A 4TOQA 4EBDA 1J0JA 1OC7A 5LA0A 4N0RA 3R5EA 2G3MA 2O55A 4EXBA 2PP0A 4KFPA 2GSEA 2BVWA 2C79A 4Y6GA 1GQIA 4YCPA 2DJXA 1J01A 3ALGA 3EZ4A 3QC0A 4R33A 4DAFA 1JDDA 3ZR6A 4AWSA 1W37A 1XYFA 4Q4QA 2R8KA 1GHRA 2VGGA 3TXZA 1AUSL 1VBJA 1QW7A 2QF7A 3KRBA 1VPYA 3B97A 3GH5A 2F2KA 4NAFA 1GKRA 5CPSA 1XRVA 5A8OA 4JHOA 3O8AA 1J18A 1OQFA 1OYBA 3L5LA 1HL2A 6REQB 2GUBA 4FXJA 4D6EA 5ABEA 3JS3A 3U4FA 2J47A 1YPFA 1KV5A 1KQZA 3PBYA 4LUSA 3V6KA 5E09A 4PA8A 2EPMX 3GQYA 4LW7A 3W82A 4F8XA 2QDGA 4A29A 2E5DA 4W89A 3MUCA 1EBGA 1Q6LA 1W32A 1UR4A 1JJKA 3LPPA 3FSTA 1GZJA 5HDRA 4FS9A 5KFXA 5AB3A 3NEVA 3VD9A 1QOXA 1XM3A 4RE2A 4RPPA 3TW7A 1QPOA 4AVFA 3SB0A 3S9ZA 3DXIA 3MMTA 2W91A 3W74A 4MY9A 5EY5A 1RPKA 1H60A 3GNOA 3IJQA 4O15A 4HTYA 2VFIA 5I5RA 4Q8QA 3OB8A 3JZUA 5A6KA 1ZL1A 4INFA 2PUZA 3UXIA 3CIVA 2FKPA 1XQKA 2XIMA 4IL2A 1EGVA 2NLYA 3MYOA 3N4AA 2C0HA 3AWNA 5G4WA 3PW4A 3GHRA 2VI0A 3GBDA 4QWBA 1QCWA 3NQMA 3ID7A 1IEVA 4LVAA 1AVAA 1EIBA 4BEQA 3BW4A 2AAAA 3LN3A 3QPZA 3GR7A 5F9NA 2H8XA 3M5ZA 3EDDA 3IGHX 3RJXA 1JDFA 2I9UA 2WJEA 5I78A 2HQAA 2V5JA 3FJ4A 4QDMA 1KGXA 2NVAA 1E55A 2INFA 4O8RA 3U3HA 1WDPA 1BSLA 1TWDA 1NP0A 3O3RA 5LIUX 1AQMA 3U2EA 3BV7A 3WKZA 4H6EA 2W4XA 3UGRA 3VIGA 3STCA 3KOZA 4ERIA 3G1YA 4I5UA 1QI2A 3PTDA 4J3ZA 1TPFA 5I0DA 3NZQA 4W7VA 3NR0A 3TOPA 1W9VA 4IIHA 1FH8A 3DEQA 1NEYA 3CHEA 1GOXA 4LYQA 3KTSA 2QKFA 2ZRXA 4GC7A 3LCGA 4OBRA 2XHYA 3WYZA 2ZWZA 4KWVA 4DI8A 3QTPA 3I6RA 2P88A 1Y5WA 1IEXA 1DIKA 3N34A 3P61A 4JCMA 2WJZA 2WNZA 2ZXQA 1UIOA 3BSGA 1NELA 1UROA 3W7QA 3LCIA 3G5EA 3R43A 1EOMA 3AAMA 3NA8A 1YRRA 3TYBA 3SY8A 3AHZA 2DT2A 1OD0A 4PGLA 3SCUA 2V0TA 3UY7A 4J9PA 1NFBA 1HG3A 1YADA 3L4TA 3JU2A 2OELA 4QWAA 1E4MM 4NNAA 4IP5A 4JIIX 4NZJA 1W56A 2GLKA 3PFRA 2F9RA 3QHOA 4N6EA 2WVVB 1SZRA 3GTNA 4W84A 1J2WA 3N2CA 4E3TA 4ECSA 4RPQA 5K9CA 4HPGA 1SO5A 4BKNA 1FP8A 2R8WA 2J6UA 2DY3A 4FX8A 1PIIA 2FVLA 3LHVA 3LG3A 1SO3A 4BF5A 5L1LA 1I60A 2BGSA 1I2NA 3ARRA 1J0YA 3CHCA 4LAZA 2R1MA 3DG6A 2GDUA 3SUUA 3G1FA 3TN5A 4F40A 1BRLA 2BZNA 1XD1A 4WGHA 1Z7AA 3D0CA 1CGYA 1AQFA 1E6SM 5GNXA 2VR4A 1KR1A 3TTYA 1KBBA 1M7PA 4O1DA 1EUNA 1WPCA 2WTFA 2DZUA 3B06A 4M51A 3B9OA 4WIWA 3WUEA 4IFRA 1PUDA 4DQWA 4WXZA 5IBXA 3L0KA 2IQDA 1R8LA 3V1HA 1RBLA 4R3UA 5EWFA 3WJXA 4Q44A 4LBSA 3QJAA 4N7QA 4R7WA 5CEWA 2QHAA 2Z1SA 2UVWA 5A6SA 3ABQA 5BRQA 1AA1B 4MSSA 4GI4A 3V16A 1SO6A 1NARA 2E77A 3PZQA 4PTDA 2GVYA 3FX4A 4P2VA 1PDYA 1GWJA 3APTA 4ZTYA 3M0YA 1Q6QA 3TJLA 2XINA 3H2NA 1K4GA 3REQB 4UB9A 4ES4A 2DIKA 5KFFA 4GH3A 3TC3A 4GI8A 4ZO9A 3EWWA 4XZ9A 4ED0A 5CSRA 4DUVA 1UKTA 2ISSA 3QQWA 5F4XA 3A9IA 3S42A 3CH0A 4LCQA 3B4YA 4EWND 4MG4A 3PW5A 3BV4A 1BAGA 1RJPA 4GJ1A 1AMYA 1XSKA 3ZJKA 3SQLA 3BGGA 3AU2A 2FVKA 1TV2A 4CVWA 4HU3A 4C6EA 2YCKX 4ZGYA 3CT2A 2FH6A 2ZOXA 3KTXA 1I45A 4ZOEA 1NWRA 1UP2A 1XLIA 2HXTA 3V4BA 3NPVA 3QKZA 3IACA 3TC7A 4LC6A 4M5PA 4UR7A 1A5UA 1JQXA 4AU0A 3SO7A 4CN6A 1NY1A 3GX9A 5F2LA 3BE7A 3OP2A 2FLIA 5FEZA 1CGXA 5RUBA 4H4IA 4K7YA 3WH7A 4XBSA 1UPMB 1G69A 4LS0A 2VX4A 4EPKA 3DKJA 3GXIA 5G2IA 1XIJA 1HO1A 3E2VA 3UZYA 4JFVA 3EDKA 4AZGA 3EXSA 5IRPA 2OB3A 1TV8A 3SJNA 2Z28A 1CZ1A 3M44A 1L8NA 3GXDA 1CI1A 5JBDA 3RX2A 1KXTA 1KFKA 4CD7A 2QLYA 3L0NA 1V0LA 2H3DA 2X40A 3EOUA 1JAKA 2FGLA 5TBOA 2DQWA 1WXJA 5EKYA 1PTGA 5A2AA 4Q7NA 2J9YA 6PTDA 2J9XA 3QY8A 1QPNA 1YE6A 3ITVA 4HA3A 3MO7A 2E67A 4PL2A 1KM3A 3AIBA 2QPSA 3MCNA 1W1VA 1X1NA 3G6LA 3K1GA 5EGRA 4C7GA 2C13A 3ZYZA 3CB8A 4TV5A 1OBAA 3V36A 1ZJIA 3D46A 1PEZA 4D6CA 1PSCA 3WD0A 4NAFB 3A5VA 3A47A 3R4IA 5FA5A 3NAVA 2ISVA 3IEBA 1VRDA 1X98A 2EPKX 1TV3A 3OQEA 2BR0A 3RILA 3PWIA 1EP3A 3QY7A 4YNGA 1KCXA 1JRBA 2ZTJA 2D24A 1WA3A 2WVSA 3G1XA 2E09A 4Q4MA 3SRKA 4LUSB 4LCSA 3U9IA 3W83A 3PUOA 4BY3A 4ECVA 1VCGA 3FFSA 3DOPA 3FJLA 2QCFA 1Q85A 5AC6A 3PBVA 3H2OA 3N2BA 4UNLA 1GW1A 5HNTA 1LRTA 2YBTA 2I57A 3APGA 1VBGA 2P3ZA 3NL6A 3NPUA 1QBAA 3PF3A 5EMLA 1ADSA 3AIRA 4B5WA 3KX6A 1KTNA 1F73A 4QG6A 3KL3A 4J9OA 4ZXLA 3E02A 3TCEA 4IX2A 1TV4A 5D09A 1XISA 4AAJA 3CV2A 2OGYA 3H2MA 4ATWA 1C8QA 3EDEA 4GG9A 4KGLA 1I1XA 2GQ8A 2OLAA 5DEZA 4MWAD 3RXZA 3WY1A 1XG4A 3OVQA 3OZYA 2EJ1A 2Y8KA 5LA2A 2QUMA 5C7VA 3DG3A 1D8WA 3O1NA 2Y88A 2QDHA 4JTEA 4YVVA 3PZNA 2D2GA 1U1HA 4BQ4A 2ESCA 5EU9A 2XVNA 2ZA2A 1OFQA 3AIVA 3DG7A 1TTIA 4OV4A 3WLKX 1ODUA 5LGZA 3QV9A 1H7RA 3BLEA 3G18A 4QNEA 4UTHA 4DL4A 1ZCOA 2FB3A 3UZZA 2GDVA 4PMDA 1OFEA 1QUMA 5B7ZA 2DT3A 5I06A 1THFD 2BP1A 1I2PA 3T1GA 2ICSA 1M5WA 2E6FA 2ZDRA 2WZIA 4QEEA 3VCNA 3VINA 3QZEA 2D3NA 1K8XA 3IGSA 1L6WA 2Y5JA 3ARQA 1VQTA 3GYCA 2AL1A 2G96A 1OFRA 2ALZA 4G2DA 3E1F1 2GFTA 3NIYA 1SJAA 2C1GA 1XIFA 3S1WA 4JNZA 5KFJA 2BFGA 2X1UA 4JNMA 1P6BA 4Q8VA 1O12A 1ECEA 2B31A 2OTDA 3ATZA 3XISA 2DW7A 4UQDA 1GOIA 4AZ6A 3VOJA 1HN1A 2C3ZA 2DVTA 4V1YA 3MDWA 2BOEX 4HMDA 4AWTA 4YLWA 3RPMA 2AQ4A 3MQTA 4X9SA 1ISZA 3CO4A 3F7JA 3MSGA 2A5HA 2JFEX 5A8PA 2FDMA 3EMZA 2C16A 2V2HA 4IPJA 4B3KA 3BLDA 4O3OA 4HHMA 1TRDA 5MHBA 3H4BA 5DCDA 3QV8A 1LOLA 2V3GA 2J8FA 2IS7A 2Q3OA 3SSJA 4ML4A 1GYNA 1GQNA 1KM0A 3W6YA 3VDBA 1NWUA 2SFPA 4GA8A 3W1TA 3QZ7A 3CYVA 3DX5A 5GVJA 2CBUA 2A3CA 2PLKA 1JZ3A 4G8TA 1PHQA 3BOLA 1ML1A 3UG3A 1M1BA 1R5YA 2C18A 3GNDA 4UOQA 3FHQA 4LB4A 3N19B 2FDSA 4E2OA 3QR0A 5SWUA 3BAYA 4WDWA 4ROQA 1OM0A 2BODX 3MBFA 3T07A 1QNVA 2W79A 1HKJA 3V0UA 3O9NA 1LROA 3VXGA 3THAA 1LWJA 1GVYA 1MUCA 5F2IA 3WF4A 5HMSA 4Z2HA 4JY9A 2JGQA 3SRFA 1CLKA 3QZ8A 3SI8A 1EGZA 1D3HA 3UBPC 1UH3A 3MMWA 1ZBVA 3KLLA 2J7CA 2V3FA 2KAUC 2Q71A 4NIRA 1W91A 1W3TA 2ASHA 1LLOA 4C65A 3A13A 4Y96A 2RDJA 2PP3A 1BRLB 5KG2A 1YBQA 2OFJA 2F84A 3VZZA 1NJJA 3RCNA 2CCRA 1V6TA 4AZBA 5DMNA 1WDQA 4GY7A 4X0VA 2EF9A 1UP3A 3LD5A 2DPIA 1QWKA 2V63A 4D1IA 3AMLA 3SY5A 1Z9AA 2PF0A 4EBCA 1ISWA 2FMOA 4RV3A 2PE4A 4ED3A 1H3GA 5D9NA 3HPXA 3WMSA 1XG3A 5AHEA 1DE6A 2I9EA 2YXXA 3RNDA 1A5AA 2Y63A 4GY0A 4DJEC 5D8WA 1K7FA 4F0SA 3NPWA 2J66A 3UVAA 4D72A 4MJMA 4PTXA 3WQ5A 4EF8A 2V67A 4MHBA 1ISYA 5A6BD 1S9FA 3ARWA 3JZEA 2YDQA 4UQBA 5F7UA 2X7WA 3M6YA 5CBBA 3DYPA 3R8GA 1J0HA 2A3LA 2UY3A 3LZ3A 2ZRYA 4RNHA 1M6JA 1LUCA 3EB2A 3G6YA 4UWMA 3W7KA 2R14A 1X7IA 1XLJA 3LHZA 1NF7A 2OJPA 2PZ0A 1VYSX 3W6MA 4Q8NA 4AISA 2GQ9A 2O0TA 1EA9C 2CU0A 4JL2A 4V1XA 3LK6A 3K8LA 2GWNA 1QK0A 4XSMA 3PR5B 2QUUA 4HU0A 4GGHA 4QR6A 3KTCA 3SUSA 3AISA 1E56A 3TP4A 3UWWA 4HNCA 3HG3A 2C14A 1S2CA 8CGTA 2JEPA 4R53A 3NGDA 5AVHA 1NWSA 5KFYA 2WZEA 1MZRA 3ZWSA 5CC5A 1EH9A 1UUQA 3CWNA 2CERA 3WQPA 1HJWA 1OZQA 5LSMA 1ELSA 1GOOA 2PD9A 2YX0A 2DVUA 5EBAA 4Z1DA 4MZYA 3ONBA 4IMCA 1D2KA 1GVIA 3WIJA 4QQUA 1KFWA 2NT1A 3VC6A 1R3YA 2BXVA 1DPMA 4JTGA 4AQLA 5EMMA 3SRDA 1KV8A 3WD3A 3LEPA 4D6IA 1BG9A 4QP0A 4FF5A 2DZWA 2PGRA 1Z32X 4J3XA 3D5HA 3EXTA 4JYFA 5XINA 3M16A 3M43A 1LL4A 1GOKA 1GYMA 4GUGA 1XBXA 1KBKA 4U3CA 1KKRA 3GKFA 3BG5A 3G3MA 4M0XA 3GS6A 3RBEA 1TWIA 6CGTA 2E5CA 2OO0A 4J9KA 3VTRA 3PFMA 1J10A 1ZFJA 3G0XA 3DUGA 3MP5A 1KW1A 1LYXA 1E71M 1W1ZA 4QFUA 1S0OA 4DYKA 3IAQA 4CU8A 1EHAA 3Q4DA 3ZR5A 1GCYA 3WJYA 1PKYA 2B7NA 2YL5A 3BLFA 3KCLA 4ZOBA 2BXYA 1W9BM 4LNCA 4YIWA 4L65A 3R12A 1NDYA 1UD6A 3MWCA 3DESA 3WZ0E 2VGBA 1EWEA 1LG2A 4EAMA 2VEMA 3RU8X 1GEHA 1CXEA 2EG8A 5KG1A 3CPGA 1BLIA 1AD4A 3R79A 2W6RA 4O11A 3KWSA 7XIMA 4IQJA 2ISFA 4KEZA 3WFAA 3W76A 4C6DA 2A3AA 2WC4A 5HANA 5A6AA 2J25A 1VKFA 1SFSA 2HROA 3TSBA 4YYFA 1C91A 1R30A 2FZDA 2XGIA 1F5ZA 1A5SA 3GVRA 1NDWA 2ZXAA 2QCEA 4WHBA 1XYZA 5KT4A 4HT3A 3UWUA 1M3UA 5BOFA 2ZZ6A 3DGBA 3TQKA 3ZT7A 2IPJA 2EXOA 2QJJA 2EG6A 4BCEA 3EEZA 4AD4A 4CVUA 5CPMA 5ENLA 3W27A 1V03A 1QTWA 2BG5A 2AQVA 4I5RA 4JTKA 4CNOA 1W1YA 2UY4A 1V3HA 2V5CA 3M0IA 3H6OA 4DXXA 3T05A 3WSUA 1R3QA 5FJPA 2FQIA 4DN1A 1P43A 3W1QA 2OYLA 1MW1A 2CKRA 3AHYA 2HTMA 1IV8A 5REQA 4LYKA 3F2BA 1PE1A 3QYQA 2C0AA 2DORA 2XN0A 3GTIA 1WOBA 4TV6A 2D2JA 3TTEA 3MMDA 1XH0A 1EOKA 4NP7A 3C2EA 1YXDA 2XH4A 1ZS2A 3WFZA 3K8MA 4B16A 1U83A 5D05A 1A0DA 3FXYA 1XH1A 4O1AA 2ZADA 4E0CA 1HJQA 4E4PA 1QK2A 4AX6A 1P0KA 4IXHA 3GZ3A 2O9RA 4R8UA 3IIXA 4DBWA 2V8ZA 3L2LA 4K3ZA 1VLWA 1POJA 5G2WA 4LALA 3NVDA 3BUVA 4F9JA 2I56A 4E5TA 4TVDA 2CC0A 3IJDA 2J75A 2QCNA 3G6VA 1ISVA 4TMBA 1F3TA 4FNRA 3W1AA 3DFYA 1K77A 4O14A 3RPTA 2NV1A 3NM1A 3N13A 5C0QA 1S3HA 2UBPC 1QAPA 3EWCA 1GNXA 3H26A 5I23A 4F4RA 1N8WA 2PTDA 3OG3A 1PB0A 1O66A 3NXLA 4QRNA 2R8JA 3AZRA 4H9YA 3KHHA 4E2BA 2V38A 3OHIA 4PMZA 5TIMA 4P5UA 3HIJA 3TV8A 4JTAA 2HS6A 4NYYA 4ZFMA 2J7GA 3AMKA 2AMXA 3DENA 2B4GA 2WSKA 3T0TA 2YSWA 1IXQA 2Z1BA 3K46A 1DIOA 2XCAA 3NFUA 2GGIA 4JTLA 4JQ1A 2J88A 4D6JA 5CSUA 4CQAA 3QOKA 2QULA 4DZHA 3WBXA 3GFYA 4ZQNA 2AGPA 5K9XA 1A3HA 2CKSA 3CZLA 5LNVA 3WF1A 2HEJA 1FCBA 1UR2A 3CWOX 3LCFA 3WD4A 4F0HA 4PMJA 1EP2A 4BI7A 2XGBA 4KWOA 5G2HA 2XVKA 4GQ0A 3WDJA 3QV7A 1MEHA 1BPLB 3P60A 1R6WA 1UP0A 4C6OA 1V02A 2BASA 1EJ7L 4L1GA 3KBVA 3PVFA 2FLPA 3E0LA 1LQ2A 1TX0A 3CL8A 4RDWA 1EO5A 3OHBA 1DJHA 1GTHA 1R3VA 4MM1A 3DFOA 1B90A 5KT5A 3N15A 4E3VA 2NX3A 3B9EA 4QX4A 4UFHA 1J96A 1KRBC 1VIZA 3BAIA 1MEIA 3KRUA 3VK5A 1K8ZA 4H9ZA 1YBQB 3UA4A 3CBWA 4TIMA 2WM1A 1JZ5A 1MDLA 3M64A 1P0BA 2DZAA 4OBTA 3LUTA 3GR4A 2WW5A 2BMBA 1H5VA 1MXSA 4RUBA 1JCTA 3TMLA 1QU4A 4CEXC 4MJ4A 3MR5A 3MW7A 1UWAA 2CITA 1BD0A 1K7XA 3FAWA 4DJDA 1IIGA 4NASA 3WNOA 2QVHA 3NDOA 4HSHA 3NL3A 3PSWA 3BQ5A 4IMGA 5DN1A 3P2VA 3GXFA 1RAKA 3AYTA 4KCWA 5DFAA 3HFTA 1KFLA 3CAQA 3P81A 1WZLA 2BGNE 4YHGA 1BTCA 5TD4A 3LGEA 4XAFA 3K13A 3UG8A 2PF8A 4H83A 5AHFA 1SJDA 4UTJA 1TPUA 4MJZA 2GGEA 3TX9A 3U5YA 2DZVA 2OLSA 2CXEA 1ONEA 5D9OA 5D2VA 4HPXA 2PDIA 1LUCB 3ZLGA 4IHCA 3IANA 5L9FA 4YVXA 3AXIA 4UMAA 5AHLA 3N6JA 2ZRVA 4XBKA 3PJWA 2YA0A 1JYNA 1PYMA 4GIAA 4DL3A 3RIKA 3QN3A 1SMAA 2YL9A 5DY3A 5A8MA 4XG1A 1PHWA 4I8DA 1FVPA 4KWUA 1DWFM 4X9YA 1TELA 3G3DA 1E6RA 3ITYA 3UFYA 4LQ1A 4AD0A 2W62A 2OT1A 2FHBA 1KRCC 5C71A 3DU0A 4GYPC 1B3YA 1MFVA 4FK9A 2OR2A 3MKKA 1RLCL 1LOQA 4YCOA 3OSPA 4J3UA 4BF7A 3UXLA 3WQEA 3BZGA 4R88A 4AW7A 1UKOA 4XIMA 1RK5A 2QDDA 3II1A 1KD0A 1WP6A 3TDFA 1LDCA 3MO4A 3A64A 4YPJA 4LY8A 5HATA 5AN7A 1XYAA 5BRPA 4H6KA 5I02A 3T0BA 4YL2A 2YB4A 3LMYA 1L2UA 4QCEA 1IZKA 4KFNA 1UZ1A 1L6YA 1ITXA 3T44A 2Z1XA 1S2AA 4O3PA 4MPKA 5GJMA 4O3NA 4KCVA 1G1YA 3T0CA 1JDAA 1VBRA 2WMIA 3AMDA 5HAOA 3W7CA 4A3UA 2GZXA 3NJ3A 1V79A 2JF7A 5DCBA 1XIEA 3UXDA 3M0HA 3HJZA 3ZLHA 1HJSA 3URAA 2XSBA 4QAIA 3ANUA 4UZSA 3MHUA 4MGGA 1XH2A 1O7AA 1FCQA 1QR7A 3Q2DA 3FDKA 3FCPA 2GJRA 2ZXDA 2Q8LA 2UY2A 2Z00A 2VCAA 4KF1A 3ZVIA 1R85A 3W37A 1Z44A 1G4EA 3B0YA 3HURA 3S0CA 1XWYA 3ERPA 2JEJA 1PX3A 4LS1A 3Q67A 4DBDA 3JVAA 2NV2A 2PZNA 4UBPC 1RK6A 1JUBA 1FTXA 1BGAA 1R3WA 2PURA 3W02A 2CNCA 3EMQA 4FF7A 2XZ7A 1RP8A 3SSZA 3P93A 1BYAA 1W3IA 1OG6A 3E2RA 3M4HA 1DJXA 5G1YA 1ZAJA 3P84A 4K36A 3PPFA 2WJFA 1TPH1 3IV3A 5CJMA 1PS9A 2A6LA 3TSDA 1PZ3A 5KFRA 4BJHA 4DJFA 1F07A 2C71A 3CEUA 3TAOA 1QI4A 4WUIA 5T91A 3VD3A 5A6TC 2WBGA 3KS5A 3VGFA 3ZO9A 3TN4A 1XCXA 2GVGA 3AIEA 3KS6A 2FPYA 4AYGA 1EWDA 3TYCA 4QS6A 4O17A 1QW8A 2O9TA 5A94A 7TIMA 3ENLA 4QJ3B 5HMEA 1T40A 6XIAA 3L0GA 3BWWA 4EPDC 3HM7A 3OGSA 2XGPA 4ZSTA 1QW9A 2BVDA 3WLOA 2VFDA 3C4UA 1WKYA 1CW2A 1F3WA 3LPFA 2QJNA 2AU0A 1Q6RA 3I65A 3C8NA 1JI2A 3H55A 2Z6JA 4DWSD 1E72M 4WJEA 4ERAA 5KFUA 1YDVA 1ZLPA 1SVDA 1XIBA 4H9TA 3WLQA 1DBTA 1RBOB 4XZBA 1QI3A 2H3BA 3HG2A 4O8AA 5KFGA 3GU1A 1X8CA 1P5BA 1T8XA 4OIFA 3MJMA 3KW3A 3IJIA 4W8BA 4R8UB 3DFQA 5H1WA 1V5XA 3TNOA 3CUXA 1BYBA 5E0CA 4NF7A 3BURA 1BEUA 1EJTC 2J6TA 1ZBWA 4TMCA 1WB0A 1B3XA 3N04A 1VPQA 1XLDA 5KMYA 3ZS4A 3RX3A 1KXVA 5AECA 1JGMA 3NO1A 4Z2KA 4EAYA 4QJ4B 2YCEA 3ABOA 4B3LA 4MLJA 1XGDA 1VS1A 5HWNA 1RQHA 4GQRA 4JX5A 2VC5A 3HGRA 4H2HA 2JKAA 2EPLX 1FH9A 3OZPA 2G50A 2NQLA 2XFRA 3N9RA 1E6XM 3KL5A 5FJJA 3I7SA 5KT7A 3VMOA 1EJRC 4XX6A 4QTGA 1TPEA 1VFMA 3SY1A 5JQ9A 1XLAA 3GHSA 3ZJ8A 5DBUA 3B9NA 2BY0A 4CQDA 1XYLA 3BCDA 2WMGA 1Q6DA 3OSNA 1B54A 3TK7A 3GQCA 3LBMA 5JH2A 3CZEA 2Z7KA 3S6DA 2BVYA 3B8DA 4FR6A 5TQLA 3HQNA 6ALDA 1SZGA 1R87A 2O9OA 1E51A 1JRCA 3MSRA 3W1NA 4XWUA 4FS1A 4U31A 3M0KA 1A5OC 1UZDA 3GVWA 5EMUA 4Y8FA 1ZETA 2O4MA 4JIRA 1XINA 4DO6A 3N29A 1HVQA 5LGXA 1Z6KA 2DJLA 1E9YB 3RB6A 2WHKA 2XZ9A 2CBIA 1R9ZA 2Z24A 4HZ6A 3NPXA 4TQTA 3GXTA 5JVLA 3SIZA 2J62A 1ITQA 1OK6A 3H4GA 1F4HA 3W73A 3BJSA 2ZZ4A 1LRQA 4WZHA 2OPJA 1Y65A 1O5XA 3RMEA 3VNLA 1Q65A 3M0VA 2WZHA 1ZJBA 3L21A 3ZJ6A 2ABBA 5KFVA 2XDFA 1EO7A 3EX3A 3EX6A 1FWIC 2W7PA 4XUYA 3TW9A 3TROA 4QDPA 4FNQA 4NX0A 4NRRA 3UYIA 3ONCA 4NJJA 4MPQA 2QCLA 1WUEA 3VOCA 4EACA 2GVLA 1UR0A 5ECUA 1OADA 3B4UA 5EL1A 2YYUA 2FIQA 3VYLA 2WMFA 4KIRA 4NSBA 2Z29A 5DG7A 3VZXA 4BQ2A 1W9UA 2XISA 5FEXA 4K39A 3HGOA 2WV8A 2CBVA 3SCRA 2HK0A 1AK5A 1RHCA 2Z1KA 3THQA 2VKZG 1US3A 4O10A 2QQ6A 3G1DA 5EA9A 1XPGA 4AH7A 4EPBC 1XIGA 1MZHA 4JIEA 4AZCA 2VUNA 2XJ7A 4N4QA 2EGZA 3W23A 3WN6A 3QXBA 2PTXA 4O19A 3GVVA 2VEFA 3CUJA 3UJ2A 1DE5A 2RDXA 2PB1A 3SN0A 1VPXA 4U3AA 2BQRA 4X2PA 3UETA 1V08A 4GH1A 3PW7A 4A8IA 1ZJAA 3WK0A 1P4CA 1LLZA 3H7VA 3CUZA 1DEDA 4LEFA 3NQ8A 4XBJA 4G7FA 5D32A 2VZUA 3PAJA 4IF2A 3CC1A 2YIHA 2VZVA 3HA1A 4KERA 2IBKA 4PUJA 5CZKA 4PUUA 4EE9A 2VCBA 3QVQA 4AHPA 3GK0A 5I24A 5EPDA 1ADOA 2VGFA 1R2TA 3V5OA 3TVAA 2R1KA 1SZNA 3CL7A 4BWLC 1KM2A 2C8NA 1UUOA 2OWWA 3W7MA 4AFYA 3AICA 1T7LA 2DH2A 1OCBA 2XGZA 4B4FA 2WMIB 5DXXA 4ZL1A 5I03A 3CEPA 3G1HA 3NOYA 3LI1A 4JIQA 5CPOA 1ZP3A 2DDXA 3VMNA 5E6ZA 4GC3A 2PRMA 1LBLA 1ONRA 3CGTA 1F05A 1DHPA 3NQBA 4C6KA 4UC5A 1FWRA 3VI2A 2JF6A 1J79A 3NUKA 3LPGA 3WEMA 3MUY1 1FWSA 2Y62A 3ABXA 4Q4OA 1KM4A 4JNYA 4DNHA 2H8ZA 1UBPC 5H8UA 4U28A 1RVGA 2WXDM 5CC7A 1MO0A 4DPPA 1SR9A 4G9PA 3KLKA 3CT7A 3KP0A 1SQ7A 4IQLA 2VQUA 1ZGDA 1MW2A 2AGOA 5DMLA 3VU2A 3WD2A 4AIUA 4WJ8A 4O28A 2BOGX 2F6UA 2RDUA 4ZENA 3W2LA 4IJRA 4R34A 3KHLA 4WX2A 1DJZA 1TMLA 4Q8WA 2Y2WA 2P3EA 3W38A 1UH2A 4AD5A 2W9BA 3O07A 3LGDA 1VGAA 4LVGA 5IDZA 1JUKA 3ZVHA 2Y4SA 2X1RA 2D23A 1OHLA 2VHLA 1UC5A 1C90A 4XZLX 2C1HA 1GQKA 3H21A 1UD4A 3S6OA 4DJED 1EEPA 1R86A 4TXEA 2Q8XA 1AW1A 1XPYA 1K7EA 4HN4A 3UVIA 1EX1A 1UWTA 5KFKA 3PULA 1VFLA 4DI9A 2VMFA 1W9XA 1V3IA 3TEVA 5A5WA 4I90A 4GQQA 1NSJA 4S38A 3WMBA 3T4WA 1UR8A 1B1YA 3SGZA 1GVSA 4KBXA 4M6VA 3HZ3A 1VFUA 1VLIA 4OUEA 4TQSA 4A8LA 4I9TA 1H09A 5DMMA 3W3OA 1E1FA 4WRHA 1PDZA 4AXNA 1M04A 2VGIA 2V81A 1OFAA 3O05A 2O7SA 4MUPA 2PU1A 3MYPA 2FZMA 3WNKA 2NSXA 2JK2A 3KBNA 1QASA 2PCEA 3AALA 2J79A 1QI0A 1OJXA 1CXIA 1HW6A 3UJFA 2QAPA 3EOOA 2D3LA 2VVNA 3L5AA 4XTDA 1A3WA 3CLWA 4UFJA 2YR1A 1LJYA 4LXFA 1GVFA 2Q09A 3NCOA 2W8LA 1FOBA 1I8JA 1BQCA 1P6WA 1UD3A 4ZTXA 3L65A 3R2GA 4EVZA 4MYXA 3ABSA 2J7BA 3A9BA 4PCSA 2Y1HA 1PCWA 1CGUA 4JQ3A 1PYFA 3AZTA 4OKDA 4IP7A 1S2WA 1AW5A 3LX9A 3UJEA 3W1XA 4ZB2A 2A3HA 4LPCA 1K1QA 2HBVA 2VX7A 4CN1A 3T9PA 2Z2BA 4O3RA 3C2RA 3O0FA 3MHFA 1IGSA 2INZA 4S3GA 2D2OA 1MQRA 4KKXA 3NDZA 3CIWA 2AKZA 2FB2A 1WO2A 4R7JA 4NI3A 3GC4A 3WQVA 3B04A 2BX7A 2ZZ3A 3ZZ1A 4JIHA 3PBWA 1XLKA 1KGUA 1WDSA 2OX4A 1GPFA 4RZRA 5AKQA 4RNMA 2W9AA 1TPVA 3C86A 5A95A 1AQHA 1A5LC 1O1HA 3GG8A 4MWAA 5DG8A 4KS0A 4IR1A 1DXFA 4WXYA 9XIAA 3KVJA 4X2RA 5HWMA 2C1IA 4OVXA 1RD6A 1OYCA 3HG4A 4ENLA 1JQVA 3WQ6A 2B0MA 3POHA 1P6CA 4ECTA 4HA0A 1CNVA 4C1KA 5KSWA 1YNPA 1F61A 2J77A 1HQTA 1O5KA 4F66A 1B31A 3TWBA 2I16A 4Y9NA 5ABGA 4F48A 3UU0A 3QTGA 5D02A 3GG7A 5CPNA 1JYVA 5F2GA 4KW2A 4O1EA 2J13A 1UOZA 3KRZA 1JIHA 2E8ZA 2ABAA 2FH8A 8TIMA 7REQA 3APYA 1TO3A 3QGVA 1E5JA 1CXLA 3NQVA 4ADSA 3MR2A 4YR2A 3LNPA 4QQ3A 2GGJA 4PRWA 4ZOCA 1F6KA 3Q45A 4UTTA 3CAVA 1IZCA 4FIRA 3E2SA 3IJ8A 2RUSA 3WQGA 2VL4A 2R94A 3GIQA 3W1PA 2OEKA 2Y5SA 3TR2A 1DQXA 2D0GA 1TIMA 2RGMA 1XHGA 5C6MA 4IR9A 1XC4A 2OZ0A 2VURA 1GGOA 2G4JA 1LF1A 2Y7FA 4PE8A 1J4EA 4FLOA 2WMJA 4X3ZA 3RRXA 4QCFA 4DVOA 3ANVA 4MFEA 4ADUA 1TJ1A 1EKOA 1LWIA 4M7TA 4WLCA 4EXQA 3N2OA 2ZA1A 1SJBA 2ALDA 4IPIA 3OIHA 4IIEA 4NILA 4GC4A 1RCOB 2NUWA 2IPGA 4IRCA 4QJ1A 4R85A 1NQ6A 4ED2A 1RA5A 2WB5A 4D6FA 5J5DA 3CAKA 5HXMA 2PDKA 4IIBA 3IWPA 2VT0A 4OFCA 4KESA 5D37A 5E0KA 5HWJA 3E38A 1V3JA 3TQ0A 3W7PA 4O52A 4RX0A 4LX4A 1X6LA 3DFTA 2I5IA 3TXVA 5DCEA 2PEVA 4JV2A 3DGRA 5HOSA 5E9AA 3QHMA 4CNPA 4V15A 4CLMA 1HP4A 3T2OA 4PFHA 3VKKA 5M5DA 4U5KA 1US2A 1VYPX 1F8IA 3W85A 4E2DA 2PD5A 2GUUA 4O4WA 4IMDA 4CQ9A 1XLHA 4W7UA 4XTIA 1BXBA 3U4AA 1UJPA 1REQA 3T8QA 5IHRA 1JZ6A 1VEOA 2VA2A 4KT2A 3NDYA 5C7HA 2PFHA 1JDEA 3GGMA 3OA3A 1YIXA 2CLKA 1E0WA 4IX0A 4P61A 2BY3A 2G0WA 4GGBA 3CUGA 4FIQA 3F4DA 4Y2WA 1C9WA 2PDJA 3WMCA 3CIXA 1XCWA 2O7QA 2P1FA 4DO7A 2QCGA 5ABHA 5ABFA 1LP6A 4M24A 4C6PA 1KGWA 3TC6A 3ELFA 1EXBA 1RJQA 4S23A 2PDXA 2PGFA 4FXSA 1R7AA 1WOAA 1LWHA 1TCMA 4C7DA 1W8SA 5BU9A 2Z25A 5KG6A 1ZU8A 2GOUA 3USZA 3KRSA 5A6BA 3GU2A 4Q8TA 5DQIA 4TX8A 3QPYA 4M1BA 1HKVA 4LANA 3EB3A 4E4FA 4HZMA 4GACA 4HJFA 4YTQA 1D9EA 1ZBCA 3L68A 3EOSA 4JN8A 1BQGA 1UKQA 4DRSA 5G4EA 4A8RA 2V82A 5A6JA 1O4UA 4QXIA 3UZXA 1H0IA 1QI5A 3QM3A 2PPGA 1A3XA 2BY1A 1XBZA 4ZO8A 1Z69A 5CQ1A 2JEFA 3FN9A 4MJ2A 3M6DA 3ZVHB 1M65A 1JZ8A 5HNRA 2F61A 2OKOA 3CZ8A 3R1ZA 3R25A 2HXUA 1DTUA 4UFKA 4MUZA 5GQBA 2WZTA 1OF8A 1UYQA 3CV1A 2P53A 2CZVA 1OFDA 4JTUA 1UMYA 1CYGA 2WVUA 1OSEA 3VKDA 4JTHA 2J8GA 4QNWA 3LTSA 3WX7A 3EA2A 3W84A 4NVTA 4ATDA 2HV5A 2V68A 5KZ6A 1RY8A 1IE7C 1B3ZA 5GJNA 1FWCC 2LLEA 2AL2A 4GNVA 1AZ1A 1XLBA 2E6AA 2HK1A 3GNNA 5DF0A 3IJ9A 1JCYA 1L8PA 1TQXA 1DYSA 3VPLA 3ARPA 3LCXA 5KG5A 1SUXA 3VNKA 2HNEA 4MVAA 3T2QA 5A8NA