1XRTA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
422
structure length
369
Chain Sequence
MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLEDRLALIEGVKRGIIDCFATDHAPHQTGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 137
structure length 369
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrtA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrtA02
4XD3A 2QT3A 1HZYA 1EJSC 4RZBA 2R1KA 4PBFA 3E0LA 4CQBA 2IMRA 2FVKA 1FWBC 1A5KC 4F0LA 3HM7A 1V79A 4ICMA 1RJQA 3MVIA 3UF9A 1KCXA 4J2MA 4EPKA 1FWAC 3DUGA 3A3XA 4IFKA 3F4DA 2YB4A 1A5NC 2AQOA 1M65A 3SO7A 4RDYA 1UBPC 3OQEA 2VC5A 3MJMA 3LGDA 3OU8A 2R1LA 2Z27A 3GG7A 3K5XA 3ORWA 3E2VA 4XAGA 4QROA 2PAJA 4IFKB 2OOFA 3IPWA 4RDZA 3TNBA 1XGEA 1RAKA 4DZIA 3B0XA 4E3TA 1I0BA 2FVMA 3TN3A 2QVNA 4INFA 4GXWA 2KAUC 4F0SA 2YZ5A 2R1MA 2W9MA 1EJRC 2BB0A 3URNA 4IG2A 5HMDA 4RDVA 1EF2A 1PTAA 3TN4A 4PCPA 1V77A 3GU2A 4ERAA 1FWJC 3B0YA 4GBDA 3UR5A 1FWIC 1A5MC 3SFWA 2VC7A 2HQAA 4XAZA 2ADAA 2GWGA 1FWEC 4IG2B 2OGJA 2HBXA 1V51A 1K1DA 4HK5A 4AQLA 2VR2A 2P50A 4H00A 4HK6A 3S2MA 1EJUC 3DCPA 4KIRA 3MVTA 1RA0A 1A5OC 4GOAA 4XAFA 1QW7A 1XRFA 1R9XA 1YMYA 4C6DA 2RAGA 4HK7A 3K4WA 2Z00A 3NURA 3LU2A 1DPMA 3ITCA 4C6KA 3N2CA 4GY7A 1J6PA 4ZSTA 4RDWA 3AU6A 1EJTC 4KQNA 3KM8A 4WHBA 3EWDA 4H9XA 4XAYA 2AQVA 4H9UA 5E5CA 4C6IA 1S3TC 3UBPC 1KRAC 4H9TA 4BKNA 4QS6A 3T8LA 3GTIA 4V1XA 3LSCA 4PE8A 4PBEA 4G7EA 2Z28A 3T81A 3PNZA 3PNUA 1EJVC 3GU1A 4V1YA 2GOKA 2QPXA 3URBA 1A4LA 4C6MA 1O12A 1YNYA 2D2GA 1NDYA 1PB0A 4C6BA 2UZ9A 4G7EB 3MDWA 2EG8A 3HPAA 2GSEA 2G3FA 4DZHA 5HMFA 4ZSUA 3LSBA 4LCRA 2D2JA 4DI9A 1FKXA 1NDWA 2OB3A 3LS9A 2WJEA 2AMXA 4NP7A 3F2BA 4F0RA 4Z42C 2VM8A 3LGGA 2GWNA 4CEUC 1V7AA 3IRSA 4WGXA 1M7JA 4GK8A 4NI8A 3E0FA 2EG7A 3E74A 4C5YA 1YIXA 2QS8A 1UMLA 4LANA 4QSFA 2P53A 2EG6A 3GIPA 3WZ0E 3IJ6A 4IFOA 3QGAC 4I6KA 3E38A 2Z4GA 1J79A 3A4JA 4C65A 3UR2A 2OODA 1XWYA 3QY6A 3EGJA 1M68A 1RA5A 3LY0A 1GKRA 4KEUA 4CNUA 3ICJA 4H01A 1NDZA 2F6KA 3HTWA 4R88A 3JZEA 2YXOA 4HA0A 4OFCA 1FWCC 4CNTA 3DC8A 2CZVA 3FDKA 3GU9A 3ISIX 2R1NA 5FSEC 4C6OA 4IFRA 2ICSA 4L6DA 3RCMA 4XD4A 4H9YA 3PBMA 3QY7A 2Q01A 4LAOA 3EWCA 3OVGA 1RJPA 4B91A 2GZXA 4EPEC 3GUWA 4XD6A 2DVTA 4JOMA 2PUZA 1A4MA 2Z2BA 3V7PA 3R0DA 4CQCA 1IE7C 4B92A 3O0FA 1RK5A 4H9MA 1A5LC 5G4HC 3CAKA 4B90A 4C5ZA 4BY3A 3GTFA 3F2DA 1R9YA 1EJWC 2PGFA 4RE0A 1E9YB 4LH8A 4D8LA 4CQDA 1K6WA 4CNSA 2FFIA 3LNPA 1P1MA 4IH3A 4NG3A 2HPIA 2PGRA 3NEHA 1YRRA 3K2GA 4C6FA 3LA4A 4LCQA 1JGMA 3C86A 2Z24A 4DI8A 1RK6A 1ZZMA 1EZ2A 3CJPA 3S2LA 3T1GA 1ONWA 3AU2A 3OODA 4XD5A 5HMEA 1W1IE 1KRMA 4GYFA 2Q09A 3IGHX 4R85A 2HBVA 2O4QA 4LAKA 2VHLA 4KERA 3RN6A 4ERGA 1XRTA 4KF1A 4IGNA 4GX9A 2I5GA 4WVXA 4H9ZA 1I0DA 4I6VA 3RYSA 1NFGA 4UBPC 1K70A 3IACA 3S2NA 1POJA 5CH9A 3NQBA 1WXZA 3D6NA 4QTGA 3OJGA 1P6BA 4YIWA 4LAMA 1FWGC 1FWFC 3MKVA 2D2HA 1FWDC 4KESA 1YBQA 1P6CA 3F4CA 4ERIA 1KRCC 4AC7C 4GY1A 3A3WA 1POKA 1O5RA 4HJWA 4QRNA 3OOQA 1NDVA 4C6JA 3QY8A 4EPDC 4KEVA 1UIPA 4C6PA 3WMLA 3F2CA 1PO9A 1ADDA 3GTHA 2ANUA 1YBQB 2WJDA 3GTXA 2YB1A 1BF6A 4KETA 4C60A 1PSCA 4J5NA 3G77A 2I9UA 3FEQA 5A6TC 4C6EA 1GKPA 2FTYA 2Z7GA 4C6CA 3MDUA 3AUOA 4R7WA 1J5SA 4DLFA 4BJHA 5FSDC 3CS2A 3MTWA 3O7UA 2O4MA 4GX8A 3URAA 4EP8C 4J35A 4DYKA 2VUNA 4QS5A 1FKWA 2ZC1A 4GY0A 4IF2A 2HPMA 4DNMA 3E3HA 4C6NA 2WJFA 5LXXA 4DO7A 1V4YA 1RJRA 4M51A 3PAOA 4H9VA 1ITQA 4TQTA 4LEFA 2P9BA 2FTWA 2DVXA 4GC3A 2R1PA 1UIOA 4DLMA 3FDGA 2DVUA 4EPBC 5AKQA 2XIOA 4MUPA 3RHGA 1WXYA 4P5UA 4IGMA 4PCNA 3WYZA 4LCSA 3BE7A 3MPGA 3TN5A 4KEZA 4CEXC 2HNHA 2Z29A 1J6OA 3S4TA 1R9ZA 3B40A 3UPMA 1KRBC 1ITUA 3ID7A 1E9ZB 4IQJA 3GIQA 4G2DA 3IARA 2UBPC 4UB9A 4DIAA 3S2JA 2Z26A 3IV8A 4GZ7A 4LFYA 3MSRA 2Z2AA 2BGNE 2Y1HA 1GKQA 3PANA 4C6LA 1FWHC 2WM1A 1ONXA 4C6QA 2PLMA 3GGMA 1EJXC 2E1WA 1EYWA 3URQA 3TN6A 1QXLA 4L9XA 2E25A 1VFLA 3GRIA 3QGKC 4B3ZA 4LALA 2Z25A 2A3LA 2OQLA
chains in the Genus database with same CATH superfamily
1SZNA 4DO6A 3BAXA 2FMOA 1VLWA 4RZBA 4K8HA 3PUOA 1TZ9A 2BDQA 4A4AA 2VKZG 2NWRA 4G5DA 4YYCA 4GJIA 4B15A 4LGXA 1FA2A 4EPKA 5CLWA 1J8VA 5LIKX 2VC5A 4N9CA 3WL0A 2R1LA 3EYPA 2WK2A 2CBJA 3Q67A 1YPXA 4QROA 5KFYA 3QC3A 3LUTA 3R8HA 3A4XA 3XIMA 4BR1A 4HMDA 1BSIA 2ZXAA 3SGGA 3V75A 3M0IA 2BVYA 3KOYA 1OYAA 1LOLA 4YTUA 3NYDA 3AHTA 5EBAA 3VINA 3DU0A 1ZP4A 4L4PA 1C8QA 5LKYA 2P8BA 4G3IA 4GMEA 2VWTA 2EJAA 1RSCA 4IPIA 4AD2A 1BYAA 1Y5WA 1G94A 2Z6IA 3WF0A 3FHQA 1EJUC 4GH3A 4B5NA 4XAFA 2QF8A 1QW7A 2OT0A 1O4UA 4DWSB 2PPGA 2NWSA 1EX1A 3VDCA 2Y8UA 5D09A 1IQ8A 3W4RA 3AU6A 4RV3A 3Q65A 5LNUA 3PF3A 1R47A 3AMLA 4XAYA 1OGSA 1NOUA 2JBMA 4H9TA 1YQ2A 4C1KA 5HR7A 3TK7A 4OIFA 5A6SA 4PTWA 3T81A 1YDVA 4KH2A 2RFGA 2XJ7A 4YWSA 4HHPA 1BGGA 3A9IA 1O12A 3FAWA 3VFLA 4QQUA 4NKCA 1BFNA 6A3HA 3VM5A 1SMAA 3DENA 1H7PA 2ZADA 4NP7A 3W29A 3BG3A 2X0SA 4Z42C 1S2TA 5AECA 3W7LA 4Q44A 1EYEA 1F74A 1LLWA 5H6HA 4RZ6A 4B3KA 2V3FA 3AHZA 5J5RA 1WB0A 3RCNA 3AJXA 3W1LA 3OHIA 3PW2A 2JKPA 1P0NA 3U7BA 1EEXA 2AMGA 3I4KA 5HUOA 4D2JA 5G2WA 3CIWA 2INZA 1QAPA 2A3CA 3VNKA 1KM4A 5HQLA 4J4KA 3XINA 3Q37A 4J9NA 2HSAA 3O15A 4KEUA 3KOWA 3OBKA 2F6KA 4R88A 3ZM8A 1B54A 2YXOA 3HMJG 5KETA 4J2PA 1V6TA 2H9AB 3GU9A 3PN8A 2NXGA 1LM1A 5KG5A 2C18A 2VFFA 3W2UA 3CZEA 3NQ6A 4NZ1A 3GX9A 3GZ3A 4LX4A 3AHXA 5A8PA 2BFGA 3FLUA 4WKAA 3ATZA 3TAOA 4V15A 2ISWA 1GVSA 2DJLA 4L4MA 3V5CA 5C9WA 5KFEA 3UA4A 3UR7A 1IE7C 3O0FA 2CLIA 2YCEA 4JCMA 2C2EA 3G1SA 3UY7A 1UUQA 2VR4A 3AALA 2HEJA 3GTFA 1XXXA 1E9YB 4IJBA 4DYJA 1NQ6A 3OYXA 4P7OA 2YCJA 2Z24A 1L8NA 3WK2A 3AOFA 1RY8A 1WUFA 4IRKA 2Z1SA 4DI8A 3S2LA 4HGXA 1N82A 4D6GA 1US2A 2YA0A 2CCRA 2PLCA 4RXGA 5KFVA 2W9CB 3QHNA 2FDMA 3CHVA 2VT0A 4NU7A 1XRTA 1FHLA 1EGZA 4CNNA 4L6OA 4Z0SA 4J9QA 3KP1A 4M1RA 3DH7A 3N17A 1A3HA 3GIMA 3OVPA 5L1JA 3NCOA 1GTHA 3DYPA 4WX2A 1DORA 4QIUA 1FWGC 3MKVA 1V7YA 1VBRA 4MLRA 4GY1A 2Q3RA 4ATWA 4K39A 3IWPA 3IGUA 4GIAA 3THUA 3TDFA 4MZ8A 4GO8A 2W4XA 4PRTA 2J74A 4ED2A 3PPFA 4L1XA 3W7NA 5KITA 5CPLA 1OF8A 1LWHA 1Q65A 3RG6A 4QJ1A 1KD0A 4JZ5A 4XUGA 4FNPA 3GXMA 3M6DA 1TPC1 4PCFA 1YKWA 4LVBA 3SUTA 5I78A 2F2KA 5CPOA 4RK8A 5FJTA 3K46A 5D38A 1I6NA 3TA6A 3SI9A 3C4UA 5GJNA 1X6LA 2AGKA 2PDXA 3P61A 3VDAA 4NNCA 3RM9A 3B0PA 3G0XA 4W8BA 1EO7A 2RJHA 2V69A 2DVXA 4XX6A 4X2PA 2UY2A 1GNXA 3TC7A 5MKGB 3A5VA 3REQB 3QF0A 2AGQA 3BAKA 2CFFA 3UWEA 4PSPA 4M6UA 2WZIA 4TTGA 2DSKA 5I3FA 1MUCA 2J7GA 3R43A 3DZ1A 1YEYA 2DQXA 2YCLB 2UBPC 1E56A 4M82A 3G5EA 4O1FA 3NQ8A 1W1YA 2IQ0A 3KFTA 4QX4A 5CPQA 3V35A 4UOZA 1GOIA 1VKFA 4NF7A 1MQQA 1TPB1 1W54A 4QG9A 4S3DA 1EC8A 5CCZA 4UTMA 2PWGA 1UR9A 3CIVA 1CDGA 2HK1A 3N29A 4D6CA 4BI5A 1RYSA 3SRDA 3UYCA 2WOQA 3LMYA 5D2VA 3EB3A 2FVKA 3PUDA 2PF0A 2OYLA 3W2LA 1AFSA 4U5IA 1DP0A 1X6UA 4W89A 1TPWA 4QM1A 4O52A 5EB8A 1HL2A 3CB3A 4I8YA 3OU8A 3FXYA 3VGDA 1N7KA 5KFMA 1F3WA 3GG7A 3QRHA 4MKSA 4ZQRA 3TTOA 5KG4A 3EMQA 2D20A 4N42A 3KL0A 2QUVA 2OOFA 4D72A 1OX4A 1LOSA 2DGAA 2E5CA 3IANA 4LUIA 2E8ZA 4HU8A 1BYCA 4M6PA 4AD4A 4DF2A 3BMWA 1LROA 1V77A 1ZJAA 4J3VA 4CN1A 3THCA 4HU0A 2ASLA 2NXHA 3WQ5A 3JR2A 3WH9A 4MB3A 5JMUA 5HPOA 1WP6A 5AYIA 5HNUA 4LB4A 2EPOA 4Q4RA 1A5OC 5D4YA 4DUXA 1XRFA 1R9XA 4D71A 1ZJHA 1AJ2A 2UVWA 5GJPA 3M6YA 7REQB 2Q02A 1GW9A 1LDCA 2FJUB 4UTWC 1SGJA 1PZ1A 1GQJA 2WHLA 4HPJA 4B2DD 4X60A 3Q4DA 5D03A 1MWOA 2DT1A 4MB1A 4J9KA 3IVSA 3GO2A 4FB7A 1TJPA 2HS8A 3QMSA 3TJIA 3N2TA 3QM3A 1O68A 2Z28A 1UD4A 2ZVRA 1RBOB 4GGBA 1EJVC 5KFDA 3C3NA 3LDVA 1S9FA 5LIYX 3LPGA 1UWIA 3NQCA 4PMOA 3LHZA 2GSEA 1NELA 4ADSA 1J01A 4D1IA 1I4NA 2AMXA 1JR1A 3P93A 5HWMA 1K6AA 4UQBA 3AIQA 1US0A 5D9NA 1K4GA 5A1AA 3LGGA 3IRSA 3STEA 5CQ1A 3U4AA 1F3EA 2HROA 2VEFA 5A8NA 1E6SM 3G3DA 4KCTA 4Y9MA 4KWUA 2A7PA 4KT2A 3UXKA 4QWDA 5BOEA 3GFYA 3EKLA 1S5WA 4BCEA 4IFOA 3C2YA 3L4UA 1XYFA 1SJAA 4JKMA 1F5ZA 3LENA 2MUCA 1RBAA 4F50A 3W7QA 3BGJA 1ZALA 2RUSA 1TV8A 2GJLA 1RH9A 2G3MA 1N8IA 5FIPA 2GK1A 4PUJA 1PZ2A 4Y9AA 3DHDA 3BPWA 1LUCB 2PZNA 1VFUA 1JZ7A 2XSBA 2Q6ZA 4C90A 3A13A 5E93A 4WDXA 3UESA 3WLOA 4JOMA 2ABAA 3PZGA 2ZRWA 4QQ3A 3SURA 5FJPA 2F9RA 3RRXA 3WDRA 5F4SA 1Q2SA 1XRVA 3UA3A 5AC4A 4N6EA 2WKJA 2GJRA 2AL1A 2J8TA 2W61A 1H1ZA 1SYTA 1QI5A 4YYFA 2DUXA 5BNKA 1IF2A 1IEIA 3U7VA 4ROQA 5REQA 1S97A 1UH3A 3OG2A 2CNCA 4LRTA 4J7RA 3CJPA 1EZ2A 2ASHA 3KRZA 3GQCA 1DJZA 3PBVA 1Z69A 1A5AA 2GSHA 2OG9A 4L9ZA 1CW2A 2VHLA 2W9BA 4GPNA 1Q3NA 4NZ5A 1B9BA 4E4FA 4JX6A 4O1CA 4PCSA 4Q8QA 2G3IA 5CSSA 1AA1B 2BXZA 4Z2GA 3TLLA 2WC4A 2DDXA 3NSXA 1NFGA 2H8XA 1BXCA 3TQ0A 5CJNA 1TV4A 2ZX7A 4MMWA 1WXZA 1UA3A 3M41A 1XLMA 3OJGA 1WQ5A 2CBUA 1F8MA 4O0QA 5CBIA 1X1OA 3W87A 3W84A 1F6KA 1V0LA 3U4FA 4M7SA 4ERIA 1ZNNA 4XVDA 1KGWA 2WYSA 1POKA 5K9DA 3MYPA 1WDWA 1GVOA 3NZGA 4ZO7A 2OLSA 1H3GA 3B06A 5IHSA 1LLOA 3IK4A 1TWSA 2YR1A 3TUUA 1Q85A 3TQKA 3HG5A 3BOXA 3JS3A 1H63A 1MW3A 5JH1A 3F5JA 3KTXA 1T8QA 4OVXA 3URAA 1NH6A 3P81A 2JF7A 2ALRA 4ALDA 3CL6A 2X05A 3DC0A 1D8WA 4AY1A 2BQ3A 5LA2A 3TJXA 1XFCA 2QCCA 4UCFA 3RX2A 4TQTA 3H2MA 5E6ZA 4H7CA 3WK1A 4AIUA 4GC3A 3A4AA 3FDGA 3NQMA 3S1UA 1YE6A 3OGRA 4WKFA 3SN1A 3LCFA 1J11A 4WQ6A 3CH0A 2IQDA 3BE7A 4GUIA 2VJXA 3A21A 5D8WA 3RLUA 3SJ3A 4PL1A 2WNWA 3DFTA 3VNDA 4IQJA 4NAFA 4KCWA 3H2NA 3IARA 3RU6A 1SJDA 1ZSXA 4JQAA 3VYLA 4GZ7A 5A8MA 4GUFA 3BOFA 3QMRA 3QYQA 2E28A 2XN0A 2DU2A 1BWKA 3PTDA 4O57A 1KCZA 4W5ZA 5C54A 2Y70A 2VCBA 5ABHA 3AZSA 3GC2A 4DB7A 3WQEA 4NJIA 5A6JA 2R1KA 3KW3A 4ML4A 3GNDA 3M9YA 3RRAA 1OD8A 1CCWB 1VYSX 1A5KC 2PCEA 4UQCA 2YLLA 1MRAA 2WSYA 5K3VA 2QJJA 4CNPA 3KZSA 5CJMA 5AYYA 2CLLA 2V6AA 3U2ZA 2J75A 3K5XA 3OSNA 4XAGA 1QOXA 1B3ZA 2XGPA 3CGTA 2PAJA 3SR7A 3LN3A 1HTIA 1R2TA 1GONA 1CPUA 5K7JA 4DO4A 1ZAHA 2WVSA 1H49A 4JTTA 1JEZA 4AZGA 2W9MA 4PCTA 3P2VA 4ACZB 1WZLA 3AC0A 3IIVA 4LOCA 5GNXA 3TN4A 3AICA 4NAEB 3W1RA 3IIOA 1FWJC 5E0KA 2IPJA 2V2HA 2B0MA 1B5TA 5D02A 4GIRA 3I68A 4IR1A 4M0XA 5JBFA 4AQLA 5F1UA 1MZRA 2YX0A 3KBNA 4HCDA 2HMCA 3N14A 3TC3A 5DY2A 1S2CA 1XIGA 3I7QA 2W5FA 4XUYA 4PFMA 4QEHA 4NIRA 3TWBA 3LPPA 3LTSA 4FOKA 1LJYA 5A6KA 4DL6A 3KL3A 2DPJA 2V5JA 1BXNA 3KBSA 4R7OA 3SGUA 1TIMA 4C6IA 4A3QA 2HRWA 3CLWA 4BKNA 1PUDA 5DXYA 3CMJA 3E5PA 3LSCA 1PKNA 2GGIA 1ZAJA 1G4EA 3TTQA 3PNZA 1MNZA 2OU4A 4J3XA 3Q45A 4DJFD 4WJXA 1FWNA 4B16A 5G5IA 1JNEA 3GVQA 2W66A 3MKKA 2O9RA 2ESCA 4LCRA 2BG5A 1FKXA 3GDRA 3LS9A 5GNZA 2GVJA 2D0GA 1IYXA 3TFXA 2G37A 1DHKA 3ENLA 1FP8A 3OYZA 2BV9A 5F2IA 3P84A 2EF9A 2QS8A 2J78A 3GS6A 1XCWA 1V5XA 3ARYA 4K8EA 1NAL1 2P53A 2WLYA 3VGEA 1GYLA 1I2NA 4NASA 1JYWA 1EB3A 1HX0A 1E0WA 2XVPA 1SW0A 2Z4GA 2BY2A 3UR2A 1XWYA 4TR9A 4GI9A 4EXBA 4RKAA 3IJ8A 2FLIA 1BWLA 8XIAA 4OFCA 4EXQA 3DC8A 4EBCA 2W62A 4CU6A 4ES4A 1R85A 2OSYA 1XC6A 1A80A 3PW4A 3W1AA 1BTCA 1PTGA 4DL4A 1EZWA 1ECEA 4WGHA 4O10A 2UVRA 1OGGA 3W1QA 2BX7A 1PS9A 3VKDA 3BQ6A 2Q01A 4U10A 4D6HA 1OF6A 1QATA 1CLKA 4LS2A 1Y7VA 2PDFA 2C14A 3T9PA 5D32A 4J9MA 1XUUA 1R3WA 2E5BA 1B57A 1KFCA 1RCXB 1KBLA 5I77A 1P0KA 2HTMA 1WZKA 1HKVA 3TTEA 4YR0A 3WQWA 1E4LA 4E2OA 3WQDA 5KFBA 1I2OA 1KNWA 3VNZA 2PGRA 1BQCA 1FY6A 4JTKA 5I02A 1TWWA 3PTQA 4ACYA 3S9YA 1LG2A 1W3TA 3AS2A 3F4VA 4PTMA 2PZ0A 2YXXA 3B8VA 1TQJA 1TA3A 1KRMA 2YCIX 3VZYA 4YVXA 1TV5A 4P2VA 3T0DA 4ZB5A 4MG4A 4ERGA 3QV7A 5BXPA 2BZNA 4ZCWA 1JNDA 5D33A 2DSZA 4HQVA 5HNRA 3PUEA 1G4SA 2OLAA 2CESA 3USZA 3LLXA 3B97A 4E38A 5FF3A 2A3HA 3D6NA 4JV1A 3BLOA 4I5XA 3OP2A 4O3PA 1QFEA 4AZCA 1ZTVA 1QDSA 3GV7B 4ZTXA 3SCRA 3NZ1A 1XIFA 3HFTA 4YPJA 3ITYA 1KRCC 3I65A 2RJGA 2PCQA 3CB8A 3P5YA 1B30A 5DMYA 1W3LA 5C70A 2FHBA 1JFHA 2OX1A 1LOQA 3RR4A 5A69A 1Q6RA 1A0EA 3ZZ1A 7ODCA 4Q7BA 3G77A 3W7CA 5A6TC 1S10A 1MQRA 4DBEA 1QOPA 2Q3OA 5DG8A 4LUJA 1E6XM 3HGJA 3DFQA 2O56A 4LT9A 2NUWA 1RVGA 4QG8A 4K37A 3IIZA 3PM6A 4JIQA 3JW7A 4DNMA 2XVNA 4NLGA 2CC0A 3PBUA 1Q8AA 3IK2A 3LX9A 1FHUA 1V4YA 3MS8A 5E9AA 3GE7A 3N1AA 5L1IA 3CO4A 5B7ZA 1RVKA 5KINA 3KBMA 4US6A 2HDJA 4HOXA 3WFLA 2VVSA 2O7SA 4AIOA 4H83A 2HCVA 4MPKA 4XG1A 3OSPA 1WDQA 1P7TB 5FJOA 4IL2A 1JUBA 2A7NA 1LQAA 5DY3A 2PDCA 4AD5A 3I6TA 1L6YA 4FX8A 2VCAA 2P3EA 3ANVA 3P62A 3CNYA 1V0NA 3B40A 3TU9A 1E9ZB 3N19B 3TAKA 4XK2A 2RDIA 3IAPA 4IPNB 3U5YA 3KLKA 2PD9A 4YP3A 3O6AA 3GILA 3BV7A 2CBIA 1DJNA 2BQUA 5FAGA 2X41A 5LZLA 1YADA 2PWVA 1H50A 4K8GA 3NPUA 4D8AA 4FEZA 2V2DA 1S2AA 4WZHA 2QW5A 2DFAA 4WK9A 3GQYA 2GJXA 3VTRA 3WLIA 1XBZA 2YJQA 4ZTYA 1WKFA 3MHGA 4JTRA 1EJSC 5C9ZA 4O18A 4JYDA 3BMVA 3SEPA 5AC5A 3SCPA 5BXRA 3EX4A 1K9EA 1B3OA 4GC4A 5C6MA 4RPPA 4IUOA 1V79A 4AX6A 3OQ8A 4Q4OA 3BLPX 2X30A 1Q6QA 5ABFB 1PE1A 5KG6A 3LGDA 3DFPA 4D1JA 3GHRA 3W71A 1KFJA 2POTA 4JKLA 3VC5A 3E1F1 2J7HA 4PTVA 5LGZA 1CB7B 4IFKB 5KFLA 4EANA 1RAKA 3QLDA 2H9AA 4KPLA 1I0BA 3CAQA 1Q45A 2OO0A 3PZNA 2J7DA 2AL2B 4UFIA 2YZ5A 3H22A 3NQDA 1FUYA 1EF2A 1PTAA 4FS1A 3U5UA 3BGGA 2XH2A 3B0YA 4ECLA 3N15A 4HPXA 1UKPA 4LTSA 2WMFA 4Y6GA 2EBNA 4HN8A 1K1DA 1JZ2A 1EOMA 2PDIA 2VR2A 2GQAA 4Y7EA 5HK4A 1X8CA 3DCPA 4BQ4A 2REQB 4AF0A 1WOAA 3QPEA 1ZETA 3ZR6A 2QCFA 4GQQA 3E9AA 4M80A 2IA6A 3WH6A 2EPKX 2FTPA 2Y6ZA 3HJEA 3NURA 4P7LA 2PDMA 3AYTA 2NW0A 3SDOA 1QPRA 1DPMA 3CUZA 3WLMA 3TNOA 1NP2A 3EWDA 4AY8A 4AWEA 3WEOA 3PS7A 2I14A 1E5NA 2PP1A 5DLCA 1BVZA 4S3KA 3T8LA 4HMNA 1O5QA 3TYDA 2W9CA 1HGWA 4I9AA 1V0KA 4D6JA 1E9IA 4LBSA 3N2XA 2YW4A 3CK5A 2VWSA 1G9HA 1PB0A 3TTSA 1KKOA 5J04A 9XIAA 3KUMA 2HXUA 1KV8A 4H7VA 5BMWA 2ZUVA 4NRRA 3UG3A 5BWFA 4IJCA 1F6PA 2A6NA 3WBEA 1V7AA 1RLCL 4Y8EA 5KT7A 2BVWA 1CB2A 2C71A 1W3JA 1ADSA 3PWAA 3OVQA 3WMCA 1O1HA 1EXBA 2DSWA 3TQVA 1TX2A 4BK9A 4QBXA 3VNJA 4K3ZA 2OJPA 2KX9A 3JRKA 1KFWA 3DHFA 2O9PA 3IJ6A 4W88A 1UJQA 4MB5A 5AHLA 3SADA 3PFMA 1QHOA 3P80A 3WF4A 3GDTA 1L2QA 3TZNA 1RD6A 3CAVA 4RUAA 4GVHA 3UFYA 3QQ0A 3OTRA 1E55A 1M68A 1FWTA 1IIHA 4H01A 4JTHA 3MY9A 4JV2A 4GC7A 1FH9A 3HFYA 3AXHA 3L2MA 3Q8RB 1OD0A 1FH7A 3ELFA 1AQHA 3ISIX 3I7RA 4BFAA 3VM7A 4DBSA 1F7BA 3SN4A 5I00A 3H21A 1QBAA 2OQHA 3RCMA 4ADUA 4AZIA 1C8VA 5FJRA 3LHUA 2R8KA 1JF5A 5C55A 3R8RA 2AAMA 5H8PA 4PTNA 3GKAA 4LW7A 3V0TA 5D04C 3LCGA 3VX1A 4IWWA 3S6OA 3FA5A 1QI3A 2R8IA 4EEYA 2YYUA 4FIRA 4PFHA 3DKJA 4GZIA 3NWRA 1NTHA 1Z32X 5EMUA 5G4HC 3UJSA 3VU2A 2XISA 1F4AA 4FP1A 3OG3A 4HHHA 2DEPA 5CC3A 3D46A 3UEQA 2DORA 2AQ4A 1O1ZA 1K6WA 1T8XA 5ABGA 4EE9A 4ZQPA 5HUPA 4UFJA 4KWSA 4XIAA 3UPWA 3ABXA 5GQBA 4DM2A 1RK6A 4JD4A 4XV0A 3OODA 3GTNA 4XD5A 2R91A 3DI0A 3UETA 3VCCA 1OB0A 5BMXA 4NSBA 3BZGA 5A3HA 1IXPA 3KLLA 3GNXA 1HQTA 4O3QA 1GG0A 1EC7A 4GD0A 1B2YA 2VFDA 2ZUWA 3EDEA 4GI8A 1OFAA 2GYIA 3K8MA 3TIMA 3BC9A 2CHNA 4AVFA 5TF0A 1N8WA 4A21A 1RQHA 2NUXA 1TJ0A 1TB3A 3IVTA 3EB4A 1TR1A 4KESA 2D2HA 2WMJA 3CZGA 3H7UA 1IXNA 2FHFA 4C1LA 1JXJA 2D3LA 2X1RA 4C6JA 3QY8A 4HOZA 1E6ZA 1OBAA 3NJ3A 3U9IA 4DRSA 4K36A 2V4QA 2WB5A 1XW8A 2E3ZA 3UWYA 2YB1A 1RV8A 3APGA 3N3MA 1OADA 4KW2A 3FSTA 4LB3A 3VNYA 1UH2A 2PDQA 3GBDA 3AUOA 4J9LA 2QXWA 3COTA 2BS9A 1J5SA 1IZJA 3NAVA 1CI1A 1TPFA 4E8DA 3MTWA 3LOTA 2VUNA 2ZC1A 3HZ3A 5AYZA 4ECYA 3IEBA 4M1BA 1FHDA 4KRZA 3VE9A 1ZUAX 2CETA 3RAQA 1RZMA 1S5TA 2CYGA 5D30A 2ODOA 5C5YA 2A79A 4R5EA 5FKYA 2OFJA 4XZMX 5D05A 2YDAA 7REQA 4J9OA 2YGYA 2DSVA 4CQ9A 3S9IA 3RHGA 4REQA 3THQA 1WYIA 3ZLHA 5KFKA 5CG0A 1XGDA 1O7AA 3PZIA 4L4LA 3GDKA 3BH4A 3ZWTA 4CD8A 3MPGA 4W7VA 4FX6M 2VDGA 3QXBA 1TREA 2O92A 1OG6A 1T99A 3UPMA 3C2FA 1PJ9A 3LERA 2Y7GA 2XUCA 4O50A 5K4XA 1TE6A 3AQUA 3RLGA 4JHZA 4QG6A 3C6CA 1EGVA 1XYAA 2Z2AA 2ZRYA 1FWHC 1XBYA 2B7PA 2Y5SA 1X1NA 2WW5A 4F66A 1V3HA 2XIJA 5CZKA 3QGKC 5C8BB 4MNMA 3W1XA 3H70A 5JQ9A 3IUHA 3V1HA 4XD3A 1HZYA 4GCAA 1XLEA 7CGTA 1SFLA 4MDOA 3VKBA 1ZP3A 4K7YA 1PDZA 3MI3A 1OQFA 2VGGA 1S0MA 3GFXA 3HG4A 5F2GA 1J0ZA 1FDZA 1S46A 3DI1A 3T5JA 5HXMA 1R3TA 3WCZA 3TYUA 4XQ6A 4A05A 2C3ZA 4MUZA 4Z1AA 1JDFA 4IT1A 2NX9A 4MTVA 2CBVA 3KWXA 1LBFA 4IJRA 2WMGA 3AIBA 3EA3A 3HPFA 1OGBA 1XLAA 4YWIA 2WVVA 4JPGA 1W1VA 3GU2A 1XV8A 4POCA 2WSQA 2CXGA 5IDZA 4KCUA 3U8GA 2GGGA 5LGXA 1RBLA 5LNRA 2J8GA 4H00A 1XYLA 3OEXA 4QE1A 4AW7A 3QOMA 3R10A 4W7WA 4DJEA 5CSUA 4JL2A 4O4VA 2DPEA 3O07A 3EPNA 3V36A 1TSIA 3KP0A 4H2CA 2W79A 4YVVA 2R6OA 1M9HA 3N6HA 1AD4A 1EIBA 4WLCA 1DTNA 1UWQA 2HK0A 1XYCA 4QDPA 4UTFA 5BRBA 8TIMA 5FOOA 3S9ZA 5U7SA 4C7GA 3BANA 4MKVA 3CV6A 4HNUA 5DF0A 3V1PA 2VENA 4PH6A 3SSZA 3ANYA 5D2WA 3WJXA 3DN5A 3WDHA 4DQWA 2QCNA 1AQFA 1Y65A 5FJJA 4ZOCA 4S38A 1V6YA 3SY5A 3MMWA 2I56A 3RITA 2D0HA 4P7RA 1KBKA 5CSRA 1Z7AA 5KFTA 4FBUA 2Z1VA 2OB3A 3A47A 4JY9A 1KR0A 4JUZA 2JKAA 2OYMA 4J9SA 3FCPA 5KG1A 1P0BA 3C8NA 1UROA 4US5A 2TPSA 3EX6A 2EPHA 4C91A 3UD6A 5DT7A 1P4CA 3LI1A 3HO8A 3P8JA 1E4MM 4O8AA 4FS9A 4HD5A 4DBDA 1RP8A 1VJSA 2ISFA 2RDXA 3V3WA 1F76A 4YTRA 3H7VA 1XGZA 3E96A 2NV2A 3MUAA 1HL9A 3GXNA 3M4HA 1VPXA 5DGBA 1CBGA 1R7OA 4FXFA 2NLIA 2O0TA 2OODA 1D7FA 1PAMA 3MKCA 2IUZA 5TBOA 1XLKA 1UYQA 4Q45A 3HQOA 2XVLA 4IMDA 1S2UA 3KHGA 2CZVA 1CGUA 2W63A 1WDSA 4IXXA 1VFOA 1EBGA 5JIPA 2BHZA 3W72A 3SUSA 2EXOA 1T6MA 1G1YA 3N4AA 3OVGA 1JZ6A 2GQ9A 9RUBA 3L2IA 2YDRA 3GUWA 1DE5A 2VL4A 4MHBA 3IJ9A 4JYEA 3G1AA 4J28A 4FXRA 5G2HA 4B92A 3GXPA 3ERPA 3O06A 4P8VA 4R33A 3UG8A 2WHKA 1U22A 3M0YA 4LH8A 4KEMA 3BL3A 5CGMA 4UTTA 5F4WA 1IT7A 2ZZ2A 4GABA 4NG3A 3H8AA 4JTUA 1CNVA 4FOUA 5E09A 4LYQA 4FLOA 2AGTA 3VGFA 2CKSA 1THFD 3VGGA 4RW3A 2V5KA 4TQSA 2PD5A 2HXTA 3GR7A 3T0BA 2PS2A 3HOJA 1UR0A 1BD0A 2NT0A 2HBVA 4KERA 2X0HA 3KDOA 4JTJA 3OGSA 3B0VC 3QW3A 1AH4A 3OB8A 3WLLA 4H9ZA 3R13A 3QV8A 2FH6A 4Y9PA 2WVTA 1IEVA 3EOOA 2DZPA 2PBOA 3WLJA 3H2CA 2ZOXA 3DYOA 3HPZA 5BW6A 2HISA 1ISWA 2F8QA 4LVAA 3PR5B 2VGBA 4G6CA 3WLQA 2GUYA 1P6CA 4DNHA 1VFSA 3UVAA 2Y8VA 1KM3A 1OABA 1SQ7A 3VNLA 4YTQA 1JAKA 5M03A 3H12A 1NWTA 3F2CA 4HZMA 2ANUA 3GTXA 3VVGA 2I9UA 3E5BA 3NL6A 4QJ5B 2ZXBA 4UFMA 3SY8A 3G1FA 3PB2A 3H4GA 3WLPA 4FXJA 2VGIA 3VIOA 1UZ1A 1XYZA 3KXQA 4GHRA 4AFYA 3BOLA 1J9YA 4JQ2A 2ZDRA 3PWGA 1ZLPA 2Y5EA 1Q13A 1W5OA 4HIBA 3BAJA 4F4ZA 3TTYA 1JQVA 3R58A 3M44A 1GVFA 2WXDM 4JIEA 1GOMA 4P8XA 1UW9A 4NZ4A 2V82A 4CKQA 5I23A 1T5AA 2WHMA 3G18A 4RUCA 3II1A 4UWMA 2Y2WA 3EDDA 4Q3MA 4AHQA 3UU0A 1MYRA 3VPLA 4JYFA 2VZUA 4WRHA 3VFCA 4AWUA 5A8OA 1D3HA 3T09A 3F1QA 2DIJA 3T5HA 3FVDA 3VE7A 1BGAA 1NARA 3INPA 4Q22A 1NU5A 1M04A 4H19A 2B4GA 1OT1A 3NPVA 4ZO9A 5CSYA 1WBHA 4RU9A 4HOWA 3QZ7A 2J9ZA 1H4PA 2H8ZA 4L9XA 2XC9A 3LRMA 5KT2A 1OHLA 4CQAA 3FGCB 1LCOA 4DUWA 1Q6GA 2OQLA 1MVYA 4ED8A 4TVDA 3PW5A 2J79A 2GGEA 4A8RA 1FWBC 5KFHA 1TMQA 1XL9A 3MVIA 1R2RA 3N12A 5G1TA 1M65A 4IXHA 2VTFA 2G97A 3AMCA 3WSUA 5KFFA 2POZA 3NO1A 1OINA 3WJZA 4UQDA 5G2IA 1XHGA 2V5CA 4JY8A 3UCCA 3G0UA 3CWNA 1TPEA 1XIHA 4Q8PA 4UOJA 2FVMA 2J62A 1E4NA 4HBKA 3N13A 3RLVA 3ZLGA 1TR9A 2G3NA 1M41A 3CHFA 3GHTA 3KHDA 4RDVA 3NL3A 3I3EA 1KGXA 1OZQA 1C9DA 5ABEA 4GVGA 3DG7A 5DANA 4ZXOA 4H3DA 1XIMA 3I6EA 4HZ6A 2FZNA 2PTDA 1O95A 4JQ4A 1T7LA 1UR3M 1RA0A 4GOAA 1CT5A 1RXOB 1OT2A 4ZBCA 4PMNA 1PWLA 4IZGA 2NQ9A 1I1XA 3K4WA 1AQ0A 3SCVA 2V81A 1A5UA 5H8UA 2VI0A 3ITCA 1L2UA 3OO2A 4O12A 1JDDA 1VRDA 1O94A 1CYGA 2Y7DA 2ZUMA 3LBCA 2EKCA 4H9UA 1S2VA 1QNQA 2WZMA 2ONEA 4HCHA 3FN9A 5DGAA 3CASA 4ZO6A 3ARUA 3M07A 4NNBA 1A4LA 3ARWA 3RDKA 4IOTA 5EGRA 4HTYA 1HKWA 1HP4A 3MHFA 3QHMA 2JQXA 2PEVA 2A3AA 2GJNA 2GDUA 2EO7A 5D9PA 1X1ZA 3L4WA 3W1NA 2XM1A 1H51A 1R3YA 2GL5A 1HGYA 5C5JA 4WXZA 4B5WA 4PMUA 5IRPA 1A49A 2Y0FA 5M5DA 2PP0A 3ITVA 1GZGA 2TYSA 5DT5A 1E1FA 4X0VA 4PA8A 4I6KA 4X3ZA 2WMKA 4CCDA 3QY6A 5XINA 2A85A 4W86A 1E0VA 2WCSA 4DJDC 5KTLA 3WKZA 1CGXA 2Y61A 2Z2UA 3ARZA 3EMZA 1FWCC 3BMXA 4BS0A 2PC8A 1VPYA 3MV01 2CPUA 1QK2A 1TX0A 1CGVA 2F7FA 4WY0F 1WNOA 3QY7A 2YLAA 4GI6A 4LAOA 4RJEA 2W67A 3R25A 2IXVA 1VBUA 5HQEA 3RB3A 2GK1B 1PV8A 3OLGA 4FO4A 1FOBA 3PR2A 3N4FA 3EX3A 2W7PA 1SW3A 1EA0A 3B9DA 3USBA 2FYMA 4PYSA 4YHEA 1WDRA 1QWGA 2J4GA 3TSMA 3VIIA 4Z17A 3GBEA 3DKLA 1EJWC 1VC4A 3UJEA 3LEPA 4GVIA 3P8IA 1F07A 3LNPA 3DESA 3KX6A 3W7IA 1YRRA 2H6RA 4E4PA 2XSXA 4EF8A 3P67A 3ONCA 3DFHA 4N9DA 3TYAA 4LPCA 1XDLA 3BSHA 4E2BA 3MV11 3RNDA 5HNTA 1WX0A 1DQUA 3AJ7A 3GNRA 1LYXA 5I0DA 1XLFA 1BHGA 5REQB 4F4WA 2X2YA 3L4VA 3V6KA 4O11A 4O17A 3UJ2A 3N2MA 3P3BA 1ML1A 1XQLA 3NXLA 4GX9A 4NI3A 4KS0A 4ML9A 3GIJA 1WPCA 3NL2A 3IACA 1UWAA 1HG3A 4GKTA 3AYSA 5ABTA 4HZ8A 3Q8SB 1SFJA 4IIFA 1X6NA 3M0HA 3VD3A 4HA3A 3WUFA 3EPOA 4DYEA 3F4CA 2VELA 3A64A 4U31A 4IPLA 1NDVA 1K8ZA 1X98A 3STGA 1UC4A 3SCNA 1G0CA 4RW5A 2HJPA 3PSVA 2EPNA 1P43A 2GFTA 2FGZA 3VKJA 2WJDA 4LS0A 4J5NA 4WSJA 3W73A 1ISZA 1GKPA 1TZ7A 2YCKX 6XIMA 1W1ZA 3WO8A 2BTMA 5DQPA 4C6CA 3BW3A 3GWQA 2DPIA 4O0KA 2OTDA 1I2PA 4AU0A 2OWCA 3QR1A 1M7OA 4IF2A 1S0NA 3ZR5A 4GWEA 1RY0A 5KMYA 3GVRA 1J96A 5HA7A 2REQA 2JGYA 1QO2A 3CV7A 3PAOA 3UR8A 3H40A 3UZ5A 4ZFMA 3VOCA 4XZNX 4YTTA 5EWGA 4LVDA 3WMSA 1YW1A 1HT6A 5F1VA 4Z2KA 1ODUA 1FTXA 1DVJA 3TN5A 3M0VA 1R9ZA 4IUGA 1XM3A 3KZPA 1Q6LA 4LWWA 2FGBA 4J27A 1I60A 1S5VA 3OBEA 2E4TA 2IW0A 2GDQA 3S2JA 2Z26A 5K4ZA 4JFUA 4BZYA 1AD1A 5EU9A 5CC6A 3CWOX 4AD3A 4NAFB 1JL8A 1GKQA 4PRWA 3PANA 1R6WA 2EHHA 2PLMA 1RP9A 3ZJKA 2A3BA 2VZOA 4IMFA 3ZJ8A 5A6LA 3GIIA 4LALA 2A3LA 4GXPA 2FH8A 4GFIA 2Y5JA 5FA5A 4QFUA 2VZVA 3QTGA 2OVLA 4ATLA 3APYA 3K1DA 1W1A1 5DMNA 4MKNA 4F0LA 2CKRA 2OOGA 3C5QA 4J2MA 3EWZA 1KFKA 1KQYA 1FP9A 4CD6A 2AQOA 3W1PA 1R3RA 4FF7A 3OQEA 5AB3A 5C9XA 1UA7A 1JJKA 4FLSA 5L9FA 4S3EA 5JU6A 3G1VA 3IPWA 3VMPA 1OFRA 1QW8A 1O60A 3NQVA 1K8XA 1XDMA 3CWHA 3H7RA 1E5JA 3KAOA 4JTLA 3GKFA 1XH2A 3ES7A 3WELA 2OSWA 4PMYA 2E0PA 1DWGM 3PZMA 2VC7A 4GZJA 3SM0A 3L0NA 4RUBA 1YX1A 2Z0IA 4RZRA 3VXGA 2INEA 3AXKA 3LBMA 2FZ9A 1T96A 3QOKA 3MVTA 1SW7A 3QGVA 1YNQA 2TMDA 2YFOA 2QJNA 2J8FA 4JTEA 3BLLA 3CTLA 2Z00A 3QW4B 3MMUA 4J9PA 4I3GA 1A3WA 1DWJM 3KM8A 2A3EA 5F4XA 3UJRA 2WKGA 1D8CA 1TFVA 1VLIA 3VX0A 3GH7A 4DL3A 5BCAA 3KVJA 3C2OA 5KFPA 4NZ3A 4V1YA 2ABBA 1YPFA 1G6CA 1UR2A 1GEQA 1L6GA 4MZ1A 4AZ5A 4O1BA 1KM5A 3MT1A 2D2JA 4DI9A 2EJ1A 5C2GA 4AWTA 2G95A 2E6FA 4Z2JA 1PZ3A 2V5BA 3B03A 3UZWA 3S6TA 1EFZA 4AB4A 4O1EA 4NI8A 1DJWA 1K77A 4JTQA 4C5YA 2A4AA 1TJ2A 4RNHA 3A5FA 3WNMA 3UYIA 5D8ZA 2I5IA 4NJKA 1FCVA 3MB9A 3AXIA 1P1XA 2CZDA 1XR2A 3NDYA 5KFQA 1ZJIA 3NQGA 2NSOA 2EG6A 3EKZA 3WZ0E 4LJ3A 4K6AA 1Q6CA 2DIKA 3GM8A 3TMLA 1KWKA 1QCWA 1J79A 3A4JA 4YTSA 5ECVA 1EA9C 3FIGA 3QZ6A 2GUUA 6ENLA 4QLKA 4WDTA 4B3LA 1KXTA 2AGOA 3DERA 4AD1A 3AIUA 4M24A 2XG9A 1IZKA 4O3RA 1UQZA 2QYGA 1AL8A 2XVKA 5FSEC 4PULA 4IFRA 4EKJA 1TVPA 2CU0A 2VEMA 1DJIA 2UY3A 4RNOA 1VFHA 4NJHA 2Y63A 4BEUA 4A35A 4B91A 4L9YA 2EPMX 2BOGX 1J5TA 2QUTA 2X1SA 2X0YA 1E70M 4J3ZA 4UTHA 2Z2BA 4WIWA 3G8RA 2XINA 2QHAA 4CQCA 1ME7A 1EXPA 3HB9A 2OMAA 1ENUA 1U5HA 4MDPA 1J0JA 3K13A 2PDWA 3SUUA 2NQLA 4S1FA 3PJXA 4ROPA 5A2CA 2FB3A 2IPWA 2PGFA 5LIUX 4Y96A 4UUIA 3L66A 1G5AA 1AW2A 1P0DA 3S1WA 3UGRA 3FV9A 5T9BG 3R89A 1RHCA 4Q8EA 1OG0A 2ATSA 3WD0A 3NQ7A 2C28A 4JIRA 3SI8A 3T1GA 3MZNA 4F4RA 5FI8A 2XFYA 2ACQA 2J6XA 2Q09A 4EYHB 2QPUA 4H2HA 4TVCA 1BKHA 3OHBA 3GG1A 1SR0A 4MF4A 1GJUA 1MW0A 1P6WA 3R2GA 2ZX8A 1ALDA 1ME8A 3D0CA 1BRLA 1GYMA 3B9NA 2ASDA 1NEYA 3EWWA 2VXNA 1QI2A 2ZIDA 1V6XA 1HO1A 3SSJA 2D3NA 3BDKA 4E3VA 4YCOA 4ECWA 3ZT7A 1BKSA 5DG9A 1E4IA 2GQ8A 3EOEA 4QRNA 3H2AA 1MEWA 5L1KA 4MNJA 2BODX 3L5LA 5HANA 4AZCB 1DE6A 2QGHA 2QDEA 3GTHA 1ODZA 4D8ZA 4OBRA 4ZQNA 2XGBA 7PTDA 4JTAA 2ZA1A 3V5OA 3NYZA 1V02E 2V3GA 1Q8JA 3FY1A 4FHAA 4Y9OA 3AS0A 3ZWSA 2FFCA 1XICA 4PMVA 1K4HA 4EAYA 2VEGA 5D2YA 3M9MB 3LZ5A 4DF1A 4B4FA 4Y2WA 3UY8A 5KFRA 4PUDA 4UTLA 4LQ1A 3GG0A 1G4PA 1GZ1A 3WH8A 3UG5A 1GT8A 3R0UA 1V93A 2E1DA 4TMCA 1CWYA 4CU7A 2ZZ3A 4XKMA 3EA1A 2JKEA 1B0IA 4WOZA 3AYVA 2WM0A 4DL5A 1E6NA 2HWGA 3BW2A 2FTWA 1R30A 4N0RA 2G8ZA 3QTPA 4Y90A 1OCQA 1YXCA 2VC6A 3P7YA 1T94A 1UHVA 3EDJA 5FJUA 4IIGA 1MRQA 3CEUA 4ZO8A 3T5LA 1JZ5A 1LL6A 8A3HA 1J6OA 3BCDA 1OCJA 1WO2A 4OZOA 3MUXA 1XSKA 2GSJA 3BLEA 4O3SA 2XHYA 1R5YA 4KFNA 5L6UA 4IPPA 2I5QA 3W7MA 1KB3A 3AMDA 2QPSA 1YNPA 3DAQA 4H6KA 3QEZA 3S1XA 1YTKA 3O6DA 3ITXA 1ONXA 4GJ1A 2ASJA 1EYWA 4CVWA 4P7QA 1QXLA 3W25A 4O1DA 1A3XA 3LM7A 3WH7A 4IGHA 1UWUA 2WMIB 3AIRA 2I57A 1DWHM 1YPIA 2GJXB 5A8QA 1W5PA 2A0NA 3EPMA 4JGDA 2CERA 1EIXA 3JU2A 3KDNA 1UB3A 3F4DA 1QNVA 3VIKA 2CHRA 4JNZA 4MYAA 3G2GA 5CKSA 9CGTA 1I2RA 3G1HA 1M1BA 4GVFA 2ZRUA 3ORWA 4B5SA 1EUNA 1GQIA 3TW9A 4HCLA 4UTKA 4MFEA 2ZZ1A 4PEEA 3GDBA 1QHPA 3T40A 2QVNA 4LU0A 4U5KA 4KGJA 4MJ4A 4GLEA 5AOUA 5IOBA 2A7RA 3U2CA 4IRDA 4BWLA 4MVAA 1H7XA 1TPDA 1XUZA 4DJEC 4DAIA 3TLQA 4HVXA 3GY1A 3CL7A 3TWAA 1WXJA 4G9PA 2OGJA 3DBPA 1V51A 1SFTA 2ZUNA 2XZ9A 2ZDSA 4V33A 2CLFA 3ABQA 1TG7A 1Y5VA 3MA8A 5F9LA 3PSWA 3VIGA 3QFWA 4C6DA 3ARPA 2V5DA 2PP3A 2OEKA 4OQVA 4AF0B 3GVWA 5KG3A 2E6YA 1VBHA 1KTNA 4IQEA 2F6XA 2OO6A 1G67A 2CW6A 1HVXA 3WJYA 1UUMA 1JPKA 4QITA 1PEZA 3HV8A 4EAMA 4HPNA 3DGRA 4GUJA 2VQUA 4O53A 1OM0A 3URBA 1Z42A 2EGZA 5HPCA 1YNYA 5HINA 4C6BA 5CEWA 1JD9A 3BXWA 1VJZA 3G1RA 2QULA 1FDYA 4UQEA 3WLTA 1DXEA 3PZUA 1Y8BA 3TCSA 1OZMA 3M0JA 3QBUA 1BLIA 2E09A 3T78A 1A5SA 4O19A 3NSNA 2GWNA 3W28A 3GC4A 1UCWA 1FHVA 4IISA 4FA3A 5EWFA 3UXDA 5TNVA 3BUVA 7XIMA 5E6YA 5D9MA 1DIDA 5M3WA 1VGAA 1FWRA 1CXIA 4S3GA 2NXIA 2PC4A 3B9OA 3MR5A 3UZZA 5JUVA 3WUEA 2W6RA 4GINA 1GCYA 2J88A 4FR1A 1BF2A 2E6AA 1KTCA 3B04A 3RIKA 1B4EA 1UOKA 1T0OA 3S5YA 3GD6A 1NFBA 3RB4A 1GKRA 1ISYA 4HB7A 3JVAA 5KFUA 2IBKA 3MUY1 4C7FA 1TTIA 1Z3NA 4FPSA 3U2OA 1V02A 2BVDA 3W7DA 2GGJA 3ES8A 1W9UA 4CQ8A 2QVHA 4F8XA 4UQAA 4XD4A 5JIWA 2RDWA 3WF3A 4IX0A 3L4YA 1AZ2A 1KR1A 5KSWA 3FDSA 2WZHA 2RH9A 4XD6A 3MBFA 3OIXA 1A4MA 1Q4NX 4UTTC 4OHQA 4KWWA 1ZRQA 2WQDA 1IGSA 4B90A 1CXFA 2TODA 2JEGA 3TR2A 2ZXQA 2CLKA 3LGEA 5FACA 2ZX5A 4BY3A 1OWQA 1VHCA 1F73A 2RGLA 4I7WA 1GG1A 1OK4A 4CNSA 1P1MA 1OJXA 4K1GA 2VYOA 2ZUSA 1E1CB 3RGTA 2WC7A 4N9EA 2XVGA 1PPIA 2DT2A 5C9RA 2FPYA 2XH7A 2XIIA 3W22A 5HMSA 4JX5A 4F0KA 3P14A 3CUJA 3AIEA 2ZUUA 3W9ZA 1DWFM 1PIGA 1R38A 1W1PA 3GB6A 4LAKA 4FZIA 4GNKB 3WQ8A 3RN6A 4ZXLA 3FGCA 1XYMA 2DW6A 3ME3A 2C2RA 3T4WA 3DHUA 4LYKA 2QUMA 1HVQA 4IQLA 1UG6A 1K70A 2FDSA 5DRCA 4OUEA 4ZA0A 2YL6A 3NQBA 3PPHA 4Z0JA 4HNCA 2SFPA 1QPNA 2JGQA 4Q8NA 3SW6A 3LG3A 4LVGA 4GQ0A 1QBBA 2G4FA 2L5HA 1YBQA 4YN5A 2PTXA 1D3CA 3IVUA 1UIPA 3RB6A 4IGSA 4IM4A 3KCLA 1V6UA 1PO9A 3PZPA 1ADDA 3H4XA 3CL8A 4DM1A 1UC5A 2Y4SA 1FCUA 2BBFA 1MUMA 3TV8A 2VFHA 3K8LA 5DEZA 2WBGA 3OHMB 4O28A 3CUGA 3PHAA 4TUFA 1U5JA 1JGIA 2BSLA 2AKMA 3P0WA 3B4UA 3G3MA 5DCBA 4H6RA 1Y5XA 1H1YA 3UW6A 4WOQA 4HZ7A 1VYRA 4JL1A 3WNNA 4M56A 3QZEA 3QQ1A 4CGTA 4NUWA 5LXXA 1J18A 1NJJA 3PBYA 4M51A 3K1GA 1IWPA 2JK2A 5GVJA 1CENA 3B8SA 5I09A 3QR3A 1HXJA 1SJCA 3CIXA 1J12A 2PB1A 2XIOA 4RZ5A 2J9XA 5DXXA 4BQ2A 4P5UA 4DJED 3B8UA 5I3IA 2QNEA 5HJLA 3NGFA 4KEZA 4RV8A 2HNHA 3LQLA 4BA0A 4N9BA 4DJFA 3L67A 4AEFA 4REQB 4H6QA 5GPRA 3ZJ7A 3FKRA 4PN2A 4G2DA 3H4WA 5BRQA 3LI0A 2D23A 1OC7A 3UWWA 1Z9AA 1TTPA 3DECA 1U5VA 2Y1HA 5KFOA 1QW9A 1S1RA 4GNVA 2FPVA 4LUTB 3ZOAA 2WM1A 5LIXX 2QIWA 3DIPA 1DL3A 3GGMA 3NO3A 1QRQA 3G24A 4G1NA 5E70A 1EH9A 1AZ1A 1XYBA 4J3UA 4KWOA 2Z7KA 4X0NA 1IR1A 5G4EA 4QWAA 4JFWA 4BF5A 2ZRVA 3N6JA 3NQFA 5K9XA 4LNCA 2C15A 3V0UA 3WQ6A 4DL2A 2VEKA 3MUCA 2QF7A 2DZXA 4US5D 4RDYA 3N18A 3W7HA 3BAYA 4J9JA 4MY8A 2GQ3A 1XRSA 2WTFA 4M3PA 6CGTA 1R7AA 1TE1A 3IN5A 2PRHA 3KBJA 1C93A 1XGEA 4XIMA 2DT3A 3HF3A 2J47A 3BSGA 1KKRA 3NOEA 1KBIA 1A5BA 3RLHA 3BLDA 3VZXA 4JTIA 3NXFA 1R0MA 5EKYA 3URNA 2DV0A 3EMCA 1PXGA 1Q7MA 4F0MA 3TJ4A 1IT0A 1TQXA 4EOUA 4P61A 3SFWA 4PUUA 5HAOA 3QJAA 3KTCA 1O6IA 3NIYA 1W5QA 4XAZA 1ICQA 2YKKA 1FWEC 2OYKA 2WVVB 5CXPA 4HK5A 2P50A 4PMXA 3A23A 1KFBA 3AHVA 1HJSA 4UTJA 1UWRA 2J7FA 3MWCA 3UXLA 2HVOA 4N4PA 1CXLA 2E9BA 1NY1A 1KM6A 1XP3A 1QI4A 3W24A 2PMQA 4RDWA 4X22A 3CZKA 2G0WA 3SIMA 2X2GA 3GFZA 1WZAA 3UBPC 3UERA 3EKGA 1XSJA 1KM1A 3LZ3A 2JIEA 2ZX6A 1HJWA 2WSKA 4AC1X 2P10A 4JTFA 3ZVIA 1LT7A 4HYRA 4JXCA 1N8FA 2ZYFA 1K1SA 1AUSL 3EOUA 4ZR8A 1Q5MA 2Y85A 3O0KA 4U3CA 4ZFCA 3LD5A 4YLWA 3QKEA 4LF1A 3CT2A 2D2GA 3F5LA 3FJNA 1JI2A 2XSAA 5HMFA 2MNRA 2G3FA 3GVVA 4JN8A 4ZSUA 4NJGA 3S47A 3LK6A 2XYLA 1W9PA 5JBDA 4F3HA 3N04A 4I8DA 3RAOA 1TWDA 2VM8A 3N2OA 1KBJA 3TP4A 1W5MA 2FZDA 2EG7A 3W2JA 5DLFA 3BV4A 1V8EA 2QR6A 3W6LA 4HYVA 4NXSA 3MSGA 2VA2A 1XD1A 3DXIA 3T05A 4IP7A 4M6QA 2WSRA 1TTQA 1EC9A 4YR2A 6PTDA 1XC4A 1UH4A 5BOFA 2IKHA 4IP4A 5EFDA 5TAOA 4WY0A 5I3HA 5E1QA 3NL5A 3JZEA 2VO5A 5T8GA 5GNYA 3RMJA 5FF2A 1H7WA 4AZHA 1HJQA 3L68A 3N9SA 2D69A 3WK3A 1WV2A 4PMRA 3LLFA 2ICSA 1FBAA 1Q6FA 4FNSA 5HJXA 2BOFX 2QCGA 3WQCA 3V6HA 1QUMA 4QSHA 1S38A 2XTKA 3IV3A 1A47A 4JICA 5DELA 3STCA 3N4EA 3NG3A 4Z1DA 1T40A 3V7PA 4RNNA 3LCWA 3QYSA 3TOYA 1M6JA 3RX3A 4X2RA 2EAWA 2QGYA 5LA0A 5CPSA 3R7MA 3T55A 1J0KA 1X38A 1GQNA 2YBVA 3DGBA 1QHZA 2TAAA 2B7QA 3P74A 5EMLA 3AWOA 4R8UA 5A95A 4ICNA 1XD0A 1JCNA 2QJMA 2Z1WA 1QO5A 2WNNA 2MANA 2C13A 5FL0A 1H60A 5FF7A 3W53A 1MI3A 3QC0A 5KT5A 3E2QA 4PMZA 4A3RA 1ZCOA 1CLXA 3P6LA 1C7SA 2ZQ0A 4XBSA 5HWJA 4JAWA 2VMFA 1YHTA 4ZE4A 2NX1A 1MSSA 2YBTA 3B8TA 1EWEA 1HFBA 3W7EA 4ASTA 3BCJA 1F3XA 3PK7A 1Q6DA 4AEOA 5AC8A 3H26A 3FSUA 3R11A 3ARRA 2XPKA 1MZHA 5DO8A 4IL0A 1VF8A 3MUZ1 4LV9A 1JCMP 4UMBA 4YIWA 4J3SA 4LAMA 3QMTA 3ITLA 1GPWA 1XH1A 1ZB5A 3BJFA 3NVDA 4KEVA 1LBMA 3PAJA 1OFQA 4L4OA 1H61A 1BPLB 4TIMA 3K4DA 1E51A 3B8DA 4GXMA 1E43A 3EX1A 2ALZA 4U33A 4G56A 4ZQOA 2Y8KA 4AHPA 1WOBA 4MFDA 4PR4A 3VUSA 1TUXA 3TSBA 2A5HA 2BP1A 4MAVA 4D6DA 5IM51 4QW9A 2PA6A 4LYPA 5FSDC 3VOGA 3O7UA 2O4MA 4MPQA 4PTXA 3WMBA 4PB4A 2ISDA 4DF0A 3M0KA 3W1UA 1Q6OA 3N2BA 2ZZ5A 5HDRA 4GE8A 1S3HA 4QDWA 4O3OA 2RGMA 4UFKA 2XIBA 3FYOA 4QAIA 1TJ1A 1W0MA 2XN2A 3ZVHA 3WENA 5XIMA 3C61A 1OIMA 4CVUA 4WSHA 3CAWA 2RDUA 3UVIA 4W84A 1JDCA 1B1YA 3CO8A 1BQGA 4KIEA 1WXYA 2ZKMX 2VRJA 4XSMA 3E0VA 1C9WA 4ORIA 4CEXC 3S4TA 3AXXA 3WD4A 1W1TA 4QW8A 2JE8A 2O7QA 4UMCA 1X7IA 2BY0A 3VA8A 4UB9A 1XLIA 3GR4A 1D2KA 4DXVA 4ENLA 1NM9A 3CUIA 4MNKA 2TRSA 3EPIA 1E6RA 3MI2A 3R5EA 4QJ3B 3U3HA 3LHWA 1X97A 3MFIA 5CGQA 2OXNA 1DIEA 2PWFA 2YL9A 4JIIX 2E1WA 4XKYB 4AVNA 1C91A 1SMDA 3GRIA 1VP5A 5H8MA 4B3ZA 1Q7QA 3IUDA 3A24A 2PE4A 4I9TA 4LUYA 5KFWA 3QN3A 4AEEA 4A29A 3E0LA 4NT0A 4LY8A 2JEIA 3E02A 2IS7A 1OEPA 4U6PA 3SN0A 4I7UA 1UUOA 4UZSA 1VIZA 3PTKA 3DUGA 2VDIA 3D3AA 3IJIA 3SO7A 1D3GA 1GOXA 4DY1A 2HE8A 2B7OA 3E2VA 4GC6A 5I24A 1R8LA 1GZJA 5EA9A 3B0XA 4E3TA 3DG6A 3T6CA 2C79A 4LUSA 4ZQCA 4GXWA 2KAUC 3AZTA 3S1GA 3EWBX 2YW3A 4U7CA 3BICA 3SQLA 3B05A 4GH1A 1LP6A 3W75A 3R12A 1H5VA 2QDHA 1PTDA 4PEKA 5TIMA 1PCWA 2V67A 1R3QA 4QISA 2PWHA 3WBWA 4DJDA 1HKMA 2GWGA 1TKKA 1BVWA 3L0KA 1VCGA 4OV4A 1F05A 5TQLA 3DEQA 4AUBA 2PTYA 1XPYA 3T2OA 3CZLA 1LZOA 4U3AA 3AMGA 4PODA 4FX7A 1DBTA 4PC8A 4D6IA 3AIVA 1YLVA 4GUHA 3T8QA 3S5OA 4ZL1A 4Q8UA 2OWWA 4E6MA 3MSYA 5IFTA 3H4DA 5C2XA 1QNRA 3W7KA 3GTIA 1GOQA 3P5ZA 5L1LA 5C2CA 3CQ0A 2OCZA 3AZRA 4PL2A 4KBXA 3TR9A 4OV9A 5H1WA 5AZ1A 4A2RA 1UP2A 2UV8G 7TIMA 3EZ4A 4GO9A 2QZRA 1I8JA 4ECSA 4HYKA 2QCDA 2INFA 4Z1CA 2WANA 3WNLA 1XLJA 1JVNA 1US3A 1EPVA 4JR5A 2CITA 3T42A 1K9FA 3W1TA 4LBUA 1UMLA 1VBJA 3VIPA 5K2ZA 3TYCA 1AL7A 4IX2A 3IIPA 3GIPA 3TC6A 3APTA 3HV9A 4G8TA 1WA3A 1FQ0A 2NX3A 4DAFA 1KCKA 2X7WA 3S5ZA 2DZTA 3OW1A 3PPGA 5HBFA 2O9OA 1TVNA 3LY0A 2J7CA 2VD8A 4CNUA 2R82A 3HTWA 3NGDA 4ZODA 1AW1A 3XISA 3CYVA 3E6EA 3VC6A 1GOWA 3RB0A 3NSMA 4ZVJA 5JH2A 3CT7A 4IMEA 5HOSA 1BWVA 2D73A 4CD4A 2PDKA 1IXQA 2FZMA 1JCLA 3RJXA 2FLPA 3W82A 1U33A 3WLKX 3BO9A 2GZXA 3LQGA 3ABZA 2X16A 3NDZA 2XGQA 5RUBA 1UR1A 3O16A 5AC7A 1QPKA 4KRTA 5EMYA 4C5ZA 4HU4A 3K4AA 2Q8ZA 4TQRA 5LNWA 3ABSA 4ED7A 4CQDA 2V3DA 4BF7A 3BQ1A 4I5UA 2X1UA 1GUVA 1Q7ZA 4CCEA 4G1KA 3W0KA 4LCQA 5I79A 3MP5A 1F4HA 1AH0A 4L5ZA 1J10A 3MMTA 1XCFA 2ZZ7A 3VMNA 4ECTA 3T5KA 1YXYA 5CPNA 2A1YA 1LRTA 3T0CA 2BY1A 3BURA 3EWXA 5LXEA 3IGHX 4R85A 1TWIA 3PR4A 1Z44A 3SCSA 3L4TA 1CECA 1VFTA 5EMMA 2J77A 7TAAA 1W2PA 1KWGA 3S3GA 1FFRA 4IGNA 3VCRA 4Q4PA 3UCDA 2WMIA 4LS1A 1AMKA 4HPHA 2I1OA 2V4RA 3A9BA 5CH9A 2P0OA 1PZ0A 1ESWA 4QTGA 3ALFA 3W37A 3A12A 2IKJA 3GAKA 3UXIA 1EHAA 3PWIA 1Q6EA 1YE4A 4H6EA 1O5RA 3OOQA 1VFFA 3UZXA 2EKGA 4OBSA 3OZPA 3T0TA 4KCVA 2UVUA 3G0SA 3MCNA 4PBGA 4ATDA 3QV6A 4OJYA 1E73M 1J93A 1GVEA 4MGGA 3VDHA 1HKJA 4QHRA 2X7VA 3MDUA 1M7XA 3G22A 3DOPA 2Y7EA 4BJHA 3UZJA 4E8GA 1KGUA 3M46A 3CS2A 4K1WA 4DX3A 1D7KA 3HPSA 4B5VA 4BHYA 5CGTA 1MXGA 1DJGA 2WJFA 3VKCA 3PZTA 1A0DA 1U1UA 1OX6A 1VEOA 1CEOA 3TX9A 2BLEA 4HHMA 1GWJA 2GPTA 5A6MA 3M0LA 4LAZA 3L7RA 3GXIA 3OZOA 1XISA 2JEPA 5CZ0A 2C7FA 4HMCA 2R8JA 4UZUA 1VBGA 4AXKA 1TPUA 4AZBA 3TE9A 2OR2A 4QWEA 3M5YA 1ZBKA 3MW7A 2H3DA 2YFNA 3GIYA 2FGLA 1PX4A 1ZFJA 3VD5A 2QDGA 5C9UA 2DZBA 4HSNA 1BTMA 1LWIA 1IV8A 4ZE5A 1PL9A 2VRQA 3RO8A 5KFZA 3RPTA 2BHUA 1GVIA 4C6LA 3ABOA 3URQA 3GDLA 3OGVA 4MLJA 5KFXA 4ORMA 1JXLA 1XIEA 4S3BA 5T26A 4S2BA 1H7RA 1JRBA 1CLVA 2Q8XA 3FVMA 1I2QA 3B9AA 3FNDA 1PHQA 1DKWA 3DX5A 1JQXA 1DHPA 4N6FA 2Z1BA 3HM7A 2HS6A 4PUKA 3PFRA 5AY7A 2W8KA 1LRQA 4RL3A 1UBPC 2OSXA 3MJMA 3A22A 5EMKA 3W2MA 2ZFAA 3WEMA 2CIPA 4BWLC 3Q8QB 3TNBA 1GHSA 4Q8FA 3HN3A 4DVOA 3WNKA 2NVCA 4INFA 5I3DA 1XKJA 2CZEA 3GK0A 3UZYA 5KT6A 3ZYZA 1EUAA 3W23A 3GXDA 3GSMA 1WCGA 1JFXA 4PCPA 2PDNA 3WBAA 4A6GA 1C7TA 4MM1A 4JFSA 4JHOA 5J5DA 1JCJA 3FW6A 4NL1A 4V27A 2YPIA 4F0HA 1HIZA 2HBXA 3IRDA 4NX0A 4JTGA 2FQIA 3L0GA 1CXKA 2FKPA 4DPPA 4HU3A 2H3BA 4BEQA 1ECQA 4XISA 4K7VA 1B4KA 2C1GA 4CN4A 3HG3A 2ZE0A 3SZ8A 4H4IA 3WL1A 3S6DA 3KHRA 3FYYA 4XO6A 3VKKA 4GYKA 4AZ7A 3PC0A 1E1CA 3ARQA 3ZFHA 3EDKA 3MP4A 1JPHA 2HVNA 4Z08A 4JTSA 3UJFA 2C0HA 4GI4A 4EXAA 3AUJA 4V2XA 1KTBA 1J2WA 3KHLA 5DN1A 4W87A 1KCLA 3PULA 4W7UA 4YMZA 1MW1A 1NDYA 1GEHA 1EQPA 1EHNA 4D9PA 3NZQA 3VUPA 3GHSA 1K1QA 3GZAA 1NDWA 4TX9A 2ACSA 1UD2A 5BXTA 3M43A 3G6XA 1SM9A 1B9ZA 3BVJA 1W3KA 3ITGA 2VC9A 4FR6A 4AIBA 1TV2A 4QJ4B 2PURA 3N25A 4OU1A 1C92A 4R34A 2YZRA 4HSHA 5LHFA 2VFGA 4UFLA 4QXIA 4Z2IA 3EOSA 4KRUA 3GHUA 3TEVA 3PW0A 2CEQA 3BLFA 5KZEA 2C22A 3ICJA 1ZENA 5KFSA 4L56A 4CCZA 3FYPA 1BG9A 1EEPA 1LL4A 1RD5A 3WIJA 4RX0A 3FDKA 3MYOA 3F4NA 5CZSA 5KT4A 2JFEX 4M5PA 3NTYA 2DQWA 3E2RA 1LRNA 2X1IA 3PBMA 1H11A 1QNSA 3G6LA 1NWRA 3W76A 1RJPA 3VZZA 3PZ9A 1SO3A 4FS2A 4ECXA 1W3HA 4H04A 5B80A 4RCXA 2PUZA 1W1B1 4X9SA 4OGZA 3WJSA 4LAUA 1PKMA 1RK5A 3SJNA 1IT8A 3H6OA 3MFHA 4ECRA 1H0GA 1W3IA 4L64A 4UNLA 2ZA3A 3VO0A 3ONBA 1QI0A 4IH3A 3MR3A 4BQ5A 5KZMA 4HA4A 4DZAA 2IQTA 3R0KA 3RPMA 5IFPA 2YL5A 5LHEA 3TSDA 3H55A 3THDA 3VIJA 5FCZA 5A2AA 3O8AA 2QDDA 4ZMGA 4LUTA 1V3LA 3MP3A 1VYPX 1CXHA 4URIA 4O0ZA 3T44A 1R2SA 5KG2A 3VOJA 3NR0A 4L1GA 2OZ3A 2FLLA 1K03A 1IZCA 1XIDA 2A6LA 2VVNA 2D24A 2FMNA 4U2ZA 4KWVA 1TMHA 2OPJA 3VD4A 3S2NA 3MANA 1JDAA 1E9LA 2VOMA 3EXRA 1W91A 2WLZA 1BRLB 4DEFA 4ED1A 3CV1A 4M19A 4PSRA 2OZ0A 4NJJA 2W91A 4DL7A 1YXDA 2W92A 4IIDA 3ZSSA 1J0YA 1JCTA 3P60A 4J1OA 1SSGA 3WMLA 5HULA 2XWEA 1LQ0A 1GGOA 1M53A 4KETA 2IXUA 1PSCA 3M16A 3FEQA 3O9NA 2C1IA 2P0IA 2Z7GA 3KVLA 1AVAA 1ZY9A 4MWAE 2HVMA 4D6EA 3EB2A 3UQNA 3EWUA 2ATMA 4JQ3A 4WEVX 1Q2RA 4A3YA 1BXBA 2EPLX 3AAMA 2XCAA 1FWSA 3LXCA 5HJYA 3E3HA 4Q8VA 3RR1A 2NQHA 5D37A 1LG1A 5G4WA 4YQWA 5L9XA 4C1NA 1UKTA 2VEPA 1QNOA 3SBFA 3RAXA 1GHRA 1ITQA 3AYRA 2PI6A 4DJFC 3PVFA 3GUGA 2WZEA 3TW7A 1XF0A 2QLYA 4YS1A 2CWNA 4JX4A 3G6MA 3C2VA 5FEWA 3O6YX 4M81A 1QU4A 3MR6A 2A21A 2Z29A 3G8EA 3AXMA 4N4QA 3MBDA 4D6FA 2QMKA 5EY5A 1KRBC 1XLCA 1HKIA 3LXBA 1SVDA 1OX5A 5M17A 1WKYA 4GYPA 3ZQ9A 2W9AA 4JTDA 3WD2A 3MSRA 2JEJA 3DFYA 1EKOA 3BARA 1WBJA 4NQ1A 2G5WA 2VX6A 1EJ7L 4Q6XA 1LL7A 1U1HA 1XI3A 1E40A 2JEQA 2QAPA 4H7ZA 3WN6A 1VFLA 1W5NA 5CZJA 2E6DA 3KCJA 3PUGA 3H23A 1UZHA 2QT3A 4YL2A 1U83A 1MDRA 3KCOA 5DQGA 3BJYA 3DYMA 1XDJA 3IJDA 1SSDA 3RBEA 1MXDA 2UY5A 4F2TA 3S2CA 1DV7A 3SCUA 1L6WA 3LLDA 5FESA 1KCXA 2LLEA 5EDWA 3BWWA 2ISVA 1XLDA 3W7RA 1LQ2A 5AYXA 5E0FA 4XAPA 4FNUA 3LRKA 1WKEA 5DQHA 1HF6A 1JPIA 4UTIA 3W3OA 1G4TA 3AHYA 4DZIA 1AMYA 3W85A 4H1ZA 3E0WA 3UWVA 1EDGA 4OKDA 4UIOA 4DN1A 2C19A 1H5YA 1EJRC 5AHEA 2I7GA 4IG2A 2PDJA 1GPFA 4JHMA 4R7JA 4WR3A 4Z1YA 3T07A 4Q6JA 2DZSA 4OBTA 5I07A 1F3TA 2ZXDA 1MQPA 4GBDA 4P7NA 1A5MC 5TD4A 2GVGA 3WLRA 5DG7A 3BJSA 4PUEA 1WDDA 1QVBA 5I7GA 5KFAA 4HK6A 4RPQA 2VDHA 2B7NA 4L80A 3ATYA 3LCLA 3I3BA 1PCKA 4HMEA 3MWAA 3OVRA 4TU1A 1PDYA 5C7VA 4I90A 3VDBA 3ZXWA 3D5HA 3L5AA 4CLMA 1DWAM 3TFCA 4P8WA 4C6KA 5A6BA 3N2CA 5FD0A 1DYSA 1J6PA 4MB4A 3KE0A 1EJTC 2WHJA 1UBSA 4WHBA 1TCDA 3RO6A 1SO6A 3TXVA 3DDMA 3BG5A 3H4BA 4W5UA 2NQJA 2FZBA 2WJZA 4XZBA 2QV4A 1IEQA 3I3DA 4PBEA 4G7EA 3QVQA 3E12A 2FZ8A 1YTEA 3MJYA 2QPXA 5BYWA 4EACA 4YNGA 5G1YA 3RX4A 4AHOA 5J8LA 4RNJA 2UZ9A 3MDWA 6TAAA 3HPAA 3LM3A 3Q58A 3WLHA 3HGSA 2XM2A 1JUKA 1FWWA 3EX2A 3ARSA 1GW1A 1H7OA 3F2BA 1JYNA 2JIWA 4F9DA 2XH0A 4CEUC 2XH4A 1O5KA 4GK8A 3CMFA 4JN7A 3E74A 3ZJ6A 1OFOA 4Q33A 1KA9F 3MI6A 5KFIA 1GVQA 2YL8A 1UP3A 4KFOA 3TH6A 5LSMA 1IWBA 2VGFA 3WFAA 2RDTA 6XIAA 4UFHA 2XCPA 2XIMA 3PB0A 3SB0A 4C65A 1LF1A 4XVEA 3R1ZA 1BSLA 1NDZA 4IHCA 5A8GA 3C0LA 1UZDA 4H8HA 2R1NA 4A3UA 1JXKA 3WQ4A 2CZ5A 1OYCA 2HNEA 3GNOA 4MWAA 1I9CB 1M7PA 4H9YA 1L9WA 3WD3A 4DWDA 4IRCA 1TIWA 3CHEA 2OT1A 1Z89A 1ICSA 5EPDA 1J0HA 1LWJA 1N2VA 4QWCA 5CPTA 3WQFA 4XO7A 3CH9A 5KG0A 4PMQA 3TONA 2NZLA 1OFBA 2X40A 2P5NA 3TMQA 2P8CA 1A5LC 4V28A 3W2KA 4FI4A 2VZSA 3MR2A 3SUWA 4KFPA 3FK4A 1E15A 4DEZA 4GBUA 3TVAA 4RE0A 1HJXA 3TQPA 4D8LA 4O8RA 2OELA 4GGHA 1WKDA 4C6FA 3ARVA 2QJIA 2VX7A 3C86A 4A8NA 2QCHA 4W85A 4A2SA 5BOOA 5AYBA 4UR7A 3BG9A 4MNLA 3MC5A 4O1AA 1NOWA 3KOFA 1XCXA 4JN6A 2C16A 1ONWA 1W1IE 4EWND 4XKYA 4LBRA 4L61A 2AOSA 4GCXA 3RF9A 1MO0A 2GGHA 1TV7A 5FJIA 3TYBA 3RYSA 4A8IA 2WWCA 3LRLA 3GLCA 2XWDA 1NQKA 1GJPA 1IR2A 1DXFA 4E0CA 2NQZA 1UWSA 5IBXA 4F79A 2PDYA 2ZWYA 3W07A 1BEUA 2NVAA 3HA1A 3EWYA 4EPDC 3NPXA 2Y62A 4FBTA 4OTKA 3LNMA 4FF5A 1XIBA 3O05A 1RLDA 1FX6A 4GACA 3CZ8A 1I1WA 4E5TA 1YBQB 2GDVA 4C60A 1BG4A 2C91A 1U2YA 2YA1A 4C6EA 1G01A 6TIMA 1XQKA 4OT7A 4CN6A 4I9JA 3PPCA 3IS4A 3PJUA 1H62A 4PUMA 4EP8C 4J35A 4QE5A 4GY0A 2PLKA 3LTYA 1PVNA 4TXEA 1FDJA 4QR6A 2P1FA 1LORA 1JX4A 4PMJA 3BAWA 6REQB 2E9LA 3O63A 1BVNP 4EBEA 4GUGA 1KLZA 3BW4A 3LYEA 3KVKA 4M8UA 2X42A 4GISA 5I3GA 1VIWA 1XX1A 2WCGA 3OZMA 4MUPA 1SO4A 4GIYA 2WWDA 3QLLA 2G50A 3TROA 4TO8A 2Q8LA 2ON3A 1VCFA 2GVEA 3VKAA 4K38A 3NVTA 4WSKA 4H41A 2V8ZA 3I10A 5A94A 4W93A 4FMVA 2O55A 4S39A 3GYCA 5CAHA 2OZ8A 4WCJA 2QCMA 4RE3A 3GW0A 4KGLA 4S23A 1EPXA 2CLMA 1B3YA 3N3TA 1H09A 3KRSA 3GNNA 3H2OA 2R24A 4GZEA 4L1WA 1U30A 1SUXA 4LFYA 1FXQA 4HJFA 2WQPA 4FAMA 3RM4A 1TYGA 3FKKA 2ZC8A 3ZT6A 1DTUA 2TSYA 3CC1A 5FF4A 2BWGA 1KM0A 2E25A 1GVYA 1HO4A 2Z1XA 3L4XA 4UCGA 2Z25A 2JALA 3NQAA 2XDFA 3HQ1A 5KZDA 4H8NA 3V4BA 4XZWA 1W9DM 4DPQA 3VCNA 1K02A 1HN1A 5CLTA 4IIEA 3T2QA 1W9XA 1AQMA 1RJQA 3HGOA 2NV1A 5HNNA 2DY3A 1UKSA 2YB4A 3WEZA 1K7XA 1ME9A 1S0OA 4O14A 2VEIA 3R8GA 3G6YA 4NILA 5BXSA 1VEMA 3WF2A 1PBGA 4HYWA 5AVNA 4UTUA 1EOKA 4MY1A 2IPFA 4F2UA 3KS6A 3TN3A 4IICA 1R3VA 2BVTA 4F0SA 3N9RA 2BB0A 1ZHAA 4FOJA 3LXAA 2I9EA 1WZMA 5DLGA 2HQAA 2R8WA 4XBKA 1CIUA 4YU1A 1HJUA 2WNZA 1DXIA 4ICCX 4RR4A 4DWSA 1B3XA 3OBAA 1UZ4A 3SAZA 3LV5A 4MSSA 3SQSA 4AMCA 2HE5A 4GA8A 1TWZA 4CU8A 5FEPA 3WD1A 2C8NA 2BMBA 3CEPA 3VOFA 3FX4A 2V30A 4NY2A 1JYVA 3TKFA 4GYJA 5GJMA 1F9CA 2QKFA 4X63A 4MJZA 4AXNA 2C0AA 1F2JA 1UD3A 1VH7A 3W27A 3CUXA 4ECZA 2WBKA 1GK8A 2PDBA 3W7OA 2AQVA 1OYBA 3QPYA 3GG8A 5E5CA 2ISSA 2YXGA 4N2YA 4NNAA 1ITCA 1KBBA 4QS6A 5I03A 3HG2A 2BR0A 1D9EA 4GKLA 2W27A 5EYWA 1TMLA 1XINA 1ADOA 1DWIM 4ED6A 2J25A 2PRMA 3IJQA 1MDLA 3M5XA 1REQB 3NOYA 3PVXA 3L12A 5AFDA 3WQVA 5LNSA 4WKHA 3ANUA 4FLQA 1ISXA 3ARTA 3VD7A 4WGXA 5I3JA 2YA2A 2WVUA 4H8VA 3WF1A 1UJPA 3VI2A 5B7YA 1GQLA 5CZTA 2QMJA 3TXZA 1K8YA 3M0ZA 4IPJA 2BY3A 1M3UA 3EXSA 5AHIA 1RR2A 3SRKA 4E8CA 3QZ8A 5HATA 1E3XA 3FJ4A 3EGJA 1VAHA 1XBVA 4QLJA 3W70A 2FJKA 1TV3A 2QAFA 4W9TA 1X39A 1XBXA 1WDPA 1F61A 2BGQA 3M5VA 2PBGA 2DSUA 4WY0B 2WC3A 3CZJA 3JUGA 3M64A 5CBJA 3PBWA 4JTCA 3FAXA 3A3HA 3NUKA 3EWCA 1MEIA 3VD9A 5FEXA 4GFSA 5LYRA 1E1EA 1BYDA 3R4IA 3RU8X 1R46A 4AZ6A 2WMHA 4QCFA 1NF0A 1A5CA 5KFCA 2WV8A 1ZBVA 3FS2A 2QJHA 3I7SA 2WCAA 1DJYA 4QNEA 4GNJA 4L65A 1VB9A 4UNIA 2PDGA 3N9KA 1ZL1A 2BNJA 2ZA2A 3SCTA 4NYUA 3CHCA 2QIIA 1VR6A 3N73A 3WG6A 4Q43A 3VIFA 3UP8A 1K9DA 3M5ZA 3EOLA 3L9CA 1JG9A 3VDGA 3SRHA 4I9MA 2KZHA 5AN7A 4R8UB 3V5FA 4MOZA 3RPDA 3WQGA 5EWEA 3N34A 4ZZ9A 4J3WA 4LF2A 2OKTA 5ENLA 3BZJA 1IEXA 5DBTA 4AVOA 2XZ7A 1UR4A 1GQKA 1OFPA 1QPQA 2QUUA 4I6VA 4KMQA 1DQWA 4UBPC 3GH5A 1EDQA 2GJPA 1POJA 4AYSA 4JKKA 1V03A 4E2DA 1VS1A 2BXYA 5C71A 3B9EA 1P6BA 2F2HA 2IPGA 3DFOA 4GG9A 2EEXA 1ICPA 1FWFC 1MEHA 3EEZA 1V08A 2YSWA 3CPGA 4GRSA 1KXVA 2VX4A 4G7FA 3S8HA 2J27A 3C56A 1C29A 4ECUA 1C3FA 2VX5A 4MY9A 1BF6A 2ZE3A 3E0IA 4AG0A 3EAUA 1BAGA 3ZLFA 3EA2A 3WH5A 1EGMA 4NVTA 3TW6A 3Q94A 1DIKA 2BQRA 2G41A 3VAVA 4Q8WA 3SECA 1UOZA 1RALA 5FL1A 2FLNA 4GX8A 2E8YA 4DYKA 2HPMA 4XTDA 1W2VA 5T91A 3WDPP 3HBLA 1X8FA 1EDTA 2J7BA 4Q7IA 5DQIA 4XZHA 4RNIA 4C6NA 1HP5A 1MUWA 3F5KA 4DO7A 4LYRA 3PJWA 4NRSA 1HW6A 2D22A 4RNMA 1JI1A 4Z2HA 1OCNA 5MKGA 3KBWA 2UVVA 4LEFA 3A6OA 3REQA 5EBUA 3RFAA 4DJDD 1MMFA 4QCEA 1SZFA 1EQCA 2YBUA 4CD7A 4B5TA 1JCXA 3H53A 5I2UA 3AIWA 1YDOA 3ZVHB 4R3UA 2YCLA 2OZTA 2O9TA 5JXQA 3G1YA 4R9XA 3EEGA 3W01A 1JIBA 1W9BM 4EWJA 2Y89A 3LBOA 1X7FA 2PWUA 4FNRA 4ZOEA 3DG3A 1TZZA 4M6VA 3CUHA 3DFSA 2BASA 3ZMRA 3DHPA 4WJ8A 3IAQA 2VNCA 5PTDA 1TPH1 1UKQA 4IIHA 4UNKA 5KFGA 2FPTA 3TN6A 5CJ5A 1FFQA 3TJLA 3L5MA 1OCBA 3W83A 4XTIA 4XBJA 2F84A 4OECA 4S2CA 4F40A 3VILA 3SUVA 2VA3A 4LVFA