1XRTA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
422
structure length
369
Chain Sequence
MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLEDRLALIEGVKRGIIDCFATDHAPHQTGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Dihydroorotase
total genus 137
structure length 369
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrtA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrtA02
3CS2A 1DPMA 3KM8A 4H9YA 4IFKA 3PNUA 4DI8A 1FWBC 3TN3A 2G3FA 1UIPA 2QT3A 1EJWC 4HK7A 4LH8A 3LY0A 1RAKA 4R85A 3GUWA 4EP8C 2UBPC 4CEUC 3LGDA 4XAFA 4CNUA 4PCPA 1V4YA 2HPMA 3NURA 1KCXA 3AU6A 1FKXA 4E3TA 3DUGA 2R1PA 1PSCA 2HNHA 1J6OA 5LXXA 2R1MA 4KF1A 2Z28A 4KQNA 2YZ5A 4IF2A 3T1GA 3HTWA 4HJWA 2CZVA 4XD5A 3IGHX 3GTIA 1ONXA 3GGMA 1R9ZA 1YBQB 4C6EA 2Z24A 2PLMA 4PE8A 4G2DA 4NI8A 5HMEA 4GY7A 1HZYA 1NFGA 2XIOA 4GOAA 4R7WA 4WVXA 3FEQA 2Q09A 4ERGA 4LCSA 4B3ZA 3CAKA 1I0DA 1VFLA 4LCQA 4KEUA 3SFWA 1EJSC 4XD6A 2Z2BA 3DC8A 1NDVA 3E3HA 4XAYA 4KERA 2VUNA 4QS5A 4BKNA 5AKQA 3GRIA 1PB0A 4IG2B 3TN6A 3K4WA 4HA0A 4LAMA 3O0FA 2YXOA 1RJPA 2FTWA 2I9UA 4C60A 4DYKA 1S3TC 1A5LC 3G77A 4LAKA 1ITUA 1A4MA 1O5RA 4NG3A 2GZXA 4C6PA 4G7EB 3SO7A 4EPDC 3AUOA 1GKPA 3B0XA 1FWIC 1EYWA 3PBMA 4V1YA 1P1MA 3F2BA 3WYZA 3OODA 1E9YB 3QY8A 2O4QA 3E0FA 4ERAA 2VHLA 4LALA 1RA5A 1I0BA 4BJHA 3WMLA 2FVKA 4RDWA 1FWFC 2Z00A 2E25A 4GX9A 4DIAA 2A3LA 4I6VA 4DNMA 1GKRA 2R1LA 5E5CA 1M7JA 4H9MA 4XAGA 1J79A 3K2GA 4AQLA 3URBA 4C6IA 3T8LA 1ITQA 3IACA 2P50A 4CNTA 2Y1HA 3C86A 4EPKA 4IFOA 1P6BA 2AMXA 4BY3A 3GTXA 2ZC1A 1IE7C 2WJDA 4ZSUA 2VC5A 4WGXA 4H9ZA 3OOQA 1R9XA 3MJMA 1POJA 3UPMA 2GOKA 1V77A 4RDVA 4H9VA 4D8LA 2BB0A 1A5KC 1WXYA 3GTHA 4J35A 3OVGA 3CJPA 3O7UA 3TNBA 1YNYA 1ONWA 4C6NA 4DI9A 4ERIA 1XGEA 5FSDC 2D2HA 3N2CA 4RE0A 3WZ0E 2FVMA 3ID7A 3S2JA 3NQBA 2OB3A 3MSRA 4DO7A 1FWJC 2FTYA 3OJGA 4LCRA 2Z25A 1NDZA 1POKA 2E1WA 4ICMA 1FWCC 3EWCA 5CH9A 4J2MA 1V51A 2EG6A 2HBXA 3IPWA 4XAZA 1XRFA 1XWYA 4WHBA 2OODA 2Z29A 1EJUC 4C6MA 2VR2A 2OOFA 1WXZA 4R88A 2QPXA 3PAOA 1YIXA 4JOMA 3PANA 1W1IE 1RK6A 2ICSA 3LGGA 4DZIA 1M68A 3GU1A 2OGJA 1QW7A 1QXLA 4KESA 3LU2A 4QS6A 1V7AA 2WJFA 5HMFA 4LAOA 4I6KA 1EJRC 4HK5A 2VC7A 4C6BA 3A3XA 4XD3A 3A4JA 3F4CA 2D2JA 4IG2A 2ADAA 4LFYA 3MPGA 4KETA 3UBPC 2AQOA 3TN5A 2FFIA 2UZ9A 4V1XA 4L9XA 3GU9A 4QRNA 4C6FA 3A3WA 3EGJA 3MVTA 4KEZA 1RJQA 3E38A 4F0SA 3GIPA 4GY1A 4PBEA 3GIQA 4GZ7A 4CQCA 2EG8A 3UF9A 1NDWA 4OFCA 2PGFA 1UMLA 4B90A 1FWDC 3T81A 4H00A 1V79A 1YRRA 4F0RA 2PAJA 1NDYA 2PUZA 3MVIA 4IGMA 3QY6A 1EJXC 3RYSA 3QGAC 4IFKB 4NP7A 5A6TC 3MTWA 3UR5A 1RK5A 3E0LA 4RDZA 2Z4GA 3EWDA 3LNPA 2IMRA 2ANUA 4B92A 4GC3A 4Z42C 3S2NA 1KRBC 1XRTA 4J5NA 2VM8A 2OQLA 3S4TA 4PBFA 1RJRA 4LANA 4C6QA 3GG7A 4C5ZA 4H01A 2Z2AA 1EF2A 2PGRA 2Z27A 1YMYA 3IRSA 4LEFA 2Z26A 3D6NA 4C6CA 1O12A 3F4DA 4H9XA 2HBVA 4B91A 3IV8A 3IJ6A 4UB9A 1UIOA 3PNZA 3RHGA 2W9MA 3HM7A 3S2LA 4CEXC 2P53A 2R1NA 1PO9A 1FWGC 4GYFA 4INFA 2R1KA 4YIWA 1KRMA 3ORWA 1K6WA 4DZHA 2I5GA 3ISIX 4UBPC 5HMDA 3URAA 2HPIA 4RZBA 1A5MC 3AU2A 3R0DA 2F6KA 4C6KA 3F2DA 2O4MA 4IH3A 3QY7A 1KRAC 2GWNA 4QROA 2GWGA 3E74A 3B0YA 3E2VA 4GK8A 4H9TA 3HPAA 4GY0A 4IGNA 1EJVC 1K70A 3MDWA 4DLFA 3GTFA 3LA4A 4EPEC 2WM1A 3RCMA 3JZEA 2AQVA 1EZ2A 4TQTA 4CQDA 1KRCC 3BE7A 3IARA 1PTAA 3URNA 4C65A 1A4LA 3ICJA 1P6CA 5FSEC 3UR2A 1J5SA 4MUPA 3FDKA 4GX8A 1EJTC 3FDGA 4H9UA 4KIRA 2WJEA 3MKVA 2EG7A 3URQA 1FKWA 5G4HC 2GSEA 1RA0A 2YB1A 3TN4A 3RN6A 1K1DA 4C6DA 1GKQA 4CNSA 1FWEC 1J6PA 4CQBA 4ZSTA 3NEHA 4QSFA 1FWAC 3MDUA 4IQJA 2DVTA 2QVNA 3OU8A 4KEVA 1R9YA 3ITCA 2P9BA 1A5OC 3S2MA 3GU2A 3QGKC 2BGNE 1BF6A 4C6JA 2Q01A 3OQEA 4F0LA 4IFRA 3F2CA 1ZZMA 4EPBC 2QS8A 4QTGA 4RDYA 3DCPA 3LSBA 3K5XA 4HK6A 2D2GA 4AC7C 1E9ZB 2HQAA 3V7PA 1UBPC 2YB4A 4C6LA 1JGMA 2Z7GA 2DVXA 3B40A 1A5NC 4PCNA 4C5YA 4DLMA 2RAGA 4M51A 4XD4A 4L6DA 4C6OA 3LS9A 4GBDA 3LSCA 4P5UA 4GXWA 1FWHC 2DVUA 1ADDA 1YBQA 1M65A 4G7EA 2KAUC
chains in the Genus database with same CATH superfamily
1XLEA 1IHIA 2MUCA 1QO5A 4IFKA 4Q7BA 1Z32X 2WVVA 2QT3A 3GM8A 4HQVA 4B9YA 3QPEA 4OWGA 2V5CA 2A7RA 2YDRA 1KM0A 1WPCA 4GZIA 2C18A 1V4YA 1TA3A 3DXIA 1F5ZA 3TTYA 1VFFA 4FBUA 2GPTA 4JGDA 1ZBCA 4GZJA 4KF1A 2YZ5A 4O0KA 2Q8ZA 1UJQA 3L5MA 4D1IA 1ZB5A 2ZXBA 2DIKA 1VBJA 3IIXA 3BJSA 4A8IA 3IGHX 2J9ZA 1T41A 2DU2A 1IV8A 1TFVA 7CGTA 2ESCA 3Q67A 2OLAA 5C9RA 2OEMA 4HNUA 5EB8A 3AMCA 2FJKA 1JZ3A 3G8EA 5D30A 4AU0A 4DUXA 4UFMA 5KFXA 2XIOA 2DZBA 4HSHA 3BAJA 3GKAA 1JNDA 2DEPA 4FB7A 3E5BA 4XD6A 1AW5A 1I75A 3K13A 3R58A 4XAYA 2VUNA 5CBBA 4QS5A 2C2EA 2X7WA 4JNYA 3VOGA 3L4WA 3CV1A 5E1QA 3VNKA 1VC4A 3RRAA 4Y8EA 1XI3A 5L6UA 4PMOA 4DWSD 3W7KA 2E6YA 2W91A 3O15A 1LZOA 4R7OA 3WELA 4UZUA 5HANA 5D2XA 3VZYA 4V1YA 4AW7A 4RUBA 3E1F1 2VFHA 4PB4A 5I2UA 2DQXA 4JFUA 1HKVA 3APYA 2QVHA 1J93A 1T3NA 1WO2A 1TPWA 1AK5A 1LLWA 3BLKA 1PPIA 1NARA 4HU8A 3TAKA 3VE9A 3RILA 1EO5A 4XSMA 2QJMA 4ZQOA 2PGWA 1QPNA 1QJWA 4ZODA 4JY8A 3LMZA 4WDXA 4DL7A 3PM6A 3DECA 4JKMA 3LOTA 2FLPA 2E5CA 3LNMA 4JHZA 4ORIA 1R0MA 3W7IA 4GC4A 3G1YA 5CQ1A 4MYXA 3O7UA 2ZZ4A 1PIGA 5I3GA 1JUEA 4W7VA 4YVXA 3KBMA 1VJZA 2AGQA 4ZOAA 1U5JA 5DG9A 1UH2A 3ANYA 3ELFA 3WZ0E 2AAAA 3MS8A 3L0GA 1DHPA 3BSMA 4PL1A 3RBEA 5K3VA 1RCQA 5C2XA 4N2YA 4O1AA 4FEZA 3KCLA 1LDCA 1Q3NA 3ZS4A 4DUWA 3AIUA 3BAXA 4RV8A 4J2MA 1V51A 4XVEA 5DGAA 4OE7A 2ZA1A 4TVUA 4XZ9A 2Y7GA 2WV8A 3ZOAA 1EJUC 4O53A 3A3HA 2DZVA 3U6WA 3O63A 4DJFA 2BWGA 3CHCA 1HVQA 4PSPA 1EWEA 3NQFA 3MMUA 1PKLA 4RNOA 3H26A 2VRQA 5AFDA 3T09A 4XD3A 1MZRA 4QP0A 3KOFA 3LZ3A 1KXHA 2XFRA 2AQ4A 2FPVA 2FGBA 4XG1A 2QCCA 5A6BD 4KEZA 1L2UA 1YW1A 4NRSA 1Y7VA 2CERA 2XSBA 4CQCA 1XM3A 3UF9A 1YDYA 4FA3A 5LIKX 5K4ZA 1MXGA 1EBGA 2DZAA 1UBSA 1YTEA 4FR6A 1CX9A 1V79A 3QEZA 4DO5A 1QW8A 3ALGA 2VKZG 3UEQA 2C6QA 3UGVA 3PW7A 3CT7A 3EWDA 5I3HA 4J5NA 2C8NA 3IIPA 1LL4A 1EOKA 2ZFAA 1VAHA 3L66A 4Q8NA 5D8WA 2QMJA 1TZ7A 5AYZA 6A3HA 1UD6A 3D47A 2I16A 4LEFA 2QPSA 4AY8A 4AY7A 4F50A 4WIWA 4CQ8A 4DWSA 2WVVB 3R0KA 5DXYA 5KFTA 3M0VA 2JEJA 1TO3A 1W9BM 3NO5A 4LNYA 3B4UA 3ZT6A 2EGZA 3MQTA 3G1XA 3MT1A 3VOIA 4QJ4B 2DT3A 3HJZA 1SFSA 3PZTA 4FX8A 1XIFA 2W66A 2GVLA 3FFSA 3GV5B 4O52A 3QZ7A 3WKZA 2J66A 2PZNA 4DF0A 3ECQA 3ZSSA 1B2YA 2I9EA 3WH9A 1LUCA 1E51A 1SO3A 4IMEA 7A3HA 1XFBA 2RDUA 2XIIA 1GVSA 1G7UA 4H9TA 4KRUA 3KWXA 3MDWA 4GNJA 2J7BA 1L8PA 2IXUA 5FF3A 3S1GA 1QT1A 3ARUA 2CLPA 4BFAA 2GLKA 3DI1A 4PMNA 1BVZA 3TR2A 5EL1A 3RB3A 3H4DA 4TVCA 5FSEC 1ZAJA 4MUPA 3U2CA 1ZHAA 4H9UA 5JIPA 4DYEA 2ISWA 1U30A 4I9TA 1EZWA 3YPIA 4ZSTA 5EKYA 4B16A 1AQ0A 1LL7A 5LIYX 3CLWA 5D2YA 3TQPA 4YR0A 2IQ0A 4G8TA 4C6JA 4UOJA 4PEKA 3F2CA 2V38A 5HJXA 4TO8A 1E6ZA 4CU8A 4DF1A 3VMNA 5JXQA 3K5XA 1EXPA 2WMKA 5KFMA 5K7JA 4GNKB 1JGMA 4LUTA 2FQIA 4FOJA 4LUSA 4XBSA 4L6DA 4QJ3B 1QI0A 1FWHC 1CGWA 4UFHA 4OOZA 1W1YA 1SFLA 4G7EA 4DUOA 2KAUC 5D33A 2OU4A 5DT5A 1FWBC 4WOZA 3KEHA 2PWFA 4QJ5B 5D2WA 1ZUAX 1Q7ZA 2J9YA 4MLRA 2BMBA 1ZFJA 2G41A 3A13A 5DO8A 4CNUA 2A7NA 1A5AA 3KRSA 3MMWA 3T5JA 5CPQA 4HNTA 5DXXA 1AH4A 1J6OA 1WOBA 3E0IA 3KVKA 4QEEA 1L6FA 3UZZA 1W9XA 2CZVA 3A21A 1A0DA 1JCXA 3KVLA 1TTIA 1JZ7A 1NWTA 2PDGA 5CGMA 1PXGA 3BG9A 1M1BA 4C6EA 1YNPA 1Z6KA 4PE8A 3BW4A 4NI8A 4GY7A 1WBHA 4KMQA 2UWFA 4R7WA 2YW3A 3N6HA 2CXGA 1RD6A 2Q09A 5AY7A 3NXFA 1L6SA 3GUGA 1GW9A 3S9IA 5DQPA 4BKNA 1F4HA 1FH8A 3K4WA 1BG4A 1RJPA 1TR1A 3HFTA 3W7PA 2AOSA 3IANA 1XH1A 4J9SA 4NG3A 3PPCA 1VQTA 3FDSA 2X8RA 2FZNA 1W3JA 4QX4A 9RUBA 1EYWA 4FIQA 5DBTA 3W7QA 4PUKA 1JR1A 4ZQNA 3W1MA 2TAAA 3P0XA 3H23A 3MP3A 1RA5A 2R8WA 3KBWA 2A6LA 4N9DA 4ORMA 2A1YA 1XBYA 4MZ1A 1V0LA 5E5CA 2J6SA 1UQYA 3KOXA 3DDMA 2CESA 3K2GA 4EPKA 3I6TA 4IM4A 3ARWA 3EKLA 1VFMA 4GA8A 2PODA 4P7QA 2NXIA 4S3JA 1OX4B 5KZDA 1JNEA 2VFIA 1R47A 2OYKA 3DFQA 1KV8A 4NYYA 3AHXA 2QLYA 3KOWA 1NP0A 1VFUA 4GBUA 4K68A 4NX5A 1ONWA 3CIXA 2V3DA 3M5VA 4MAZA 3WD4A 3RFAA 3CTTA 1UD5A 5JVLA 3FIGA 2WMGA 5BYWA 4R9OA 3NL5A 1R85A 3WNPA 1BPLB 3AXHA 2IPGA 1RSCA 4JNZA 3R79A 5KG6A 3MFHA 2CPUA 4NXSA 2VR2A 1HW6A 5XIMA 4M0XA 4WQ6A 1G01A 2OFJA 1YLVA 1H5YA 3QZEA 1TIWA 2WMFA 4JICA 3SCRA 1XQLA 1GOIA 2BOEX 4U31A 5FF0A 1F74A 1CB2A 2D2JA 4HMDA 2VGFA 5DMMA 4RE3A 2O92A 2PF8A 5EY5A 2HK0A 3W1NA 2CEQA 2YBTA 4P8XA 3L65A 1RJQA 1US2A 5BWAA 3GIPA 2ZXQA 1EP3A 4QDMA 3ANUA 4B90A 2BLEA 3BG5A 5I09A 5ABHA 4NVTA 1YRRA 1NDYA 4DUVA 4GUJA 3WNLA 3PHAA 1YXCA 3QW4B 3OLEA 2V3EA 4AFYA 1JI2A 3LPFA 3KHHA 3STEA 1LBMA 4AZBA 3TAOA 5FJTA 4FNSA 1LRTA 4PBFA 4TV5A 3SFKA 4Y7EA 3GIIA 2DZSA 2R9RA 2Z2AA 4W87A 1D9EA 3M0IA 3UFYA 4ZFMA 5I3IA 3G1SA 4S3FA 1E0UA 3HG3A 2R24A 2NVDA 4H7ZA 4ZE4A 3L0KA 3SJ3A 1TWSA 5BWFA 4NAEA 4EBCA 3M47A 1RQHA 4S3EA 2G96A 2WNWA 3E49A 3AS0A 1NFBA 1RLCL 3WBAA 4IX2A 3OLIA 4YHGA 3CHVA 3STCA 5KFEA 3LXBA 1E9LA 4O1FA 3A23A 5C9XA 4LUSB 2O4MA 5A94A 2DDXA 3L23A 4TMCA 2GWGA 4KWUA 2PBGA 3B0YA 3AUJA 4F2BA 3E2VA 1BVNP 1Q6EA 1WZLA 2XSAA 5AB3A 5F2LA 5F1UA 1KGUA 5F2MA 1J0JA 4CN4A 4X60A 1ZAIA 3AJXA 3WD0A 1KFKA 4LVBA 4YTRA 3HGRA 4G5DA 3SCOA 3V75A 4UIOA 2PDPA 2ZRXA 1OVDA 3NPUA 4ZEPA 3U7VA 3MKVA 2AKZA 1X7IA 2BY0A 1S46A 4DJFD 3FGCA 1CPUA 3R1ZA 1IYXA 4LS0A 3SCQA 5L1KA 4LF2A 3W22A 3CLMA 3ITGA 5KFPA 3BTNA 3WJZA 3WQFA 1H50A 1AVAA 1XLCA 1FXPA 1W17A 3RB4A 1PAMA 2RH9A 1BSLA 5FF2A 3HF3A 4HNVA 4QLJA 2VOMA 1YXDA 1KTNA 4IMGA 2BX7A 1OGGA 4D8AA 1Q6LA 1XSIA 5LKYA 5C9UA 3W26A 3NQMA 1CNVA 4Y9PA 3FY1A 3IIVA 3L4UA 5AHLA 4ED8A 3QPYA 3T44A 2ZZ5A 3DG3A 1X6UA 1TKKA 3MYOA 3MR2A 1AMKA 3GH4A 4DI8A 4EVZA 2VWSA 3DG7A 2HS8A 1EKOA 1WP6A 3OEXA 3S47A 1B0IA 3KP1A 1CIUA 2OWXA 4V15A 2BFGA 4H6KA 1Q8AA 2DPEA 2POTA 1XCFA 3JR2A 4NNAA 3IJQA 3LI1A 1D8WA 3EMCA 5DLCA 4BWLC 1TV4A 3VD5A 1UUQA 1WDPA 4IIEA 2XINA 5I77A 1R9ZA 3KOZA 1OX6A 5BOEA 3M5XA 1Z89A 2Z24A 1XLAA 3RR1A 2P8BA 1GQLA 2BNJA 1V3JA 5HMEA 3MFIA 3FKRA 4MKNA 1LROA 3WQGA 3DKJA 3VPLA 5MKGA 5C7VA 3MHFA 2VYOA 4IP4A 2ASJA 4Q8VA 4ZOCA 4O3PA 3NYZA 1EPXA 3CB8A 4RV3A 2V5JA 1HKWA 3H53A 5AKQA 5BZAA 4YCPA 3C2FA 4AD0A 1XGZA 2IKGA 1KR1A 2GGGA 3HPFA 1PBGA 1XX1A 5IDZA 1KQZA 1W8SA 2W79A 3NQ6A 3UCQA 3WQ8A 3EX4A 4I7VA 1P1MA 4DZ5A 4MKSA 1XBZA 3RMEA 1UR3M 4C7GA 4NRRA 3PSVA 1Q63A 3F7JA 4UTHA 4KCTA 2YXGA 3RO8A 1K4HA 3B9DA 4JFVA 3LRMA 1YPIA 3CPGA 6XIAA 4EX4A 1DJHA 3G1FA 4O57A 5H91A 1OYAA 5CBJA 3QFWA 1F8MA 4BF9A 3LCLA 4G7FA 5KFIA 4P8UA 5FOOA 5JIWA 1P6BA 3MUCA 2YDSA 4BHYA 4BY3A 3QV7A 2ACQA 3SCNA 4JIIX 4A2SA 1JEZA 4QXIA 4BCEA 1TZ9A 1VIWA 3K8MA 4PMJA 1MXDA 2GQ3A 1POJA 1TPVA 3PW2A 4H19A 4MADA 6XIMA 3NTYA 3W7HA 3AYRA 1EH9A 4LQ1A 2OTDA 1DJNA 3W74A 1H1NA 2YA0A 4AZ7A 1JZ2A 3O05A 1I2RA 2LLEA 1XD1A 3THQA 2C91A 1EEXA 2OB3A 1KKOA 1LQAA 3OJGA 4LY4A 4P8VA 4F9DA 1W91A 4W84A 1LRQA 2PRHA 3QTGA 3SRKA 1D3GA 3QXBA 5GNYA 2X0SA 3AHZA 2EG6A 3MYPA 4XZBA 3SRHA 5HJLA 1FA2A 3I3EA 2VR4A 4K39A 3W7EA 1MDRA 3C2OA 1REQA 3ITVA 2RDIA 2X30A 3C2VA 2VQUA 4LT9A 3W88A 1VGAA 4LVAA 4U33A 3VGFA 1C8VA 3PR4A 1EYEA 2WPBA 2A7PA 1TWWA 4IWWA 2EF9A 4I5RA 4P7LA 3S9YA 1M03A 3EGJA 3A3WA 4V28A 1CYGA 2ISSA 3LRLA 4BA0A 2F7FA 2VURA 3WQ6A 5CSRA 1G9HA 1YDVA 5EFDA 1X38A 2E67A 4XQ6A 2BASA 4HU0A 5D9PA 3EX3A 1JQXA 5FEWA 1NSJA 5FCZA 1RR2A 2Y6ZA 1QHOA 2VUYA 4JTJA 1S5WA 4R7JA 3ABRA 2VP8A 1UD3A 2BY2A 7REQB 1K7EA 1GVQA 1HKMA 1LRNA 3IJ8A 4F2UA 1HO4A 5KFSA 4QE1A 3U57A 1FDYA 5K9XA 4WOQA 5FAGA 3LCFA 3M44A 1UZ1A 1BG9A 5E0FA 1RY8A 1GZ1A 4NZ3A 4OKDA 1JAKA 1JG9A 2VZOA 3C2EA 3W7OA 4XB3A 4IMDA 5G1MA 1XUZA 2EPKX 3KBJA 4JV0A 4ACZA 4E2OA 4PN2A 1IEWA 3CZGA 3IV3A 1TRDA 4GYFA 1MQPA 4DZHA 1PWMA 2YYUA 1FHLA 1Z41A 4AWTA 3KZPA 5KFKA 1QTWA 5C8BB 1OFPA 1HIZA 3WQEA 3CB3A 2BXYA 3TCSA 1VFTA 3G0UA 3BSHA 4P7RA 3UERA 1UD2A 3AS1A 4KGJA 2G97A 3IGUA 1LM1A 3GVQA 1KCLA 3CQIA 3IJLA 2C1IA 3OBEA 3PWAA 3PJUA 3LA4A 3B0UX 3V5OA 2PLCA 2Y88A 3VINA 3LTYA 1O60A 4G1NA 1R2TA 3SN1A 4Z0JA 3TE9A 3PN8A 1H0IA 3MBDA 4C65A 2YLAA 4BK9A 1N2VA 3WLQA 3PTDA 4YMZA 1FWTA 3PWIA 5KZMA 3KBSA 5KFBA 1J0ZA 4BZYA 1H7RA 5C71A 3IK2A 1OADA 1UD4A 1I45A 3UG4A 3HPZA 5IHSA 3RU8X 2EEXA 3TV8A 4O13A 1Y5WA 2Q02A 2P9BA 2A79A 3KLKA 4GUHA 2ZVRA 1BF6A 4LY8A 4O28A 4AY1A 1UA3A 2VO5A 1PDYA 4M29A 4AMAA 4RK8A 4CVUA 4O8AA 3DCPA 4POCA 1JUKA 3M1ZA 5A6BA 2YCLB 5MKGB 3VD7A 5AHFA 3GBEA 1A0CA 1DWAM 2C0HA 4XD4A 3W9ZA 4YTUA 4ZMGA 2X1SA 2J75A 4GBDA 2NX9A 4E8DA 1H7OA 4O8RA 5A6LA 4PMXA 4Z2LA 4W8AA 3CMGA 5KFDA 1WXJA 2WVUA 2YOCA 2GQ8A 3CS2A 3SSZA 3WK2A 2IQTA 3OPSA 4H9YA 3RCNA 1FOBA 2GUUA 4Y8FA 4JTGA 1YDNA 2CYGA 3LB0A 3OZYA 1F3XA 2X1IA 3LY0A 1ME7A 1KGWA 4R85A 3LHWA 1R3SA 2HEJA 1UOKA 1UWTA 1YE4A 3QYSA 1FVPA 5JH1A 3GNPA 3TJLA 4E0CA 3BARA 3DFSA 3PVXA 1B1YA 1YPXA 3CXOA 4QNEA 4AZCB 1WYIA 4PL2A 3L4VA 3S46A 1HJVA 1BRLB 5AC5A 5CLWA 2QDEA 1E70M 4XD5A 3QYQA 1CXLA 2WZIA 5F4WA 2XHYA 3H7RA 2DY3A 3C0JA 4K3ZA 3H55A 1DWIM 3W4RA 1LQ2A 4WY0A 3LYEA 5CPSA 1M3UA 1SJDA 9XIMA 1ZNNA 3TUUA 4WVXA 2PRLA 3U2OA 2IPJA 1JCLA 5G5IA 1AJ2A 1GEQA 4IQDA 2A21A 3GH5A 4B15A 3A22A 4Y90A 4MZ8A 5EMMA 4I8DA 1VBUA 2X2GA 4DYKA 4LAKA 4EE9A 3MW7A 4J2PA 1I2QA 4PMQA 1QO2A 3SO7A 4OBRA 2NSOA 2PDCA 4UWMA 3AROA 1IR2A 4PB3A 1OCBA 2QCFA 1O95A 4MPQA 1RBAA 1AW1A 3T4CA 4PTDA 5REQB 1EP2A 2GJRA 4RW3A 4AVFA 4DYJA 3TSMA 1EHAA 4CD4A 2Y70A 3BAIA 3W72A 1AL7A 2G3NA 1J79A 3DFNA 3RIKA 1TCDA 1YE6A 1B3WA 5ABTA 5GJMA 1YQ2A 1V0KA 3RBDA 1Q7QA 1CWYA 1OJXA 2FZMA 2I57A 1N82A 3V0TA 2VL4A 2QZRA 1PZ0A 1PZ1A 5I00A 4O19A 2ZUVA 1PUDA 5HWJA 1AA1B 4QNWA 4GD0A 4D6CA 4UMAA 3FW6A 4J9LA 3WQ4A 3KCJA 3LCHA 3M5ZA 4EXBA 1YXYA 5JMUA 4REQA 2XGPA 3LD5A 2JEQA 1JRBA 4GLEA 4Y6GA 1P6WA 5JQ9A 4E2DA 4XISA 4Q8QA 3P84A 1G1YA 3W0KA 4J40A 2YA2A 2OX4A 4GJJA 4XZWA 2DGAA 3BLPX 2UVUA 3W84A 5KT2A 1RP8A 2DUZA 1G4TA 3NQ2A 3MA8A 3IAPA 1I2PA 3DH7A 1O5QA 1PL9A 1IQ8A 3VABA 3JS3A 3NJ3A 1XYFA 3WLIA 4I6KA 2NXGA 5HJYA 4ZGYA 1EO7A 1TV7A 5I7GA 1SW0A 3OZPA 2POZA 2ZWZA 3KOYA 2FFIA 1XLLA 3BLIA 3ZQ9A 2DJLA 2D73A 5HR6A 2ZVIA 4HTYA 5BXTA 1K4GA 2VGGA 3G18A 2C15A 3PZUA 3CIWA 5A6AA 1B4KA 3WD1A 3RXZA 5FEZA 2PDFA 4HHLA 3HMCA 4QEHA 4Q4OA 4R8UB 1NU5A 4FK9A 4NP7A 1G69A 4WCJA 4S3GA 4HZ7A 5JUMA 5AN7A 1NIUA 4L1WA 3SW6A 1QNOA 2W67A 3GXIA 4B92A 1PE1A 3S2NA 4KWVA 2FGZA 4GYPA 3QW3A 3AAMA 3R8HA 3K1DA 3OVPA 3V5FA 2W63A 2WHLA 3PZGA 3INPA 2PGRA 3LPOA 1J5TA 1B9BA 4HNOA 4JKLA 1GT8A 4G6CA 6PTDA 4KBXA 2X1UA 1KBIA 3IJ6A 3DN5A 1DE5A 4O4VA 3OVRA 2P53A 2BQUA 2I7GA 5JUVA 1ECEA 4XIAA 3CGTA 2WZEA 1EUNA 4IGSA 1K6WA 4N6EA 3ZR5A 2HROA 2ON3A 2I5GA 3ZJ6A 3WN6A 4JTLA 3U7BA 3WL0A 4V27A 3MCMA 4JZ5A 4C6KA 4DXVA 3H7UA 1ZCOA 1W54A 3BUVA 2H90A 4OBSA 4YYCA 2EPLX 5A6SA 3AYSA 1O1ZA 2CHNA 5F2GA 2V82A 3E9AA 3KAOA 3V36A 4U3AA 1S9FA 1HTIA 4QFUA 3CV7A 3LGEA 4IGNA 5AZ1A 1OCQA 3TTQA 4TQTA 3SQLA 1RBLA 2YFNA 1PV8A 1H61A 2FKPA 1DJIA 2JGQA 3M16A 3SN4A 3IARA 1GOWA 4CQAA 3D5HA 5C54A 3URNA 3KW3A 4B4HA 3BCFA 1OFRA 3TOYA 4QDPA 3L0NA 4GVHA 4QG9A 3FDKA 1JPKA 2GL5A 4KIRA 2XN2A 3KWSA 3LQLA 3RN6A 1RYRA 2RDJA 1SZNA 1TJ2A 1OX4A 4CNSA 3UZYA 3W01A 3E2QA 3EPMA 3PZOA 4HVXA 5G4WA 2HWGA 2DVTA 2CLKA 3ONCA 4G9PA 2WTFA 4PTWA 4IFRA 2B0MA 5D37A 1QVBA 3MUZ1 4A3RA 1RZMA 2YCJA 4E2VA 2BBFA 1E9ZB 1XR2A 3BCDA 3PBGA 2W0UA 5L1IA 3CK5A 4EAMA 2ZXAA 3VKKA 3WNMA 3U3HA 4LS1A 5KFCA 5CAKA 2WHKA 3XINA 3KDOA 4FOUA 2PCEA 3WCZA 3OQ8A 2ZICA 4Y9MA 1TUFA 3RAQA 3ARRA 3T0BA 3V1PA 3UJFA 4PRTA 1QWKA 4WX2A 2DP3A 3PJWA 3GZAA 4PUJA 2PP0A 3WIJA 5H8PA 4CD6A 5C5YA 1H11A 1UIPA 4HA3A 1OX5A 4S3DA 3CPUA 2OELA 2YLLA 2XG9A 3MI3A 4XAFA 2C2DA 2G4JA 4DPPA 3V6KA 1IT7A 3TC6A 3M41A 1WAUA 1FP8A 2RDXA 3WY1A 1K7XA 1GVRA 3CTLA 5LXXA 1E0XA 4KQNA 1H7PA 1GPWA 2E6FA 4N9BA 1N8IA 1JPHA 1TCMA 4L1XA 3AIRA 1RVGA 1EGMA 1HKJA 5L9XA 4GO9A 3FCPA 3KFTA 1YX1A 4Y96A 1JPDX 3AMKA 3QBUA 5CXPA 4QHRA 1SUXA 2YDAA 3GNRA 2VFEA 3BICA 4ALDA 2YKKA 5D02A 4X0VA 5U4NA 4HU3A 4QWCA 3QF0A 2XCPA 4O1EA 3EB3A 4PUNA 2JKAA 3WLTA 4KT2A 1S39A 1XLHA 4GUGA 4Q4KA 4DNHA 3G6XA 2C14A 4C6PA 3E2SA 4BF5A 1M41A 4J3SA 4EPDC 4R9XA 1XHGA 2HE8A 3M6YA 3NZPA 5DT7A 3ZZ1A 4ATWA 2PA6A 1IM4A 4Q4MA 1FWFC 4JX6A 1E6QM 1E71M 4I6VA 2PLKA 4U7CA 4F0MA 1M7JA 1FTXA 1ML1A 5KFZA 5FIPA 1W9UA 2VMFA 3TJ4A 3M46A 3UY7A 3C3UA 2Y1HA 3WNKA 5C9WA 4M24A 3S5YA 5HNNA 4YPJA 1HP5A 2JIWA 2WYSA 4DL5A 2WJDA 4TTUA 1D2KA 1X1ZA 4AB4A 2IPWA 2GGJA 3OOQA 5DG8A 4JTTA 4M56A 3MJMA 4K36A 4FBTA 4JN6A 3DGRA 1XBXA 3M5YA 6REQA 4QBXA 4A22A 2DPJA 2A0NA 2CW6A 2WPGA 3TK7A 3VXGA 3MI2A 5T9BG 2RDWA 3FYPA 3OVGA 3PP7A 2PDMA 3VOFA 2CBVA 3N6QA 1HXJA 3S6TA 1F9CA 5L1LA 2WNZA 1VENA 4UFJA 4XZHA 4H3DA 1L6GA 4UTLA 4NNBA 3NZGA 3QMTA 5E6ZA 2C19A 3GHSA 5CGTA 3V16A 4LCRA 3W27A 1UZDA 3U2EA 5A8PA 4RE2A 3LV6A 4X3ZA 1Z42A 1F6PA 2OVLA 5KFNA 4ICMA 1JQVA 2HXUA 5CH9A 2D0FA 3GDRA 4QAIA 4XWUA 1EQPA 3MANA 4GYJA 5C2CA 3VYLA 1KWKA 4L6HA 4LUYA 4B4FA 4X61A 5A6JA 5LIUX 4JY9A 1XH0A 4MB1A 1RBOB 3HG4A 1QW7A 3EOOA 1C9DA 4DRSA 2NQHA 4BI7A 1TE1A 2W92A 4PTNA 4C6BA 3VNYA 2Z1BA 1GTHA 4IG2A 2C28A 4F4YA 4NT0A 1ISVA 2V30A 1Z44A 2AQOA 1EDQA 4YTSA 1E4NA 5I78A 5HUPA 1XLDA 3IJ9A 4IMFA 2QMKA 3MVTA 1FY6A 2H3BA 5FJIA 1FHDA 3IUHA 3B8UA 2PGFA 1FWDC 4GNVA 5J5RA 2D20A 1GEHA 3RLHA 4H00A 1BXCA 3PC0A 3QY6A 1ISYA 4TUFA 1LT7A 3QM3A 3QC3A 4LPCA 3NEVA 1J96A 4J1OA 3A64A 3CUZA 4AD2A 3FX4A 1UHVA 2ANUA 2J7HA 3CAQA 1X39A 3S83A 2ZZ1A 3AHYA 1B4EA 3ZM8A 2TYSA 4C5ZA 5CKSA 3S6DA 3VD4A 5KFWA 1E5NA 5T14A 4KKXA 4PGLA 2Y8UA 1G7VA 3FAXA 1SFTA 1ZETA 3LXAA 4LU0A 3D6NA 1OQFA 3BH4A 4M1BA 2QAFA 3NGDA 3SM0A 2PE4A 4UQBA 5DQGA 1MYRA 4EOUA 2IPFA 1XIHA 1O5XA 2REQA 3UNDA 2Y89A 2ZUMA 3TR9A 5H6HA 2D1ZA 1GQKA 3TEVA 1EIXA 1EC8A 1GCYA 3WMSA 3EOUA 5DGBA 1JI1A 1H7NA 3ITXA 5AC4A 4YIWA 3R25A 1KRMA 4AZ5A 3FGCB 4RXGA 1M7OA 2V5LA 4JEQA 4IIBA 2WJZA 3EDKA 3QSRA 5KG0A 2V2HA 3W1XA 4HPXA 2FTPA 3WUBA 4JIPA 5F9LA 1XLMA 3UT0A 4CD5A 3AWOA 3HFYA 3HPAA 1SJAA 2DZXA 3GFXA 5CG7A 2EKGA 4EPEC 3EPNA 1E4IA 1L8NA 5I3JA 1PTAA 1W3TA 3DENA 1AD1A 1SVDA 2VRKA 1N48A 3IS4A 1P6CA 3RPDA 2TRSA 3LERA 1EJTC 2EG7A 1W8GA 4B5VA 2WANA 2XFWA 2RHGA 2WB5A 4ACYA 3O6YX 1XL9A 3ERPA 2PC8A 3BQ2A 1TWZA 4O10A 4Q45A 8RUCA 3EMQA 3L4TA 4IR9A 2OZ8A 5KFQA 4JV1A 2RGLA 1VHCA 4K2SA 1FBAA 1FFRA 1LLOA 3C6CA 1S0MA 3B9OA 3GYEA 3HPSA 5FF4A 2HDJA 3OP2A 1ZRQA 1MSSA 2VCCA 1ZS2A 4C5YA 3WH6A 4DEZA 3SUVA 2NSXA 3RO6A 3MY9A 3TXZA 2DVUA 4MHBA 4Q4SA 1PYFA 4I9AA 5LSMA 1R3YA 1BXNA 1MFUA 1JJKA 2VNCA 3NQGA 2A3HA 1XRSA 2H8XA 2VQTA 4FLRA 3GXTA 4AWUA 1IXQA 1IT0A 3GVGA 1BRLA 5KZ6A 1EJWC 2BZNA 5AHNA 3EPIA 3STPA 3GVVA 1OG6A 4E38A 2XSXA 2PF0A 4PCPA 2E0PA 3TYAA 2JKPA 1UW9A 2J8GA 4PCFA 3QHMA 1DIDA 3R4IA 4X9YA 4IRCA 3NNTA 4GH3A 2UVWA 3EXTA 3RNDA 3WQVA 4IPIA 3HTWA 1TV3A 1RHCA 3CHDA 2X41A 1VIZA 3BVJA 1CCWB 3T2PA 3EZ4A 1K3UA 5D03A 3GGMA 1HF6A 1TPDA 2QHAA 3FSUA 3LCWA 2XFFA 3G3DA 4JYFA 2VDGA 3FA3A 1KNWA 4DAIA 5M17A 4CCZA 1WBJA 3SGGA 1BQCA 4ERGA 4TQSA 1F73A 2YZRA 2AL1A 1FHUA 3SFWA 3N19B 3VIHA 2AU0A 2CWXA 1VZWA 4QWEA 4NXKA 4AEFA 5BU9A 4Q7NA 4FMVA 4AVNA 1I8JA 1P0DA 4RE4A 3WSUA 4E6MA 1A5LC 1UC5A 1UUMA 3C5QA 3W73A 5ECVA 3USBA 2FMNA 4PODA 1T94A 3ALFA 1O5RA 4F9JA 1E6SM 4LRTA 3V4BA 3MWAA 3GVRA 4QE5A 3NO3A 4H8NA 1GOQA 2IKJA 4ERAA 3CUHA 1AMYA 3WMLA 4TIMA 2DT0A 1ICSA 4B5UA 3RF9A 4PC8A 1GKRA 1BTMA 1PEZA 4XAGA 4AIOA 4JTUA 1ITQA 1RV8A 2H9AA 3WL1A 4PMVA 3EXRA 2NX1A 2VC5A 4EEYA 1AJZA 1DQWA 3GILA 2WBKA 4F2TA 1J12A 2CBJA 2O7SA 6ENLA 4B5TA 4UQCA 4JTFA 3WLJA 3TNBA 1OIFA 3OTRA 3VCRA 5L1JA 5M2FX 1OT1A 4ERIA 3QZ8A 3I4KA 2VT0A 5DG7A 4QDWA 2B7NA 3R5EA 1H41A 4GFSA 1V93A 4B3KA 3VGEA 3L68A 1JVNA 1W6TA 1YYAA 1ZJAA 2PPGA 1S2CA 3AYVA 1UZ4A 1M53A 2WXDM 1FRBA 5DRCA 3WJSA 2VJXA 4WHBA 1W3HA 5A2CA 1VYRA 3U0HA 4GCAA 1H60A 1KM4A 3IVTA 4UFLA 4JOMA 3AS3A 2DZUA 3DBNA 4GINA 1FCBA 2HVOA 2OZ3A 4IX0A 3M9YA 2GJPA 5HMFA 1KBBA 1N56A 1Q4WA 1KLZA 4W93A 3Q65A 3A9IA 2YA1A 4JTSA 1VFOA 3B0PA 4KETA 4WXYA 5IBXC 4B5WA 4WJ8A 2V3FA 5KG3A 1OC7A 2QGYA 1N7KA 1RCOB 3B06A 3CZLA 4PBEA 1WNOA 1UR0A 5FD0A 2QJGA 3T81A 2X1TA 2XGZA 3NL2A 4O14A 5BNKA 1Z9AA 4AHOA 1ZCCA 3LPGA 4ZA0A 4O15A 5LNSA 2ZUWA 3VNMA 2J47A 4HP5A 1V7YA 4MB4A 4QIUA 5FJRA 2Z4GA 3EX2A 5BROA 4F8XA 4UFKA 2Y4SA 2CZ5A 2G0WA 3W76A 4QW8A 4JL1A 2VEMA 1RJRA 1LP6A 4HKPA 5FJJA 3IEBA 5M03A 4HT3A 4UOQA 3W28A 3CQ0A 3M07A 3KTSA 2Z26A 1KBLA 1G6CA 4FNQA 3QHNA 3F4DA 1OFBA 3FJLA 3GHUA 1Q6QA 4GYKA 3LRKA 3EOEA 3BOLA 1CGYA 4KCWA 2OZ0A 4GUIA 2WHMA 1PO9A 1Z7AA 1KLYA 2Q8LA 3HN3A 1GOXA 4KWSA 3RUBL 3RMJA 3LUTA 3A9BA 3BQ6A 1DIEA 1U5VA 7TAAA 3AU2A 3RM9A 2ZCGA 2F6KA 4JXCA 3LQGA 2XM1A 4IH3A 1SPQA 1V3KA 5HOSA 3E74A 1W5QA 1WDSA 1SR0A 4M1RA 3N18A 4FALA 2YL5A 1K77A 2OOGA 3R0UA 4H8UA 4GIEA 3JZEA 2JALA 2FFCA 3NCOA 1WCGA 4ZQMA 3H4BA 4D6FA 2PCQA 2WCAA 5HNTA 3T2OA 1G4EA 2DSZA 3QRHA 4ICNA 1DE6A 5DY2A 3I3BA 5G4HC 2XTKA 2YB1A 4FS9A 4TXEA 1WDQA 1F2JA 3P6LA 3EDJA 2PDYA 4Q7IA 3EXSA 3JUGA 1FHVA 2XH2A 4PULA 3F1QA 4FS1A 2OR2A 2IKIA 3GNOA 3WD2A 1V6VA 4XTIA 3KBNA 4F79A 1S38A 3LCIA 4AXKA 4J3WA 2X2YA 1QK2A 4QTGA 2ODOA 2VGBA 3LBCA 4M6VA 3GLCA 4J7RA 3TSBA 5DRIA 4U10A 5M3WA 3T0AA 1QHZA 1Y5XA 4IPPA 4DHGA 3AOFA 5KEZA 1XH2A 2C79A 3MC5A 3GZ3A 4M51A 5LHFA 4P61A 2ZIDA 3QQWA 4WRHA 4O18A 1F3EA 2YIHA 2YCKX 1VLWA 1GOOA 1M65A 3W53A 2QCLA 4ECRA 5KSWA 3VVGA 3P8IA 1J8VA 4IP7A 3WQWA 1J2WA 2OJPA 3BCJA 3RJXA 5IFTA 1B3VA 4MJMA 1K8ZA 1V5XA 1E3ZA 1GOMA 2G3FA 2NV2A 1U22A 4HK7A 3PZQA 1IF2A 3WFAA 4LEQA 3LGDA 2C2RA 1ESWA 1XUUA 2CITA 2DORA 4XKYA 3ES7A 1FWNA 1GVIA 1UB3A 5BXRA 2GVYA 4PTXA 4I7WA 1JIBA 1IT8A 4W88A 3W2UA 4MKVA 3WJYA 4CN1A 3UA3A 4YWIA 4FZIA 1RXOB 2WQDA 1QNVA 4ZQPA 4ZXOA 2CLLA 3GTNA 3PZVA 4B2DD 1JL8A 2BXVA 4ED6A 1US3A 3B0VC 1GVOA 1W1TA 3B8DA 5D05A 1HZYA 3V3WA 3ZR4A 4NZFA 2F2HA 3CU2A 3SRDA 3KZSA 1HNYA 5HQEA 3BO9A 3E3HA 3FHQA 1OT2A 4HNNA 1R87A 4OQVA 3PUDA 3ABSA 4LGXA 1C8YA 3RCYA 4RCXA 3R7MA 1JYXA 2EO7A 1TJRA 2CKRA 3N9SA 3ZFHA 1DQUA 4JD4A 3CO4A 2QCNA 3LI0A 1DJZA 1LWHA 1DEDA 3R8GA 4AHPA 6REQB 2GOUA 2O4QA 5F7UA 1QHPA 1W9PA 3NQ8A 1ALDA 1E73M 4BJHA 4L9YA 2Z00A 1KKRA 2BTMA 4NJIA 4LC8A 3CL8A 1EJ7L 3N73A 3PTMA 2J7DA 2GJXB 5FJOA 1R3TA 2BHUA 4IT1A 4HYRA 4A8RA 5EGRA 2YJQA 1J0HA 3NSXA 3T8LA 3WJXA 4BS0A 3AXXA 5DANA 4K7YA 1V3IA 4DF2A 4HGXA 4GJIA 4O17A 3JW7A 1AZ2A 4XBJA 3TFXA 1UG6A 1N8WA 1WXYA 1ZGDA 1UR1A 3VUPA 1ELSA 3OG3A 1XG4A 3W2KA 3DFPA 4C6NA 2OX1A 2YFOA 4DI9A 2VFDA 3WQ5A 5H1WA 3BXWA 4Q33A 4ZOBA 2W8LA 1QDSA 1DTNA 4LX4A 4PMRA 4Q8WA 4CNPA 1C92A 1S97A 1CBGA 4N7QA 4FXJA 2YYTA 1V02A 2HSAA 4M3PA 2G3JA 4MJZA 3N17A 4S1FA 4LBSA 2PWDA 4AH7A 2E40A 1ONEA 4O4WA 3BV7A 1PIIA 5JBEA 3UW6A 5MHBA 4YHEA 5J8LA 1M04A 3GHRA 3WF2A 5B80A 5HINA 1DKWA 1NFPA 2B7OA 4EF8A 5J04A 3IVUA 2O55A 5TNVA 5LGXA 3CZJA 5ABFA 1ICPA 5TIMA 1Q6CA 3W81A 1TPEA 4XKYB 4S3BA 1PZ2A 1WKFA 4ZENA 2VI0A 3GFZA 2GUBA 1XKYA 3ABXA 4GISA 1NDWA 3HB9A 4DL4A 4JN7A 4O16A 2BQRA 1X6NA 1UJPA 5HNUA 2QEZA 2VENA 3MVIA 2VA2A 1ICQA 4B2DA 3TW7A 1A5SA 3EEZA 1MUWA 2ZUUA 2V3GA 5FEXA 1TQXA 1AZ1A 1S5VA 1T40A 4FP1A 1AH3A 1P48A 4GC3A 4HPHA 4D71A 3IN5A 1WZKA 3CT2A 2J7CA 2FB3A 1ZSXA 4L4PA 3EKGA 3P0WA 7PTDA 4CVWA 3PG9A 2B81A 3OGVA 1XIMA 4C6CA 3SDOA 2J25A 3GBDA 4HIBA 5T91A 1VCGA 3OBAA 4CUCA 3OW1A 2XISA 3RITA 1AQFA 5H8UA 3OGRA 1F05A 3W75A 3TLLA 3VO0A 4NZCA 4I90A 3TW6A 4ML9A 5AC7A 2VDIA 4AYSA 1W3LA 3IVSA 4MM1A 1GHRA 3QTPA 2MNRA 3BW3A 4GXMA 1XCXA 3SUSA 3BGJA 3WDQA 1A3WA 1WAWA 4IZGA 1F3TA 3RX3A 4ZL1A 5AC8A 1ZJBA 5FACA 3WH8A 1H2JA 1V3LA 2G5WA 3HMJG 3HU7A 3N13A 4DLFA 3K8KA 3HIJA 2GYIA 4AD4A 3H24A 4XO7A 3BAKA 4WSHA 2QULA 4DXXA 2CKSA 2Z1WA 3GV7B 1A4LA 1QOXA 8XIMA 3M9NB 4GX8A 3CHFA 2QUMA 1XBVA 1XC4A 2XWEA 4RNNA 4RUCA 1CGVA 4WF7A 5KG7A 3REQB 2NZLA 4MLJA 3DHPA 4JS3A 1VBHA 4J3ZA 5HATA 2D23A 3A5VA 4KFOA 5E9AA 2Y24A 2AGKA 2XCAA 3QOKA 3WDIA 5HDRA 1JF6A 1E0TA 4Y9NA 4ED1A 1C93A 3ME3A 5HNRA 3W38A 1BTCA 2WC4A 2NXHA 3L5LA 2FPYA 5D38A 1UBPC 4KIEA 4C6LA 4Q8FA 2WSPA 4H04A 5EWEA 1XLIA 3BOXA 3WF4A 3HJEA 1JDDA 4MNMA 4P5UA 2J9XA 4OUEA 1HKKA 5CZKA 3BGAA 3TYZA 5KFVA 2FLIA 2Y61A 3KM8A 4JKKA 1HX0A 3PZMA 1UKOA 5KETA 1Q6DA 3I6EA 1JYWA 4DJDC 3VX0A 4W8LA 3T40A 1H3GA 1KM6A 2WMHA 3TTEA 4IPNB 5CZTA 2WO5A 5LXEA 3DC0A 3NURA 4M6PA 3TNOA 2TPSA 5G1TA 1FKXA 1JCJA 3DUGA 1LOLA 3HV8A 3EWXA 4OVXA 3UXDA 4AAJA 3HOJA 2X42A 4EKJA 3COTA 1BGGA 5GQBA 3P61A 1HGYA 2X16A 5XINA 5F2IA 4MDPA 1W1A1 4J3XA 4W86A 5BMWA 3FEQA 2JIEA 5BU6A 1DIOA 4PEEA 2BQ3A 3B9EA 4PMDA 1NDVA 1TV5A 3GY1A 2QJJA 5I5RA 4FXFA 3MKCA 4GABA 3NQAA 1IXOA 4WKAA 2VA3A 3W7NA 1TUXA 4MMWA 4LC6A 4JCMA 1ITUA 3VKBA 1B3ZA 4S3AA 1GJPA 2R6OA 1GKPA 1XS2A 2Y7EA 1TR9A 4GVIA 3WH5A 4A05A 3FNDA 3BMXA 1PVNA 3FYYA 3T5LA 1WDDA 4DM1A 4GC7A 2IXVA 4GX9A 4UQEA 3P80A 4PUDA 1KFBA 2QGHA 3RJYA 5HUOA 1S0NA 4U28A 2JE8A 3L67A 3KL3A 3CZKA 1M6JA 3AIWA 3G1DA 2PU1A 3CV2A 3C86A 2PI6A 4V2XA 4IFOA 4LXFA 3GTXA 3W6LA 4I5XA 2J24A 4ZSUA 4WGXA 4DVOA 5AYIA 4AD1A 4MAVA 4FOKA 4NJKA 4L56A 3BQ5A 1NEYA 4JTHA 3VDCA 1FX6A 2NWRA 1WV2A 1W31A 4ED0A 1YTDA 5CPOA 3W25A 3LTPA 5KFGA 1P7TA 3U8GA 3BW2A 2CCRA 2V69A 3A4WA 4YTQA 4D8ZA 4L7ZA 3N2CA 5DX7A 4RE0A 2FVMA 2J6TA 3ID7A 3SI9A 4FHAA 4Q8EA 2C1HA 2PDJA 2J13A 1VCFA 5SWUA 2WC7A 8XIAA 1LUCB 2E1WA 3ATYA 3EWCA 2DW7A 3B8WA 1XWYA 4ONVA 4GQBA 1QFEA 4R53A 4F3HA 2JEPA 3B8TA 1Q65A 4YLWA 3S3GA 1Q45A 4WDTA 1ZP4A 4OV4A 1QATA 3SCWA 2ICSA 4DZIA 4N0RA 2PB1A 4M5PA 4HCHA 2OGJA 3P67A 4FXSA 4J27A 1GJUA 4W7UA 2HS6A 4FNTA 3CEPA 4DWSB 2RDTA 4HSOA 3F4CA 1Z69A 3M7WA 4AX7A 3UBPC 1ECQA 3GU9A 4M7SA 2NQZA 4W5UA 3TJXA 5EYWA 3KS5A 4ECQA 4WGHA 1LLZA 4GZ7A 4Q4PA 3QR0A 3CPRA 4OFCA 2I17A 4RX0A 3R11A 2OGYA 4HMEA 1DVJA 1EP1A 3Q8PB 2XH4A 2ZDRA 2PUZA 3IGXA 2NT0A 3P7YA 2G37A 3UJEA 4W8BA 2VWTA 1SQ7A 4S2BA 3WEMA 2R82A 3W2NA 4A3HA 4CD8A 4XZMX 3IGSA 3W37A 1PYMA 3UWVA 3G22A 4HHMA 2XZ9A 1CI1A 7XIMA 4H7VA 1L0PA 4RNJA 1IXNA 4LANA 4H6EA 5CC7A 3MB9A 1CLVA 1A47A 4XUYA 4JNMA 3SRFA 1CXFA 4HMNA 5AHMA 4PFMA 3THCA 3LBOA 2ZZ3A 3ZJ8A 1LTDA 2UV8G 4HNLA 2F6XA 4UTWA 4MWAC 1UIOA 1UH4A 4R3UA 4WK9A 3Q94A 5HMSA 3BZJA 1OFDA 1TTPA 4CEXC 3O0KA 4ENLA 3RRXA 1GHSA 4AIEA 1I60A 3EA2A 4ZO9A 2AGOA 3ORWA 2PTDA 3VKDA 4UQDA 5A3HA 1VB9A 4ZBCA 3MV11 5G2IA 4UBPC 2ZQ0A 3H54A 3GXFA 4RZBA 1T8XA 4WD0A 2FH6A 1QI4A 3JU2A 1KRAC 5D9MA 4D6GA 4DM2A 2JQXA 2XU2A 3W02A 4F48A 1XCWA 4GVGA 2UY2A 4GY0A 4TOQA 3GTFA 1JYNA 2QXWA 2BOFX 3UPBA 1E4LA 2WQPA 1Y0EA 3DHUA 1W1B1 3VKJA 2JK2A 1Z48A 2G95A 3O07A 4CLMA 3UR2A 4DWSC 2I1OA 1JULA 2V81A 2VGIA 4M80A 5HXMA 2DH3A 3O06A 4X2RA 1JXKA 1V08A 2XN0A 1GKQA 4K1GA 1S3HA 1ENUA 3NEHA 2P1FA 3MP4A 3MDUA 3W2JA 3RX2A 4M8UA 3ITCA 3T07A 4QAWA 3TC3A 1R2RA 3MUXA 2VR5A 2EPMX 3C56A 3BJFA 3AISA 3UYIA 4IJCA 1IEQA 1IWAA 4O50A 4IQLA 3WQPA 2OKTA 1GYNA 3LSBA 1BSIA 1EWDA 2CHOA 2GJXA 3TYUA 1NOWA 5CPMA 2HQAA 2OT0A 2WKGA 3BK0A 4P7NA 2EBNA 3VNIA 4PCNA 4PUUA 1YTKA 1TVPA 3Q8RB 5HR7A 1O5KA 1SW3A 4NKCA 3KLLA 5HWMA 4NAFB 4I8YA 2HMCA 1RPXA 1AODA 1OY0A 1K03A 3W23A 1S5MA 4F0HA 3KXQA 5CJNA 2A2IA 1QI3A 2Z2UA 3S5ZA 3DGBA 3ZLHA 2P8CA 1RCXB 2ACRA 3ZT5A 2QF8A 1ZAHA 3SI8A 1KWGA 3TN3A 4XK2A 4ATLA 1CXHA 3T9PA 3GUWA 3DHDA 4CEUC 5U7SA 4XX6A 3QOMA 4XZIA 3EX1A 2A4AA 2QPUA 1TE6A 4IRDA 1NWUA 5G2HA 1GQJA 1VLIA 1XD0A 1Q85A 1PSCA 5FAJA 2F9RA 4LUIA 3B9NA 3CO8A 4M82A 1UYQA 1XYBA 4GUFA 2C13A 1XLGA 4UCFA 2NQLA 5DMNA 3W71A 4TMBA 1UWIA 1TJ0A 3SUWA 3U48A 1ONXA 3W86A 1FDZA 3DOPA 4LSBA 2DT1A 3Q8SB 1REQB 1ZBKA 3STFA 2PLMA 1ADOA 1BYDA 2CNCA 1C7TA 3GC5A 1E55A 2XIMA 4AZCA 4LVGA 1UP3A 3UXKA 2QYGA 4DJDD 3UESA 4Y2WA 4O3RA 3UP8A 2VEPA 3T8QA 3ZSTA 3HZ3A 2VOTA 2YL9A 3VTRA 3D0CA 5IHRA 5D2VA 3S42A 1D7FA 4JTAA 5FA5A 1XYMA 3TN6A 3WH7A 2QCHA 1XLJA 3C0SA 4YXGA 1A53A 1BWLA 2PDIA 3C8NA 5C70A 1I4NA 1MW1A 3HV9A 3VIKA 3L12A 1RLDA 4PSRA 3WLMA 3C52A 1XYZA 3MBFA 2BS9A 1NOFA 4O3OA 3AZRA 2GZXA 3ITLA 2VX7A 1W3IA 1FWIC 3OG2A 1PZ3A 4O3SA 3G0SA 1FCUA 1MXSA 3GQCA 2PMQA 4NUWA 2V5KA 3FA5A 3T0TA 1ZBVA 3LLXA 5I02A 4ECYA 2HNEA 3KL5A 3SIZA 4J9KA 1G4PA 3OB8A 2A3LA 1YPFA 3SN0A 4YYFA 5EWGA 5TBOA 4S38A 1PS9A 3NSMA 1ISWA 4PTMA 4CNTA 3OHAA 1TIMA 3AO0A 1BF2A 1QNQA 4XIMA 1NWSA 2C3ZA 2VRJA 1J9YA 1DIKA 2I14A 4H9ZA 5A95A 3A47A 3TDFA 4UTKA 3H2MA 1XG3A 2INFA 1K8XA 1K9TA 3P62A 3MCOA 3P5ZA 3POCA 1A5KC 2ZTJA 4J35A 5B7YA 2E8YA 5T8GA 3SECA 4XVDA 2J6VA 2ISVA 1HGWA 5HK4A 5K9DA 3UGRA 2VZSA 3M0XA 4Q6XA 2FTYA 8A3HA 1XW8A 3M0LA 4XSLA 2J7EA 3B8SA 3KRZA 3KVMA 5XIAA 4Q8OA 4AUBA 2XVPA 3C61A 4GO8A 2YX0A 1X97A 3AMDA 1OINA 1W2PA 2XGBA 3FVDA 4D6DA 1SO5A 5CC6A 3NZ1A 4FX7A 5A6MA 3MO4A 4JIRA 3GU1A 1WZAA 1GORA 4XBKA 2GK1A 3GG1A 3SUUA 5E70A 3ZYZA 4KCUA 3HGOA 3N4AA 3AMLA 3O6DA 2Z7KA 1XLFA 3AHTA 4O1BA 1DOSA 3GG0A 4RUAA 3GB6A 3RG6A 2MANA 1R3RA 3ZO9A 3E38A 3ITYA 1QRQA 1BXBA 1MI3A 4LYKA 3UU0A 4H7CA 3GIQA 4PA8A 3ITTA 2WSRA 4UUIA 2XIQA 3T42A 4ZVJA 3F4WA 1NAL1 4JN8A 3THUA 3TQ1A 5AHIA 1TX2A 3QGAC 3FOKA 2QCEA 3VI2A 4O54A 2ZX9A 4RDZA 1O66A 1IZJA 1S1RA 4LAUA 3LNPA 2IMRA 2CLIA 3GXPA 4HHPA 3V5CA 3BV4A 3S4TA 4ADTA 1HP4A 4QWBA 1WUFA 4D1JA 3ZWTA 4HYVA 4H01A 1UR9A 3VOJA 4O12A 2AGTA 1V6TA 1J0KA 1LCOA 1DORA 4PRRA 1DJYA 4H8HA 4FSAA 1SSDA 2O0TA 4U5IA 1R6WA 4CN6A 4F4ZA 3UZXA 1UR4A 5LA1A 3OHBA 3RHGA 3S2LA 2DSVA 2R1NA 4Q22A 2GSJA 3PBUA 1CXIA 1LQ0A 4L9ZA 3AZSA 3CUXA 2ZBTA 1GZJA 5HMDA 1WQ5A 3W1UA 4A3UA 1LG2A 2GDVA 1UA7A 3K4DA 1WKDA 4HN4A 1OC5A 2FPTA 2V67A 2W6RA 1OSEA 1NVMA 4NY2A 1VEPA 4WLCA 4DL6A 3TROA 5KFYA 3U4AA 4ES4A 4NZ4A 4K1WA 2OO0A 3UY8A 3S0CA 1NM9A 3B05A 4CQDA 1Q5MA 5CZSA 4RPPA 1UPMB 3FVMA 3FYOA 3BLLA 4QLKA 3UJSA 3U9IA 1BFNA 2Y85A 3N4FA 4MNKA 2DSWA 2WJEA 2Z1SA 1B90A 3TN4A 1AJ0A 3UXLA 6TAAA 3Q8QB 3VIMA 3MCNA 1RALA 4C7DA 2C0AA 3ZLGA 4IQJA 4AEOA 3G6VA 3S2MA 2H9AB 4A8LA 4Z17A 3FKKA 1E4MM 4OZOA 4L80A 1CTNA 1CW2A 2VCAA 4PZVA 5CJMA 3BC9A 2EAWA 1Y65A 1SR9A 3MHUA 3BMWA 1I1XA 2YB4A 4D6EA 2OMAA 3W24A 2Z7GA 4A2RA 3WF0A 1R46A 3WNNA 3UG5A 1WB0A 2D0HA 3PULA 1N8FA 1XRVA 3G8RA 4H2HA 2V4RA 4UTTC 3SCTA 1YBQA 2P3EA 3O1NA 5C7HA 1HKIA 1XLBA 1VCVA 3FEMA 2ZZ2A 4L4MA 1T8QA 5BOOA 4MIMA 1E72M 3RX4A 4URIA 3T5KA 1JX4A 1IWBA 1WKYA 2HNHA 1O94A 4GFIA 3QMRA 2WLZA 1W3NA 2HVNA 2G3MA 1CENA 1MEWA 1OC6A 1XQKA 4IP5A 4JYDA 3R2GA 3S6OA 3VOHA 2P88A 4DJEA 4R8UA 1SJBA 3CAWA 2Q6ZA 4JQAA 3WEZA 5LNRA 5CGQA 3WBWA 4G2DA 4JV2A 1P4CA 4Z2JA 1O6IA 1P1XA 4UTJA 3VOCA 3WK1A 5HQMA 3ABZA 3QJAA 2VZVA 3LN3A 4J9JA 5DY3A 1VFLA 4LCQA 2OCZA 3VNZA 1NOUA 4KERA 2QDDA 3DYMA 3FV9A 3TA6A 3UR7A 3D46A 3TMQA 3KVJA 5CJ5A 4EWND 2H6RA 3TCEA 4WY0F 1R7OA 3TQKA 3VA8A 4V33A 1GVFA 3S2CA 2A3EA 3QQ0A 5GJNA 3OSPA 5AC6A 4UTUA 3UWYA 3W82A 3CM4A 3NPXA 3GXMA 4PUEA 3W00A 1PKNA 3PBMA 3CZEA 4HOXA 1MEIA 1ISZA 4Q4QA 3IJIA 3Q2DA 1P5BA 1QUMA 2VFFA 3UXIA 1EHNA 1DL3A 4Y9OA 4BQ2A 4JIQA 5ABEA 2RJGA 3AXKA 3Q37A 5IDIA 3VD3A 4YTTA 5I03A 4J3UA 4WDUA 3KDNA 1AW2A 2FIQA 3PBYA 3OZOA 2IS7A 4PMUA 3TZNA 4DBEA 2FZBA 3A4AA 7TIMA 2IKHA 1FWSA 3VC6A 3KHJA 5D2TA 3GNXA 2A6NA 2WKJA 3E0VA 4S3KA 4P2VA 4XUGA 3NDYA 3PUEA 2HE5A 1Q6GA 4K37A 3GTHA 3QR1A 2GUYA 1R5YA 1UKSA 4RPQA 1GQIA 2DSKA 4ZR8A 2NWSA 4IOTA 3QH2A 2IMWP 3DG6A 4JTQA 4IMCA 1SZGA 3NQBA 3GW3A 3T55A 2Q3OA 4HYKA 5D9NA 3AFBA 2XJ7A 1I2NA 1DXEA 2Z25A 1POKA 1UWQA 4US5A 2ATLA 3H8AA 3L21A 3KUMA 5A8MA 1XRFA 2ZRUA 3EB4A 2Z29A 4U5KA 1KFCA 7REQA 3GNDA 5AHEA 4R88A 2QPXA 3F5LA 1YIXA 2BP1A 3VKAA 4U6PA 4P8WA 1OZMA 3LGGA 4W85A 5TQLA 1M68A 2BV9A 1QXLA 8TIMA 1M5WA 4JHMA 4TVDA 2VC7A 2C71A 1EPVA 2BHYA 1H5VA 2ADAA 3MPGA 2GVJA 1K9DA 4R5EA 3USZA 6CGTA 3S9ZA 4OTKA 3MUAA 5AVNA 1QI5A 3NOYA 2ZRYA 4QCEA 4JQ4A 2INZA 3CHEA 2OSYA 3DAQA 1K8CA 3EWYA 1S2WA 4YR3A 1U2YA 1HJQA 2DIJA 2TMDA 3W70A 4NX0A 3ANVA 3EEGA 5BOFA 2WSYA 3MTWA 2FB2A 2FHFA 2OG9A 2J78A 1RK5A 3W6YA 3UCDA 4IIHA 4QR6A 1H63A 3V1HA 4UMBA 1SM9A 4AF0A 2EQDA 4PH6A 2VD8A 5EMKA 4GGHA 3WMCA 4ZTXA 2ZRWA 5K2ZA 2A3AA 1Q2SA 3S1VA 2R14A 4C7FA 2QCGA 3JRKA 3SUTA 3C3NA 3ZIZA 4IRKA 2HBVA 2ACSA 2W5FA 4MTVA 4QG8A 1JDCA 3QPZA 1BQGA 5E9XA 2PWHA 4ED3A 1RUSA 3BANA 2YBVA 3EWZA 4J9RA 3TSDA 2UY4A 2VD9A 2PFHA 1X98A 3VIJA 3AQUA 1UD8A 4NIRA 4CCEA 1EL3A 1XFCA 1GK8A 3O9NA 4NILA 4RZ5A 4MFEA 3F2DA 2CLFA 2WSKA 5AZ0A 1A50A 2GWNA 3AMGA 4UQ9A 5BRBA 1QK0A 4DEFA 3O3RA 1B3XA 3LLDA 1VRDA 1TRIA 3ZMRA 1P0EA 1MUMA 3P14A 3O6AA 1PTDA 2AQVA 3B3DA 1ZJIA 4KWOA 5DFAA 4OOUA 4AD5A 1MO0A 4JX5A 1KRCC 2J79A 1B5TA 1EGVA 2GGHA 3REQA 3AYTA 5EMYA 3QVQA 2CFFA 5KFHA 1T5AA 1V3HA 4C1NA 5KFAA 3TJIA 1RVKA 2B31A 3QC0A 1L6WA 2Q71A 1E6XM 4CQBA 4NJGA 1HFBA 3KTCA 4BQ5A 3CH9A 4QSFA 4DJED 2BDQA 1X1OA 3DFTA 3ARZA 5EDWA 1VS1A 3WO8A 5HQLA 1H62A 2BGNE 1FUYA 1VRXA 4AVOA 5GNZA 3PZ9A 2BY3A 2ZA2A 4X22A 1VD6A 4HK6A 1EEPA 3APGA 3I4EA 4UTWC 5KT7A 1QMLA 4OECA 1YADA 3PJTA 3UG8A 4W7WA 3P93A 3B97A 2DVXA 3C4UA 4HD5A 2WMJA 4EYHB 4K8HA 1GOKA 4GKTA 3RDKA 1A0EA 3UWZA 4OV9A 1SZEA 3W83A 1DWJM 2AQWA 3PF3A 1MW0A 3PPHA 1TQJA 5M5DA 4E8CA 1L6YA 2DZTA 1QPOA 1GWJA 2XFYA 3G5EA 2DUAA 3RR4A 1LL6A 2D69A 3M0JA 3OVQA 3FHAA 3U5UA 4EP8C 1TPFA 3TWAA 3OZMA 4Z2GA 5IXEA 2QIIA 1MRQA 1DBTA 3CMFA 3PSWA 3UQNA 1HJXA 2R8JA 2IUZA 1R2SA 1XP3A 4FX6M 1CDGA 4I5UA 2F38A 4GZEA 4IF2A 1QNPA 5DQHA 1UP2A 4HJWA 3TZFA 5GJPA 2W9CB 2YXXA 3T78A 1UWSA 4Q8UA 2WVSA 1OD0A 2OLHA 3P60A 4I9JA 1T6MA 4O1DA 3H40A 4LNCA 2QDGA 3M0HA 1I1WA 4LOCA 2NQ5A 5G2WA 4LUTB 3FSTA 1F07A 4LAZA 2ASDA 2J7FA 2DZWA 1XJBA 3TYCA 3DC8A 4TX9A 3CQJA 4GI4A 1QPRA 4YS1A 2XUCA 1HJWA 4HA0A 1W1ZA 1TWDA 4AZGA 3O0FA 4KEMA 4US5D 2VVSA 4E3VA 1A4MA 3AIQA 3B0XA 1BYAA 3E12A 3L2LA 3F2BA 1TPB1 1EBHA 3QKZA 3WK0A 3WYZA 5T9CE 4C91A 4BF7A 1GONA 1FWRA 3E0FA 1FWWA 1IGSA 3SURA 4EXAA 3H70A 3T05A 1JFXA 3DEQA 3CMJA 2BG5A 4GWEA 1ZU8A 2PRMA 3GFYA 2HRWA 3WDHA 2QUTA 3URBA 3TWBA 4AWEA 4JUZA 4M7TA 3PTKA 2Z0IA 1W9VA 3VILA 1F7BA 2ZC1A 3KCOA 4PRWA 1YEYA 4GXPA 5HPCA 3L2IA 4NZJA 1L9WA 3WQOA 1BWVA 1SW7A 2E1DA 5H2ZA 3NM1A 1ITXA 4PUMA 1HJSA 5E0CA 3LXCA 1V3MA 2CZDA 2QCDA 2W7PA 5DCBA 3TIMA 3GDTA 4OBTA 2A3CA 4KWWA 4WXZA 1D7KA 1MDLA 1OFOA 4Z1AA 1YNYA 3ARSA 2XVKA 3GO2A 4JTKA 1K6AA 2PTYA 2XVNA 3WK3A 4NAEB 3WDJA 5FSDC 4N02A 1FH7A 4EACA 1TX0A 4GACA 2BGQA 2QAPA 3BL3A 3U4FA 3SGUA 1ME9A 4EBDA 3UXAA 5I3DA 2ZTKA 3M9MB 5KFUA 4HA4A 1D8CA 2Y7DA 5FEPA 3S5SA 3NQ7A 4GC6A 4N6FA 2KX9A 3PW5A 1DJXA 2GQAA 3VU2A 4FR1A 2OOFA 2JF6A 5HAOA 5IM51 4YJ5A 4DX3A 3N11A 2P3ZA 1RQBA 3WEOA 3NQVA 4HHHA 4IJRA 1ZL1A 4PBGA 2DFAA 4GYPC 3G6LA 4JIHA 4CNOA 4Z1CA 3E96A 3LU2A 1T96A 3JZUA 1LBFA 3O6CA 1GZGA 1RPKA 3GSMA 3A4JA 1BEUA 4CU6A 1OBAA 4JTDA 5HWNA 4MPKA 4XTDA 3QLLA 3OA5A 4C6FA 3TC7A 2PDBA 1P0BA 4H83A 2E4TA 3PAJA 3GD6A 1VPYA 2CZEA 4O3QA 3M9OB 4QM1A 3LV5A 3GQYA 2FH8A 1TV2A 1XSKA 3MUY1 2V5DA 4F40A 1XXXA 4XZNX 4GH1A 3GIKA 5F4SA 2JEFA 3BZGA 5A8QA 4MYAA 4R34A 3EPOA 4AYGA 3U2ZA 3CWOX 3UR5A 1PKYA 1F76A 1U1JA 1D3CA 2R8GA 5I06A 1EXBA 4JIEA 3DX5A 2JGYA 3W2LA 4MJ2A 1OYCA 2AL2A 4U4MA 3T0CA 4ZB2A 2E6AA 3NZRA 1HT6A 2HZGA 5A8OA 3NPVA 2Z27A 5KFJA 4TR9A 4Q8MA 1M9HA 1JZ8A 1TWIA 3UZ5A 1E6RA 2OYMA 3SQMA 5D8ZA 4MB5A 4ZCWA 4DL2A 3HM7A 3N2OA 1X1NA 3PZPA 2WNQA 3VGBA 2QCDB 3E6EA 3OO2A 2BR0A 5GNXA 3WQCA 3W1LA 5KT4A 1BYCA 3PUOA 3R0DA 4NJJA 4UMCA 2ZRVA 4B3LA 1UWAA 1C8QA 3P8JA 1XC6A 4UZSA 1CGXA 4UNLA 1ZLPA 3SADA 1JIHA 3N3MA 5PTDA 4DL3A 3CIVA 2XH7A 3SIMA 3NA8A 1A80A 3PTQA 2GVGA 2ZYFA 2Y8KA 3RCMA 3H7VA 3KX6A 3FJ4A 1MVYA 3H12A 3GE7A 1RY0A 1F6KA 1XPYA 3NGJA 2C1GA 4WUIA 1NH6A 1VBRA 2PBOA 1MQQA 3QQ1A 2IA6A 3O2LA 1BHGA 1E6PA 2CLEA 1KFWA 1US0A 5G4EA 1VR6A 3TU9A 5LIXX 1W2VA 1OB0A 4GCXA 1OYBA 1OD8A 2FZ8A 4ZOEA 1ZP3A 4AIBA 3RK8A 1FWAC 2Y5JA 5LYRA 5CEWA 1A5OC 4E4UA 3HGSA 4MGGA 4KRTA 2P10A 4Q6JA 3H2AA 4FLQA 5KTLA 4WKHA 4JQ2A 4D6JA 3G1HA 4C90A 3KHRA 1KCZA 3W7JA 2VX6A 4J3TA 2DV0A 1AQHA 2PDLA 4S3CA 4NQ1A 2VEKA 4DWDA 5C5JA 5LA2A 4IQEA 4Z1DA 3TOPA 2CLHA 2FHBA 4UTIA 4AC1X 4CNNA 1HO1A 3TVAA 1PCWA 2QV4A 3N4EA 2O9OA 1EC9A 1UC4A 2GJNA 2FLNA 3EAUA 2CXEA 2WLYA 2AAMA 3DZ1A 1E15A 1F8IA 3M0MA 3WLNA 1ME8A 3AU6A 4NZ5A 5CBIA 3LHYA 3EBVA 1TPC1 3MR3A 4B9ZA 3T7VA 2D22A 1KW1A 3QR3A 5F4XA 3BOFA 4JPGA 4WY0B 2PLJA 5EU9A 5I3FA 3B9AA 4ILSA 1AFSA 3RLVA 4DELA 3LM7A 2PWVA 4J28A 2C22A 2XM2A 3UNTA 3W1AA 3E0WA 3H21A 1C90A 3C8FA 3GVWA 5F9NA 3C0QA 1TJ1A 5K9CA 2ZADA 3N12A 2YCEA 1QW9A 3MWCA 1LJYA 3BGGA 1OWQA 4LCSA 3CAKA 3NPWA 1CLKA 2ZKMX 4PYSA 1EJSC 3VGHA 1ZPTA 2VC6A 3CEUA 3M6DA 4W4QA 1R38A 1E1FA 3KRBA 1IZCA 1WDWA 5DMLA 3ARXA 1PIFA 3GRIA 4IG2B 3ZJKA 1E43A 3KBVA 3AZTA 3EYPA 2CHRA 5KG2A 3GG8A 1EFZA 1TB3A 3VX1A 4PCTA 3CYJA 3GAYA 3JVAA 2ISDA 5L9FA 4N42A 6TIMA 1TZZA 1R3WA 2Y63A 4KFPA 1KM1A 1E9YB 1A49A 2BVTA 3QY8A 4YVPA 5DCEA 1I9CB 4IUGA 2QF7A 2ZUSA 3MJYA 4IPLA 7ODCA 1V6XA 2FGLA 1AUSL 1QAPA 2E25A 3AWNA 2XYLA 4Q8PA 3P5YA 4WEVX 4JTIA 2R1LA 3UWWA 4H9MA 1NWRA 3B8VA 4D72A 1G5AA 2X7VA 4AQLA 1TELA 3M0KA 1L2QA 2OLSA 3HQ1A 3PB0A 1CEOA 3PZIA 3VIGA 4HOWA 4MNJA 1IE7C 3P2VA 1U33A 2XGIA 3PR5B 2XH0A 2OEKA 1QCWA 1R9XA 2NVAA 3DESA 2FJUB 5ENLA 2V8ZA 4JTRA 1VPQA 4GGBA 3IRDA 2GQ9A 1Q8JA 1C9WA 3SBFA 3HA1A 2BVWA 5D9OA 3CUIA 2QIWA 3NQEA 3MSDA 3BAWA 2E5BA 2FHCA 1OZQA 3PVFA 3N3TA 5CLTA 2D2HA 1S10A 3A4XA 2DPIA 3LCGA 3EKZA 3K4AA 4E5TA 3MSRA 2DSUA 3QV8A 3UJ2A 3VIPA 2QJIA 4DO6A 3P81A 4R27A 1FWCC 4GQRA 4XAZA 2JEIA 1UZHA 3VIIA 4AF0B 2OODA 3VFCA 4RZRA 2VZTA 1H49A 2VFGA 1WXZA 2GGEA 3EWUA 3FN9A 3UPWA 1JZ6A 3CNYA 3PJXA 5DF0A 3IWPA 1A3HA 4BQ3A 3EOSA 4EANA 4ICCX 3N2XA 3F03K 3WFZA 1FQ0A 1VEMA 1HL2A 4FLOA 3ARQA 4KESA 2J74A 3HPXA 3GR8A 4EXQA 3SSJA 3A3XA 4E2BA 3W2MA 2J62A 4N4QA 5I6SA 1B9ZA 3EA1A 4AXNA 1LOSA 2D2OA 4V1XA 1O4UA 1TPUA 4G56A 4QSHA 1VPXA 4GMEA 4DY1A 3UETA 2EG8A 3BURA 2C16A 1JCYA 1UMLA 3WBXA 1F61A 4GI6A 3BJYA 1XDLA 5C55A 2PAJA 2QQ6A 3R89A 3HBLA 2BVYA 5TD4A 2XDFA 3BJTA 3GH7A 2DZPA 3SZ8A 3OYXA 2R8KA 5AYXA 2EHHA 1TMHA 1EOMA 5KFRA 4Z42C 1AH0A 1KTCA 2OQLA 1Q2RA 3IIOA 3M0YA 3TLQA 4HU4A 3PBVA 1OHLA 4MY1A 2ABAA 2J8TA 1TJPA 4N9EA 1XYCA 5FL0A 4ZB5A 3EWWA 4LWWA 3MV01 1UP0A 3THAA 2ATSA 3XISA 2H3DA 4H9XA 5GPRA 1JZ5A 3LLFA 1B54A 4TU1A 4UB9A 2Z1VA 3AIBA 2HK1A 3PNZA 3G6YA 3FK4A 4G3IA 4DZAA 3NL3A 1ZQ5A 2A5HA 2IW0A 3WDPP 1B57A 4E4PA 4UFIA 2R1KA 1JDFA 2CZFA 1PHQA 3VFLA 3D3AA 3WUFA 3WUGA 3PY2A 3AI0A 1XIEA 1LF1A 2NUXA 2PDXA 1QPKA 4MSSA 1HVXA 1NP2A 5IOBA 4RL3A 1KR0A 4MF4A 2QKFA 2JKEA 2B7PA 1DXFA 4ECLA 4XO6A 4WSJA 1BLIA 4A6GA 2NQ9A 4LV4A 3KP0A 5FJUA 4IJBA 1UKTA 4BR1A 4CD7A 1JCMP 1WOAA 2BVDA 1SGJA 1D3HA 1W9DM 2V0TA 2P0OA 4PR4A 1T7LA 2VXNA 1LOQA 2CLOA 4EIVA 3VCNA 1RA0A 3GC2A 3PFRA 3QHOA 2CWNA 2HV5A 2WWCA 1JF5A 1DTUA 4J9QA 1DJGA 3P3BA 3SR7A 2D0GA 3EB2A 4B5XA 3GK0A 2ZUNA 2QVNA 3W29A 4KS0A 1CECA 2PDUA 3UWQA 3AXIA 4JTEA 3PR2A 4QG6A 4DBDA 4FLSA 3DFYA 2QS8A 4DJFC 2PDQA 1S5NA 4AC7C 1BAGA 1RP9A 1SMAA 1XICA 4ZE5A 4MWAE 3ENLA 3II1A 3O16A 3B40A 3WLOA 5EMUA 2OWWA 2XN1A 2RAGA 1ISXA 4CQ9A 1VH7A 1GYMA 3UJRA 3MMTA 3LSCA 3BG3A 1UWRA 3KE0A 4RNMA 4DXKA 4BQ4A 1LORA 2X1RA 3T08A 5B7ZA 3WUEA 1BD0A 4P7OA 4NNCA 1RD5A 4MY8A 4UC5A 2NLYA 4ZO8A 2V6AA 3NQDA 3CQKA 2HXTA 2X09A 1KD0A 1KGXA 2X05A 3AIEA 4DO4A 1XYLA 3SCPA 2I56A 2UVVA 4DJEC 3UCCA 3W7DA 2YBUA 2AKMA 3TH6A 3TYEA 1XDJA 2PGEA 3LDVA 1H09A 1G0CA 5K4XA 3GTIA 4QWAA 3PK7A 2QJHA 1OIMA 1QNSA 4LB4A 5LNVA 3VIFA 5H8MA 3EPGA 3TTSA 4IGHA 3O8AA 3WF3A 3H6OA 4F0KA 3NAVA 3VM7A 3ONBA 1Q6FA 3G3MA 4GOAA 3DBPA 3RM8A 4ZZ9A 3ARPA 3AALA 2V2CA 3A5FA 3A6OA 1NY1A 3GR4A 3HO8A 1FH9A 3M43A 1R8LA 4Q3MA 2JFEX 1T0OA 4A3QA 2UVRA 1A3XA 4CCDA 1W0MA 1G94A 4ZTYA 1K8YA 2EJ1A 5KITA 2E7FA 3SQSA 4JQ1A 5FL1A 1Q6OA 1TTQA 2J6XA 3PB2A 2XIJA 2C7FA 7ENLA 3AUOA 3LG3A 2VVNA 4MY9A 4LS2A 1K9FA 2FDMA 1LT8A 4NAFA 1OFEA 3MO7A 1W5PA 4HYWA 2VHLA 1MEHA 1KXVA 2NVCA 5CAHA 4OJYA 3BWWA 3M64A 3PZNA 5EMLA 4UR7A 3A24A 2YCLA 4GKLA 2OH2A 2BY1A 5CC3A 5E6YA 2PDHA 2HISA 1CT5A 1QR7A 5HPOA 1RYSA 2PD5A 5LIWX 3NSNA 4HTBA 5E09A 1IEXA 1JUBA 2PSNA 1JD9A 1VYSX 5KT6A 1CB7B 1W32A 4OGZA 5CZ0A 5JU6A 4AIUA 3FJNA 2NV1A 1MQRA 1TV8A 1V77A 2ABBA 4XV0A 4MDOA 4RDVA 4DQWA 4D8LA 1E40A 2WMIA 2Q3RA 2DW6A 5DCDA 2AMGA 2PU0A 4YL2A 3N04A 2E8ZA 5FKYA 3VGDA 1DV7A 4Q32A 4IL2A 2HTMA 1U1UA 3I6RA 2JF7A 3NUKA 2V68A 3S2JA 1EIBA 5EBAA 2XPKA 4I9MA 3UZWA 3ZVHB 2DJXA 3WLRA 1P0NA 3TQVA 2WVTA 3LZ5A 1LWJA 4KW2A 5REQA 3WBEA 4KPLA 3RAXA 3IPWA 2ZUTA 3H22A 2F2KA 1TMLA 2OQYA 2HVMA 1E6NA 4IIFA 3PBWA 1QBBA 4XZLX 1W1IE 4L61A 2E28A 5EBUA 1W1PA 2ISFA 4S23A 4JDBA 3VCCA 2ZX7A 1XKJA 4QS6A 1V7AA 3H2EA 1EX5A 2ZA3A 4HK5A 3DU0A 3R13A 1MNSA 1E1CB 4L65A 5A5WA 3GXNA 4LFYA 2UY5A 1QWGA 5CSYA 1TMQA 3G2GA 4L9XA 3IIZA 2VEIA 5EPDA 2RJHA 3OHIA 4ECXA 1UWUA 2OKOA 2R94A 4ZB0A 1VFSA 3LHVA 3AJ7A 1X6LA 4M6UA 3SY5A 1E56A 3W1QA 3VAVA 5I07A 3W3OA 1MRAA 4TX8A 3C0LA 1AD4A 1CXEA 1UH3A 1OCJA 3MHGA 1QASA 2TSYA 4LVFA 1H0GA 3QZAA 4X9SA 1NF7A 4FF7A 4Z1YA 5A6TC 4D9PA 2YSWA 3VE7A 4L6OA 1EDTA 2W9CA 4RU9A 3ZR6A 4ROPA 3BAYA 4O0QA 3NYDA 2ALRA 4H4IA 2O9TA 2QNEA 3TA9A 2D24A 3WFLA 4JAWA 3NG3A 2IQDA 4MUZA 2VDHA 4D6HA 4L4LA 1ONRA 1WA3A 4WJXA 1U83A 4O3NA 2GJLA 3DIPA 3IRSA 4AMCA 3TW9A 2PTZA 3WLSA 4B91A 1Z3NA 2Y62A 4FF5A 5DQIA 1UUOA 1KCKA 5KZEA 3IV8A 1J0IA 1EB3A 1P43A 2W9MA 4GI8A 3QFEA 2VC9A 1FWGC 5CZJA 1DWFM 4B5NA 1J10A 2HPIA 3M4HA 4MOZA 1A5MC 3W7CA 2JBMA 1PWLA 1PJ9A 3W7RA 4IMAA 3GKFA 3N29A 1Q4NX 3CASA 4QROA 2Y8VA 3PW0A 2WWDA 3G6MA 1K1QA 3S1WA 2P76A 5BCAA 1ODUA 1K70A 1H7XA 2ACUA 1M7XA 2SFPA 2PWUA 4GIRA 3RAOA 3B4YA 4LW7A 3POHA 4PTVA 3ABOA 4RXFA 2DH2A 5KMYA 4KFNA 4D6IA 1QI2A 1KB3A 1V8EA 4BWLA 2BOGX 3WQDA 1J5SA 3W7GA 1TSIA 4JFSA 3FDGA 4BI5A 3URQA 3WJWA 1BGAA 1JFHA 3N6JA 1UR2A 4GQ0A 1YNQA 3BLEA 1EF3A 1C8XA 1GPFA 2NW0A 3OLDA 4IUOA 4ECWA 5DELA 3OU8A 1H4PA 3S1XA 3MR5A 1LWIA 3C2RA 4C1LA 4GQGA 5CCZA 1ZZMA 4EPBC 3MZNA 1K02A 2E9BA 3QKEA 3V7PA 1LG1A 4NF7A 4I3GA 4YWSA 2OT1A 3CAVA 4GQQA 3CZ8A 4DLMA 2A85A 4WKFA 4E8GA 1SFJA 1Y8BA 5M1TA 1PTGA 4JFTA 4MWAB