1XRTA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
422
structure length
369
Chain Sequence
b'MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLEDRLALIEGVKRGIIDCFATDHAPHQTGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotase
molecule tags Hydrolase
source organism Aquifex aeolicus
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
total genus 137
structure length 369
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrtA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrtA02
3S2JA 3PAOA 4DZHA 3F2DA 4RDVA 3GU1A 4IGMA 1V4YA 2FVKA 4ZSTA 1YMYA 3MVIA 5HMEA 4C6MA 1GKPA 2GOKA 1EJWC 2O4MA 1PO9A 3KM8A 4TQTA 1FWBC 2PLMA 2WM1A 4C5ZA 4ZSUA 1EJUC 4RE0A 4CNSA 2FTWA 3LY0A 1KRBC 3D6NA 4KETA 3QY8A 5AKQA 3OJGA 4H9TA 3F2CA 4PCPA 4DZIA 3TN5A 2VC5A 3GG7A 3PNZA 3QGKC 1BF6A 4H9UA 2YXOA 5G4HC 4INFA 4DLMA 2KAUC 1V7AA 4LAKA 2R1NA 3ORWA 2GSEA 3UBPC 4KF1A 1M7JA 1V77A 3OU8A 1RK6A 4C6LA 1RJQA 4XD5A 4F0SA 4DYKA 3UF9A 5HMDA 3R0DA 1S3TC 1PTAA 2YB4A 4QS5A 4GOAA 2Z29A 4KERA 4XAYA 1YIXA 4GZ7A 3T8LA 3LSBA 1XGEA 1V51A 3C86A 2PGRA 2E25A 1YBQB 2W9MA 4MUPA 3DUGA 2R1MA 2WJFA 1R9XA 3GGMA 4C6DA 4RDZA 1RA0A 1DPMA 2I9UA 2E1WA 3ISIX 2OOFA 2OB3A 3UR2A 3BE7A 2Z25A 4C6JA 2OODA 1P1MA 4G2DA 1KRMA 4LFYA 4WVXA 4IFRA 2HPMA 3LGGA 3E0LA 4EPKA 4C6KA 2Z2AA 3K4WA 4LAOA 4KEUA 2AQOA 3PNUA 3IPWA 4H9VA 1GKQA 4ERAA 1FWHC 1YNYA 4L9XA 2A3LA 3MDUA 1P6CA 1O5RA 3FDGA 4L6DA 4V1YA 2QVNA 2HBXA 4J2MA 3S2LA 1FWAC 2WJDA 4C6NA 4DNMA 1RAKA 4HJWA 3UPMA 1M65A 2VHLA 2R1LA 4C6IA 1NFGA 4IG2B 3RN6A 2PAJA 4LEFA 4IF2A 5FSDC 2R1PA 3NURA 2OQLA 3GU2A 4F0RA 3JZEA 3E0FA 1J6PA 1RK5A 1GKRA 3HTWA 1ITUA 4ERGA 3E38A 3B0XA 1FWIC 4CQBA 4CNUA 3IARA 4DI9A 3LGDA 3LS9A 2Q09A 2HNHA 4KEVA 1M68A 4QTGA 1ADDA 1RJPA 3E2VA 2OGJA 4WHBA 2Q01A 2VM8A 3TN4A 1E9YB 1IE7C 2BB0A 4GK8A 2QT3A 2WJEA 4E3TA 1O12A 2Z2BA 3OQEA 3EWCA 4HK7A 3HM7A 1EZ2A 1A4LA 3MVTA 4G7EB 3HPAA 3OVGA 3F4CA 3GU9A 3WMLA 1EJTC 1W1IE 3URNA 3LA4A 1ITQA 1FWCC 1QXLA 3RHGA 3WZ0E 3IGHX 3MKVA 4XD4A 4KEZA 2GWNA 1UIOA 1K1DA 4UB9A 3F4DA 4QROA 1J5SA 2UBPC 1VFLA 3TN6A 3UR5A 3WYZA 4H00A 1KRAC 4BKNA 4QSFA 4XAGA 5E5CA 3AU6A 5LXXA 5A6TC 3CJPA 1POKA 3B0YA 3LSCA 2VUNA 1RJRA 3MPGA 2Z7GA 4R88A 2P53A 3GTHA 4PBEA 3IACA 1UBPC 1NDZA 4D8LA 1P6BA 2QPXA 4DO7A 4B90A 1ONXA 2GWGA 2VR2A 1RA5A 1QW7A 4XAFA 4RDWA 4DLFA 2G3FA 2DVUA 3URBA 3IRSA 1EJSC 3MSRA 2BGNE 3OODA 2Z26A 4LCRA 2FVMA 4M51A 3O7UA 3T1GA 2DVXA 4AQLA 1FKWA 2EG6A 2F6KA 3RYSA 4H9XA 4R85A 4EPEC 1PSCA 2P9BA 1EYWA 4V1XA 4CEUC 3A3XA 3GTXA 4YIWA 1I0DA 3URQA 3K2GA 4NG3A 3S4TA 4DIAA 4LH8A 3RCMA 4ICMA 4C60A 1ZZMA 4GBDA 4XD6A 3ID7A 2XIOA 3DCPA 4IGNA 2YB1A 4RDYA 2ICSA 1A5NC 1E9ZB 2YZ5A 1NDVA 1UMLA 4NP7A 3E74A 4CNTA 4UBPC 4LAMA 3G77A 3DC8A 3A4JA 3EWDA 4CQDA 4QRNA 4NI8A 3V7PA 4LCQA 1EJVC 4IG2A 3IJ6A 3ICJA 3GTFA 4IH3A 4OFCA 2HPIA 1JGMA 1J6OA 3NEHA 1EJRC 4BJHA 1KCXA 3AU2A 2P50A 4LALA 2GZXA 2Z24A 3AUOA 1A5KC 4G7EA 5FSEC 1A5OC 4EPBC 4C65A 4GYFA 3MTWA 1R9YA 4RZBA 4C6CA 3QGAC 2PGFA 3SO7A 2ADAA 4Z42C 2FFIA 4C6FA 2ZC1A 3GRIA 3NQBA 3MJMA 1A5LC 4WGXA 4B92A 4P5UA 4KIRA 2Z4GA 1POJA 3QY7A 1XWYA 3LU2A 4JOMA 3CS2A 1J79A 4IFKA 4GX8A 3SFWA 1FWFC 4GXWA 4CEXC 3URAA 1FWEC 3S2NA 4F0LA 3TN3A 4IFOA 4GC3A 3IV8A 4IQJA 2O4QA 1FWGC 4LCSA 3T81A 1FWDC 4J5NA 5CH9A 4HK6A 1NDYA 4KESA 3GTIA 2UZ9A 3TNBA 4H9YA 1ONWA 1PB0A 4BY3A 3FEQA 4C6BA 2ANUA 2RAGA 4GY0A 2Z27A 4HK5A 4QS6A 3OOQA 1V79A 4I6KA 3MDWA 3FDKA 4PBFA 1EJXC 1K6WA 3K5XA 2HQAA 3A3WA 4H01A 2EG7A 4DI8A 1HZYA 2HBVA 4R7WA 4ERIA 4CQCA 4H9MA 4H9ZA 2AMXA 1EF2A 1A5MC 4C6EA 3PBMA 1XRFA 4XD3A 4EP8C 1FKXA 4XAZA 2AQVA 4EPDC 1I0BA 1UIPA 3CAKA 2I5GA 2Y1HA 4PE8A 4IFKB 1YRRA 3E3HA 3O0FA 4B91A 4HA0A 2D2JA 4I6VA 2Z28A 3S2MA 1WXYA 1NDWA 4B3ZA 3F2BA 2D2HA 2FTYA 3GIPA 3LNPA 4GX9A 4C6PA 3PANA 4C5YA 2DVTA 2R1KA 4J35A 3B40A 1FWJC 2IMRA 1YBQA 2VC7A 4LANA 3GUWA 2PUZA 3N2CA 5HMFA 3GIQA 3QY6A 2Z00A 4GY7A 2D2GA 4PCNA 3ITCA 1XRTA 1WXZA 3EGJA 1R9ZA 4C6OA 1A4MA 4C6QA 4GY1A 1K70A 2EG8A 2QS8A 4AC7C 2CZVA 4KQNA 1KRCC
chains in the Genus database with same CATH superfamily
2DSWA 4NRSA 2JEFA 4M81A 3GH7A 2WKJA 3F2DA 3W2NA 3MW7A 3NL6A 3T55A 1QNOA 1HJUA 4JX6A 3VX0A 4Q8OA 1C3FA 1H09A 2QPSA 3E49A 2DZPA 2INEA 2WJZA 4K1GA 1XLEA 3ITXA 4YJ5A 3SCPA 3UWQA 5I09A 5D2YA 3RO6A 5CGTA 1QAPA 3IJLA 2JKAA 2EAWA 1UD4A 1X98A 4G3IA 1TB3A 3AO0A 4H9TA 3GW0A 1WKEA 4HMCA 3IJQA 3OGSA 1OF6A 1C92A 2ALRA 1RPXA 1UUMA 1XBXA 3UBPC 2A7RA 4FIQA 2OU4A 1OCJA 3RLHA 2A5HA 1VYSX 3VFCA 1ITCA 3BJSA 1YIXA 2OO6A 3C6CA 3BZJA 4I9MA 1CXIA 1S3HA 1KWKA 3NR0A 4UFLA 4PTMA 1BRLB 4MUPA 4RE2A 1PDZA 4DPPA 3NYZA 4FLSA 3T6CA 4DJEC 1N8FA 2YCIX 4KWUA 4DXKA 2JBMA 4FXSA 3W25A 4GYKA 4PMZA 1OX6A 3MHFA 3TV8A 3GC4A 3LBCA 1YQ2A 2IPJA 4NJIA 4TUFA 2ZIDA 3GXDA 2TPSA 5DEZA 4AEOA 3MB9A 1BYCA 4AZHA 1PX8A 4RE3A 5A8GA 3ALGA 1KNWA 2FZNA 2C18A 4ADSA 1AQFA 4C6IA 1HJXA 2QCCA 2P0IA 2ON3A 3L5AA 4GCAA 4HQVA 3QHMA 4U2YA 5H8PA 3O07A 1NAL1 3B06A 1NM9A 4ES4A 1LUCA 3TTYA 2PB1A 3E0IA 1ITUA 1BLIA 5D2VA 1S2AA 4CQBA 4DM2A 1T41A 1J0JA 1GJPA 4YTTA 1ADDA 4FNPA 3QC0A 2D3LA 3CU2A 1K8CA 2WZMA 4AISA 2Y24A 1QOQA 3E2QA 3REQA 3TNOA 2BOEX 3THDA 4LT9A 2DZUA 3XIMA 3IK4A 1EIBA 3VMOA 1TE1A 1ITQA 4W7UA 3WQGA 3TQ1A 1M5WA 2JEPA 2W7OA 4QCFA 4OE7A 1KW1A 5D2WA 4EF9A 4YR3A 1K77A 3NDOA 3TYZA 1REQB 1DOSA 1UKPA 2WMHA 5LXXA 3UXDA 1Z32X 3N9SA 3EMCA 3B0YA 4J3TA 5CPNA 1D3HA 1VH7A 3A21A 1MRQA 2CLPA 4TMBA 4A35A 4J2PA 1K8YA 4WY0A 2G95A 3WEZA 4JCMA 1Q7MA 1ZQ5A 1VEOA 1RA5A 2F7FA 1XIMA 2J6VA 3WX7A 3IRSA 2HNEA 5ENLA 3U4FA 4DL3A 1XIJA 4LCRA 5JBDA 3T1GA 4AQLA 3APGA 4KKXA 2P9BA 3SIZA 1D8WA 1YTKA 1P7TB 1U5JA 4DL6A 3L9CA 1PCWA 4L9ZA 4J3WA 3EEGA 2R91A 1GJWA 3KDNA 3AWNA 2I16A 1JX4A 3BMVA 4Q4QA 5A8NA 3EKLA 1TWWA 1NDVA 1U2YA 2X0YA 4K68A 3N29A 4CQDA 3VD4A 4QNWA 5I07A 2V82A 1EJVC 3UPWA 2QJJA 3W2JA 1VFTA 4Y90A 4CU8A 3AYSA 2W9BA 3EKGA 3HFTA 5LNUA 3VZXA 1LP6A 2WNWA 3CB3A 3AUOA 5EMKA 2Z2UA 3WH5A 1TMQA 1EWDA 4JNMA 1JEZA 4UFJA 3WG6A 2PRLA 3U2ZA 1TIMA 2WVUA 2CLOA 1C9DA 1PHQA 4NI3A 4IPIA 3RO8A 1PL9A 2VWSA 1Z9AA 2OLHA 4PUMA 3TE9A 3OVRA 3PC0A 1KFKA 4KIRA 3E12A 1W91A 2OX4A 5CG0A 3T5KA 3M64A 1W8GA 4JTDA 2JGQA 3UWEA 2OOGA 2CPUA 1WE5A 1XLAA 3MZNA 3HMJG 5AHIA 1RY0A 5FJOA 1DE6A 3CTLA 1NARA 4MGGA 5MKGB 1PKYA 4JY8A 3NVTA 4IIBA 3MMDA 2G4JA 3NQEA 2D1ZA 3U7VA 2BODX 4NZCA 3EZ4A 4DUXA 3MY9A 3VNZA 2J77A 2EG7A 3M0IA 4LV4A 1HZYA 1PEZA 1TV2A 4FHAA 4HMDA 1GHRA 1TJPA 4HKPA 2XGBA 3CV6A 1L6SA 2VRQA 3OLIA 6TAAA 4AZCA 1BVWA 1E6XM 1TPUA 4FLRA 4H1ZA 4HPJA 4ZO8A 3V36A 2GQ9A 1EYEA 3LCFA 1FUYA 4A2SA 1JD7A 3SBFA 1ICPA 4L1WA 5MF5A 1FX6A 4ZQNA 4TX6A 3GIPA 4LPCA 4LBRA 1GTEA 3GM8A 3FVMA 2FGBA 3V6JA 4JTJA 4J35A 3TX9A 1YBQA 4W9TA 5HATA 1TWSA 2PUZA 4KRTA 4UQAA 1XYBA 2UWFA 4GCXA 1VYRA 3MUXA 3LCXA 4Z1AA 4GY7A 3VDBA 3EMQA 5HPOA 3ZIZA 2YBTA 1EC8A 2ZWZA 4I9JA 4UFMA 2VNCA 1US2A 4LYPA 5EWFA 1KRCC 2W27A 3EWBX 1O1ZA 1SZEA 3GVWA 4JN6A 1EO5A 1TPC1 3N04A 3GH5A 3DG3A 3TR2A 3IGUA 4OV9A 5M2FX 4ED3A 2AGQA 5KZ6A 5BW6A 2CKRA 4MB4A 2EEXA 5DQIA 1FWBC 2QGHA 4GNKB 4IX0A 4EIVA 3PZUA 4RE0A 4NAFA 3GTNA 3NZGA 4US5D 2J6TA 1KC7A 4RV8A 3DHUA 2YCEA 1VIWA 1Q63A 3AYTA 4LRTA 1LRQA 1G94A 3GNPA 1JD9A 5G4HC 1HVXA 3WK2A 1H3GA 4ADUA 4BEQA 1OC6A 4OKDA 4Q44A 3B0UX 5FF2A 1S3TC 1HW6A 3ARSA 3WDQA 4QFUA 3W7NA 1Y7VA 3CIVA 4MY9A 4DHGA 5TF0A 4B4FA 5D03A 4HGXA 3P74A 2QJIA 3Q8QB 1EA0A 2WJFA 1DPMA 1R3QA 5H8MA 4LF1A 4P7LA 3WCZA 3C2VA 3WLMA 5B80A 5T9BG 3V18A 3MO7A 3ERPA 4AZGA 5CC7A 4KCWA 2AQOA 2A3HA 4F8XA 1RBLA 3PBVA 2X1SA 4G6CA 2ACSA 4DEZA 4HYVA 2VJXA 4OVXA 2BVWA 4S3JA 3FJLA 1MEHA 3EKZA 2O9RA 1QHPA 4J2MA 3W37A 5F4WA 4MF4A 3QZEA 4BWLC 2E6DA 1A53A 4I9AA 4U4MA 2GDVA 2QCNA 4MJ4A 1NP2A 1VRDA 2NV1A 1VJZA 5JXQA 1KLZA 2J7EA 4RPQA 3VM7A 3GU2A 3ARRA 4DRSA 2XN1A 3M5VA 3UG3A 1J6PA 4H3DA 1DQWA 3AXMA 2FVLA 1E56A 4NAFB 1GW9A 3KP1A 4YYFA 3OLEA 3CHFA 3TW9A 4O53A 3S3GA 3LS9A 3U0HA 1LRTA 1W9DM 3CEUA 1XLKA 3N9RA 1TWDA 4QW8A 3WQ8A 3T05A 1GQNA 3P3BA 4BQ3A 4GK8A 1E51A 4H8VA 3PPCA 5BNKA 2FZBA 1IT7A 1QPQA 9XIAA 3VFLA 1IR2A 1EQCA 1PVNA 3GU9A 4U33A 5CC5A 4W8AA 5M3WA 3N19B 3LGEA 4DJDA 3HN3A 5C2XA 3PULA 4KCVA 4JHZA 1VRXA 1W2VA 1PTGA 2UBPC 2VEMA 2YGYA 5HNNA 1E73M 3N2BA 1POKA 1R0MA 4AD5A 3DAQA 4HZ6A 4BF9A 3SECA 4MJZA 4EYHB 3GV5B 2QYGA 5A6BA 1H7RA 3CC1A 1RLCL 5FOOA 4XAFA 2V63A 2C13A 4MM1A 4JTIA 1GK8A 1XI3A 1V7YA 1MNZA 3ZQ9A 4XSLA 1WA3A 5G1MA 1G4EA 1OG6A 2I14A 1S0OA 3HGJA 3KHJA 3H8AA 3RX3A 3DBNA 4QR6A 1DHKA 3HGSA 1LLWA 2A3BA 4Y9AA 2ZUNA 4RX0A 7REQB 2PLJA 3W26A 3OO2A 1ZGDA 4ECTA 3V16A 2WBGA 4ONVA 3A4XA 2IMWP 1S2VA 1C8QA 3TK7A 2Z1XA 2INZA 4FX8A 3S4TA 4Q4RA 4IL0A 1E0WA 4NZJA 4HA4A 2WM0A 3VTRA 1XCWA 3ZR4A 4NKCA 3NQMA 2J78A 3UWVA 3G77A 1S1RA 2C1GA 1IT0A 3S1XA 3VCRA 4OBRA 3C2OA 4I5XA 3IJ6A 3NWRA 1V0NA 4S3EA 3FXGA 5KFEA 2DSKA 2H8ZA 4E38A 1R30A 3GIIA 1GQIA 4ZL1A 4K38A 3C8FA 2VFDA 2ASDA 4RZBA 4C6CA 3NSXA 1XLBA 3M0XA 1XKYA 1ZJBA 3OG3A 4ML9A 1SSGA 4GUGA 3NNTA 2Q6ZA 3MJMA 1TZZA 4GFSA 2D20A 1GZGA 5AC8A 1Q2SA 3S1WA 1CLKA 4O52A 5A8MA 2PDCA 1KFLA 6TIMA 1J96A 4GQ0A 3ATZA 4JICA 4F0LA 3TN3A 1E3ZA 1OIFA 1HO1A 1Q3NA 1E15A 3T81A 5AC5A 3RMJA 3S5NA 3W7PA 5KFIA 1XIDA 3BLIA 4L1XA 4DYEA 1S5NA 2JK2A 3QFEA 3V35A 2V69A 2XCPA 2FLPA 2PSNA 1BKHA 1E1EA 3O6CA 1XCXA 3AZRA 1JF5A 1S2WA 3N34A 3TW7A 3VO0A 2CU0A 3EPMA 5DG8A 1C8VA 2VFGA 2DZBA 1EOKA 5G1YA 4J9NA 4H01A 4P7OA 3RR1A 1RCXB 3WDHA 3VKCA 1L6WA 1SZNA 3G2GA 4GC7A 3N2OA 4FXJA 3UESA 1RBOB 1GGOA 3G1RA 4MZ1A 1XRFA 2VX6A 4XAZA 2NX1A 1I60A 4LS1A 3WFLA 4DUWA 3B4UA 5D09A 3CAKA 3IUDA 1E0TA 3OSNA 1XBVA 1UA7A 3E3HA 4Y9MA 3WK0A 4IL2A 1Q2RA 4HA0A 4J3SA 4Z1YA 3S5ZA 3M41A 2GGIA 1XUZA 1BYBA 3BANA 3NTYA 4J9LA 5A6BD 2BZNA 3CBWA 2Y89A 4J9KA 3G8EA 2GQAA 1W9BM 1CEOA 2XFFA 1F4AA 3QVQA 4GFIA 1V02E 4XTDA 3N17A 4ZENA 1XRTA 1UZ4A 2W8KA 3VNIA 4EE9A 3TA9A 2W66A 1KD0A 3EB4A 1C93A 3C0SA 4DZHA 1YKWA 2WMKA 4A8IA 2HZGA 3Q8SB 1YLVA 4NJJA 2QMKA 3LHTA 4MKNA 4LAZA 3ONCA 4PUKA 5B7YA 3VGFA 3MSDA 1YMYA 1UB3A 4PC8A 2VR5A 2XGIA 4F40A 2ZUMA 2VT0A 1F4HA 4XKYA 2FLLA 3PW5A 1I6NA 1QI2A 1G9HA 5KFRA 4WX2A 3U6WA 2BVTA 3AFBA 5I77A 3PW0A 5JUVA 4KH2A 2PDPA 3TW6A 4DJED 5M17A 1SZRA 2ZVIA 2XVPA 3ORWA 1FXQA 1SO5A 2XDFA 3OU8A 3RM4A 4QBXA 1JXKA 4ED1A 3MFIA 3MJYA 4DL4A 1G7VA 1UWSA 3WQPA 1MW0A 4H8UA 4KPLA 4GYJA 2WZEA 4IWWA 1XGEA 2OG9A 3OB8A 1V51A 4Q8NA 1ME7A 2BHZA 2UY4A 2XYLA 1CGUA 1O68A 3LD5A 4KGLA 4PMXA 4IX2A 4F9DA 4C6JA 1FWSA 1KRMA 4I5UA 5EMLA 3AIQA 3OVQA 1AD4A 1MXGA 3BQ1A 4YYCA 4Q43A 4Y9PA 1H0GA 4XSMA 3PNUA 4HPHA 5JVLA 4ED6A 4ATDA 3SAZA 1PYMA 5EGRA 3BWWA 2ZXAA 3OIHA 1O5RA 4L6DA 5E09A 1HL9A 1CCWB 1FWAC 1XG3A 2O56A 4C6NA 7A3HA 3ZJ8A 2G96A 5BCAA 3ME3A 1Q6QA 5TQLA 1NFGA 2Y4SA 3BW4A 3IIVA 3IK2A 5FSDC 2EKCA 4J9OA 4EX4A 7ENLA 3P6LA 3G1SA 3NURA 3WUFA 2AGKA 1W1PA 4MLJA 3DFQA 3SRKA 2RHGA 1H1YA 1BTMA 2EBNA 1TMHA 3CZKA 4WKAA 1FWIC 4FPSA 2Q09A 1DIEA 1M68A 1RJPA 3QW3A 4WHBA 4KS0A 1FH9A 1QNSA 1HNYA 1QCWA 4UR7A 4Z1BA 4GUJA 1Q5MA 3ITLA 3CQKA 2J9ZA 2WOQA 2P10A 5LHFA 3VX1A 3R8GA 4LYKA 4Y6GA 4R8UB 4K8EA 1QBAA 4PMJA 3GDTA 1P0KA 4C1NB 1LCOA 2JEIA 3KVJA 4NYUA 5HK4A 4NF7A 3F4CA 4DZ5A 3I10A 3W00A 4N7QA 2J7FA 3XISA 5AYIA 1OGGA 3M5YA 3CMGA 1E4LA 4MJMA 4UB9A 1L2QA 3LPGA 5HOSA 1LWHA 3N6QA 3L4TA 3AU6A 1FVPA 4WK9A 2WSYA 2YL9A 3OA5A 4F4YA 2XGPA 3QSTA 1MNSA 2AAMA 1Q65A 3M6YA 5JUMA 2J88A 3L2MA 3LOTA 4E4UA 5FF4A 5E1QA 4ECQA 1SO4A 4G7FA 4B90A 4PB4A 4GUIA 3OHBA 4WUIA 3LN3A 3ZVIA 5D8WA 1DJIA 1GOKA 3BMXA 1PZ1A 5A94A 2BGNE 4LBUA 4JTRA 3W82A 4MLRA 3NGDA 1P0NA 2DVXA 4RR4A 3VZYA 5KFWA 4H9XA 1OFQA 4KW2A 5D32A 2PTYA 2OKOA 3SCNA 1H63A 5F7UA 1K02A 1E6SM 4MPQA 1VFHA 1ZENA 5K2ZA 4Y8EA 2OVLA 4JD4A 1QVBA 2G41A 3G6MA 2JGYA 1T5AA 4PGLA 2X1RA 1KGXA 4HNNA 1B1YA 1A5NC 3K8LA 4O1BA 2CEQA 3M0HA 6ENLA 3E74A 4CNTA 1W5MA 4GI4A 1KB3A 3BV7A 1Q6CA 3W7MA 4B5UA 1PXGA 1I75A 3NO1A 3VKBA 4LB3A 3W3OA 3CWNA 3ATYA 3FIGA 3G1YA 3W2LA 3PB2A 3ICJA 1S46A 5IHRA 2PTDA 3EOUA 1TPEA 4ZTXA 3NEHA 4QLKA 3L4VA 1YE4A 3GNNA 3UWZA 1UBSA 1XINA 1DWGM 3GY1A 1ZP3A 1WBJA 2W79A 3OIXA 5E0KA 2C8NA 5CC6A 1JFXA 5FSEC 3C2RA 5DMMA 4J9RA 2DUXA 2FB2A 1KXVA 3KAOA 2TRSA 4FI4A 1WDDA 4H6KA 1BG4A 2BVYA 3W23A 1QFEA 3VNJA 2Q8LA 4AZ6A 1EL3A 1H49A 4HCHA 4DF1A 4ECUA 5DQHA 2Y0FA 1XWYA 1KM2A 1P0EA 2WSPA 3TXZA 1V08A 3GILA 2NXHA 4J27A 3QYSA 5D4YA 1OABA 4XZHA 1LOQA 4D6CA 2F9RA 2ZDRA 2VQTA 5A2CA 1W3LA 3CLWA 1M7OA 5I23A 1NWRA 1ONWA 5IDIA 3SCWA 2W3ZA 3KHRA 1NF0A 1BG9A 1QW8A 3LYEA 3LI1A 3MWAA 2WLYA 5J8LA 1DQUA 3A3WA 2OPJA 2ZZ5A 1JCNA 3QQ1A 4KBXA 4H9ZA 5HQLA 4JN7A 3MP3A 5D37A 1GYMA 3S8HA 4EP8C 1JAEA 2OWWA 1WZKA 2WHKA 2OT0A 5BMXA 4WIWA 1ENUA 4B4HA 2POZA 4H6EA 1DWJM 3NG3A 3D47A 2Z28A 3WEOA 1ZLPA 3UZXA 1WXYA 3L7RA 5KFJA 4HSHA 4LYQA 3LBMA 3GAKA 3MBDA 2XGZA 3LNPA 4S2BA 2FGZA 4O14A 4DF0A 2IMRA 3H24A 3P82A 3GQCA 1XLMA 1KM3A 4AD0A 3ARPA 3WFAA 4FOKA 1EPXA 1SW0A 4CLMA 2ISVA 4CQ8A 1A5CA 3M5XA 2Z6IA 1K9TA 2E6FA 4M82A 3RMEA 1I2RA 3EPOA 4GBDA 4HU8A 4REQB 3PZNA 3D0CA 2NQLA 4L6OA 4S3GA 4L65A 3S42A 1QASA 2FH6A 1W56A 2V3EA 1QPKA 4Q45A 3I4EA 3SIMA 1GKPA 1X8CA 4TQTA 3WNOA 1ZSXA 4Z2LA 4CNSA 2XHYA 5AC6A 3V1PA 4QXIA 4CNPA 1YEYA 4WZHA 4WCJA 3KLLA 3W7OA 2BLEA 4JTKA 3CZ8A 4F2UA 1UP3A 2HEJA 5EFDA 3VI2A 4HNVA 4KCUA 3K30A 4NASA 4IIEA 1XJBA 3C61A 3AI0A 1A0DA 3WJZA 1XBYA 1GEHA 1U30A 5JH2A 4FOJA 1FCQA 2YLAA 3QMSA 4X0NA 1ISZA 5AY7A 1YBQB 4TVUA 1IEIA 1VZWA 5E93A 1R9XA 4XQ6A 1OFAA 4QSHA 1RQBA 1JCJA 2D73A 2HCVA 2PU0A 1MUWA 3CWHA 3VDGA 3CAWA 4D6GA 3UD6A 3L4YA 1Z3NA 3HV8A 4ZQMA 4EPKA 4W8LA 2WHJA 3BLOA 2HVNA 4UZSA 1TPFA 3DN5A 2ZVRA 5I24A 2H6RA 2C0HA 2G50A 4WKFA 4FS2A 4ZOAA 1FWHC 1Z44A 1P6CA 2VZTA 3CXOA 2G4FA 1ELSA 2X41A 4LJ3A 2ZFAA 3TQKA 2CESA 3T7VA 4G9PA 4IP5A 2C15A 3PWIA 5F9LA 1A5AA 2R1LA 1M3UA 2VZSA 3RB6A 3VIHA 1MVYA 3VIIA 3T07A 1G01A 1LT8A 2W5FA 4U3AA 1UH2A 3T42A 1VLIA 4LQ1A 5M5DA 1SO3A 2C71A 3W75A 1VGAA 3P14A 4AHPA 4F0HA 5I3FA 1QOPA 2I5IA 2HNHA 4X60A 3GFXA 4PODA 3GDKA 5KETA 3GVQA 3DI1A 2Q3OA 3ZWSA 4QE4A 4WXYA 3SCVA 4IIFA 1W3IA 1B3WA 4AD3A 4UNLA 3TUUA 2CLLA 1O66A 4Q8EA 4ZB5A 1W9XA 3OQEA 5MHBA 3TQPA 1EZ2A 2BFGA 3RU8X 3UNTA 3ZVHA 1EJTC 3GAYA 2QF7A 2VD9A 4OOUA 3TVAA 4GO9A 1ODUA 3F4DA 4AF0B 4NIRA 3MHGA 3T9PA 3FAXA 3MR3A 1HKWA 1HO4A 1Z48A 5HUOA 3R43A 1FCVA 1VJSA 3TC3A 1MO0A 3NUKA 4JPGA 2NZLA 4LEQA 3LXBA 4EWND 4PR4A 1K4GA 4HCLA 1CWYA 1NDZA 4Y96A 5C6MA 3M44A 4ZEPA 2GFTA 2QHAA 4E8CA 4M1BA 3L65A 2ZYFA 2ALZA 1UZDA 3L23A 3MKCA 5KTLA 4QG8A 1V6VA 3FDSA 4DEFA 1YW1A 5AC4A 4M51A 3BAXA 4E4FA 1X6NA 4AFYA 3GXTA 3APYA 2ZZ3A 2AL2B 4P8UA 5JMUA 5AHLA 2FLNA 1DXIA 3PG8A 1B90A 4WR3A 2YW4A 3KBSA 1S5WA 3URQA 1BAGA 1OFPA 2BV9A 3ABRA 3VYLA 1PWLA 2ABBA 5GNXA 1TPVA 1ZZMA 1JZ2A 1OCNA 5D02A 5C9UA 4N4QA 2IS7A 2CXGA 2ZZ4A 3AMDA 3GDBA 5KZEA 2HS6A 3DC8A 3EWDA 1AK5A 1OFRA 4K1WA 3QGVA 4NI8A 3OHMB 3INPA 3GR8A 4NU7A 4S3FA 2PWGA 1F3EA 5DXXA 1T8XA 1S97A 4UTJA 3G6LA 4ZBCA 4MFEA 1R2RA 3V0TA 1FWNA 2J7GA 3SRDA 3S46A 2YR1A 3G0XA 4AAJA 4GVHA 3O6AA 5CSYA 3DOPA 3VIOA 2ZCGA 2PP0A 2RJGA 3VOJA 2OGYA 3WNMA 1JYXA 2QJNA 3G5EA 4LB4A 2PGFA 1E6PA 5KINA 4B92A 1M7XA 1ADOA 3DFYA 3BICA 2WPGA 1I2PA 3G0UA 3GG1A 3H2MA 4A8LA 3T2OA 2AGPA 2CHOA 4IFKA 1Q6DA 4CEXC 1VR6A 2FYMA 4Q4SA 1PAMA 1TTIA 3RLUA 4NJKA 5CH9A 4I90A 2GDQA 5KG5A 4JGDA 2ISFA 4C1KA 3IJ7A 3UXIA 3MUCA 5EMMA 3EXSA 1AUSL 2VENA 3RUBL 4YTRA 1IEQA 5D33A 4D6EA 3TNBA 5KFBA 2WQDA 2YIHA 3P93A 4XISA 4IMDA 3QH2A 2VFEA 3IWPA 4ECRA 2R24A 5F2GA 4O19A 4WSKA 4I6KA 4XZBA 3O6DA 1Y8BA 4CQCA 1F7BA 1GVYA 4WY0B 5HQMA 4P2VA 4IXHA 1RVGA 1P0DA 4NNAA 3CYVA 1EJ7L 1VFMA 1WAUA 4BQ2A 1Q13A 3AMGA 1WDQA 5KFZA 2ZX7A 1DJGA 4IMCA 4QJ4B 4W4QA 2GPTA 3PUGA 4DUVA 3CV1A 4UFHA 4MNLA 4YVXA 2XVNA 3N9KA 3NQ2A 3U4AA 3S2CA 4HTYA 4RJEA 9XIMA 1KGUA 3F1QA 4IPNB 4HZ8A 3ZT7A 1BVZA 4O4WA 3NIYA 3GE7A 1FWJC 3O2LA 4YTSA 3PZQA 4GZEA 4PRRA 3ITCA 1EIXA 2DPJA 3GQYA 3C2YA 3DG6A 1VFFA 3TJLA 2J62A 1LTDA 2OWCA 4HN8A 4RUAA 4DO4A 3T0BA 3MU7A 1XKJA 4JFWA 4LVDA 1GONA 4PB3A 1BYAA 1JDDA 3GD6A 4CN6A 2G37A 3MFHA 5KFQA 4TQSA 3PBUA 4R3UA 1RXOB 1DJXA 4PUWA 3WFZA 3AC0A 3VKJA 1JYNA 1AVAA 1EGVA 2QVHA 3QY8A 2JF6A 5I3HA 2W9AA 1XLCA 1K7XA 4PCPA 3ITOA 1XBZA 1JF6A 1ONEA 1YPXA 3TXVA 2YXOA 3HA1A 4KRZA 3GUGA 5B7ZA 1BHGA 3LRKA 4PMQA 2FIQA 2DIJA 3DBPA 3TYUA 3TWAA 4S3KA 4DWSB 1S2UA 1QMLA 2UY3A 1ZAHA 4O28A 2GSHA 2OZ3A 4EBDA 2EPOA 3F03K 1J2BA 3PZMA 3VC6A 1E1CA 3KTSA 2OH2A 1J0ZA 4LUTB 1BF2A 1S2CA 4MSSA 1G4TA 3HPZA 2PCQA 3ISIX 3ARYA 5FJJA 5LKYA 5FACA 2IA6A 3CZEA 4JIQA 1ZHAA 4KEUA 5ABEA 3TQ0A 3IPWA 1J0KA 3GR4A 2JEQA 1OBAA 1QWGA 1A50A 3DC0A 1QJWA 3FYOA 1DWIM 3C3NA 4GVGA 4DNMA 3A64A 2F6XA 1EBHA 3UGRA 4GXPA 5KITA 4M29A 4L80A 4AC1X 2J47A 2Q02A 2XUCA 1OHLA 3NAVA 3TCEA 3BG3A 2V4RA 3E0FA 3AHTA 4A8RA 2YFNA 1MEIA 5G4EA 4GQBA 1FY6A 1QW9A 3LGDA 1JUBA 3L5MA 4QTGA 4O3QA 1BXNA 3D3FA 1B54A 1XFCA 1XYLA 4EAYA 2OFJA 3IS4A 4Q33A 2VFIA 4AZBA 4WJ8A 1UP0A 2ESCA 1EZWA 3HZ3A 1HJVA 1OQFA 2Y63A 4X61A 3VGHA 4AB4A 1UHVA 1PKLA 2V81A 4LOCA 4QISA 4J4KA 1O12A 4RZ5A 4XKMA 1YPFA 4HK7A 4UCFA 4RUBA 2DJLA 3QRHA 3OVGA 5XIMA 4RNMA 1BWLA 4WDWA 4IGSA 2QV5A 2WO5A 1ODZA 4Q8PA 4Z0JA 2F2HA 1UWIA 4LRSA 4YU1A 3FA3A 5SWUA 2V2DA 2DZTA 3PK7A 4GI6A 3ZVHB 1J9YA 3T4CA 1R47A 4MB3A 2EPMX 2YDAA 2HK0A 3WJWA 4MKVA 3L0KA 2V68A 2EXOA 3RRAA 4H7VA 2E0PA 2V5BA 1DWHM 3FS2A 2C22A 1CECA 4GUHA 3P5ZA 4LNYA 2PDIA 4UMAA 7TAAA 1H7OA 3N73A 3H54A 1DYSA 8XIMA 1EHNA 4PMUA 3STFA 1PS9A 4A22A 2YL8A 1XLDA 3N12A 2VTFA 1EYWA 4V1XA 4MG4A 1ICSA 4XZLX 3SEPA 5FJPA 1GZ1A 8A3HA 4Q4MA 3K2GA 4XG1A 4H83A 4JTSA 2YCKX 4NG3A 4DIAA 1LG2A 1R5YA 1EUNA 4NUWA 4NJHA 1KFBA 2YB1A 5C55A 1TKKA 2VMFA 1RBAA 3T09A 3ENLA 3HO8A 2NVAA 4LAMA 1XL9A 3WQFA 2GVLA 1XC4A 3CIWA 4D6IA 2QCMA 4JFVA 3FEMA 2ZX5A 1I9CB 1EJRC 4R27A 3E0VA 3EWXA 5F4XA 1IIHA 3CAVA 1I2NA 2VOTA 2QAPA 3JVAA 4JIHA 3BCDA 2V5CA 4EAMA 4NZ4A 4C65A 1KM4A 4G1NA 3LXCA 2V2CA 4GYFA 1JRCA 3KHLA 5E70A 1W32A 4GISA 1LOLA 1YDOA 2FFIA 4GQQA 2VDGA 4W87A 1UD2A 2FFCA 4OZOA 4AH7A 2V30A 1E0VA 3UU0A 1CXEA 4MKSA 1BSIA 2XIQA 3IV3A 4LYRA 1FWFC 4TIMA 3S2NA 5K9CA 4FO4A 4IQJA 3TROA 1PZ2A 1W54A 1LL6A 4ZQOA 5L1KA 4MTVA 5EB8A 3OZPA 3SURA 1TWZA 1US3A 2UZ9A 4ED2A 3CUHA 4DX3A 3NQFA 1OADA 5H8UA 5KG2A 2YDSA 4QS6A 1Z41A 6PTDA 5HR6A 3ZSSA 3HPXA 1V79A 2WK2A 3CL8A 1ZBVA 1GUVA 1K6WA 2PP1A 3A4WA 4JHMA 3TEVA 5LHEA 3CQHA 5U4NA 2Y7GA 4PTNA 1JPIA 3QLDA 4GO8A 3VNKA 1ESWA 1L6FA 5JH1A 1OYAA 2A6NA 3W1LA 4YCPA 4GWEA 4TV5A 5EMUA 3BAJA 3DFNA 4H8NA 4LY8A 5FF0A 4B5WA 3EWZA 2CYGA 3NO5A 2WSKA 2AL2A 2E3ZA 2Y85A 3GXNA 4OUEA 1H7PA 4QHRA 3BMWA 3K8MA 2V5JA 1W8SA 3VIGA 4QM1A 2G5WA 3HURA 2GQ3A 4PZVA 3VM5A 1Y65A 4RPPA 4UWMA 3LHVA 4Z08A 4WOQA 1OSEA 1ZPTA 4PTWA 2XTKA 2YL6A 1WXZA 1VAHA 5D9OA 3SY1A 2VCAA 3KLKA 1AQ0A 2CBUA 1A4MA 2PDQA 1UR4A 5T8GA 1K70A 3HJZA 2QDDA 1LL4A 2WB5A 4B3KA 4V27A 1WPCA 1FOBA 4HA3A 3A47A 5KFGA 4UQDA 3BQ6A 3SM0A 5HULA 5C71A 5HMEA 4C6MA 3H12A 5EY5A 4MNMA 1EB3A 4C5ZA 4JTLA 4DN1A 2JKEA 2FTWA 1MEWA 4BFAA 3OSPA 3LY0A 1SO6A 5CBIA 3GC2A 3KS5A 1UUOA 1FDZA 2OLAA 3G18A 2HRWA 3HF3A 2C16A 4XZIA 3QMTA 2VC5A 3CL7A 5L6UA 3M9OB 1HF6A 2OSYA 3BCJA 3QBUA 2GSEA 2Z1VA 1M6JA 1RK6A 3SJ3A 3H4XA 4DYKA 3W7KA 2BTMA 3R0DA 1W3NA 5LNVA 2IQTA 3VC5A 2JIEA 1EP1A 1JDEA 2D24A 4MZ8A 3C5QA 3VOFA 4CU6A 1R3SA 2QF8A 3NEVA 1GVIA 2R1MA 1NVMA 2XWDA 2QJGA 1EXPA 5KG1A 3GNDA 3DFSA 4JTTA 4TVDA 3HQPA 3UR2A 1J18A 1ZJIA 4IFRA 1K7EA 3U8GA 4BF5A 1JVNA 1IT8A 4JYEA 3G1FA 3LENA 1YPIA 2CZEA 1V3MA 1I1XA 2ZTJA 1GG0A 4J1OA 1G67A 1GOMA 3UPMA 3I3BA 2Z1KA 1JUKA 3G3MA 4P8WA 3AJXA 2BQ3A 3BGJA 3G6XA 2E9MA 4O3OA 4FBUA 1W3HA 2YX0A 2D69A 1ZB5A 1RK5A 3WD2A 1EGMA 4DPQA 3KFTA 4FEZA 5C9WA 4E0CA 3LZ5A 4XZWA 4QJ5B 1UR8A 5CAKA 1OD8A 2FGLA 1Y5XA 2FPTA 3G1DA 1CTNA 5JBEA 1J2WA 5IRPA 3RLGA 3N14A 4HYWA 3JRKA 4PH6A 3NPVA 3R1ZA 1HN1A 1IWPA 3LCWA 4XTIA 3P0XA 2GVGA 1N8IA 2NV2A 3OW1A 4CNOA 4E3TA 4S3CA 2WXDM 2QW5A 4RUCA 3I6RA 3STCA 3VABA 1W1VA 3B0VC 1M41A 3T0DA 3RX4A 1FWCC 2GVJA 2WQPA 3U2CA 3LCHA 3PPHA 1UIOA 5H91A 1LBLA 2Y5EA 1K1DA 1SSDA 1SVDA 5L1JA 3AIEA 1A5UA 4WOZA 3TYBA 4H7CA 4AIBA 4H6QA 1KRAC 4JV0A 3W22A 2PEVA 3LCGA 5AHEA 2HVOA 2VZVA 3LSCA 2VUNA 3LHZA 4CVUA 2QUUA 3Q58A 4GQGA 1GOWA 1AW2A 5HQEA 3R7MA 4DXXA 5DXYA 2E6YA 3UWWA 2VURA 4IUOA 4PUNA 1ISVA 2ASJA 2X8RA 3ZJ7A 4YP3A 2XFWA 5J5RA 3W07A 1T7LA 5DQPA 4DL7A 4FA3A 2DQWA 4ORIA 3RGTA 2TAAA 3WBYA 4A3UA 4AWEA 5FJIA 1GQLA 3VIKA 2WZTA 3WF2A 2DPIA 4AG0A 3EWYA 2DSUA 2IPWA 1L6YA 1AJ2A 5DBUA 3R8HA 1XPYA 4LH8A 3LTYA 3MI2A 4BS0A 1JJKA 1UMYA 4XD6A 1KM6A 1KBBA 4AY7A 3EAUA 3KHHA 2ICSA 4JDBA 4LV9A 5HNRA 1KLYA 2XH7A 1IZJA 2BS9A 3PWAA 4QRNA 3APTA 4Q7IA 3WQEA 5C9XA 3LMZA 1UW9A 2R8KA 1DE5A 2WNZA 4IH3A 3IJDA 4AZ7A 2HPIA 2Z1WA 4LUIA 3UXLA 5EU9A 3GV7B 3RX2A 1WQ5A 2X1IA 3PP7A 4H2CA 4E8GA 4RXFA 2Q8XA 4G56A 3UY8A 5DT5A 1RCQA 4KCTA 1ONRA 2PDGA 2CXEA 3CZJA 4O1FA 1JIHA 5M1TA 1QNVA 1A5LC 3B4YA 1M03A 4RE4A 1V6YA 2Z4GA 4WDUA 4O16A 3O6YX 3LU2A 2DT1A 3VKKA 1MZHA 4JXCA 2CLKA 2W0UA 1XUUA 3MWCA 4GX8A 5FJTA 2R9RA 3NFUA 4IIGA 4FZIA 3WNNA 2UV8G 1S38A 3GSMA 2VEGA 2V3DA 3UA3A 4O1DA 2CBIA 3AS2A 3CQ0A 1PB0A 3FEQA 2BXVA 2FZDA 1HIZA 3QFWA 1UKTA 1ZAIA 2ZUUA 5I3KA 2GJRA 3GBEA 4HHLA 1VBGA 2IKIA 3EA3A 4A05A 2CZ5A 1N2VA 1BQGA 2GJXA 2AMXA 4FF5A 2VC6A 2QCDB 4FR6A 3UR7A 4TO8A 1EA9C 2V9DA 2E67A 3H7VA 4DAFA 4PA8A 4O1AA 3M43A 3AALA 3B8WA 4XB3A 1RYRA 2EPLX 1CXHA 4PB5A 2QEZA 2XGQA 1UPMB 1F07A 2RDIA 4MWAD 1GVEA 1R87A 4QQ3A 4WGHA 1G4SA 1OG0A 1X7FA 1V0LA 4ZTYA 3RLVA 4TOQA 1JPMA 2D2GA 4PCNA 5IBXC 3F7JA 3GG0A 4ZOCA 4JN8A 2WZIA 2VD8A 1L2UA 3H2NA 4DELA 3KL0A 1AH3A 4KQNA 3S2JA 1PZ0A 3VK5A 4WRHA 4YNGA 3BXWA 3QV8A 1QO2A 3R79A 4AHOA 2UVUA 3OPSA 4O57A 3SY5A 2CBVA 2Z7KA 1DORA 5HJXA 1UD6A 1JXJA 2GJPA 1JQVA 1KBKA 1YHTA 4O3RA 1KRBC 3D6NA 1HJWA 4KFPA 1LRNA 1T40A 1OF8A 4NY2A 3KCOA 3OJGA 3F2CA 3P84A 2QAFA 4DZIA 5CJNA 2A0NA 4B5SA 2VDIA 1G1YA 3KRUA 1E4IA 1F6KA 4AD2A 3KZPA 4KF1A 1M7JA 4RZRA 1EO7A 1SUXA 1PX4A 4LGXA 5HWMA 1N55A 4M80A 4FAMA 4Y7EA 3BJYA 5KFNA 1MMFA 4X3ZA 4JX5A 2W9MA 2V9WA 4L6HA 4OV4A 3B9OA 3WLLA 4UIOA 2C28A 2NVDA 4ED7A 1QHZA 3MI6A 4XBJA 4CVWA 2E77A 4JEJA 3DZ1A 4DVOA 2PDYA 2A79A 3NDYA 4O3PA 4MNJA 2NW0A 4FXRA 5CZSA 2HWGA 3W7GA 3VIFA 4LUSA 3UPBA 1XD0A 4WDXA 1UWRA 4HPGA 1YNYA 2GGGA 3FYPA 4L5ZA 3FJNA 2G3MA 3BO9A 5KG6A 4HMNA 5KFYA 4ICCX 4UFIA 4Q4OA 1IZCA 1DJZA 3CZLA 4F48A 3L0GA 2UVWA 2PDUA 3BLKA 3W6MA 4XO7A 3PVXA 5HANA 3WDRA 2CERA 3E38A 4AF0A 4Z1DA 3GG8A 2PE4A 1UASA 4GGBA 3WLIA 4DBWA 3T8QA 4F2TA 1TFVA 3MSGA 5FKYA 2O7SA 4I5RA 1YX1A 4AHQA 1TQXA 1UKOA 4FALA 4AWUA 3AIUA 2BB0A 1UZHA 5D9PA 3PZOA 4PN2A 2A3CA 3IGXA 3CUXA 1R8LA 1R3VA 1SMDA 4ED0A 1OY0A 4BZYA 4GVFA 3O1NA 1RD5A 1W1IE 4GVIA 5FF7A 4PFMA 3IGHX 1WOAA 1XIIA 3T0CA 1OIMA 4NAEB 4N9EA 1PBGA 5C9ZA 4MIMA 2PZ0A 2J9YA 3QQWA 4XKYB 4NNCA 1JCMP 4IOTA 6XIAA 1IV8A 3U57A 4DF2A 1NIUA 4LUJA 3BAIA 4PTDA 5DRCA 2ZA2A 2E5BA 3WUEA 1P6BA 1S5VA 5CJMA 3ZLFA 2GWGA 3V6KA 2CHNA 1XLHA 3STGA 4FF7A 3VE9A 4KFOA 2I17A 4Q8VA 1JYVA 4C91A 3RU6A 2TODA 2GUUA 2YYUA 1PJ9A 2PTWA 3EX1A 2IPGA 3VIMA 4DBUA 4HJFA 3NOEA 4HD5A 1IEWA 1PSCA 1ZBKA 1C7SA 1LQ2A 1NY1A 4CN1A 4ZB2A 5A8QA 3OEXA 1MW2A 5LA1A 5LIWX 1OZQA 3DYPA 5CLWA 4DWDA 5KG7A 4QQUA 2RDXA 1AZ1A 1J0HA 2PF8A 4OU1A 2IKJA 2XIOA 1Y0EA 3BSMA 4L7ZA 1XW8A 7XIMA 5FA5A 4PBGA 3B05A 1OK4A 1SJBA 2GGHA 4NHVA 4M19A 3SR7A 4D9PA 2X30A 2FH8A 3AHVA 3UWUA 4J3VA 4GYPC 1J6OA 2ZRWA 3CNYA 4W7VA 1UKQA 3GHSA 5D38A 3DKJA 3SQMA 4LALA 4ZVJA 3W02A 3CUJA 2X7WA 1DL3A 1M01A 5D30A 3BW3A 4MOZA 3LM3A 2ZZ6A 2J7DA 4RL3A 3KCJA 4DNHA 1UR0A 1VFOA 5A6JA 1EX1A 1RR2A 3CTTA 3SO7A 3NGFA 3GRIA 3ANUA 3RXZA 3E2RA 3DX5A 4WGXA 2E40A 2PCEA 3DFTA 3L0NA 5CZKA 3OBEA 3QY7A 1KKRA 2DT0A 2HDJA 1BWKA 1GWJA 2GUBA 3QM3A 1YXDA 4YQWA 4UNKA 5KFOA 3AS0A 3AIWA 4LCSA 3AZSA 2QCHA 2IW0A 3LUTA 3EDFA 4J5NA 4PMRA 4HK6A 3UXAA 4GUFA 2PD9A 3DIPA 1P5BA 2VUYA 3VD3A 3M07A 2FDSA 4O3NA 3KOXA 3W29A 4A3HA 2HK1A 2OEKA 3V1HA 1TJ2A 1UPPA 3WF4A 1JZ7A 2VO5A 2XG9A 5I5RA 5DCBA 1Q7ZA 3KXQA 3FJ4A 4WSJA 4AD4A 2I57A 3QV9A 4US5A 4PBFA 5I6SA 4CD7A 1EJXC 3DHDA 2GDUA 4JIRA 2H8XA 3SUVA 3FA4A 5A2AA 3SUUA 4CCCA 5KFTA 1TVLA 3PBMA 4GRSA 5DT7A 1ITXA 2ZE0A 1XLJA 4O1EA 3GNXA 4KWVA 5G2HA 1S0MA 2I5GA 4GQRA 4PUEA 5A95A 2D2JA 3I7QA 1B31A 1QT1A 3GIYA 3MMWA 2HTMA 2D2HA 2WKGA 4D71A 2XM2A 4C6PA 4C5YA 2DVTA 1H7WA 4AW7A 2O55A 2CLIA 2Z1BA 3LI0A 3BCFA 1ML1A 1KFJA 1QI0A 2D0GA 3HPSA 1KBIA 3QY6A 3DXIA 1EC7A 2FHCA 2LLEA 1TSIA 5BMWA 3H2AA 3AIVA 2VVSA 3W87A 1N82A 3WO8A 2WC4A 1P43A 3H22A 1T0OA 3F4VA 5I06A 2G3IA 2YDQA 3G1XA 3KUMA 1EPVA 2CNCA 3AHYA 1EGZA 3M0VA 5KG3A 2PDKA 5BOEA 2I7GA 2Z1SA 4WLCA 5AOUA 1LOSA 4AIEA 3KEHA 2NUWA 4RU9A 4L4LA 2W62A 4KETA 3RRXA 4QLJA 5AKQA 1XHGA 2W8LA 2A2IA 3UG5A 3W85A 4ZFCA 2BR0A 4PMDA 2O9OA 2ZBTA 4QCEA 1FHLA 3B0PA 2B81A 3TAOA 4LBSA 3GVGA 4C6LA 4XD5A 2VCCA 4XBSA 4DXVA 5C9RA 3UF9A 3O05A 1CIUA 2RJHA 4M6UA 1Q4NX 2KX9A 3LPPA 2REQB 4KERA 1D3GA 1DXFA 1PWMA 1XLGA 2YJQA 2PGRA 3CASA 1JZ6A 3P62A 2C19A 3M0ZA 3ABZA 3QPZA 1EQPA 2DW7A 3IIXA 3G1AA 5CPTA 4X9YA 1MFVA 4B15A 1ZU8A 1P1MA 4WVXA 4JQ4A 2VGFA 1HKKA 2Y5SA 1F73A 5HDRA 3NGJA 2WANA 1L0PA 4ZA0A 4GC6A 3STPA 2D3NA 2P3ZA 1MQQA 4EK7A 3W7JA 3WF0A 9CGTA 2QVNA 3WLHA 1E70M 3GYEA 2PGWA 1RALA 2PDFA 1OEPA 5C7HA 4NZ3A 2CLFA 4DY1A 2NUYA 3M0LA 3F4NA 1M65A 4JIIX 1JCTA 2UY2A 4IG2B 2J7BA 1R85A 3R89A 2OQLA 2DIEA 4YXGA 5LA0A 3I6TA 1H0IA 2VX7A 4Q8FA 5E6ZA 1HGWA 1R7AA 3AICA 3LLDA 5EBUA 5C0QA 1RUSA 3BAWA 4TVCA 2VKZG 4TTUA 2VVNA 4FX6M 1C29A 4CCZA 3NL5A 3RCNA 4B3LA 2PWHA 1TUFA 3BC9A 4BQ4A 5BXTA 2C14A 1E9YB 4UC5A 1G69A 1ADSA 1NQKA 4K8GA 1NOUA 2GSJA 4YR2A 3DI0A 3GVRA 5HNTA 3I4KA 2VX4A 4GNJA 3GW3A 2X05A 2BY2A 3L4XA 4I8YA 1JDAA 4GPNA 1KXHA 4D8ZA 3QTGA 4A2RA 2I9EA 2XN0A 4LVFA 1DIOA 3WZ0E 3MKVA 2DGAA 2P88A 2X16A 3BDKA 1XYAA 3PUDA 3PSWA 5FIPA 4RZ6A 3SN0A 2V3GA 3M0YA 1VENA 4FNQA 2PC4A 2X09A 1MYRA 3FGCB 2HVMA 4OTKA 3CO4A 3SRHA 4KRUA 4D8LA 1MXSA 4DO7A 4QP0A 3MO4A 5HNUA 1QW7A 1GVSA 3DENA 1EP3A 2W4XA 2ZRYA 1QNRA 2NXIA 4CD5A 3N11A 3BG9A 4H8HA 5IM51 2L5HA 1FRBA 3AIRA 4ECWA 2ZXQA 2QLYA 1DWFM 1O94A 5G5IA 1FKWA 2QDHA 4C7GA 4D6HA 4A4AA 4UTFA 2ZUTA 5KT7A 3SCOA 3TWBA 2V0TA 1UZ1A 1WZAA 3L4WA 3A9IA 3KL5A 4K3ZA 1TR9A 1TO3A 1OT2A 2QGYA 3GTXA 1X8FA 3PZPA 4ASTA 4GKTA 4JFTA 2QIWA 5A3HA 1LJYA 4IZGA 3W7IA 2J7CA 2XSAA 2VL4A 2Y70A 1ZNNA 3ID7A 1KFEA 5KT2A 3WBWA 1MRAA 4UR9A 4X9SA 1Q8JA 2CHRA 4FS9A 4JQ1A 3NSMA 1SYTA 1VHCA 3VGBA 2WHMA 4P61A 4RCXA 4OFCA 5I78A 4ECYA 1LBMA 3W2MA 3LK6A 2C79A 4ALDA 1R3YA 3BARA 1GYLA 5A6AA 3BQ2A 3M9YA 3PFRA 3TP4A 1U22A 3KVKA 3YPIA 3ALFA 3UZWA 3NQGA 1DQXA 5E0CA 1OZMA 4AD1A 4PTXA 1LLOA 3W1NA 3FKRA 3LERA 5C8BB 1H60A 1X1ZA 3KOZA 5LNRA 4IQEA 3TONA 1WYIA 1ZAJA 2BMBA 3B03A 1XIBA 1RQEA 3SFWA 3W24A 5K9DA 5KZMA 1VHNA 1FWGC 5I79A 3QR1A 4IPLA 1JPDX 3WL0A 4UMCA 4PUJA 4X2RA 1MI3A 4JR5A 4CD8A 3GTIA 4V15A 4NLGA 4MAVA 1ZETA 1LQ0A 4C6BA 2ISWA 2ANUA 2E09A 2RAGA 3KBNA 1XYCA 4QEHA 3SSJA 2RDTA 3BLFA 4E2VA 3RPTA 3ZMRA 4DI8A 1F3XA 1JUEA 5C7VA 3BLLA 3M9NB 2OWXA 3E96A 4GJ1A 2E68A 1X6LA 4O0ZA 3ELFA 1L8NA 3G22A 5GPRA 3EDDA 4FB7A 5IXEA 2NUXA 4IIHA 2H9AA 1QDSA 5A6SA 2R6OA 1V3IA 2XH2A 4PE8A 1V93A 3WLPA 4B91A 1T96A 1AZ2A 4ZE4A 5IOBA 3S2MA 1SQ7A 2ACRA 4H7ZA 4QDWA 3RF9A 1XH2A 2NWSA 3N6HA 4R53A 4Q8UA 3HQOA 1DP0A 3S5OA 4UTWA 3WELA 1Y5WA 4P7RA 1QNQA 1FDYA 2FZ9A 3GFZA 1AQMA 2QUVA 2H3BA 1W2PA 2BXYA 3OGVA 3OG2A 3EGJA 3VZZA 4MYXA 1M9HA 4F3HA 2TSYA 4PTVA 4DJFA 1HVQA 8XIAA 3TOYA 4HU3A 5CEWA 1DEDA 2WMGA 3IAPA 1EP2A 3GU1A 4IGMA 3II1A 1TPB1 1XPGA 1XSKA 3MANA 3MVIA 5KFFA 1H1NA 5DG9A 3H2FA 1BWVA 3KBMA 2CLHA 4ZSUA 5EMYA 2OQYA 4FXFA 3L2LA 1SW7A 1NU5A 1CGTA 3UG4A 4X0VA 4H41A 5BXPA 5FCZA 4ACYA 1XS2A 3RM8A 5LYRA 2INFA 3WBXA 2W63A 1AW1A 2QUTA 4RLIA 4TR9A 1PTAA 2YB4A 3GZ3A 4NAEA 1V0KA 5D05A 1VEMA 1F3TA 1E3XA 2WYSA 1NWTA 1FP8A 3A22A 5HBFA 3TDFA 1FXPA 5F2LA 2YXGA 4FSAA 3ANVA 5D2TA 3BE7A 2Z25A 1JYWA 2WCGA 3U2EA 4LFYA 1PPIA 1VLWA 2EPKX 4KWOA 1VC4A 4QWDA 3K4WA 4UOZA 5F1UA 2B7PA 7PTDA 5CSRA 3W6LA 3FHAA 4S3DA 2PA6A 1MQPA 1D9EA 4L9XA 3VU2A 3FDGA 3HU7A 3VUPA 5IDZA 3RM9A 3M7WA 1E71M 1K1SA 3VNMA 4HJWA 1ZCCA 2AU0A 2VHLA 4ECVA 3PTDA 3ARXA 1YTDA 4PEKA 3QHNA 4PULA 5CLTA 1RP8A 3WQ5A 5RUBA 5TNVA 1K8ZA 5TBOA 3NZRA 2FQIA 4AWSA 2AAAA 1WKDA 3RG6A 2HE5A 4DI9A 1H41A 3FKKA 1UH3A 5H6HA 4MWAB 2VM8A 3IVSA 4XO6A 1F05A 3CHCA 3CHDA 4UQ9A 5T9CE 1UH4A 4RNJA 3VE7A 3UJFA 1J10A 3M6DA 4F4ZA 3QLLA 1B0IA 3JS3A 3W1AA 4EBEA 2HE8A 2DFAA 3AUJA 4UTMA 4KEZA 1MZRA 2GLKA 1XF0A 3Q65A 2HS8A 4PCSA 4HHHA 1ZJHA 4H00A 2R8HA 3H55A 1IYXA 2WBKA 5KFKA 5BRBA 2PLCA 1K7FA 2Y6ZA 4E2DA 1B3VA 4CCDA 3TAKA 3GDLA 2BY0A 3IACA 1AFSA 2IUZA 1XLLA 1R6WA 2VR2A 2QQ6A 2W9CA 5HINA 4DLFA 2WCSA 4LNCA 3V4BA 3W73A 1S0NA 3PSVA 4BHYA 1CT5A 1H5YA 1FWRA 3C0QA 4QIUA 2F6UA 2BDQA 3VILA 1MWOA 3UYIA 3WDIA 1VYPX 2PI6A 4ATLA 1MDLA 1M04A 3C56A 3JUGA 1E1CB 4HN4A 3O8AA 5FL0A 3LRLA 2Z0IA 2HXUA 4ZGYA 3EPGA 2QV4A 3W1MA 4R8UA 2OJPA 3S47A 2OYMA 4IT1A 4KWWA 1IWBA 3D3AA 2O9TA 2D0FA 2YZ5A 4GNVA 1UMLA 3UWYA 2O7QA 3MUZ1 3QOMA 1B9ZA 4U6PA 1XR2A 3PWGA 3SCSA 4DWSA 5DBTA 4LCQA 2AQWA 2WVVA 5L9FA 4MFDA 3H4BA 5LNSA 4QNEA 2J66A 4IXXA 2UY5A 4PEEA 2YW3A 4V33A 1KCXA 1C91A 1V5XA 4UUIA 3AMCA 2GZXA 2B31A 1UJQA 2OO0A 2H3DA 3K46A 1LUCB 1F5ZA 1CX9A 1GQJA 4C6FA 4AX7A 1REQA 4WY0F 4L61A 3UGVA 4P5UA 2VEKA 3QZ8A 1TTPA 3QZAA 4IP4A 1JCXA 4UTLA 1B3OA 1V3KA 3VD9A 3EX4A 5AZ1A 3WUGA 2BX7A 3EA2A 4AX6A 2QR6A 3H2OA 1FHUA 4Q8TA 3WMBA 4DJFC 4IIDA 5XIAA 1BGAA 3MR6A 3GXMA 3H2EA 2Y7FA 3MZ2A 5DY2A 1J8VA 3W76A 4O12A 2DPEA 4YR0A 3ECQA 5FEXA 5FD0A 3OLDA 3WDPP 3PTMA 5E9AA 1KCZA 4R5EA 2ONEA 1VFSA 3V0UA 1W3KA 2YKKA 1E5NA 1HGYA 3LRMA 2F84A 3EB2A 5KFDA 4M7TA 1Q8AA 1QK2A 2RH9A 2JEJA 4J7RA 1OD0A 4DM1A 5I3IA 1JI1A 2BVDA 3QN3A 1IGSA 1I0BA 1LWIA 4GACA 1O5QA 3VGDA 1VIZA 4BF7A 4JTCA 3TYEA 4AZIA 2R82A 1EC9A 5G4WA 4B5TA 1B57A 1NOFA 2ALDA 4O0QA 1V6XA 4ICNA 2R1KA 3SQSA 1EFZA 4BI5A 3KWSA 2IQ0A 1SJDA 3AXHA 5TAOA 2NT1A 1PKNA 4IJRA 3UW6A 1Q7QA 4W84A 3VD7A 1UA3A 1H62A 1B3XA 1K4HA 4KFNA 5IBXA 5GJPA 5AZ0A 2WVSA 2V6AA 4ATWA 1XIGA 4P8XA 3QF0A 3WEMA 4HSOA 3WH9A 4J3ZA 3UZ5A 1ECEA 2QUMA 4BA0A 1HP5A 1QK0A 1H7NA 3TLLA 1I8JA 3R12A 3TQVA 4EKJA 3SDOA 1DIKA 3L5LA 4O0KA 4HNLA 3R0KA 5K3VA 2J9XA 3PUEA 4DJDD 2PLMA 3PUOA 4B5XA 2PTXA 4LSBA 2R94A 4L4PA 1NF7A 3WY1A 5T14A 1A3WA 1LROA 1QBBA 1WV2A 1QNPA 5EYWA 4DLMA 1SFTA 2QCFA 3GXFA 2WWDA 4IICA 1AH0A 1E6QM 3AXXA 1ALDA 2XIMA 4NRRA 2JEGA 1X6UA 2AKMA 3EWUA 1PCKA 4D72A 4GOAA 3M5ZA 5BRPA 3G6YA 3EX6A 4OHQA 5GNZA 4CGTA 3DUGA 1BYDA 1JGIA 1T99A 1LG1A 5XINA 4IMFA 2E1WA 3WQ4A 2YLLA 2OOFA 1BPLB 1A47A 2HJPA 4G2DA 4MZYA 1YDNA 5DFAA 1XDMA 3PAJA 4GIYA 4X63A 2F2KA 5ABFB 1N7KA 3W7QA 3WMCA 2GL5A 3KOYA 1P4CA 1Q6FA 3MYPA 3B9DA 5KT6A 1XGDA 1XP3A 2ZRXA 2GQ8A 1EKOA 4LY4A 4ROPA 2W61A 3WENA 1UG6A 4ERAA 1XD1A 3KCLA 1XIHA 4UTWC 2FKPA 4M6QA 3NVDA 3G3DA 3NCOA 3L2IA 2AGOA 4OJYA 2FHFA 2JKPA 1TV7A 5FAGA 2PWFA 4XX6A 3NDZA 3RILA 1CPUA 3T40A 1A0EA 2C1IA 2CBJA 3R11A 1U33A 4IUGA 4JBRA 3CLMA 1FCUA 4BR1A 3VKDA 4K7YA 2R1PA 6REQA 4AU0A 2Y88A 2QUNA 5CBJA 1JRBA 2J75A 3FN9A 1SMAA 2WKLA 2EGZA 1IF2A 2VI0A 5CPSA 4A8NA 2C0AA 1R2TA 4MAZA 3R10A 5KFHA 3KOWA 3P5YA 4GYPA 3W7LA 4HYRA 1TA3B 3NA8A 2OXNA 3G1HA 2GGJA 5CKSA 2V8ZA 1JQXA 2WW5A 3BV4A 3TYAA 1BFNA 2YCLA 3IJ8A 3MYOA 4S1FA 4N0RA 2CZDA 3BQ0A 4PMYA 2MUCA 1JCYA 2FPYA 2W91A 2Z2BA 2XIIA 1A4LA 2VGGA 1DWAM 1CGVA 4PUDA 3URNA 3RHGA 3S6TA 1KR1A 4AVNA 4OQVA 8CGTA 2VCBA 4GJIA 1UWUA 5JIPA 2Y61A 2V3FA 5AVNA 3VAVA 1AMYA 2ISDA 4J9QA 4GGHA 4BKNA 3E6EA 4XAGA 3KBVA 1AMKA 2G8ZA 3HQNA 4MB5A 1BTCA 3DFPA 4PBEA 2ZDSA 5C70A 2RUSA 3UFYA 5CBBA 1JDFA 1NSJA 2DZAA 3SJNA 1E6ZA 4OECA 4HNTA 3DFOA 5ECUA 2XH4A 4J3UA 2FVMA 2EG6A 5CPMA 1A3XA 3OLGA 2UVRA 4ECLA 1GCYA 2ZRVA 4GC4A 4IHCA 3RIKA 1FFQA 2BP1A 4YWIA 3ZLGA 2Y8VA 3S1GA 1DJHA 2O0TA 1SM9A 3R8RA 1VJIA 5AC7A 5K7JA 2ZOXA 3CYJA 4DL5A 2GJNA 2FZ8A 3DCPA 6CGTA 3AQUA 5BXRA 2PLKA 3W1TA 2F61A 3S1UA 3OBAA 4OOZA 4JCLA 3A4JA 3P80A 3CV7A 4JTQA 2CLMA 1KCKA 2TYSA 3L67A 2PPGA 2PRHA 4RNOA 1UD8A 2QJMA 3CPGA 3W71A 2WNNA 3LHWA 5A6MA 2X42A 3VIJA 5IFPA 4W88A 1IXOA 4GH1A 2CW6A 2ZKMX 1KCLA 4JIEA 2BHUA 4DAIA 4HHMA 3WQWA 1S9FA 1QR7A 1W9VA 5LIYX 1F76A 3GS6A 5HAOA 1YE6A 1TWIA 5HA7A 1ME9A 1TV5A 2IKHA 3HG4A 3WIJA 3T44A 3DDMA 3FJ6A 3ZFHA 5H1WA 1IIGA 3PZIA 1QO5A 3THAA 2WVVB 2ISSA 3IV8A 2PWUA 3ZYZA 5DLFA 1EXBA 3L21A 2BQUA 3UCDA 2RGMA 2C2EA 3IEBA 3IIOA 5AN7A 3W01A 5EKYA 4YVVA 4B5VA 3P7YA 2P8CA 1OFBA 1XIEA 2MANA 3WF3A 1Q6EA 3SUSA 1PDYA 3EMZA 4PMNA 1UD5A 3N18A 4ADTA 1DXEA 4FIRA 3OOQA 4HU4A 1WB0A 4XAPA 1JR1A 1TELA 1JZ4A 3UZYA 1WX0A 5LIUX 3CUZA 3SY8A 2RDJA 2GGEA 2HBVA 1SU5A 4TU1A 5GJNA 2NQHA 3ZWTA 4E2OA 1JZ5A 4LU0A 3EDJA 4WF7A 4N9DA 4CQAA 4ZR8A 5CPQA 5ABGA 1T6MA 1RD6A 5CCZA 3P2VA 2ZRUA 2C1HA 5BRQA 2YPIA 3F5JA 3WLQA 2A6LA 1OYCA 4B3ZA 2VELA 1S5TA 3T0AA 1E5JA 2WSQA 1XC6A 5D9NA 4XZMX 3T5LA 3DGRA 1CGWA 4MDPA 1X38A 1O5KA 1E4MM 3B40A 4JNYA 2DH3A 4LANA 1TJRA 2VGBA 1HKIA 1TREA 1J0YA 1OX5A 5TD4A 5FJRA 3ONBA 4N02A 2X0HA 3TA6A 3EEZA 3WD0A 1BVNP 3O3RA 5BWAA 3W7RA 4WSHA 4C6OA 4GY1A 3HMCA 1UKSA 2ASLA 2QS8A 4HNUA 2CZVA 1S39A 1QRQA 4LAUA 1R86A 2DSZA 3OZMA 1ZS2A 1JNEA 2I5QA 5J04A 3D5HA 1KQYA 2FMNA 1OINA 4O8RA 1QHOA 3EWWA 3GX9A 5BU6A 3C3UA 1KBLA 4TMCA 1T94A 3L12A 4PRWA 3I6EA 1XDLA 4GABA 3LPFA 4MWAA 4AUBA 3EB3A 3H23A 4IMEA 1EUAA 1W1A1 3QGKC 4S2CA 3GV8B 2BHYA 1XCFA 3LHYA 4R33A 1V77A 3CM4A 4IP7A 5HMDA 3VXGA 2FDMA 2WNQA 3MQTA 4QEEA 3W1PA 5LIKX 4QS5A 4PCTA 2Z29A 2ZZ2A 1CB7B 5DY3A 3FVDA 1GOOA 2OCZA 3PJXA 1E43A 4X2PA 1RVKA 1F6YA 1TPWA 4AEEA 2EJAA 1MDRA 3GGMA 2GVYA 3TR9A 1GJUA 4OUIA 4Y9NA 3AJ7A 1CLVA 5CSUA 4Q4KA 1HX0A 3CT2A 1ZY9A 2QZRA 4D6DA 4DO6A 1E40A 3WF1A 1QU4A 4I9TA 4JYFA 1FWWA 3I7RA 4DYJA 1S10A 3PW7A 2DZWA 2OYKA 3RBDA 1ZBCA 3C52A 3TJ4A 2A3LA 2FTPA 2PFHA 3IJIA 1B4KA 1TTQA 2HBXA 4NNBA 3E1F1 2WJDA 4I7VA 1WUEA 3N2XA 5C5JA 1I2QA 3ARTA 3B9AA 1LDCA 4IF2A 4YMZA 4LS0A 1V3LA 2ATLA 5KSWA 2VA3A 3JZEA 4GMEA 3OBKA 4NZ5A 2YDRA 3RITA 1UP2A 4JQ3A 2YCJA 3Q8PB 1QOXA 1RQHA 2DV0A 1TCDA 3WSUA 3KOFA 4MWAC 4CNUA 3IARA 1JFHA 3FA5A 3UJ2A 1GPWA 2E9BA 3RAOA 5KFPA 3PR5B 3EPIA 2OTDA 2JFEX 5DGAA 1W17A 3W1UA 4JDYA 1E72M 9RUBA 3CAQA 3PBGA 4O1CA 1UC4A 2WJEA 2Y62A 2G97A 2PF0A 4O8AA 4LUTA 3FAWA 5CJ5A 1EDTA 3AZTA 1TV8A 3M0JA 1TV4A 2E5CA 1V6UA 3DU0A 3WLKX 6REQB 1AD1A 3QEZA 2XPKA 3N6JA 3RPMA 4QW9A 3R94A 5CZTA 3A12A 4BK9A 2VDHA 4HB7A 2VR4A 5CPOA 4DL2A 2XFRA 1TRIA 1MW3A 1QWKA 3T4WA 4JZ5A 1KV8A 4R88A 1EF3A 3GIJA 3J7HA 5JU6A 3B8SA 5G1TA 4Z2GA 3GHTA 3AAMA 4JTGA 4YCOA 2C91A 1W31A 8TIMA 3F4WA 3W28A 2DEPA 1B3ZA 2J27A 1W3JA 3NJ3A 3P67A 1XH1A 4O3SA 1B30A 2AGTA 3OYZA 2WVTA 1YTEA 3P8JA 1BEUA 4LTSA 3BK0A 7REQA 1Q85A 4R9XA 2XIBA 3NYDA 4NZFA 2HXTA 2DH2A 4A3YA 3PTKA 1F2JA 4Z2JA 4ICMA 4W85A 2BOGX 2PWDA 4RDYA 4UOQA 4AEFA 4U7CA 4ZO7A 3OHIA 1XRSA 5F1VA 3QZ7A 2ZUWA 4UCGA 5FESA 2C3ZA 3BL3A 5CQ1A 3OYXA 1K03A 3TOPA 1ISWA 1JGMA 4RW3A 3KRZA 1WP6A 3AU2A 1WCGA 4F9JA 3DERA 1KTBA 4FS1A 4J28A 3IRDA 3Q67A 4QWCA 3KE0A 3PS7A 3VDCA 4XIMA 1NQ6A 3RB0A 4RV3A 3UA4A 4ENLA 1EX5A 4DJFD 2WLZA 2ZRZA 2ADAA 5DELA 2DZSA 2ZX8A 3S6OA 2VA2A 4JV1A 3ARWA 4BEUA 2BG5A 3RNDA 1HXJA 5AB3A 3BG5A 4JOMA 2W92A 4K39A 1J79A 2Y7DA 5LXEA 4GXWA 1TPDA 3HG2A 4V2XA 2XCAA 1E4NA 3Q94A 1KM0A 3LG3A 5DCDA 4G1KA 1NELA 1E9LA 1HJSA 3UXKA 4NILA 2ZX6A 3MT1A 3EBVA 3DHFA 3TKFA 4BWLA 4HTBA 3IUIA 2PDMA 3IANA 1UOKA 3B97A 4Q6XA 2FMOA 2V2HA 2Z27A 4FOUA 5EDWA 3VMNA 3F5KA 1AL8A 3MDWA 3FDKA 4N42A 1JXLA 3WQDA 2PTZA 1Q4WA 4WDTA 2J6UA 3CGTA 1ME8A 1XLFA 3MUAA 3W83A 3M0MA 4IMGA 4C6EA 3TYDA 3E0WA 3W88A 1TZ7A 4JS3A 4QGCA 3TTOA 1FHVA 2Y1HA 2ASHA 4LX4A 5HR7A 3IVUA 3MA8A 1NFBA 1RPKA 2YBVA 3MP4A 1GW1A 2EO7A 5LZLA 3H4GA 4BI7A 3N3TA 2EPHA 1PTDA 1D2KA 3HBLA 1NWUA 5CPLA 3PANA 1M53A 1UD3A 1PUDA 2FJKA 5I0DA 3C2EA 3L66A 1XM3A 3I3EA 3GIQA 1KM1A 7CGTA 1UR3M 1NEYA 4HSNA 3T5HA 2XJ7A 4PYSA 4S3BA 4UQBA 3FNDA 4IQLA 2EG8A 3H6OA 5E6YA 1PV8A 1DV7A 1UC5A 1O1HA 3CIXA 2G3NA 1TPH1 3M1ZA 3NZQA 4NXKA 4CD6A 5C54A 3FLUA 3W4RA 4J40A 4ML4A 2FVKA 1LF1A 1AODA 4AVOA 4BI6A 1KFCA 3QTPA 1U1JA 2VEIA 2V67A 4QWBA 4EXAA 4ZMGA 3CWOX 4F50A 2A3EA 3EOSA 3NPXA 2A21A 2GYIA 4EF8A 5FEWA 3A9BA 3FSTA 3OHAA 3PJWA 1ISYA 4ZO6A 5TIMA 3QQ0A 1V7AA 2YBUA 2R1NA 1JZ8A 1O5XA 2YXXA 2FHBA 5D9MA 1TG7A 1XH0A 3OA3A 1A49A 4XAYA 3BH4A 5JIWA 4B9ZA 3GKAA 5DMYA 3VUSA 1RA0A 3LZ3A 4RNHA 4O18A 3TU9A 5A8PA 5DG7A 1EDQA 3P81A 1OYBA 4PSRA 2X1TA 3BJFA 4JKLA 5DF0A 1HFBA 1UWQA 3Q37A 3ABXA 3NM1A 4RZ4A 5GVJA 4F2BA 3S2LA 2BGQA 2VEPA 3KHDA 2XC9A 4S39A 4L9YA 3VDHA 2YZRA 1V0MA 2IQDA 3NZPA 3W2UA 1V6TA 5A69A 3HB9A 4ZQPA 3R58A 2OR2A 3NO3A 1RHCA 2ZZ1A 5MKGA 3MCMA 2IKGA 3ITVA 5F9NA 3H21A 3LLFA 4HA1A 1DVJA 1YXYA 4J9JA 1CENA 5KEZA 3HTWA 5EFFA 1MFUA 3RDKA 1LQAA 2PP3A 3GIMA 1EBGA 3QHOA 3E9AA 1PX3A 1GG1A 1IHIA 3WN6A 3AXKA 2V5DA 3K1DA 1HKMA 5FAJA 4W93A 1VCGA 2XISA 4Q4PA 5BOFA 4Z0SA 4TXEA 3ARQA 1F9CA 1R3WA 2OKTA 2ZXBA 4LVBA 1NOWA 3S0CA 3EWCA 2GJXB 4GHRA 3KS6A 1OCBA 4AYSA 3WK3A 4CNNA 2P76A 4K2SA 1IGWA 4AZ5A 1E6RA 3H40A 1OCQA 4DQWA 1J5SA 3S1VA 5E5CA 4MMWA 3CJPA 3USZA 1DJNA 1QPOA 3VGGA 1E0XA 3PHAA 1HKJA 2PRMA 1CLXA 4RNFA 3ZZ1A 3SB0A 3H70A 3MKKA 1K8XA 2VZUA 5HMSA 1NJJA 3RR4A 4U5KA 1FH7A 1M7PA 3BTNA 4E4PA 5BWFA 4K36A 2XINA 1C90A 3MBFA 3BLDA 2EJ1A 3CEPA 5KT3A 2NXGA 4C1LA 3PZTA 5DO8A 4F66A 1O4UA 1B3YA 1QUMA 3CPUA 2ZADA 3OZOA 2ZXDA 1ZL1A 1W5QA 1CB2A 3RYSA 1S1PA 3N13A 4GE8A 3MMTA 3WJXA 5AYBA 3TSMA 1N8WA 3FX4A 5EL1A 1E55A 4WEVX 5HJLA 4Q32A 3QZ6A 1OX4B 4IM4A 2BXZA 4GD0A 4R34A 4C60A 2A3AA 3I65A 4NX0A 3FGCA 1A0CA 1O7AA 4YN5A 3AHZA 4JTAA 2DJXA 2A7NA 4WXZA 2DSVA 4IG2A 4J9SA 1OT1A 4O54A 3GTFA 1J4EA 1JL8A 4BJHA 5LA2A 4JAWA 4H19A 4N2YA 1KXQA 2CIPA 3IIPA 3ZS4A 5DMLA 4TX8A 4J9PA 1HJQA 4GI9A 1R9YA 2Z6JA 4KEMA 2A85A 5CG7A 1H4PA 4K6AA 3QV7A 1OM0A 1IR1A 3WD4A 4Z42C 3W1QA 5EWEA 3NQBA 4YPJA 4GZJA 1WKFA 3A5FA 1ZCOA 2NV9A 2XZ7A 4Q7NA 3CQJA 2C2RA 1O60A 4AIOA 2PBOA 3NPUA 3GC5A 1J93A 5DRIA 4ZOBA 4IFOA 3TMLA 3SFKA 5DCEA 1S2TA 3S9YA 4KESA 3WQOA 1VB9A 1O95A 2EF9A 1VPXA 3M46A 3TC6A 1I45A 5A5WA 4AXKA 2MNRA 2G3JA 2Q3RA 4XIAA 4CN4A 4JTUA 5CAHA 5KT4A 4UTUA 4PMOA 4QDMA 4F4RA 2BNJA 4YTQA 4R7WA 1PIGA 1WAWA 4XV0A 2PODA 2I1OA 3GR7A 5L1LA 1A5MC 3GWQA 1G5AA 3HPFA 3LX9A 4H04A 3SADA 3ABOA 3IUHA 3WK1A 3EOOA 3W86A 1YNQA 2CWNA 3IAQA 4PL1A 3I7SA 4JX4A 1Z89A 3TJXA 5H2ZA 1TE6A 3OGRA 4AIUA 3C4UA 5U7SA 5K4ZA 5A6LA 3WJYA 2FTYA 4X22A 1C8XA 4UFKA 4QG9A 1QI4A 3H53A 4NQ1A 3BSHA 3GUWA 3MS8A 1FHDA 1W1YA 1FDJA 4N6EA 4D2JA 5AHMA 2NLIA 3L4UA 3WLSA 2IBKA 3KRBA 3N4FA 2O92A 1KFWA 3L68A 3ZOAA 2ZICA 3LDVA 1K9EA 1EEPA 4C6QA 3VOCA 1XRVA 4CKQA 3R4IA 3WD3A 5K4XA 1TQJA 3SUWA 1MSSA 1XG4A 2PMQA 3DEQA 3VA8A 4B9YA 2WC3A 1PIFA 3WMSA 2DP3A 1NH6A 4GA8A 3S9ZA 3FCPA 1U83A 2WMIB 5KFSA 3MUY1 2GOKA 1EJWC 2R8GA 2O4MA 4FR1A 3TFXA 1QI5A 5CZ0A 2VC9A 4ACZB 1KO0A 1KV5A 2G0WA 3UG8A 5BU9A 4ZCWA 4L64A 4UZUA 1UOZA 4K7VA 3TN5A 1WUFA 4QE1A 3PNZA 2P8BA 3WKZA 4H9UA 4LAKA 2FPVA 1R7OA 4YL2A 2Q71A 1IXQA 4YVPA 2QXWA 1S5MA 1W1B1 5GQBA 4EVZA 3E5BA 3ITTA 3T8LA 3LSBA 1MQRA 3F5LA 1N48A 3WQ6A 2R14A 4DBDA 4D1JA 3IVTA 4O17A 1EEXA 4U10A 4FLQA 4C1NA 4HMEA 1YXCA 2BSLA 3GNOA 2DDXA 3UVIA 4O10A 3I3DA 4JEQA 4XK2A 7TIMA 2WZHA 1TVPA 1C9WA 2XN2A 2EPNA 1VQTA 3E0LA 3O63A 1GZJA 3TSDA 1VF8A 3ZJKA 3NQCA 3UNDA 3W0KA 2YA0A 4CU7A 1W6TA 4N4PA 2BGSA 3HGOA 4V1YA 2YL5A 1PHWA 4RNNA 4EACA 4XZ9A 2YCLB 4EOUA 3TTQA 4A29A 1RAKA 3ANYA 3BOFA 3OZYA 3RN6A 1RLDA 2P5NA 1TZ9A 4LEFA 2WCAA 4I7UA 2NX9A 2AOSA 3SI8A 4LUYA 4KMQA 3ZLHA 3RPDA 3WLTA 5DANA 1OGBA 3MP5A 4PSPA 3SGZA 2ACUA 3RAXA 5AHFA 2ZC8A 2R8JA 3SRFA 1T8QA 4XZNX 3K8KA 4GH3A 2GVEA 3H7UA 1W0MA 4YHGA 1ZTVA 5FEPA 5CGMA 1B4EA 5HWNA 1OFDA 3HJEA 1H61A 4NSBA 3AS1A 3KRSA 5A8OA 5I3DA 3HM7A 4URIA 3QC3A 3WMLA 2J4GA 2DY3A 3GXIA 2OELA 4NVTA 3B8VA 1CXKA 3CUIA 1KR0A 3KHGA 2DORA 2JE8A 1KBJA 1GEQA 3EYPA 3V6HA 3EPNA 4GLEA 5M03A 2FB3A 1F74A 2ZUVA 1FWTA 4LW7A 1LBFA 1GVFA 3ITYA 2P53A 2A1YA 3DKLA 2ZX9A 1UBPC 4HYKA 3B8DA 3RBEA 2QPXA 3JU2A 3UZZA 4F0MA 3B04A 3W7DA 4ROQA 3AWOA 1HL2A 4EWJA 2VP8A 4LXFA 1XSIA 3E2SA 2VGIA 3MSRA 3NL3A 4UTTC 2AKZA 2F38A 3ZR5A 1N56A 3H7RA 1AW5A 3ZXWA 1A5SA 3SI9A 1R3RA 4LVAA 3FV9A 4RXGA 4M56A 1HL8A 4YIWA 1I0DA 2DUAA 2WMJA 1V8EA 4A21A 1FTXA 4D1IA 2XZ9A 5AECA 1OVDA 2GK1A 4DO5A 3WQCA 1VCVA 3GKFA 2XFYA 1GOIA 4NP7A 1LORA 4UBPC 3EOLA 2QCEA 5I00A 3VMPA 1Q6GA 3DGBA 2FLIA 3WUBA 2B0MA 3AYRA 4HP5A 4Z1CA 4F79A 2PU1A 3KVMA 2P50A 3EX3A 3MCNA 2D0HA 2Z24A 1RV8A 1EWEA 4FLOA 2XWEA 1FA2A 4G7EA 3LCIA 6ALDA 4EYIB 3A24A 4U31A 3TMQA 3UEQA 5G2IA 3UETA 3KX6A 1TA3A 3PG9A 4XWUA 2QCLA 3LB0A 1K9FA 3ZSTA 3THUA 2PDXA 1DHPA 3B9EA 1VBHA 4QAWA 4FMVA 1GVRA 3UJSA 2C2DA 3C8NA 1AA1B 4XUYA 3UCCA 1FWEC 3ZO9A 1J11A 2DIKA 5A6KA 1LYXA 3V3WA 4TV6A 3O0KA 2O4QA 4S3AA 3PFMA 1DJQA 2P0OA 1FWDC 2XVKA 3T2QA 1NDYA 5E0FA 3R6IA 2DU2A 1G7UA 1W1TA 4H9YA 4B16A 2JALA 1A3HA 3R0UA 2J79A 2CZFA 1VFUA 5ABHA 3JZUA 4M8UA 4GY0A 1JCLA 3PN8A 3CUFA 1R3TA 3U48A 1ZP4A 3LV5A 5KZDA 3W7HA 4E2BA 2YOCA 3K5XA 2OSXA 2CLEA 1MUCA 4NL1A 1EF2A 1ZUAX 2V38A 3MC5A 1UQZA 4DZAA 2EQDA 4Q8WA 2VOMA 2OZ8A 4EPDC 2NQJA 1DJYA 3N25A 3EOEA 1UIPA 4UTIA 5HJYA 1QI3A 4R7JA 2PZNA 3QXBA 1KKOA 4LF2A 2JQXA 1NDWA 3MUIA 5EBAA 1U5VA 4DBEA 4QAIA 3D46A 3MR2A 3OTRA 1V6WA 4GX9A 4OGZA 1X1OA 4DBSA 3N2MA 4FNRA 1P0BA 5HXMA 4BCEA 4UNIA 2WC7A 4MVAA 3VINA 2E7FA 3O06A 1H50A 3QOKA 4JKKA 5FI8A 3W74A 4QE5A 3SSZA 4EEYA 4LS2A 1IXNA 1F3WA 1W5PA 3M9MB 1Q6LA 2PGEA 2Y2WA 1NWSA 5DX7A 3VPLA 3W2KA 3RJYA