1XRTA

The crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
422
structure length
369
Chain Sequence
MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCEVNPNHLLEDRLALIEGVKRGIIDCFATDHAPHQTGIIGLQTALPSALELYRKGIISLKKLIEMFTINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYTIKDGKMVYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a novel, latent dihydroorotase from Aquifex aeolicus at 1.7A resolution
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Dihydroorotase
total genus 137
structure length 369
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1xrtA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1xrtA02
3IPWA 3E38A 3EWDA 2W9MA 4HK5A 4XAYA 3FEQA 3TNBA 4F0SA 4HJWA 4KEVA 3WYZA 2PAJA 2HPIA 2Z00A 4LEFA 1KCXA 4IGMA 4ERIA 1E9YB 1UMLA 2Z26A 1EJTC 1M65A 3B40A 4GY0A 4CNUA 4C6KA 4C5ZA 4H9MA 3RCMA 4XD6A 2D2HA 2CZVA 1FWIC 4NG3A 4LALA 3GTIA 2AMXA 3S2NA 1RK6A 5AKQA 3GU9A 2HPMA 1A5LC 2VUNA 4IF2A 2GZXA 3MKVA 2GOKA 4R85A 1EF2A 2P50A 4KESA 4MUPA 3TN3A 2HNHA 4IQJA 3OU8A 4IGNA 1NDWA 2AQOA 1FWBC 2DVUA 2P9BA 4B3ZA 1ZZMA 3OVGA 4BKNA 2I5GA 2G3FA 1R9YA 3LA4A 4G7EA 2Z27A 2O4QA 3FDGA 1FWHC 3MDWA 4LFYA 3OQEA 3PBMA 3B0XA 3QGAC 3RN6A 4HK7A 4GK8A 1YBQB 2FVKA 3GUWA 3ICJA 4CQBA 2UZ9A 3QY7A 2QT3A 4KERA 4C6IA 2VHLA 4IH3A 3F4CA 5HMEA 4INFA 2A3LA 4G7EB 3IACA 3ISIX 4HK6A 4J35A 4PCPA 4C5YA 3A3WA 4QTGA 2VC7A 4ERGA 3T81A 4QSFA 4GX8A 3F2DA 2R1PA 3UPMA 3MVTA 5E5CA 3QY6A 3RHGA 2R1MA 4C6EA 2FVMA 1FKXA 4QRNA 2EG6A 1V51A 1J6PA 3QGKC 2YZ5A 3URQA 1EYWA 1E9ZB 3URAA 4R7WA 4LANA 4C6JA 4C6PA 1A5OC 4DIAA 4HA0A 1YRRA 2I9UA 3T8LA 4DNMA 2Z29A 1RJQA 4BY3A 2FTWA 4IG2B 4I6KA 3MVIA 2DVXA 4LCQA 4ICMA 4C6DA 1S3TC 4C6BA 1EJSC 2ICSA 3LGDA 2OQLA 3GU2A 3OODA 1M7JA 3GGMA 3DCPA 1RK5A 4KQNA 4C6NA 2WJDA 1FWFC 1A4MA 1V7AA 1VFLA 4KEZA 3PNUA 4KF1A 3HM7A 4IFOA 1KRAC 4KEUA 4DYKA 4WGXA 4DI8A 4C65A 1XWYA 1ONWA 2ADAA 2YB4A 1PSCA 3DUGA 4GOAA 3LS9A 1XRTA 3EWCA 4RDWA 1UIOA 3IRSA 3LGGA 1GKPA 3E0LA 4IFKB 3MDUA 1NFGA 1K1DA 3CJPA 1A5KC 1J6OA 4E3TA 1J79A 3E0FA 1YIXA 1RAKA 5HMFA 4WHBA 4H9YA 3S4TA 3HTWA 4EPEC 4UB9A 3S2LA 2RAGA 2IMRA 3O7UA 3K4WA 2OGJA 1M68A 2ZC1A 1NDVA 3LU2A 2OODA 4AQLA 1UBPC 1KRMA 4L6DA 4GBDA 4UBPC 4D8LA 4C6LA 4H9UA 2YXOA 2Z25A 1A5NC 2FTYA 3PAOA 4DI9A 1WXYA 3URNA 2Z4GA 4H01A 1A5MC 4EPDC 1ADDA 3UBPC 5LXXA 4GZ7A 3AUOA 4I6VA 3MSRA 1V4YA 2Q09A 2P53A 2VR2A 4J2MA 3HPAA 2D2JA 4R88A 3TN5A 3E2VA 4XD4A 4M51A 3WZ0E 2Z24A 3OOQA 2R1NA 3UF9A 4H00A 1EJRC 4DO7A 2OB3A 4YIWA 4LAOA 4RDYA 3URBA 4LAKA 1I0BA 4JOMA 4AC7C 3AU2A 1JGMA 4XAZA 4V1YA 3CAKA 2HQAA 4B90A 3FDKA 1FWDC 3B0YA 1ONXA 4QROA 2Z7GA 1POJA 2Z2AA 4H9ZA 3WMLA 3NQBA 3GTFA 4ZSUA 4DZHA 2F6KA 2Q01A 3PNZA 4F0LA 4TQTA 2HBVA 5HMDA 3GTXA 1ITQA 3E3HA 1FWCC 4RDZA 4C6FA 4QS5A 2DVTA 1WXZA 2BB0A 4LAMA 2YB1A 4CQDA 4IFRA 3IV8A 1NDYA 3JZEA 3CS2A 1XGEA 3EGJA 2PGFA 1O12A 3G77A 2WJFA 4NP7A 2GWGA 4C6CA 1FWEC 5A6TC 4CNTA 4J5NA 4IFKA 2QPXA 4IG2A 3S2JA 1EJXC 3ITCA 4H9VA 1YBQA 3LSCA 4LCSA 1YNYA 3NURA 3PANA 1QXLA 3SFWA 4B91A 2WJEA 2R1KA 4XAGA 3K5XA 1K70A 3DC8A 3GTHA 1KRCC 1P6CA 5FSDC 4CQCA 4GC3A 3MPGA 1KRBC 3LSBA 3OJGA 1HZYA 2OOFA 4B92A 1FKWA 3N2CA 1ITUA 4ZSTA 1R9XA 3T1GA 4DZIA 4XAFA 1FWJC 2PGRA 1P6BA 4EPBC 4PCNA 2XIOA 4OFCA 4C6OA 3SO7A 3AU6A 2Z28A 4ERAA 3MJMA 4F0RA 2PUZA 2QVNA 3R0DA 3LY0A 2Y1HA 4BJHA 4GYFA 4PE8A 1EJVC 4Z42C 1RJPA 4XD5A 4GX9A 3O0FA 4RZBA 3K2GA 2HBXA 1POKA 4GXWA 2WM1A 4EP8C 1A4LA 4CEXC 2VC5A 4LCRA 2EG8A 1PB0A 1GKRA 1J5SA 4CEUC 1QW7A 1PO9A 4H9XA 1W1IE 3UR2A 5G4HC 3ID7A 2AQVA 4QS6A 1RA0A 2EG7A 2GSEA 3S2MA 1V77A 4GY1A 3A3XA 1R9ZA 2UBPC 3A4JA 3GU1A 3LNPA 1RJRA 3GRIA 1IE7C 1BF6A 4C60A 3BE7A 3E74A 1EJWC 3F4DA 1I0DA 2PLMA 3GIQA 1NDZA 4GY7A 1FWGC 4KETA 4DLMA 4WVXA 3UR5A 1DPMA 4NI8A 2D2GA 2FFIA 3IJ6A 4EPKA 4PBFA 2O4MA 1P1MA 3IARA 1O5RA 3F2BA 1YMYA 1EJUC 3IGHX 4RE0A 1GKQA 3RYSA 3GIPA 4KIRA 2BGNE 4P5UA 1UIPA 2GWNA 4H9TA 2Z2BA 1K6WA 3D6NA 2QS8A 2E25A 3F2CA 3V7PA 4C6QA 4CNSA 1FWAC 2R1LA 1PTAA 4V1XA 2ANUA 2VM8A 1RA5A 5CH9A 3TN4A 3ORWA 4L9XA 4PBEA 4XD3A 3GG7A 1XRFA 2E1WA 5FSEC 3MTWA 4G2DA 2KAUC 1V79A 3NEHA 3QY8A 3KM8A 4LH8A 4C6MA 3C86A 1EZ2A 3TN6A 4DLFA 4RDVA
chains in the Genus database with same CATH superfamily
1XG3A 2Z2UA 1OT2A 4HK5A 5LIKX 1F3XA 3CTLA 2FFCA 4F66A 2QVHA 3FVMA 4LW7A 4AWSA 3CUGA 1M65A 1OQFA 4ED1A 4GY0A 1V03A 3KDNA 2CITA 2JEFA 2Z6JA 4LAUA 3UESA 1JIHA 3TYZA 1LL4A 1N2VA 3RX3A 3BW2A 4XO7A 1M7XA 3LENA 4UMCA 3PJTA 4LS0A 4R5EA 4B5UA 5GJMA 3G1FA 3MSDA 2QKFA 3USZA 2V3EA 1CXKA 4JFUA 2PDHA 4FS1A 1DBTA 1OSEA 2E9LA 4NU7A 4W88A 4QW8A 1XCWA 4LB4A 2FZ8A 1F2JA 3EWWA 3QGAC 4F0MA 1CECA 2I17A 4A3YA 3KBJA 2QT3A 1DJQA 4WK9A 5DT7A 1DIEA 3W37A 1JDFA 4QLLA 4GCAA 5HMEA 4Z17A 4G7EB 3CUFA 1JRCA 5BXRA 3MC5A 4MVAA 3NYDA 5LNRA 2CERA 5I23A 3FSUA 4MZ1A 1RY8A 2CZ5A 4QBXA 3CB8A 5A8NA 3W7EA 1KGXA 3AO0A 1JFHA 1PWMA 3VDGA 1HJSA 1ZNNA 2R1MA 4O0QA 2FVMA 1CGTA 3IIPA 4NJHA 1J6PA 2Z1KA 4QDMA 4D6EA 4S3CA 3WENA 5EL1A 1OX4A 3UPBA 2DT3A 2J66A 1UKOA 3TR9A 4AIOA 3GTNA 5C7VA 5TNVA 4MPKA 5D2TA 4M6UA 2DVXA 4WQ6A 1PTGA 4C6BA 4J9QA 3S1WA 2VCCA 1PTDA 3RX4A 5C7HA 3UY7A 3K4DA 4P7RA 4MY9A 4ATWA 3PB0A 2WJDA 4GKTA 1K03A 1UZ1A 2R6OA 1UD3A 4IFOA 1HJUA 1TZ9A 5FJPA 4JX5A 2ZUSA 4GGBA 1IGSA 4Y9NA 4FXSA 2PDXA 3GH4A 2V2CA 3WO8A 1FY6A 3U2ZA 4GUIA 3SN1A 1K1QA 3MI2A 5IDIA 1PDYA 3NM1A 4S3DA 1R3RA 1Z32X 4TX8A 4NHVA 1IZCA 5TQLA 4PBGA 1RAKA 3KRUA 4CN4A 3KUMA 4BQ5A 1VBHA 4Q8TA 4XZWA 4Q43A 3L0KA 1W3TA 4DWSB 4JNMA 4LX4A 2YDAA 3NZQA 4FP1A 5KT4A 4D8ZA 1LJYA 4NZ3A 1UWRA 4E2OA 2C0AA 4MAVA 2XYLA 3LOTA 1RCQA 3LTSA 3OA5A 4R9OA 3B9DA 2X1TA 1FBAA 2XVPA 5G4WA 1GPFA 1WXYA 4MB5A 4O3OA 1NSJA 2Z4GA 3GHUA 5A6JA 3NQEA 2R8GA 2XFYA 3ZIZA 2OELA 4JYFA 5RUBA 4B4HA 3A22A 4I6VA 3MSRA 4UFLA 2ISSA 4J2MA 4LVAA 1YX1A 3E2VA 4I8YA 4HPHA 3H7VA 4ATDA 4F0HA 2NX3A 3M0XA 2JKEA 1DJZA 3RITA 4FSAA 1I8JA 5L1IA 3UVAA 2X1RA 2ZUUA 2OX4A 2YPIA 1Z69A 3BG9A 5DMYA 4KWOA 3UU0A 1XL9A 2OZTA 2FKPA 1JGIA 1VEMA 3MUXA 2Y5JA 3ABXA 1D8CA 1BSLA 2FLIA 3EPIA 2C14A 3E2SA 3TAKA 1ITXA 1WYIA 1M6JA 1K7EA 1KV8A 3VMPA 5LYRA 3N6QA 3T2OA 4LBUA 4RDZA 3HG2A 4F48A 3GBDA 3LI0A 1D3CA 3SI8A 1BF2A 1UR3M 3C5QA 3KL5A 2DPJA 3KHGA 1J0HA 4GYJA 5DXXA 1TIMA 2HXTA 5A8OA 4J5NA 4AWUA 3C2OA 1VCVA 4HHHA 4JTDA 4HQVA 4LCSA 3U7VA 1YNYA 3DDMA 3NURA 3PANA 1KB3A 4E2DA 2PWHA 1S2VA 3S1GA 3S0CA 2J27A 3W28A 3PTKA 3GTHA 4LVGA 4NL1A 1VLIA 1V0LA 2B7PA 3Q45A 3TCSA 1N7KA 3MWCA 3UG5A 2B7NA 1LOQA 3LK6A 3DYOA 1DWAM 5E0KA 3PW7A 5HATA 2FVLA 3TH6A 1MWOA 2X0YA 3N9KA 1XKJA 4GNVA 4W8LA 4XZ9A 1BVNP 2PDUA 2WVSA 3QVQA 3KRBA 1BXCA 4F0RA 3UXAA 1BWVA 1UH2A 3BAKA 4OV4A 1BYAA 4EBDA 3WH6A 3PFMA 5D8ZA 2W7PA 2QCEA 4S3GA 4J3VA 1DWJM 3B06A 1RJPA 1P48A 4UQEA 3BH4A 1A80A 5DY2A 4LCRA 4WXYA 1XLCA 3FN9A 1V6VA 2I56A 1C8XA 7PTDA 3ZZ1A 1E6PA 4BI6A 1QWGA 4QISA 1QPRA 3IV3A 3GVVA 4E2BA 1E3XA 2FPTA 4AFYA 1BF6A 4C60A 3ABRA 3E74A 1MQQA 2A21A 5EPDA 2DZWA 3I65A 3L4WA 4MADA 1KXHA 3O6AA 2QCMA 5KG0A 3PBGA 1W9BM 2O4MA 3IARA 5E6YA 3G0SA 1NF7A 2YBTA 1BFNA 4Y9AA 4GKLA 4AH7A 4R9XA 4CNPA 2VX4A 1CDGA 1EPXA 3SGZA 3KCJA 1QNVA 4IM4A 5HQMA 4FMVA 3BQ1A 1CB2A 1W9PA 3W7OA 1GYMA 3PR2A 5KFGA 3QR1A 4XVDA 4FBUA 3D47A 3ALGA 1S5WA 1Z6KA 4YYCA 5T14A 1TUXA 1ZBKA 2PB1A 1JCYA 4C6MA 1IWBA 4RDVA 3OYXA 2X30A 2VOTA 4JTKA 4KMQA 2TPSA 3RAXA 3QV8A 3B4YA 2Z6IA 2QCLA 1QI3A 4RXGA 3SCWA 3CK5A 3VNZA 1UKQA 1C8YA 2F61A 5DELA 4E5TA 4PMYA 3VE9A 2GGEA 4XD6A 3LXBA 3GK0A 4D6DA 2D1ZA 3OBKA 4PA8A 2E6FA 2FTPA 1TV5A 1K02A 5HNRA 4O54A 3GS6A 4AVOA 2J9ZA 3PBVA 1AJZA 3C0JA 3PPHA 1G1YA 4Y9MA 2HNHA 1JFXA 3ATYA 2TMDA 1V93A 4WEVX 3VTRA 1XYLA 2ZDRA 1T7LA 3POHA 5IHRA 2Z27A 2JK2A 1T94A 3EDFA 3W70A 3N11A 2PZNA 4DXVA 1XBZA 1VD6A 1XBYA 1CIUA 2V81A 1TTPA 5G4EA 2PTZA 3ELFA 2QCHA 3O6DA 4H6QA 4QLKA 4I8DA 1AQHA 1DE5A 4WUIA 3DYPA 4QSHA 3KBSA 2SFPA 5DGAA 1Q7ZA 1VHCA 3EPGA 4FI4A 5C55A 1MFUA 2ZXAA 1IZJA 3W7NA 1JRBA 1XXXA 4JN8A 3FYOA 2GJNA 3BV4A 1OT1A 3NQAA 3RHGA 3MZNA 2MUCA 4ED2A 3PR4A 5JU6A 5LHEA 1UW9A 4XG1A 5E09A 5HQLA 2R94A 4DJEC 1HJVA 1XKYA 4H2CA 4HNVA 3CL7A 1A5OC 2BQUA 2BP1A 3PW4A 2VDGA 4NX5A 5HWNA 4LCQA 1FCBA 1MXSA 4QDWA 2H90A 3NG3A 1UWQA 1ICPA 3UA3A 1TE6A 3V5CA 1X6NA 4DEFA 1SQ7A 1U33A 1EX5A 1LF1A 3G3MA 3W87A 1P7TA 4NF7A 3WEOA 1I1XA 2I16A 3VIHA 3II1A 1P4CA 3RM9A 2FZNA 2JQXA 4G5DA 3WUBA 3EA3A 5JVLA 4EK7A 1L2QA 3PW0A 1IM4A 2DY3A 4H6KA 4V33A 1HJQA 3IRSA 4PUNA 1VIWA 3M0IA 2PP1A 2OU4A 3EDEA 2XGPA 3KHRA 4ASTA 4J1OA 3HTWA 3M5YA 4QNWA 4UB9A 4DM1A 1AK5A 3THQA 4RZ4A 2AAMA 1Q6OA 1ZS2A 2PWFA 1LT8A 3R2GA 1A0DA 5LGZA 1B9ZA 1S1RA 2OSWA 4H04A 3T2PA 4AHPA 4NLGA 4KWUA 4P2VA 3V0TA 4QE4A 7TAAA 5CZKA 5HUPA 4EKJA 4QWAA 4YQWA 4PC8A 4K39A 3RB3A 2GUBA 1TTJA 1RY0A 1W3LA 3RMEA 5CGMA 3VGHA 5CPSA 2P53A 3HPAA 2RDTA 4MWAD 3RPMA 1E0WA 3V6KA 3MUY1 1F3EA 1DOSA 4GNJA 3H26A 1XUUA 4AD0A 2V68A 4TIMA 2BHUA 2DIKA 4MMWA 1WUFA 2EO7A 3PJUA 1GEHA 4K37A 2OTDA 1OD0A 3T9PA 3E02A 2ZRYA 1HIZA 4Q8NA 1FCVA 1XLEA 5D8WA 1H2JA 1AJ0A 3F4NA 4KT2A 3B0PA 1JCXA 3N19B 3QRHA 5D9NA 3UNTA 5HMDA 1FWNA 5E6ZA 3H54A 4JFTA 1R30A 1WXZA 2CHRA 3BLIA 3UXLA 4UQCA 1U5HA 3IV8A 3T8QA 1YDOA 5LIXX 4FNPA 3ITGA 4HNOA 4MFDA 3PN8A 4WDWA 5CZJA 3T78A 5A6TC 5AB3A 4Q3MA 5CG0A 4HU3A 1ZAHA 4Q7NA 2PPGA 1EJXC 3LSCA 1W1TA 2D0FA 3SFWA 4U31A 5DX7A 1MRQA 5CSYA 5D32A 4XAGA 2JIWA 1U5JA 3K8KA 1XSKA 3GXNA 1DJWA 3KLKA 4C1NB 3FAWA 4QR6A 4ZQPA 1AVAA 2ZZ4A 3WBXA 3W24A 2HJPA 1HN1A 5MKGA 1T41A 1FUYA 4W7UA 6XIAA 2FJUB 3TZFA 4PR4A 1VFUA 4E38A 2QF7A 4IHCA 3BOXA 4Y90A 1GONA 3LY0A 4FNRA 3KWXA 4TQSA 1L2UA 3NQMA 4L4PA 3IK2A 4C1KA 4O1BA 1V02E 4Z2KA 3GC2A 2IKHA 1GKRA 4GWEA 3N2XA 3CPGA 2POZA 1R9ZA 1LROA 4ADUA 2PRHA 1VF8A 1CCWB 2Y7GA 2GPTA 3B8DA 1NH6A 4IJCA 2E09A 1BPLB 5BROA 4O3RA 3P80A 4J27A 4MY8A 2PRLA 3IJ6A 2R82A 3DI0A 4DL7A 4RE0A 3CPRA 1A0CA 3ZJ8A 3DI1A 4WY0A 1YPXA 3A12A 1RCOB 3VFLA 4ECQA 4V1XA 2VM8A 4Q6XA 3FY1A 2XIMA 3P5ZA 3AFBA 1QOQA 3BLPX 3G2GA 3LZ5A 3QY8A 2V4QA 2VFDA 1GZJA 3BAWA 5EBAA 5CJMA 4MB4A 3T0BA 5DLCA 2VRKA 3IUHA 4JDYA 2VR5A 3CQIA 4UTLA 2QV5A 4U3AA 3B3DA 5MF5A 4YVPA 4JQ4A 3OQ8A 1EP2A 1AH0A 3VKCA 3A23A 3SRKA 2PAJA 2CZDA 2G5WA 3B8WA 4XIMA 5C9ZA 5G1MA 4A35A 3ZR6A 3STGA 2QW5A 2FPYA 3W23A 3STEA 2NXIA 3VOCA 4C5ZA 1VFHA 1EDQA 2ZXQA 5DCEA 1XUZA 4PUKA 4DXXA 1VPQA 4LALA 3UJFA 4NZ5A 3LX9A 4CLMA 2VUNA 2QV4A 2AGTA 2OWWA 1S2CA 1E4MM 1QHPA 1Z9AA 5BZAA 1I2PA 3W2JA 4TUFA 3TN3A 2OYLA 2YCJA 3CQHA 1QCWA 1M01A 2WOQA 5HXMA 2XN0A 4N9CA 4AD1A 3PZIA 1KFKA 4LV9A 4ZOBA 4QWDA 2AU0A 4O0ZA 1B5TA 2O4QA 2GL5A 1TQJA 3FDGA 3AXMA 1SFSA 2WHMA 5A5WA 3E2QA 4HK7A 2BXZA 4BQ4A 3GBEA 4RV8A 1E43A 2NV9A 1P0BA 3UJEA 1GOWA 3B8UA 1OZQA 1OINA 4ZEPA 4IIEA 4ZBCA 3QOKA 4IH3A 4DN1A 3HPSA 4F3HA 3GQYA 1UROA 1I2QA 5IHSA 4AB4A 4O1FA 4KEMA 1FP8A 3S5SA 3TK7A 3KE0A 1T3NA 4DYJA 3ZS4A 5BXTA 1V51A 2ZZ2A 4C6JA 1P0KA 1FH8A 3FA5A 1KBLA 4YP3A 3UZWA 2V5JA 3T40A 1NQ6A 1OFEA 3RLVA 1GUVA 4DO5A 3GC4A 4X0VA 2FLLA 4AF0A 3QV6A 1UA3A 4QXIA 1T96A 2YLLA 1XGDA 3RBDA 3M41A 3P8JA 5KZ6A 1FHLA 3F5LA 4MHBA 1TRDA 4YL2A 2VZSA 1VEPA 1LZOA 3HM7A 2WHKA 3AYSA 5AFDA 1FFRA 3OP2A 4GACA 4CCDA 1OGGA 1BXNA 2OQYA 3PPGA 1S0NA 1Q6QA 2E67A 3GZAA 4GOAA 1XRTA 1Z44A 2BOGX 2ISWA 5E9XA 4WCJA 1UKTA 4LF1A 2VZOA 1EBHA 1WDWA 1AD4A 2IXVA 3VUSA 4K38A 1J79A 4D72A 2MANA 1FRBA 1H61A 3CIXA 1KNWA 3W0KA 2QZRA 4H9YA 1W3IA 3BCJA 1HT6A 4H4IA 2RAGA 4DWDA 4AZHA 3ZWTA 3N73A 1XIIA 1GWJA 3NXFA 4DUXA 2HEJA 3W25A 4LY4A 2ZUMA 4H9UA 1W2PA 1DXIA 3C4UA 4JN7A 3TIMA 1D3HA 2Z25A 4QJ3B 3K46A 3W86A 1IQ8A 3M47A 2PDCA 4PFHA 4EX4A 2F6UA 4PEEA 3E9AA 4GZ7A 5XIMA 4NVTA 3W2UA 3LCXA 3GH7A 2D2JA 1C91A 1TJ1A 3LEPA 3AIEA 2BBFA 4DF1A 3SIMA 1Y65A 1ECQA 4HU8A 4JOMA 2WV8A 2XFRA 1ISXA 3EB2A 4PMNA 2ZUVA 3UFYA 1XSJA 3RFAA 4HYRA 4QAIA 3HG5A 4RUCA 4HMDA 4H9ZA 3GTFA 3POCA 4DZHA 2WHJA 3G1XA 3W1LA 3FYYA 3WQGA 3AXKA 2ZX9A 3AIVA 4O4VA 4I7VA 2PLJA 4NJJA 1FWCC 4BI7A 2UV8G 3P62A 2ZRWA 3WH5A 4Z0SA 1MEHA 1JI1A 2WC3A 4IFRA 4J28A 2J6XA 3AYRA 3TR2A 3JZEA 5CPLA 3TYDA 1KQZA 3GLCA 3TW7A 2GWGA 4CNTA 2WB5A 4AF0B 3TYAA 3S2JA 3GNXA 2XH7A 3OEXA 1SZFA 4WJEA 3TXZA 3VIOA 3H6OA 2ACSA 5AYIA 4Q8VA 2OFJA 3G3DA 5M17A 4GC3A 4J9OA 1XBVA 1YE4A 1MRAA 1IT7A 2XGBA 4MFEA 5C8BB 1V7YA 2WMIA 2VWTA 1KM2A 3GC5A 4PTVA 1JXLA 1R2TA 1JIBA 5A6KA 4QNEA 1DWGM 2B0MA 3IGXA 2VGIA 3FJLA 4KBXA 2ZE0A 4C6OA 3AU6A 3S5OA 4AD4A 1WDQA 4HNUA 1W9XA 3NQFA 1TPVA 1GNXA 4S1FA 2B31A 2WM1A 3RILA 4EP8C 2WKLA 2QUUA 3WLLA 3FYPA 4QAWA 1E70M 5T8GA 3DG6A 1JG9A 1JUBA 4IIHA 3HQOA 7A3HA 3DOPA 3W2MA 4F2BA 1RP9A 3ARVA 3T44A 1DQUA 2OLHA 1JZ6A 3GIQA 2XZ7A 3QN3A 4F4WA 5C2GA 1MQPA 4Q33A 3HURA 2PC8A 1WNOA 4CCEA 2VELA 1TVPA 4ECWA 4J3WA 3QH2A 1ONEA 2BGNE 2WZHA 1LT7A 2NVCA 5G2WA 3M6DA 4IXXA 4IJRA 2RDUA 1S5NA 5KFMA 1QATA 1GQNA 3APYA 4L7ZA 3BAJA 4ORMA 2A7PA 1GVIA 4JTQA 4GQQA 3GM8A 2WPBA 1V79A 2C13A 3TYBA 2OMAA 3NO5A 4NAFB 2E5BA 2GK1A 3RRXA 4OJYA 3SGGA 5JBEA 3W7GA 1GVEA 1P0NA 5FF7A 1E6RA 2VI0A 4MJ2A 4IPIA 1DQWA 2EQDA 3EXSA 1R38A 5JUMA 4HB7A 4ED0A 3W7IA 3NQDA 4YLWA 3ZYZA 2D2HA 1V3JA 1EGMA 4W89A 3TZNA 4DBWA 1TSIA 3GU9A 3GDLA 3OGRA 2QCGA 2J8TA 1Q6LA 4M6VA 5KFOA 3IUDA 2YDQA 1EF2A 5AECA 2WO5A 2PMQA 2C1HA 1RH9A 3I6RA 4IQJA 3AMLA 5LNVA 4HHMA 4TVUA 2CESA 3CT7A 4W4QA 2WCGA 1GCYA 1HO4A 3DX5A 4B5NA 4UTWC 1XQKA 1G69A 4CD8A 2QJJA 3G1YA 3RGTA 2RDIA 3UJ2A 3MHGA 3GUGA 3ZJKA 1NOUA 3QMSA 2FVKA 3PZGA 3RB4A 2R8IA 3M9MB 5F7UA 2Y85A 1FWSA 1TMQA 3GDBA 4N0RA 2G96A 4UUIA 1LQAA 3ISIX 1E6ZA 4C5YA 1XLAA 3HV8A 3PZQA 2VP8A 2YL5A 4Z1CA 1W0MA 4ERGA 4PH6A 4NASA 3MVTA 2WZMA 4ICCX 1K7FA 1E0TA 3Q4DA 4GH1A 2YZ5A 2VR4A 4LF2A 4LANA 3HJZA 3V5OA 1V3LA 5XIAA 3BURA 1B54A 4UCFA 3LI1A 3VKJA 2YW3A 5EMYA 4BY3A 1HGWA 3DU0A 1MO0A 1UD4A 1EHNA 1KXVA 3QTGA 2H6RA 5HINA 1X98A 1QHOA 2OO6A 3PW2A 1NJJA 2DJLA 3VOGA 1XG4A 3L23A 1XR2A 3CUZA 1KBJA 1QVBA 5G5IA 3EDKA 3LRLA 4KCUA 5KFEA 1TPH1 5LA2A 2GK1B 4CNNA 3BARA 1OC7A 1Q4WA 5BWFA 4ED6A 4ZO9A 1E71M 4K36A 2RFGA 1J10A 2ABAA 3W4RA 4W87A 1Q5MA 3VD3A 4IL0A 5I7GA 4IMDA 5D38A 4Q8WA 1KRMA 2EPHA 2CU0A 4ZA0A 4ZOAA 3PJWA 3WQWA 3VKAA 4QIUA 3W82A 4J40A 3R79A 3UYIA 3NO1A 3PAOA 1TWZA 1HKKA 1XLHA 4PGLA 3IAPA 4IMEA 2J6TA 1MMFA 3AHXA 4HPGA 1SO4A 3UBPC 2C2EA 1LDCA 3MWAA 4UQ9A 2E77A 2VR2A 2QPUA 2XSXA 3TN5A 1JCLA 3L9CA 2OEJA 3EXTA 2EF9A 3PVXA 5H8UA 1GJUA 3OOQA 1EKOA 2C7FA 5AC8A 2R24A 1ZB5A 4B5TA 1Q2SA 3R89A 3LMYA 3GR8A 2Z0IA 1JGMA 1XLBA 3M9NB 4JFWA 2JGYA 3QYQA 1HJXA 2GGJA 4JCLA 2HQAA 4F40A 3UWUA 4O1CA 1NOFA 3LPFA 4A3HA 2ZE3A 3SCSA 1T99A 2WTFA 2GVYA 5DANA 1ZUAX 3ZT5A 1WP6A 1J9YA 1YXCA 1I6NA 1R3YA 4YR0A 3B03A 5E93A 4DBEA 2X05A 5HR7A 3C0QA 5JBFA 2NXHA 3EGJA 2PGFA 4OZOA 4C7DA 4CD6A 1RPXA 3GNDA 4UOJA 5EMJA 1FWEC 4LYRA 2NLYA 3FV9A 4KRZA 3W85A 4AYGA 3PBWA 4JY9A 1UUOA 1S2UA 3W1AA 2E68A 3EPOA 4RCXA 5T9CE 1K70A 1YTEA 3ZWSA 4ADTA 4CQCA 1RV8A 3WJXA 1L8NA 4UZSA 2PURA 4K8GA 3LQGA 2VC9A 5C5YA 4E8GA 4AIUA 3UWYA 4EXAA 4PCNA 3WJZA 5C54A 3WDPP 4AZ5A 2OSYA 3SO7A 3PW5A 2Z28A 1JNEA 3O15A 5IOBA 1JNDA 2P88A 3NNTA 4JHZA 2J75A 3MCOA 1HP5A 4MKVA 3ARSA 2W3ZA 3IJ9A 2AAAA 1BAGA 2CYGA 2FB2A 5M3WA 4CEUC 4JV2A 4LU0A 2W67A 1G01A 2GSEA 4JL2A 1EA9C 1CXHA 1GZGA 2FLNA 4D6CA 3LNPA 4E4FA 2AGKA 5E9AA 3H4DA 1OG6A 3F4DA 5DRIA 5GNYA 4GI6A 4PMUA 3TLQA 3CQ0A 3EWUA 4I9TA 2RJGA 1JYWA 4GI4A 4TX6A 3KOXA 4U3CA 1TTIA 2ZQ0A 2O9OA 1UJQA 4HTBA 1NP0A 4HNCA 1UIPA 5MKGB 2EKCA 1PBGA 5EFFA 3BAXA 7TIMA 3WLOA 2X40A 2QPSA 5I77A 3P0XA 3CWHA 4JEJA 1PTAA 2ANUA 3WBWA 1RD6A 1EBGA 4PTXA 1WDSA 3MTWA 5JBDA 1QI5A 2R14A 2CCRA 3SECA 1UOKA 5BXPA 2B7OA 3W01A 3G6LA 4DLFA 1F6YA 4FB7A 7XIMA 5BYWA 2ZX7A 1PL9A 3LD5A 3O16A 4IT1A 4RZ5A 5DQPA 2A6LA 3IVSA 3UYCA 2PWEA 1A5CA 4HSNA 2Z00A 3MI3A 3SCVA 5FEZA 1UKPA 2A3AA 1U30A 4CNUA 1HF6A 2P5NA 1C3FA 1U1JA 2YW4A 3PBUA 3W1NA 2GVJA 3MS8A 1YADA 4H8VA 5JH2A 1SFLA 3MQTA 2JBMA 2VUYA 4MPQA 2NT0A 2BOEX 4P7OA 2FMNA 5DRCA 1GQKA 4LV4A 3QOMA 4BKNA 3HG3A 3G6MA 3R25A 1PDZA 2PCEA 3RR1A 2ACQA 1UJPA 4C1LA 3AZSA 4UR7A 3TW6A 1K3UA 3K8MA 3QR0A 2C19A 1N8WA 3UWZA 2Y8KA 4RK8A 2PI6A 5CBIA 4B5VA 2C6QA 5HK4A 5CC3A 3IJ8A 4JTRA 3L0GA 3RK8A 3DHFA 5CC6A 2H9AA 3W38A 4KERA 4OUEA 3CV1A 1SUXA 1K9FA 4XZLX 3VXGA 3G8EA 4V28A 1Q13A 3I10A 1TPB1 5FJIA 4JIPA 3BSMA 3DECA 4QFUA 3TLLA 3EPMA 1JR1A 1YDNA 3VGDA 3PFRA 3ZVIA 3S42A 3U2EA 2PD5A 2FHFA 3NGJA 1O60A 1LBFA 2XM1A 3NL3A 4OE7A 4HZ6A 1XLIA 2OLSA 3QGKC 3MUZ1 3MU7A 3VE7A 2J13A 4LVDA 4M1RA 1QDSA 4DAIA 2OSXA 5DN1A 5AVHA 3D3AA 3N9SA 2Z29A 3GKFA 2FTWA 3OZOA 2ODOA 4W93A 3L4VA 2AOSA 1UC4A 1SZEA 3S1VA 3CLMA 1FWWA 1FWFC 2EHHA 1JEZA 2ZYFA 1WV2A 1J0ZA 4Q4SA 3K30A 1H4PA 2NV1A 2PDKA 1M04A 2PU0A 1XLKA 4N6EA 4ECXA 1RPKA 3RU6A 1MI3A 4HTYA 3SQMA 2ADAA 3UZ5A 2YB4A 4AVNA 3C0LA 1GKPA 2ZZ5A 4US5D 4E0CA 4B2DA 2R91A 4XO6A 2Z1XA 1A3XA 3C6CA 4S3FA 2FGLA 3L5AA 2GGGA 3EWZA 4DX3A 1VIZA 4JX4A 4F2UA 1KFWA 2ZC1A 4BK9A 3HA1A 1QJWA 3CZLA 4UBPC 2WJZA 4PCTA 4CUCA 1R2SA 4F4ZA 2E6DA 1NF0A 1F73A 2YXOA 1K8ZA 3V16A 2AGPA 3RXZA 1VZWA 1ZP3A 4GQRA 3OLEA 5CEWA 1OCJA 1R3QA 3KVMA 1A5MC 1VFFA 3SJ3A 4EPDC 3OVRA 3T09A 4Y96A 3W1PA 2Y62A 3GG0A 1VENA 3AUOA 1THFD 1PX8A 2VDHA 1VFMA 2ZA3A 4G9PA 3VD9A 2IKJA 1PWLA 2REQA 4JTUA 4K8HA 1WPCA 4AYSA 3CHDA 1N82A 1WZMA 4U2YA 2IW0A 1XYBA 2QUVA 3T0CA 3A9BA 3CAKA 3I7SA 1LOLA 1FWDC 5G1TA 4FIQA 1JCNA 3AZTA 2Z7GA 4DJDA 1DL3A 3NQBA 1W1YA 2F6KA 2C2DA 2IBKA 3PZPA 3TKFA 4CCZA 1Q6RA 4XZHA 3E3HA 3CL8A 1B0IA 2WCSA 4B9YA 3PWGA 3N17A 4LS2A 2YBUA 2DZBA 2XU2A 3QJAA 2ZRUA 1JYVA 3XISA 1MSSA 3ES8A 2HROA 4IX2A 2A3EA 3CAQA 4US6A 3VNMA 3UWVA 1AL7A 2IQDA 1OYAA 1E1FA 1JDEA 1GOKA 1V0NA 1SYTA 2ACRA 2CFFA 4ZQCA 5LNUA 4Z1BA 1BTCA 2QIWA 2WJEA 3Q8QB 4JL1A 1TFVA 3GHTA 3ARQA 3P3BA 2F2HA 3A24A 5FSDC 3ZVHA 4AD5A 3WDIA 2AL1A 1KRBC 2QNEA 3OJGA 4HYVA 2PDYA 4GO9A 2YX0A 3TU9A 4ECSA 4PYSA 3ANYA 4KFOA 1QPNA 3WQPA 1Q45A 2XIOA 3PBYA 4DBDA 5IBXA 1E6XM 1TB3A 4X0NA 3GIYA 3AMCA 3GIIA 1MZRA 3QSRA 4A6GA 1KLZA 1D3GA 3SGUA 2PDWA 4Z42C 5M2FX 2VURA 3K2GA 3SUVA 3SY8A 3MSYA 2X8RA 5KZDA 3UJRA 1LG2A 1XV8A 3AQUA 3QC0A 7ODCA 4QWCA 4HD5A 1Q6CA 4BS0A 5A2CA 1QW7A 1RA0A 3S2MA 4TO8A 3WLMA 4U5KA 1XPYA 4J3SA 1XH0A 3B0UX 4PZVA 3CMGA 2A85A 3DH7A 1KM5A 5F2GA 2J62A 5KFSA 1GOQA 3BE7A 4DJFD 3OTRA 1E51A 1Q66A 4XSLA 1KTCA 1TCMA 4FF7A 1UCWA 5HR6A 3F2BA 1V5XA 1XI3A 4BQ2A 4ICNA 1K6WA 2OZ0A 1OK4A 4H8NA 3F2CA 1KBIA 3H12A 1BSIA 1Q6FA 1W17A 3LXCA 4FOJA 4YTQA 3AXXA 1WDPA 2NT1A 1TJ2A 3EB4A 1OFPA 5DO8A 4W85A 4GIEA 2YFOA 4F9JA 3TUUA 2NV2A 2GQ3A 3CPUA 2PF0A 1T8QA 4DL2A 3WJWA 1UP2A 3W2NA 1KR1A 2HPIA 4MOZA 4H6RA 6TAAA 2FJKA 2WVTA 1E9YB 3GW3A 3M4HA 4PUEA 3SBFA 2D73A 3TMLA 4H9MA 1V6UA 1K4HA 4LJ3A 3KBMA 5AHNA 1OCQA 2PTYA 1GK8A 3RCNA 1J18A 4Q8MA 5KETA 3L21A 5KT2A 1Y5XA 1H5YA 3WD1A 1FWBC 3OVGA 3WLHA 3UETA 4DYEA 2EGZA 3CL6A 1M7PA 4H7CA 4K8EA 4EOUA 4JPGA 5LA1A 1SZGA 2IKIA 1JI2A 1OFRA 4S38A 3CUJA 4H3DA 3OLGA 5HAOA 4IMCA 3CTTA 4ED8A 3O07A 4LC8A 3RM8A 1F6PA 1OEPA 4G56A 4JTCA 3IIZA 4O12A 2DH3A 4UTTC 4FLOA 1AMKA 4CNOA 1TQXA 2RDJA 4B3KA 3XIMA 4CD5A 1P0DA 3W7JA 4A3UA 1X7IA 1EDTA 3SRFA 1PV8A 3HGSA 3V5FA 1XS2A 3HGOA 5FL0A 3A3WA 3FS2A 4OBRA 4GABA 1JCJA 3W02A 2PF8A 4GX8A 2QEZA 1X7FA 2H8XA 4I3GA 4ALDA 1O94A 4XX6A 4DZ5A 3PWIA 5EU9A 3WFLA 1TVNA 3RLGA 4QJ5B 1MEIA 4KW2A 3NQ2A 3EDDA 3AROA 1WOAA 4GZIA 3AS0A 3FSTA 3ZQ9A 1XLGA 3FX4A 4HOZA 4I6KA 4L1GA 1ESWA 1JZ2A 1M7JA 1IEQA 3GGMA 1TV2A 3PTDA 1XFBA 2V30A 5LNSA 4F9DA 4LBRA 1H7PA 1F4AA 1B4EA 1V7AA 1VFTA 1HX0A 4IICA 3W75A 1VYSX 3N4AA 4FX8A 4QW9A 2HCVA 1QU4A 2ZIDA 1X6LA 3GHSA 1O5KA 4ZE5A 4Y9PA 4EAMA 4LS1A 3T5JA 1TPDA 6XIMA 3LS9A 3UXIA 1F74A 1KXQA 4MTVA 5A8MA 4IZGA 3RDKA 3VK5A 1TPEA 5EMMA 2WWDA 5CC7A 1K1DA 1K1SA 2JEJA 4FR6A 3CH0A 1HW6A 1EQCA 2J77A 2ISDA 1H7OA 3H55A 1UD8A 1S97A 2G37A 2J25A 1BRLA 5GPRA 3TROA 1JZ4A 3VCCA 1TREA 3P0WA 3PZ9A 1B3XA 4DWSD 5DG8A 1DJNA 1IEIA 4E6MA 4HHPA 4A22A 7CGTA 2VEGA 2ZRXA 3UPWA 3LXAA 2NQHA 3QPZA 2J6UA 1ITCA 3GNRA 3BLOA 2FLPA 1GOIA 5A6MA 3GG8A 1FDZA 3E5PA 5A8PA 3PSWA 2QMJA 1V4YA 3QFWA 4GYPC 1GVQA 3DFPA 4LUSB 2XFWA 3LERA 5BNKA 4XIAA 3TE9A 3H2MA 3NOEA 1E1CA 1B3OA 4AZCA 1G4EA 1LORA 1NWSA 1P7TB 1IIGA 5KFHA 1XIEA 1XP3A 3OBEA 2FMOA 1W3KA 3OG3A 4LB3A 3KBWA 2QIIA 4FOKA 4US5A 1B9BA 3A5FA 2BODX 2CLHA 4MJ4A 4GUGA 3U5UA 3EMQA 2NWRA 1OGBA 3EDJA 1GVRA 1RBAA 4BF5A 2GQ8A 2V63A 3ZOAA 2CBIA 2YB1A 4LY8A 1JD9A 1NDYA 5DY3A 3CS2A 2G4JA 2RJHA 1TWIA 3WDHA 3R6IA 4AWTA 4J9MA 4TTGA 3PZTA 5BMXA 2TSYA 1EP1A 2J8FA 4TVCA 2DT2A 5AHLA 3WMSA 2OXNA 5FESA 5KFJA 1OFOA 2V4RA 3O05A 3ITCA 3WH9A 3HMCA 1ZTVA 3Q37A 4A3RA 1G4SA 1GYNA 2CKRA 4ZB5A 1K7XA 1IWAA 3FLUA 4RUBA 4Z2LA 3BJTA 3TFCA 3H7UA 3W6MA 2HVMA 2VC6A 2D22A 2W79A 1FHVA 5K4ZA 3JS3A 1VB9A 3L68A 1ADSA 1UYQA 1IGWA 3LLXA 4S3EA 3WQ6A 5FL1A 3W1MA 4TXEA 3W72A 5FAGA 2NQLA 3KZPA 3MV11 3BAYA 5D2XA 3VGFA 3SB0A 2Q3RA 1O5QA 4MM1A 1PIIA 3O63A 4IIBA 2WSKA 2PUZA 2QVNA 1ZHAA 2E8YA 4X61A 4PE8A 5I06A 3I4KA 2H8ZA 1D7KA 4JKLA 3NQ8A 4UNLA 1EA0A 1HL9A 1ICSA 3P2VA 4JFVA 3ID7A 3GXMA 2HVOA 2C91A 1MVYA 5J5RA 3TJ4A 2VVSA 4XKMA 1YYAA 2NQJA 5D09A 1FP9A 1TJRA 1TRIA 3NIYA 4W8BA 4O1EA 5DXYA 4BWLC 3EX2A 3H70A 3P84A 3FNDA 1JULA 1FWGC 5LKYA 3SRHA 4HBKA 3UR5A 3CUHA 3UCCA 1O5RA 4PMDA 3V75A 1KFEA 3RYSA 2AKZA 5A8QA 4XQ6A 4K7YA 3VGGA 3N34A 5HJYA 4I9JA 1I2NA 4WDUA 4C6QA 3BLLA 4CNSA 3G5EA 5IFPA 3JW7A 2IQTA 4WSKA 3ORWA 1BQCA 2GJRA 3E0WA 1FQ0A 1XC4A 3WJYA 1LLZA 3TX9A 3KAOA 5JH1A 2NX1A 3WLRA 1G94A 5LHFA 3APGA 3N2BA 1TO3A 1EZ2A 1QI0A 3ZJ7A 3TYCA 4DWSA 3PTQA 4ORIA 2A6NA 1RYRA 1Z89A 3DFTA 5LZLA 2Y7DA 4Q4PA 2ZWYA 5HNUA 1ZALA 4GYPA 4DNHA 4IGMA 3C8FA 3B40A 1KTNA 2FQIA 4AD3A 3RCMA 1K77A 4NKCA 1XH1A 3L67A 3LLDA 2VKZG 1KA9F 1FWIC 3DGBA 2J78A 2AMXA 3W00A 1QAPA 3WSUA 3KHDA 2ZBTA 5BMWA 4XAPA 4F4RA 2PP3A 3B8IA 2XPKA 4J3UA 4LC6A 2BHYA 4UFIA 4HCHA 4AZ6A 1FVPA 1FH7A 1PX3A 4V15A 1JQXA 2B4GA 2WWCA 1UD5A 2G8ZA 1PKYA 5KSWA 3UR8A 4JKMA 1TCDA 2ZTJA 4UFJA 4A4AA 1BD0A 2W5FA 3V6HA 3ZSTA 4M3PA 1UPPA 2NUXA 3B0XA 5A6BA 2ZKMX 3VOIA 1IXNA 3C56A 4LEQA 1C93A 4MWAC 1ZFJA 4IMFA 3PZVA 1QBBA 3P5YA 2BVDA 3Q8RB 4NNBA 1XLMA 4PTNA 4INFA 1M5WA 2XWEA 1ZJIA 3LHZA 3VM5A 1H0IA 3T5KA 4FR1A 4O16A 3AC0A 3M9YA 3AI0A 1KFLA 4W86A 3RNDA 2WZIA 1XGZA 3OVQA 4ZL1A 1JPDX 2R1PA 1IHIA 1PZ0A 2Q8LA 3BLFA 4MB1A 1ISYA 1FX6A 1B2YA 2J6SA 3VABA 4QGCA 5ECUA 3OGVA 3A9IA 3URAA 4O17A 1SMAA 4FS9A 4DJFA 3WD3A 3ARUA 3CAVA 1OYBA 3KTSA 1PHWA 2A3HA 5H8PA 2PODA 4XZBA 1BKSA 3MVIA 3M7WA 1H0GA 2C8NA 3LGDA 2OQLA 5I0DA 3LCHA 1S46A 3DCPA 5A69A 3OLIA 3WBEA 4L65A 1XYFA 4KQNA 4C6NA 4HYKA 3A47A 2G3JA 1X96A 3OB8A 1KRAC 4ZOCA 1DIDA 4FXFA 3WLKX 5DMMA 4YR2A 2C28A 4YCPA 3BZJA 1GVSA 2E7FA 3SCRA 7REQB 3W83A 4NXSA 1A5KC 5JIWA 4PSPA 2QF8A 4LGXA 3GKAA 1QBAA 1XC6A 3H2OA 2E6YA 1RZMA 1B3WA 3QQWA 1ZJBA 3N15A 5CG7A 3CHVA 4Q4MA 1M68A 4A05A 2AGQA 3P67A 5I78A 2GJLA 2CWNA 2DIEA 3QZEA 3B9OA 3T2QA 1EJ7L 4D9PA 2HDJA 3TSMA 1XDMA 2HK1A 4OECA 3A4WA 5DMLA 2PDNA 4H01A 3NQ7A 3CV7A 2B7QA 1X1ZA 4MG4A 1FHUA 3WLIA 2Q09A 1B3YA 1JD7A 2V5LA 4TQRA 3SEPA 1F9CA 1P43A 4M51A 4OQVA 2BV9A 4KFNA 4RDYA 2JE8A 1Q8AA 2OJPA 4M29A 4U10A 4E4UA 3OZPA 4Q8OA 4HPJA 2A3BA 4RPPA 4AEOA 1R6WA 4UTUA 3AS3A 1EO5A 4I9AA 1A47A 4GFSA 4GQBA 3H4WA 4P8UA 3NSNA 3BG5A 1ITQA 3R43A 3FGCB 3TAOA 2WHLA 2E3ZA 4PMRA 4GA8A 2P8BA 2VGBA 4TU1A 3V18A 2DW6A 2VFHA 5BRQA 4CVUA 3I3DA 2CBJA 3R11A 1AG1O 2ZUNA 2WJFA 2QUMA 1QPQA 4C6CA 2GJXA 3VKBA 1GQLA 3NUKA 2MNRA 2F2KA 4S2CA 3KX6A 1AFSA 5FJRA 2QULA 2C0HA 4PUMA 4GJ1A 3EX4A 4HYWA 3VKDA 4PMVA 3R94A 4LT9A 1HKJA 1V6TA 3KFTA 3W7PA 1XLLA 2QJGA 3NXLA 2XH2A 4Q8UA 4DWSC 5BWAA 3BJFA 1J01A 1DJIA 1FWJC 5FIPA 4C91A 4JV1A 3WD0A 3MYOA 1IV8A 2PDIA 3OZMA 3DERA 4H41A 3VC6A 1XYZA 4NNAA 4QX4A 2EEXA 2YYTA 4V27A 1X97A 1DV7A 1VP5A 1NQKA 3TC3A 4EVZA 2DDXA 2YA0A 2D3LA 3IIXA 1OF8A 1PB0A 3W53A 4L4LA 4YXGA 4DAFA 3W7DA 2XH0A 1PO9A 4UXDA 4RJEA 3ZSSA 4Q7IA 1HL8A 1V77A 4CQ8A 1R86A 3V36A 2VDIA 3BMXA 3UZZA 3HIJA 2XISA 3E2RA 5AYYA 1P0EA 4QWEA 3PAJA 1G67A 4DF0A 4NT0A 1NDZA 4DQWA 3PULA 4QJ4B 3AWOA 4ML4A 1DPMA 1ISWA 2D2GA 3NGDA 3PG8A 2JF6A 2NLIA 1OIMA 5CXPA 1YMYA 1RSCA 1GKQA 3EB3A 3KZSA 3GIPA 3B8SA 3MA8A 3OHBA 1KWKA 2Z2BA 2HSAA 1I45A 3RUBL 3V7PA 2WNNA 1QOPA 3ZLGA 4B5WA 3HGRA 3H2CA 3TN4A 3P7YA 4JN6A 2FIQA 4AIBA 3Q2DA 1AQFA 3P82A 5AYXA 3W6YA 3NQGA 4PL2A 4KRTA 4AXNA 3WNLA 3WFZA 1MXDA 1AZ2A 3TTQA 3EKGA 3THCA 1TR1A 3H2FA 5BRBA 3IANA 4O28A 4C1NA 2GSJA 4XKYA 1B4KA 4NZ1A 5F2LA 4NAFA 2BY1A 4TR9A 2ZA1A 2IA6A 5BOOA 1LUCB 4XZIA 3OIXA 4L5ZA 3OZYA 4EXBA 2AL2A 1RK6A 1X39A 4S3KA 4GLEA 1JPKA 4IF2A 3PZOA 1XPGA 5DMNA 3ENLA 4DO4A 4CVWA 3DGRA 1Z8AA 1UWIA 2ZWZA 4JTAA 2P50A 4KESA 4R34A 4MDPA 4M8UA 2DT1A 1TV8A 3EMZA 2J9XA 4O0KA 1X8FA 3T07A 1M41A 1TX2A 2P9BA 1C8VA 1B1YA 1QOXA 2G3FA 1MFVA 2HWGA 1R47A 3VGEA 4BR1A 4RNHA 1W3HA 3UQNA 2QDEA 1JPIA 4N9BA 5C9RA 3KHHA 4WOQA 2A4AA 4JTEA 4GJJA 4GHRA 4IOTA 1W8SA 2XFFA 1XISA 3BSGA 8XIAA 1YE6A 1UC5A 3SUUA 1OCBA 5DEZA 4IXHA 2VA3A 1Q6DA 5BU9A 4JUZA 1EXPA 4EF8A 3M07A 3HFTA 2V0TA 5DQGA 3IGUA 3S9YA 3HBLA 4NY2A 4HGXA 4UTJA 3BGAA 5LA0A 2R8JA 1HO1A 5A6SA 3WBYA 5EY5A 2XVKA 1E40A 2D0HA 1EGZA 4QRNA 2VX5A 2QCNA 1F8MA 4R7WA 1K4GA 4XTDA 1YKWA 2GQ9A 3ONBA 1NY1A 2WSYA 4YTTA 4ROPA 4AZBA 2TAAA 4D6GA 1W5QA 2ACUA 1GVYA 1O66A 1OK6A 4GI8A 3DN5A 3AAMA 1DEDA 2WPGA 3MUCA 3C2VA 2W9CA 1R3WA 5KG4A 4KCVA 3WX7A 1B30A 1XH2A 1BYBA 3F5KA 5E70A 3R8GA 4AMCA 4DYKA 4WGXA 1VRDA 5ENLA 2J7DA 1HL2A 3B0VC 8CGTA 4IL2A 1KM4A 4JR5A 4MWAE 2Y8VA 2QCDA 4L9ZA 4PMOA 3KRSA 2XDFA 5K9DA 5K3VA 4O1DA 4GGHA 2DT0A 1US2A 2O0TA 2RGLA 2VRQA 3P8IA 3TTEA 2AQ4A 2YFNA 3SN0A 2P3EA 3DZ1A 4ZCWA 1SO3A 3MR5A 4WXZA 1TZ7A 2V69A 2HVNA 2QGYA 1XSIA 1HJWA 2D2OA 1G4TA 1AODA 2CXGA 4AC1X 2Z7KA 3IEBA 3EOLA 4IWWA 3WH8A 2J74A 3PZMA 2CLKA 2W9AA 2PWDA 3QC3A 1PPIA 3VIJA 3MW7A 1HGYA 3R5EA 2DZPA 3CO4A 3BMWA 1W9UA 3DENA 2PGEA 3ARZA 3WZ0E 2WC4A 2BFGA 3S5NA 2Z24A 4EE9A 4DL6A 4PTWA 1HNYA 1XINA 3MMTA 4Q8EA 3W1TA 5F9NA 2EPKX 1FA2A 1EJRC 3PK7A 4DO7A 2WSRA 2BR0A 4ED3A 4LAKA 1HKWA 1NAL1 3TP4A 3I7RA 2J7GA 3PPFA 5HULA 3WLNA 3AWNA 5CLWA 1Y5WA 4W7WA 5A3HA 3FDKA 2GGHA 3TA6A 4PMJA 4GVGA 1LBMA 5CPMA 2UY4A 3HQPA 5L9XA 5H2ZA 3UY8A 2X16A 2YXGA 4D8AA 1FXPA 1CTNA 1TE1A 4O50A 3QKEA 3AHTA 1RCXB 5GNZA 1TZZA 3ERPA 4YTSA 5KFQA 4JTIA 3W71A 3BO9A 2ZZ7A 2GDVA 2C15A 3U0HA 1MNSA 3TEVA 4JIEA 4LUSA 4IUOA 2QPXA 1EIXA 4DJDD 5D03A 2GOUA 3DFYA 2W8LA 1T8XA 4DEZA 2Y61A 1P6WA 3K5XA 4D6FA 2INEA 4X3ZA 1OADA 4L6HA 1CGXA 4DY1A 2J6VA 1W2VA 4UZUA 3T0TA 3M0VA 2XUCA 2HMCA 2V5CA 2BXVA 3A4XA 2IPFA 4WJXA 4ENLA 3Q8SB 5U4NA 1GQJA 1UUQA 1DJXA 3V0SA 4GO8A 3STCA 3HFYA 3NQVA 1JL8A 4UCGA 4ECRA 3KOZA 2OX1A 3U5YA 1ODZA 2QYGA 3G1HA 3VVGA 2HTMA 2J47A 3FXGA 3M6YA 4S3BA 1PS9A 3G1RA 2PDBA 4MAZA 1QO2A 3LGEA 1KD0A 2PE4A 2UBPC 5CZTA 1OC5A 2ABBA 1YDYA 3GU1A 3PZNA 4GUJA 5JIPA 4GUFA 5C9XA 1S2WA 2CW6A 3NPXA 4KETA 1K9EA 1JPHA 4HNLA 3UZJA 1KBBA 3QLDA 4EPKA 1Q65A 3L4YA 3EAUA 4OTKA 1C29A 1KM0A 4B3LA 2W91A 2E25A 4O3SA 2ZX5A 2W9BB 1DHPA 5KFKA 2ZZ1A 1RLCL 1M1BA 1RA5A 5J8LA 3U4FA 1CEOA 1OZMA 8A3HA 2WBGA 3BOLA 3BV7A 4GMEA 2JALA 1JZ8A 4JXCA 1U2YA 4GNKB 3K13A 1C92A 3W07A 1OFAA 5TF0A 1UWAA 5CJ5A 3G6XA 4RNJA 3EWYA 3E0IA 1HKIA 4HNTA 3EWDA 3GSMA 2C16A 1JF5A 3RLUA 3QZ8A 3AIBA 3F7JA 4M1BA 3PZUA 3MKKA 2UVVA 4UMAA 3EOOA 4LEFA 3OHAA 1EXBA 3WEZA 4CD4A 3IJ7A 1EJTC 1NOWA 1U22A 3N6JA 2W7OA 3LN3A 3KP0A 2YL8A 4Z0JA 2C1IA 3ZR4A 1TG7A 3T08A 4PMXA 4MLJA 3U48A 5AKQA 4MKSA 4URIA 4P7NA 4O11A 3GH5A 2HPMA 1A5LC 4O19A 4ZO7A 1IXOA 3JR2A 5KFFA 4UTMA 2QJHA 3FDSA 2CIPA 1H5VA 4G1NA 3L4ZA 3CV6A 3LYEA 1UH4A 4QEEA 3ARTA 2GSHA 5LIYX 5FJTA 1SO6A 2E9MA 4ZB0A 5FF4A 1XCXA 4MYAA 3VUPA 1Z7AA 4FNUA 3N25A 2QCFA 1CWYA 5C0QA 4F2TA 2OCZA 2VNCA 1L6YA 4ZMGA 5AY7A 4JY8A 1BG9A 1XJBA 3C61A 3GUWA 3ZMRA 2VD8A 1PZ1A 5HPCA 3HQNA 4O15A 3QW4B 4HCDA 4FPSA 2UVWA 3N2MA 1UA7A 1UPMB 1PXGA 1WXJA 3W1RA 3AMKA 3OW1A 4UTKA 1S3HA 4Y6GA 3S2CA 5D33A 3M0JA 1U5VA 4ZTYA 3U3HA 3MMUA 3B04A 4PODA 3EX3A 2I1OA 2J7CA 2CLPA 3E49A 3E96A 2DZSA 1XLDA 3MSGA 3V3WA 3KP1A 3BC9A 4IRDA 3I3BA 2NUYA 3WLTA 3V1PA 4MNJA 4M81A 1IIHA 1XRVA 2QJMA 3GV8B 4RW5A 4TTUA 4C6PA 1SZRA 4DIAA 4R8UA 2OKOA 3SAZA 4UTTA 5LSMA 3PUGA 3MZ2A 4ICMA 2PDFA 3CV2A 4HVXA 6ENLA 1BHGA 2HE5A 3PHAA 3SUTA 3NPVA 5AHIA 4JQ1A 1Z3NA 5A6AA 1XLJA 4RLIA 5KFTA 1I75A 2YA1A 5A94A 1JDCA 1EFZA 3DHDA 3DESA 2BWGA 4S3JA 3A4AA 4A3QA 2FZDA 2YIHA 1EUNA 3MJYA 3N14A 1XIBA 4ACZA 3AMDA 1S38A 4CN1A 5HJXA 2H9AB 1CB7B 4IIFA 4GH3A 1BXBA 1F5ZA 1KO0A 4IFKB 3BMVA 4J3TA 5A2AA 2LLEA 3IK4A 3WQCA 1C7TA 1F4HA 1BGGA 3CWOX 1KKOA 4CU8A 4WHBA 1FWRA 1RBOB 4RR4A 4EPEC 1RUSA 2RDWA 5PTDA 1Z41A 1S1PA 4RV3A 1IXQA 2GDQA 1UBPC 4LUJA 5KFYA 4D8LA 1XDJA 3H4XA 5I79A 5DBUA 1IWPA 4F4XA 3HJEA 4GVFA 2ZX6A 3V1HA 2CZFA 2B81A 1YNPA 4DI9A 3Q94A 4YVVA 1WO2A 3RCYA 4FXRA 3UGRA 1MQRA 3QHNA 2I5QA 3NM3A 3KWSA 4UQDA 1GJWA 4GRSA 2P1FA 1SJBA 3AZRA 3Q65A 1UHVA 3KVJA 2CPUA 3SCUA 2F84A 3BQ6A 3LM7A 5L9FA 1I2OA 1YQ2A 3WH7A 4XAZA 2BX7A 4AEFA 5KFPA 1NTHA 3AALA 3INPA 5CAKA 3WL0A 3NGFA 2RH9A 1JVNA 2A79A 3B0YA 5AYBA 5CGTA 4Q22A 1NM9A 1XHGA 5H1WA 2W61A 3DFHA 4HZMA 1CX9A 2ASHA 3NYZA 1FH9A 1VH7A 2BB0A 4Y2WA 4CQDA 5KG1A 1K8XA 3DG3A 1LTDA 2CNCA 4NZ4A 3CQJA 1O12A 4OT7A 1ML1A 3RAOA 4BWLA 5L1JA 1CGVA 1ISZA 1U1HA 3SFKA 1TA3B 5KFCA 1V0KA 3TXVA 3GAYA 4LNCA 2XZ9A 3VI2A 4OOZA 5H6HA 5AC7A 2BASA 2NSOA 4WF7A 1V6YA 3LSBA 3KBVA 1XICA 2OOFA 4MY1A 5BW6A 4HSHA 4C7FA 5FJOA 3UG4A 4DZIA 4UR9A 3K8LA 1UR1A 1C9WA 3SCNA 4KRUA 2QUTA 3FKKA 4U6PA 4ZR8A 1EX1A 2CLOA 4YN5A 1KGUA 4DZAA 5FCZA 2QGHA 2PWUA 1TMHA 2J8GA 4GXPA 1TWSA 2Y1HA 2XN1A 3BDKA 4XD5A 3W1XA 4GX9A 2JIEA 1POKA 2VD9A 1J5TA 1L6WA 3AS1A 2GVLA 3L4TA 3GO2A 4GBUA 3W7HA 1D9EA 3W1QA 3N04A 3LMZA 2PD9A 4NAEA 4UR8A 2FGZA 3T55A 3R12A 3TNOA 4PSRA 5DG9A 1GPWA 3VO0A 2I5IA 1UR4A 1L0PA 2PWVA 1EJWC 1UR0A 1IEWA 4GY7A 3QLLA 2V3GA 3LTPA 5AHFA 4WVXA 3GYEA 4PBFA 3C2RA 2VTFA 4WSJA 4PFMA 1HUVA 3O2LA 4AZ7A 1UUMA 2X1SA 3C2YA 3TONA 4MZ8A 4KIRA 1AA1B 4H9TA 2PDPA 3DFQA 1Q6GA 3FK4A 4OU1A 4J3ZA 4R8UB 1X38A 1EWEA 4OV9A 5A1AA 1VC4A 1E6NA 2IPJA 1U1UA 4Y9OA 4ZXOA 1WZAA 1G5AA 1J11A 1WDDA 3VNKA 1J0IA 2L5HA 2BG5A 4GYKA 3KM8A 4IQDA 4I9MA 1V02A 3FA4A 3BTNA 2C2RA 3UZXA 1H50A 4E3VA 5HANA 1RLDA 3FEQA 3T42A 1V3HA 4DJEA 2D0GA 3WYZA 4G6CA 5EB8A 1KR0A 2R8WA 2OR2A 4C6KA 4YCOA 3N4FA 4OVXA 4AWEA 2JEPA 2W9BA 1LWIA 4HZ8A 1JYNA 2XVNA 4NX0A 1KM1A 4H6EA 4UOZA 5F9LA 4IGHA 4P61A 4QQUA 2VCBA 3STPA 3UA4A 1V3KA 2BGSA 1UR2A 3AXIA 4R33A 3BPWA 2JEGA 1OX5A 1ZZMA 4HJFA 2W27A 3DBNA 3WEMA 3QF0A 5F2MA 3W7KA 4UWMA 3LA4A 4K1WA 1A5SA 5CAHA 3KL0A 4GI9A 4NIRA 4M0XA 4WY0F 5HA7A 2DSKA 1UMYA 1T6MA 3H2AA 1E55A 3NZGA 2NVAA 2Y6ZA 2WAGA 1E5JA 3QKZA 4UNKA 1LWHA 1UWTA 3V0UA 1WCGA 3PJXA 3RO8A 3G6VA 1VCFA 3N13A 1X1NA 2CBVA 2WM0A 4J35A 4D2JA 1E5NA 2DFAA 3U57A 1GVFA 4M7SA 2VX6A 3REQA 1WOBA 4RNNA 1XD1A 4M6PA 4DHGA 5L1KA 3AYTA 3KS5A 2ASJA 2Y24A 1VBRA 2DSZA 4ZFMA 1GGOA 3QW3A 2VVNA 1MDRA 3AS2A 3GG1A 5J5DA 3RU8X 1ONRA 1YDVA 2INZA 3ATZA 3E6EA 1OFQA 3RBEA 4IRKA 4GVHA 2OYKA 3WDQA 4Y7EA 3NVTA 2CZEA 3M0ZA 1G0CA 2VEMA 4PEKA 3GIJA 1TELA 5H8MA 1C7SA 3FHQA 1ZU8A 4JTSA 3GU2A 2XVLA 5HUOA 4B16A 3SCTA 3U2OA 1K8CA 3CGTA 1DIOA 1PZ3A 1OGSA 4KF1A 3EWXA 1CENA 3HPXA 2P0IA 1A53A 3JZUA 1KM6A 4FZIA 3UCQA 3CM4A 1VHNA 5EKYA 3PTMA 4KIEA 3RB6A 4AZIA 3N1AA 1S0MA 4BI5A 3ES7A 4F79A 4U4MA 3MUAA 5F2IA 1E6SM 1P5BA 1CXLA 4GQGA 1KGWA 5H91A 3DUGA 1Q7QA 1LG1A 1D2KA 1US0A 1QW8A 4AY8A 5DCDA 4RZ6A 1CXIA 3WQ5A 2GLKA 2VT0A 3H23A 4Z1YA 5KFIA 4YTRA 3UERA 1SW7A 4A29A 3K4WA 4GPNA 1AW5A 3LU2A 1PKNA 3AJXA 2D69A 5KFRA 3LB0A 2XSBA 3VNLA 1I9CB 3ZLHA 4C6LA 5AC6A 3TFXA 2ASDA 1B31A 3IWPA 4CN6A 5D04C 2O7SA 2VOMA 5E0FA 2V2HA 1A5NC 1JXKA 4NJKA 1QASA 1RR2A 4M56A 5EMKA 3E1F1 5T26A 3T5HA 2V5BA 3SUWA 1KKRA 4ZTXA 4GC4A 4LBSA 4IPNB 4ADSA 2G97A 2G3MA 3LM3A 4LRSA 3N3MA 4FXJA 4I90A 1TPFA 2RGMA 3TDFA 3BCDA 4WDTA 4H8UA 1DXEA 1NFPA 4HA4A 2HXUA 2D23A 4FNSA 3GWQA 1KFJA 3V35A 1A5UA 5M1TA 1W54A 3LCIA 4EYIB 4AC7C 4P7LA 1BYCA 4H83A 1DVJA 5FEPA 3CAWA 2PSNA 5FF3A 3SQSA 2Z2AA 4MLRA 4XV0A 3UG8A 3WMLA 2FYMA 2QDGA 3ABZA 3PNZA 3VIGA 1TJ0A 3QZAA 1IR1A 2PTDA 1NU5A 2P10A 2PDGA 2NSXA 3TW9A 4GXMA 1H7XA 1A5BA 3R0KA 1F3TA 4HA3A 2WSQA 4Z1DA 2HE8A 3P61A 1E15A 1RD5A 1JDDA 4AISA 4NP7A 1YXYA 4QEHA 3LCWA 2JGQA 4RNMA 5BXSA 4H2HA 4JQ3A 3DIPA 3NVDA 4LUTA 2WKJA 2PZ0A 5CJNA 1QO5A 4IQLA 1Q6EA 4AUBA 1QXLA 1S2TA 3GDMA 4HPXA 4IMAA 1WAUA 2O9RA 4XZNX 4B92A 1KWGA 1K8YA 1XCFA 1ITUA 4K3ZA 5K7JA 4L9YA 1DJGA 3N6HA 1N8IA 2VEKA 5CPQA 2PGRA 2PBOA 1WKEA 1TPWA 1JDAA 4OGZA 4D6JA 1QNRA 1HKVA 3MJMA 1GJPA 5GJNA 2EPNA 4WSHA 4U5IA 2J7EA 4GQ0A 4IX0A 3M16A 3L4UA 1PCKA 5REQA 4TMBA 4RZBA 2VZVA 4ECYA 3VOHA 3AISA 4FA3A 1J5SA 4N42A 2I14A 3GXDA 2EBNA 4BF7A 2ZA2A 3KW3A 3FW6A 2ZZ3A 3GV7B 2ZRVA 8TIMA 4UTIA 2QMKA 4ML9A 3A3XA 3N29A 1VYRA 3UCDA 4NYYA 3MCMA 3L65A 1I0DA 3VNDA 2BY0A 2Q02A 5IBXC 3DBPA 3VYLA 4R7OA 2VYOA 1IF2A 4KWWA 2FFIA 3BICA 3MHFA 1P1MA 3TCEA 1R3SA 2AKMA 1MW1A 2XG9A 3AXHA 3MO4A 3IN5A 5GNXA 3CO8A 4HU4A 1C8QA 2WANA 1TTQA 1A0EA 1S5TA 4MYXA 1PKLA 3GG7A 3WDJA 1AQMA 3F03K 4XSMA 2V38A 2DV0A 3UT0A 3BLKA 1BKHA 3NQ6A 5D37A 4Q8PA 5EFDA 2WVVA 3PVFA 3RX2A 3I68A 2X0SA 4RW3A 2W9MA 4FNTA 5AYZA 2W62A 4O57A 4YWSA 4HNNA 2Z1WA 2XVGA 1UWSA 1PHQA 1QI4A 3CNYA 5AN7A 1QPOA 3BW3A 4QHRA 4GC7A 3VZXA 2V2DA 3MR2A 1R5YA 1O95A 4K68A 4JAWA 1XF0A 2UVRA 2X41A 5FJJA 5KT5A 2JEIA 1O5XA 2XCAA 4EIVA 4WJ8A 1E56A 1BWLA 2GOKA 2BVWA 1B3ZA 4IMGA 1XDLA 1VBJA 4ED7A 1ECEA 3W7MA 3C2FA 2V8ZA 5FI8A 4D71A 3CHFA 3LCLA 3QGVA 2XIQA 1PE1A 4QDPA 3NL2A 3EX1A 4O3QA 6A3HA 4WGHA 5M5DA 3EPNA 4LQ1A 1YBQB 2OWXA 3VOFA 4EBEA 2AL2B 4JTHA 1JJKA 4OBTA 1UQYA 3ICJA 3WDRA 3LBOA 2BS9A 3RG6A 1A3HA 2F8QA 1VYPX 2W0UA 4RE4A 4QLJA 1M03A 2HV5A 2RDXA 1XYAA 3UWEA 1Z42A 4F50A 3QZ7A 1XBXA 5AZ0A 3TSDA 1DKWA 1LYXA 3WQ4A 4QTGA 2BMBA 2DPIA 3CHCA 4AIEA 3GHRA 3UPMA 4UFMA 5E5CA 3CU2A 3VDBA 3CHEA 1JZ3A 1VQTA 5HOSA 4C6EA 1EYWA 4JIQA 1TV4A 1W9VA 4JHOA 3LHTA 3P74A 3ZJ6A 4PUJA 2I9UA 1J12A 1H41A 4R7JA 1XIHA 4U33A 1VAHA 1X1OA 4CU6A 3R0UA 4ECLA 3HF3A 3OBAA 1NP2A 3QPYA 2CHNA 3A64A 5I2UA 4RXFA 3RO6A 4J9RA 3T5LA 3AIQA 2CHOA 5KITA 3E0VA 1XW8A 4LAZA 1HVQA 4HN4A 1CGYA 1J0YA 1SR9A 1G6CA 3DFSA 2PDMA 2OH2A 4BZYA 3CXOA 1FWTA 3LHYA 1OWQA 4DPQA 3LGGA 3TWAA 3E0LA 1OABA 3NCOA 3KS6A 4CGTA 2Y4SA 1BVWA 4L4MA 1TA3A 2P76A 5IM51 4N6FA 2CC0A 2QHAA 4DXKA 1VFOA 3SW6A 2YXXA 1XX1A 3WIJA 5FF2A 2ATSA 4JICA 2OT0A 4HT3A 2OODA 2V9WA 5I3DA 3M46A 4L4OA 1OX4B 3QYSA 2VX7A 3IRDA 4N9DA 2CXEA 4FBTA 4KFPA 4WKFA 3UG3A 2WMFA 3LPGA 5AC4A 4J9SA 1AH3A 1TJPA 4M24A 1X6UA 1W32A 1ADDA 5LXXA 4EANA 2VQUA 2HK0A 1TR9A 1EQPA 2ZVIA 2UY2A 1Y8BA 2R1NA 2HS8A 4H00A 3NL5A 1WZLA 5A6BD 3TYEA 2WMJA 1XD0A 3HV9A 4LAOA 3BQ2A 1AQ0A 1JUEA 1KLYA 3N9RA 1F07A 3WY1A 1GT8A 3R7MA 3YPIA 3WK0A 3NSMA 1D7FA 3E5BA 3B05A 1W1PA 3W81A 2XGZA 4F0LA 3IJQA 3WBAA 3UP8A 1IR2A 4PTMA 5C6MA 3M0KA 3BXWA 4GJIA 2GDUA 1NEYA 3D3FA 4KKXA 5JMUA 4GFIA 4WKHA 1XGEA 4O18A 2E9BA 3MP3A 4B9ZA 3M64A 1ZQ5A 1H1ZA 3UVIA 2AGOA 1RHCA 1WAWA 2ALZA 1KXTA 1RP8A 4R27A 1HXJA 3C3NA 1OYCA 3G1DA 1BVZA 4C90A 3W9ZA 3PF3A 4LVFA 4JYEA 3ZM8A 2DIJA 3LBMA 1J2BA 1ZBVA 2O56A 3GIMA 4WD0A 4DM2A 3JVAA 2I9EA 4IRCA 5FF0A 1Y5VA 4P8XA 1S0OA 3ZT6A 1G4PA 1E73M 2HS6A 1ZENA 1MUWA 3BQ5A 4OFCA 3NZ1A 4M5PA 5IDZA 3GV5B 4RUAA 1RYSA 4JS3A 3S5ZA 2WZEA 3VU2A 3AIWA 1OFDA 4BJHA 3FEMA 3TSBA 1SO5A 4FOUA 3STFA 3PC0A 3FA3A 2PS2A 1KFBA 1HVXA 2YR1A 2VC5A 2BOFX 2GFTA 1W3NA 4HA1A 1H7RA 3REQB 2EG7A 5FD0A 4FEZA 4IIGA 3DKJA 4PUDA 5D9MA 2DZVA 3W7CA 3OG2A 4QCFA 3WL1A 1S2AA 2J7HA 2FZ9A 2RKXA 1ALDA 1QI2A 2EXOA 3WLPA 2V3DA 4KWVA 3ABOA 2FGBA 3R58A 1W5OA 2FH6A 1K6AA 4M7TA 3B9NA 3WD4A 4OKDA 3GAKA 1UWUA 2OEKA 4O4WA 3A13A 3K1DA 3D6NA 1PIFA 4RNIA 1JUKA 1MDLA 4L9XA 1KFCA 4ACYA 6TIMA 1SJDA 5MHBA 5FSEC 3NJ3A 2CLFA 4EWJA 5EMLA 4FX6M 1OY0A 4DBSA 5KG5A 1S9FA 1A5AA 1SMDA 1YXDA 2DU2A 4J9PA 4JCMA 4BCEA 2Y0FA 4UOQA 4YHGA 2FPVA 2G3NA 4EYHB 2PEVA 2QLYA 4GIYA 2CLMA 2WMIB 3G0XA 4PRTA 3BLEA 1C90A 2PP0A 2ASLA 3UXDA 1N48A 2QDHA 3GZ3A 4O53A 1ZCCA 4JTLA 1RVKA 4ACZB 2O9TA 2WNZA 3BANA 3PSVA 5AHMA 4MUPA 3WNMA 4QITA 3L5MA 1MUCA 1LQ0A 4L1WA 2VFEA 2WXDM 2ZOXA 1WKYA 3VA8A 1YTDA 1EWDA 3PM6A 4HN8A 3S46A 3PY2A 4NXKA 3H21A 5FA5A 4G7EA 1TKKA 5C71A 3W88A 5I02A 3MDWA 3WF2A 3CEUA 3O06A 4YU1A 2ZDSA 3WN6A 3SY5A 5I09A 3CZ8A 4W5UA 3ECQA 5EA9A 1EHAA 3H2NA 4GINA 3IACA 1W31A 4W5ZA 3MKCA 3W7QA 4D1IA 5EWFA 3ARPA 2RHGA 1TMLA 3N4EA 3F4WA 4K1GA 3CBWA 4QSFA 2R9RA 1BLIA 1SVDA 1PYFA 4FHAA 3HOJA 4JNYA 2IXUA 1W8GA 1FKXA 4RKAA 1E9ZB 5KFZA 1YRRA 3QR3A 3S6TA 1VJSA 1KTBA 4LYQA 3TC7A 1EDGA 4B2DD 4YPJA 1YPIA 2E4TA 4HMCA 4GD0A 2X1IA 4LUTB 3UD6A 4RX0A 3MB9A 3T0AA 5I07A 1MW2A 3CASA 1W5NA 4MNLA 3KL3A 3HU7A 4QCEA 3KEHA 3IJIA 4QE5A 2UVUA 2FB3A 3PNUA 2E40A 1E0XA 5ABHA 4KEUA 2V5KA 4AY7A 5F1UA 3VILA 3NWRA 3W73A 2PLKA 1E0UA 2DGAA 3EWCA 4RDWA 4O3PA 3EZ4A 3KTCA 1ME7A 1LRTA 2OGYA 4JDBA 3S5YA 1OF6A 4Z2IA 1C9DA 4DB7A 3H53A 2J7FA 2TODA 3NO3A 5GJPA 3S83A 1A50A 4KGLA 3WF0A 4IJBA 3SDOA 1NDVA 2Y63A 4DL4A 4X63A 1WBHA 2QR6A 5DT5A 2O92A 2WVUA 1SFTA 1GVOA 1GW9A 1TPUA 3H22A 4L6OA 1RQEA 5KFAA 2DZXA 1BEUA 5ABFB 3DXIA 3LNMA 1PEZA 3URNA 1LUCA 3IVTA 1TWWA 2WMHA 2WZTA 2BVTA 6REQB 3S3GA 1OM0A 3MO7A 2VFFA 4MGGA 4B4FA 3GB6A 3GR7A 5E1QA 1PCWA 4R88A 2PWGA 4R3UA 1SR0A 3IIOA 1MNZA 2EKGA 1W9DM 3B97A 1ZCOA 3W27A 3VIFA 1FCUA 1DIKA 3HGJA 1HKMA 1IZKA 4B5XA 1YPFA 2NWSA 1UP0A 3WQVA 3SSJA 4K2SA 4RZRA 5CC5A 2UWFA 2FDSA 1FDYA 2TRSA 3EEGA 5CGQA 3HMJG 1POJA 2YBVA 3T4WA 3RPTA 4ROQA 2IMWP 2Q01A 1EEXA 2O7QA 3WQDA 1IXPA 6ALDA 3LV6A 3SM0A 4I5UA 4JTTA 1E9IA 4B5SA 2ON3A 3LQLA 5K9CA 4OOUA 1MYRA 2WLYA 4LTSA 3WLSA 2EPMX 1J0KA 4OWGA 3WFAA 3R1ZA 5CQ1A 1ZP4A 3GNOA 8RUCA 4IFKA 5DQIA 1IYXA 3WMBA 1AJ2A 5I3JA 1OX6A 3KOYA 3EWBX 2VGFA 2YJQA 4A8NA 1I2RA 1CT5A 3NDOA 2BLEA 2IUZA 4P8VA 1EIBA 1CGWA 3EKZA 1SW3A 3EBVA 3IJDA 3L12A 5K4XA 2KX9A 2HNEA 4HKPA 4L80A 5AC5A 1YW1A 2HRWA 3SR7A 1E0VA 4Z2GA 1JZ7A 4M19A 3AIUA 3TV8A 4ZXLA 4XUYA 4GCXA 3O3RA 5I6SA 4GYFA 5C9UA 3AHVA 5EWEA 3G24A 4KGJA 1EEPA 2VA2A 1W1B1 3S9IA 2O55A 1LL6A 1Q4NX 4CKQA 2XIJA 3GX9A 5DLFA 1FOBA 1LLOA 1MUMA 4YJ5A 5A6LA 4QS6A 1N8FA 3G1AA 3DFOA 3THUA 5KT6A 4OIFA 2EAWA 4DBUA 1TX0A 5EWGA 1RJRA 3UWQA 2DZAA 2Y70A 2Q6ZA 1QR7A 5E0CA 3O9NA 4DLMA 4HP5A 2I57A 3WQEA 1WE5A 4NJGA 2ZZ6A 3TJIA 1JF6A 3IGHX 3U7BA 4TX9A 5KFXA 3IUIA 4GIAA 1FHDA 3TOPA 2VO5A 2Y88A 2GWNA 2YGYA 1BQGA 4ZQNA 1J93A 2OPJA 3EEZA 1NWTA 2ZX8A 2R1LA 4XVEA 3HZ3A 1AL8A 4J9KA 4XD3A 9RUBA 2VQTA 3MANA 1HTIA 3GVRA 3V6JA 4DVOA 7ENLA 1E1EA 4G8TA 3EYPA 3F1QA 1OJXA 3TN6A 4WOZA 4E8DA 3PS7A 4E2VA 3IPWA 2DEPA 4N7QA 2Q8XA 2A3CA 5KZEA 2OLAA 3NTYA 3RPDA 3GVQA 3MT1A 1DWFM 4KEVA 1ZAIA 1CGUA 1YLVA 1R3VA 1JCMP 1WKFA 1REQB 2XIBA 4HOXA 3U9IA 3FVDA 4RE3A 4IPJA 2BNJA 2FDMA 3T4CA 3CH9A 3VD4A 2CLLA 3MKVA 5LIUX 4NSBA 3GYCA 2G4FA 1W5MA 2G41A 3CB3A 3NL6A 4YWIA 3EA1A 4N9EA 2C1GA 4B3ZA 1CI1A 4HPNA 3S8HA 5M03A 2CBUA 4J4KA 5D05A 3S1UA 2EJAA 3OO2A 3G18A 3W3OA 3OSNA 5C5JA 1A3WA 4U28A 2J4GA 3QZ6A 1O68A 4IP4A 1SSDA 1PAMA 3FKRA 3QQ0A 3VOJA 2XINA 2Y2WA 3T7VA 4CQBA 5HBFA 5DQHA 4FO4A 3H7RA 4GZEA 3EKLA 4X2RA 4JQAA 4ZQOA 1N55A 3H8AA 4M82A 4YVXA 3CT2A 5KZMA 4WZHA 1GOOA 3SZ8A 2P0OA 1AMYA 4AG0A 5FOOA 4LNYA 1G9HA 2PA6A 2EPOA 3IVUA 1LRNA 2PBGA 2ALDA 3HPZA 1GTEA 3SSZA 1R85A 2QXWA 1JQVA 6REQA 1OB0A 3LLFA 1F7BA 1UZ4A 3S6DA 4FF5A 4HOWA 3WUGA 5BOEA 4JFSA 5BU6A 4HA0A 1VRXA 2IPGA 2JKAA 1QPKA 4UQAA 1XYCA 3R10A 5D4YA 1SJAA 1Q2RA 4NZCA 1H3GA 3OODA 4HZ7A 3CUIA 1O1HA 1RK5A 4E8CA 3DKLA 4WX2A 3JUGA 1M53A 3A3HA 1WDRA 1VS1A 2BHZA 1NVMA 2J7BA 2NQ5A 3NR0A 1XWYA 1ONWA 2J88A 4XUGA 4RNFA 1GW1A 2BQ3A 2YA2A 2ZICA 1UOZA 4N4QA 9XIMA 1UIOA 2C71A 2PDLA 1I60A 1WX0A 5D2YA 4J2PA 4J3XA 1O6IA 1O7AA 3TQKA 4A21A 4EAYA 3MBFA 1IEXA 2GJPA 1EC9A 3P81A 1E4IA 1KCZA 1RXOB 1BYDA 4YHEA 3SIZA 4J7RA 4BFAA 2OGJA 1DP0A 4O52A 1V0MA 3M1ZA 4MF4A 3BAIA 5I3GA 4L6DA 1H63A 5GQBA 4X2PA 1H51A 4AD2A 3KCOA 4JZ5A 4ZODA 1QMLA 1GHRA 3R8RA 3EOSA 5F4XA 2Q71A 3NFUA 4H7ZA 3RB0A 1HG3A 2J24A 2E5CA 3SI9A 3NSXA 2WKGA 4G3IA 3SJNA 5DG7A 3N2OA 2HISA 5L6UA 2YSWA 3DAQA 1W6TA 3BVJA 2VMFA 2XGIA 2ZUWA 1GG1A 3U4AA 2OZ3A 2XC9A 4UMBA 2OB3A 3PPCA 5FACA 1DQXA 1BRLB 1CLXA 2QQ6A 2PLCA 2PFHA 2W6RA 3VNYA 4KS0A 4H7VA 3VM7A 5I3HA 2XJ7A 4AEEA 3WKZA 4QROA 4A2RA 2H3BA 3EMCA 3BSHA 2BZNA 5TBOA 3U6WA 3Q8PB 3FAXA 2BY2A 5T91A 2HBVA 4YR3A 3O6YX 2YZRA 4DL5A 1EH9A 1CXFA 3QMTA 1GEQA 3KTXA 4LVBA 4KPLA 4TV6A 5FKYA 3KVLA 1QFEA 2ZVRA 4FLRA 2AQWA 1QNOA 1D8WA 5KFNA 3LBCA 3NDZA 3IIVA 3C52A 1GOXA 3QBUA 3UW6A 3W1UA 1LLWA 4JQ2A 1T40A 2YDRA 4ZE4A 9XIAA 4NRSA 3QFEA 1KRCC 4HSOA 1TUFA 1KW1A 3MPGA 2IPWA 8XIMA 1R87A 4O8RA 1ZY9A 4ZSTA 1W5PA 3WELA 5B7YA 4ZO6A 4RPQA 1H1NA 4B15A 2F7FA 4EEYA 4KH2A 3WNKA 4XB3A 4YTUA 3SCOA 2YCIX 2ZRZA 4HCLA 4ZVJA 1DTNA 5GVJA 2DUAA 4JGDA 2GUUA 3CEPA 1REQA 2HZGA 3GXFA 1DHKA 2V9DA 5BRPA 4TVDA 4CCCA 4ZB2A 4FLSA 5KFVA 4Q4OA 1S5MA 1EGVA 4X9SA 4H9XA 2AQVA 4WY0B 3MMWA 1R0MA 3BLDA 2OG9A 3LHUA 3M5VA 1F61A 5G2HA 1JCTA 3BJSA 2POTA 3SN4A 4CQAA 4LUIA 4ILSA 4WLCA 3CC1A 4CU7A 2PLMA 2ISFA 3IAQA 3P14A 4NI8A 4NZFA 1ELSA 4Q4KA 3WUFA 2ISVA 4ZFCA 2J9YA 1YHTA 1EJUC 3GVGA 5HNNA 1UR9A 4BEUA 2YCLA 4PMZA 5TAOA 3CMJA 3TTOA 5LNWA 1VPXA 4Z2HA 1ZETA 2XH4A 3UGVA 2OYMA 3O6CA 3N2TA 1ICQA 3NAVA 1IT8A 3HQ1A 2A2IA 1AH4A 3DHPA 2CKSA 4NI3A 3GILA 3C86A 4DL3A 1H49A 3LCFA 3G1SA 1WUEA 1DJYA 4A2SA 1YTKA 4N02A 3TNBA 2NQ9A 2KZHA 3BW4A 2VENA 2DSWA 4NYUA 3OSPA 1KCXA 3M5XA 3WF3A 2Z26A 4EF9A 3LG3A 3D0CA 1EC7A 1B90A 1PKMA 2ZC8A 3NQCA 4Z2JA 4DELA 4NG3A 3O8AA 3W2LA 2A7NA 2A5HA 1ZSXA 2GZXA 3KHLA 4R85A 4EBCA 4N2YA 1LCOA 2WVVB 5IRPA 1S39A 3VMNA 1NDWA 2F38A 3MI6A 1DTUA 2PC4A 3LHWA 3N18A 1ZBCA