1XRYA

Crystal structure of aeromonas proteolytica aminopeptidase in complex with bestatin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Interactions of Streptomyces griseus Aminopeptidase and Aeromonas proteolytica Aminopeptidase with Bestatin. Structural analysis of homologous enzymes with different binding modes.
rcsb
molecule tags Hydrolase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xryA00
4UF4A 2CIJA 2CTCA 3PEIA 4G1PA 5LYFA 3H8FA 3NH8A 4IAVA 3WC5A 1UWYA 3PBBA 3B3SA 2O53A 1LAPA 4NGTA 2HC9A 3SJXA 1F57A 2C6GA 2AFZA 4DJLA 3MN8A 4MCSA 1LCPA 4WJBA 2ZEFA 3SI1A 4A94A 2CF4A 3PB6X 2GREA 3IC1A 1Z8LA 1ZG8A 4X2TA 4OC3A 3GUXA 1R43A 3SI0A 2AFSA 4X8IA 2Q51A 3VH9A 1TF8A 1TKFA 1YMEA 2PVWA 1CPXA 4P45A 1KWMA 1EE3P 2F7VA 4R8FA 5JH9A 3RAMA 1CX8A 2AFUA 2PJ4A 2PJ8A 2FVGA 1XRYA 2POKA 1QQ9A 2ZEMA 4P6YA 5K8OA 3IO1A 1Y0YA 3ISXA 5D8NA 2GLJA 3PB8X 4OMEA 2C6CA 2BCOA 4PXEA 3GLJA 3B7IA 2PJ1A 1FT7A 3S9MA 5CPAA 1CP7A 1CBXA 1LANA 4PXDA 1ZLHA 4ZI6A 2PJCA 4P4IA 3TC8A 1AMPA 1AYEA 4FAIA 2EK9A 3PRTA 3D7GA 5CBMA 4NJRA 2GU2A 3WC6A 4PXBA 3K2KA 2RB7A 2PIYA 2V8HA 4UEFA 1ELMP 4A38A 1TKHA 3KR4A 2EWBA 2QJ8A 2IQ6A 1BPNA 1VGYA 1LFWA 4Q7AA 4LQGA 2V77A 4ZX9A 5LYDA 4UEZA 1YW6A 2Q4ZA 5JM6A 3B3CA 5DS0A 4P44A 3SJFA 2AFXA 2QYVA 3B3TA 3V38A 2PJ3A 3KZWA 5LYLA 3WABA 3N5FA 4F8ZA 1BAVA 4WWVA 2NYQA 1TXRA 2ZEHA 5LRGA 2XEFA 2AFMA 3NH4A 2V8GA 4IHMA 3KQXA 4K3NA 3FECA 2PJ2A 3FF3A 1HDQA 4OC2A 1LAMA 4P4FA 7CPAA 5HXDA 4PPZA 2BO9A 3V7ZA 4OP4A 2PJ0A 4YU9A 3PB4X 2PJ9A 1QMUA 2VL1A 2EK8A 2AFOA 1CP6A 2PE3A 3FEDA 3CPXA 5HVFA 3K9TA 4ZY1A 3FEEA 2PJ7A 3QNVA 1BLLE 1XFOA 4TWEA 3NA6A 1CG2A 3FMCA 3H8EA 3SJGA 2ZEOA 1Q7LA 3CDXA 1HEEA 3PFEA 4JYWA 4NGNA 2O4HA 4NGMA 4W9YA 4Z65A 4P4EA 2Q43A 4OKOA 4OC4A 3WC7A 4NGPA 4B6ZA 3IWWA 4MHYA 1VHOA 2AFWA 4MHPA 4BD9A 3D68A 5ELYA 2PRQA 1ZG7A 3HUVA 5K8MA 4AXVA 4DUKA 3BXMA 4ZX8A 2XEGA 3ISZA 1NSAA 4R76A 1RTQA 5HVGA 1Z5RA 1XBUA 2C6PA 2I3CA 4MHZA 4O23A 1Y0RA 1TF9A 5LYIA 4R6TA 3KQZA 4F9UA 3CPAA 3PB7X 1FNOA 2ZEEA 3SJEA 4P4JA 3SI2A 3FJUA 2ZEPA 4OC1A 3IEHA 3B3VA 1JQGA 4NGRA 5I4MA 2PCUA 4P10A 2ZEGA 4JZ0A 3FX6A 1IGBA 6CPAA 1R3NA 2HB6A 4F9VA 2IMOA 3L2NA 4UIAA 2ZEDA 3KI9A 2NSMA 3JRUA 4RUHA 3LWUA 2PIZA 3HLPA 1Z2LA 3I1UA 3NFZA 8CPAA 1ARMA 2J9AA 1VHEA 3BI0A 3GB0A 2DEAA 3D7HA 1GYTA 1PCAA 1VIXA 4EFDA 1PYTB 4H2KA 3BI1A 4MCPA 2PJ5A 3IIBA 1BPMA 4YWYA 4IK2A 4R7MA 3B2YA 3IJ3A 1ELLP 3D66A 3RZAA 4EWTA 2V8VA 3PBEA 4CPAA 1DTDA 4NGSA 2F8HA 3FVLA 1F2PA 2G9DA 4ZY0A 4MHNA 4P4BA 5LRKA 2V8DA 4MCRA 4UEEA 1OBRA 4UIBA 2XEJA 3BHXA 3B3WA 1H8LA 4EMEA 2ABZA 3D7DA 3T8WA 3RBUA 2JEWA 4MCQA 3D67A 2OR4A 1ZLIA 1HDUA 3KGQA 5K8PA 3WT4A 2XEIA 3KHXA 2ZENA 3B35A 5HVHA 3KR5A 1XJOA 4OC0A 4NGQA 2CTBA 4ONWA 5J1QA 3PFOA 1TKJA 2C1CA 2WZNA 5LRJA 1YSJA 3DLJA 4GM5A 2QVPA 4OIWA 1ZG9A 5THWA 3MRUA 2JBKA 3KL9A 2OOTA 5D29A 3KHZA 1DE4C 3VATA 3TX8A 4MRIA 1LOKA 1F2OA 1ARLA 1M4LA 5JGFA 1YLOA 4OC5A 4FUUA 4PQAA 3DGVA 4MMOA 2ZOFA 2JBJA 3H8GA 2PJAA 5F09A 2PJBA 4MXUA 3S9NA 3PB9X 1YW4A 5K8NA 1XMBA 1IY7A 4OIDA 2WYRA 4ZY2A 2GLFA 4P4DA 4DYOA 4NFRA 1CPSA 4X3RA 4TNUA 2ZOGA 2PVVA 2RFHA 3NH5A 3FH4A 4KSIA 5IB9A 3D4UA 4NJQA 4A37A 3LMSA 4A39A 2IJZA 3IFEA 4ZYQA 2PJ6A 4FBEA 3CT9A 3KASA 4PXCA 3D7FA 2BOAA 2ANPA 3S9LA 1Y7EA 3VARA 4FWUA 2ZELA
chains in the Genus database with same CATH superfamily
4UF4A 1CJWA 5G21A 2CIJA 2CTCA 1BOBA 3PGPA 3PEIA 2X7BA 3P2HA 2FSRA 4G1PA 5LYFA 3H8FA 3NH8A 3PP9A 4IAVA 2I79A 4MY3A 4L8AA 3WC5A 3IGRA 1UWYA 1OZPA 1K4JA 3TO9A 3EXNA 3PBBA 3B3SA 2O53A 4X5KA 1LAPA 3S6HA 4NGTA 4C2XA 2HC9A 4XPDC 2HUZA 3SJXA 3TCVA 4NEXA 1F57A 2Q7SA 4AG9A 2C6GA 2AFZA 2FCKA 4FD6A 1B87A 4DJLA 1PUAA 3MN8A 4MFJA 4MCSA 4E0AA 1LCPA 4WJBA 2ZEFA 1IYLA 3SI1A 4A94A 2ZPAA 4AG7A 2H5MA 2CF4A 2C27A 3PB6X 2GREA 4C2YA 3IC1A 1CM0A 2ATRA 1YLEA 1KZFA 1Z8LA 4GS4A 1YGHA 4PSWA 1ZG8A 4CYNA 4X2TA 4KVXA 4B11A 4OC3A 4QB9A 3GUXA 1R43A 3SI0A 4B14A 5AG7A 2AFSA 4IF5A 3FYNA 2VZYA 4X8IA 2Q51A 1TIQA 2HQYA 3VH9A 1TF8A 2Z3PA 1TKFA 4KORA 5JQ4A 2DPTA 2R8VA 2QMLA 1YMEA 2OU2A 1MK4A 5GCNA 4EVYA 2Q4VA 1CPXA 2PVWA 4P45A 1KWMA 2FS5A 1EE3P 2F7VA 4R8FA 4F0XA 3RAMA 5JH9A 2B3VA 1CX8A 2AFUA 2PJ4A 2PJ8A 4I49A 4J3GA 2FVGA 1XRYA 2POKA 3RYOA 1QQ9A 3IWEA 2ZEMA 1M4IA 4R3LA 2G0BA 4P6YA 2Y0MA 4R9MA 2RC4A 5K8OA 4UFVA 1I12A 3RO0A 3IO1A 4XPKA 1Y0YA 3ISXA 5D8NA 2GLJA 4QBJA 4E2AA 1QSOA 2Z3OA 3PB8X 4OMEA 2C6CA 2BCOA 3CXSA 2DF5A 3GLJA 3B7IA 4PXEA 2PJ1A 4H6ZA 1FT7A 4M6GA 5EC4A 2OZHA 3S9MA 4JD6A 2REFA 3NE7A 5CPAA 3R9EA 1CP7A 2HV2A 1CBXA 3S6GA 1LANA 4PXDA 5G22A 3S6KA 1ZLHA 1XMTA 4ZI6A 1GHEA 2PJCA 3R9GA 4P4IA 3TC8A 1AMPA 2DPSA 1AYEA 1R57A 4FAIA 2EK9A 3PRTA 1X10A 2K5TA 4JXQA 3D7GA 5CBMA 2Q04A 4C7HA 1U6MA 3GIUA 4CGMA 4NJRA 2GU2A 3WC6A 2VI7A 4PXBA 3IU2A 5HH1A 2Q44A 2PC1A 3K2KA 2RB7A 5KTAA 2P6GA 2PIYA 5AG5A 2V8HA 4UEFA 4OAEA 1ELMP 4A38A 1TKHA 3KR4A 2GIVA 2EWBA 1YVOA 2QJ8A 2IQ6A 2OZGA 4MI4A 1BPNA 1VGYA 4MHDA 1LFWA 4U9ZA 4Q7AA 5F47A 3GKRA 4LQGA 2V77A 2QECA 4ZX9A 5H84A 1ZO0A 5LYDA 4UEZA 1YW6A 2Q4ZA 5JM6A 3B3CA 5DS0A 2ARHA 4P44A 3SJFA 4CAFA 2BUEA 1KUXA 2AFXA 3E0KA 2QYVA 4A95A 3B3TA 3V38A 2PJ3A 1S7LA 3KZWA 3A9LA 5LYLA 4HPSA 3WABA 3N5FA 4MFPA 3F5BA 4F8ZA 1Y9KA 2ZW6A 1Z9UA 1BAVA 1M4DA 1UFHA 3BLNA 2FE7A 2PSWA 3GYAA 4WWVA 2NYQA 4CGOA 1TXRA 4HNWB 4B10A 2ZEHA 3W6XA 1S5KA 5LRGA 2XEFA 4K30A 2AFMA 2GFQA 3FXTA 3ZJ0A 2VEZA 1YVKA 2D4OA 3NH4A 4KUAA 2V8GA 3JUWA 1JWQA 5F48A 3TO7A 3FIXA 4IHMA 4PV6A 3KQXA 1IOFA 4K3NA 3FECA 2PJ2A 3FF3A 4LUAA 1HDQA 4MBUA 4OC2A 1LAMA 1YQEA 4MFQA 4P4FA 4RS2A 3DR8A 7CPAA 3RNZA 5HXDA 2YNCA 4GXHA 4KVOE 4PPZA 2JDDA 2BO9A 4Y49C 3V7ZA 4OP4A 1QSTA 2PJ0A 1MJBA 5E96A 4R3KA 4FD7A 4XPDB 4H89A 4CS0B 4B5PB 5ISVA 4YU9A 3PB4X 1S7NA 2PJ9A 2EUIA 1QMUA 3LODA 2VL1A 2EK8A 3B8GA 2AFOA 5C88A 4CRZB 4B13A 1CP6A 2PE3A 3R95A 1FY7A 2YNEA 3FEDA 3CPXA 5HVFA 3K9TA 4YGOA 4ZY1A 3FEEA 2PJ7A 3QNVA 1MJ9A 1BLLE 1XFOA 1BO4A 2FXFA 4TWEA 3NA6A 1CG2A 2CNTA 3OWCA 1X12A 1XOVA 3FMCA 3H8EA 5F46A 3SJGA 4M3SA 2ZEOA 1Q7LA 2PR1A 4IUSA 3TOBA 2CNMA 3C26A 1M44A 3CDXA 1LRZA 1WWZA 4KZTA 4MFLA 1HEEA 3PFEA 4JYWA 4MY0A 2O4HA 4NGNA 4NGMA 1KUVA 1KUYA 1Y9WA 4QUSA 4ZGYB 4W9YA 2G3TA 4Z65A 4KUBA 3VWEA 4P4EA 3V8IA 2Q43A 4OKOA 4OC4A 4KOXA 1QSMA 3WC7A 2FIWA 4NGPA 2WSAA 4B6ZA 2G3AA 4Q38A 2ZW7A 2YNCC 3IWWA 4MHYA 2Q0YA 4NF1A 1VHOA 2AFWA 4MHPA 3N7ZA 4CGNA 4BD9A 3FNCA 3BJ7A 3D68A 3VWDA 2OH1A 3F8KA 3K9UA 5ELYA 1IICA 2PRQA 3MGDA 2I00A 1ZG7A 4UFXA 1YK3A 4UBRA 1S3ZA 3G3SA 3CZXA 4JJXA 4QVTA 2GANA 2VZZA 3HUVA 5K8MA 1QSNA 3FBUA 5FVJA 4AXVA 2GE3A 4KSAA 4DUKA 5AG4A 3BXMA 4ZX8A 4KLVA 1PU9A 2XEGA 2J8MA 1M4GA 3SHPA 1ON0A 3ISZA 2AJ6A 1NSAA 4R76A 1RTQA 3T9YA 4UCMA 4A31A 1Z5RA 5HVGA 5KTCA 1XBUA 2C6PA 2ZW5A 1M1DA 3QAHA 4U9YA 2I3CA 2OZUA 2YNDA 4MHZA 1Y0RA 4O23A 1TF9A 4F6AA 4PK3A 5IV0A 4ORFA 5LYIA 4R6TA 2P0WA 2WPXA 4KVME 3KQZA 4F9UA 3CPAA 3PB7X 4CAVA 4AVCA 4M6HA 1Z8TA 1FNOA 2VBQA 2ZEEA 4UA3A 3SJEA 4P4JA 2YGWA 3SI2A 3FJUA 2ZEPA 4M85A 4KSFA 4OC1A 4XNHC 5DWNA 4EFDA 3R1KA 3DR6A 3IEHA 3B3VA 4JLYA 1JQGA 4CAXA 1P4NA 4NGRA 1NSLA 3S6FA 5I4MA 3QB8A 2PCUA 4P10A 4OADA 4II9A 2ZEGA 3PZJA 4JZ0A 1Y7RA 4CAWA 4RN7A 3LD2A 4CYOA 4KOUA 5HMNA 4DNCA 3FX6A 3EY5A 5AGEA 3R9FA 2B4DB 2PDOA 1IGBA 6CPAA 1R3NA 2HB6A 1Q2YA 4CAEA 4F9VA 2Z3KA 2IMOA 4KLWA 1Z4EA 4A33A 4MFZA 5IX3A 5EBVA 3EC4A 4BINA 1A2ZA 1NE9A 3L2NA 4UIAA 3WR7A 2ZEDA 3KI9A 4KOVA 5H86A 4KOTA 2FL4A 2NSMA 1YR0A 4NCZA 3JRUA 2B58A 2Z10A 3SXNA 4B5PA 4RUHA 3TTHA 3LWUA 2Q7BA 3UY5A 1S7KA 5EMIA 1YX0A 2PIZA 3G8WA 3HLPA 1I21A 1Z2LA 1Z8XA 2P6FA 5JPHA 3I1UA 3W6SA 3NFZA 4AVAA 8CPAA 1ARMA 5C82A 2KCWA 2J9AA 1VHEA 3BI0A 3GB0A 2B4BA 3JVNA 1MJAA 3GY9A 2DEAA 1I1DA 2EVNA 1GYTA 1P0HA 1PCAA 1QSRA 1VKCA 1VIXA 1AUGA 3D7HA 4Y49B 2WUUA 4BBHA 1PYTB 4H2KA 4E8OA 1IIDA 2PR8A 3KKWA 2A4NA 4PK2A 3BI1A 4MCPA 4AVBA 2PJ5A 3BJ8A 4HKFA 3W91A 2BEIA 3IIBA 1BPMA 4YWYA 3FRMA 2Z3LA 1Q2DA 3FB3A 2R1IA 1IB1E 4IK2A 4R7MA 3B2YA 3IJ3A 2Z3MA 4LX9A 4ZBGA 1ELLP 3D8PA 4CYQA 5DWMA 4NSQA 5AG6A 3D66A 4UCNA 4KS9A 5IB0A 2WPWA 3RZAA 2B3UA 4EWTA 4A30A 2V8VA 3PBEA 4CPAA 2B5GB 3LACA 3TO6A 5BWAB 1YREA 1DTDA 4NGSA 2F8HA 3FVLA 4UCPA 1F2PA 2G9DA 2Z3NA 3NE8A 4OLLA 4ZY0A 3D2PA 3H5ZA 4MHNA 4HNYB 4P4BA 4CGPA 5LRKA 1IOIA 2V8DA 4MCRA 4UEEA 3EFAA 1OBRA 4UIBA 5F49A 2JEVA 2XEJA 3BHXA 3B3WA 4L89A 1H8LA 4ONUA 1Z8WA 2ZXVA 2QIRA 2OB0A 4EMEA 1L0CA 4KOWA 4LQ6A 3CXPA 5KTDA 2ABZA 3D7DA 3T8WA 3RBUA 5A27A 2EBJA 3SXOA 2JEWA 4MCQA 4YRHA 3D67A 2OR4A 4F0YA 1ZLIA 3I3GA 1HDUA 3KGQA 4CYPA 5K8PA 2P6EA 3WT4A 2XEIA 4CGLA 2BL1A 3KHXA 2ZENA 3CXQA 2Q4YA 4Q36A 3B35A 3TT2A 5HVHA 3JTKA 3KR5A 1J4JA 4JWPA 1XJOA 4OC0A 1B6BA 2O28A 4NGQA 1XEBA 3D3SA 3DSBA 2CTBA 3EO4A 4ONWA 5J1QA 3PFOA 1TKJA 1Q2CA 2C1CA 1RXTA 2WZNA 3DNSA 4R57A 4H6UA 1YSJA 2PRBA 2NMTA 3DLJA 4GM5A 5LRJA 3TFYA 4A32A 2QVPA 2AE6A 4OIWA 4UWJA 2IL4A 1ZG9A 5THWA 3T90A 2B4DA 3F0AA 3MRUA 1XF8A 2JBKA 3KL9A 2J8NA 2OOTA 4FD5A 4YFJA 4B5OA 5D29A 4HNXB 3KHZA 1DE4C 1IYKA 2BSWA 4XNHB 3TX8A 3VATA 3TE4A 2EO8A 2Z0ZA 4MRIA 4C2ZA 2D4PA 1LOKA 5G20A 4AB7A 1F2OA 1ARLA 5J8CA 3TOAA 1M4LA 3P2FA 5JGFA 1SQHA 1YLOA 4OC5A 2J8RA 4KOYA 2ODFA 5G1ZA 4FUUA 4PQAA 3DGVA 4C7IA 4MMOA 2ZOFA 2JBJA 2R98A 1WK4A 3H8GA 2PJAA 4NXYA 5F09A 2DXQA 4MJ8A 5A28A 2REEA 2PJBA 4MXUA 2F5IA 2CY2A 4BMHA 3S9NA 2VXKA 3H4QA 3PB9X 1YW4A 2R7HA 4FD4A 4CRYB 5I0CA 4B12A 5K8NA 4KOSA 1XMBA 1IY7A 1S60A 4R87A 4OIDA 2WYRA 1NMTA 4A2ZA 1Z4RA 3IU1A 4ZY2A 2GLFA 1RO5A 4P4DA 1N71A 1IU8A 3ZZIA 3IWGA 4DYOA 4NFRA 1XIXA 2CXAA 4MFKA 1CPSA 2CNSA 4PSXA 4M6IA 4RI1A 4X3RA 2JLMA 3R96A 4TNUA 5J8FA 4C68A 3I9SA 2FT0A 2ZOGA 2PVVA 2RFHA 1XE4A 3NH5A 3FH4A 4KSIA 4U5YA 3DDDA 5IB9A 3D4UA 4NJQA 1S7FA 2ZW4A 4A37A 2FIAA 3LMSA 4A39A 2IJZA 3IFEA 2Z11A 4ZYQA 2PJ6A 4FBEA 2PQ8A 3CT9A 3KASA 1V0CA 4QC6A 1VHSA 4PXCA 3D7FA 2VQYA 2BOAA 5CNPA 3QAYA 2ANPA 4UWIA 3S9LA 4XPLA 4JXRA 2JDCA 1Y7EA 2B5GA 4UFWA 3D2MA 4FWUA 3VARA 2ZELA
chains in the Genus database with same CATH topology
4UF4A 2CIJA 2CTCA 3PEIA 4G1PA 5LYFA 3H8FA 3NH8A 4IAVA 3WC5A 1UWYA 3PBBA 3B3SA 2O53A 1LAPA 4NGTA 2HC9A 3SJXA 1F57A 2C6GA 2AFZA 4DJLA 3MN8A 4MCSA 1LCPA 4WJBA 2ZEFA 3SI1A 4A94A 2CF4A 3PB6X 2GREA 3IC1A 1Z8LA 1ZG8A 4X2TA 4OC3A 3GUXA 1R43A 3SI0A 2AFSA 4X8IA 2Q51A 3VH9A 1TF8A 1TKFA 1YMEA 2PVWA 1CPXA 4P45A 1KWMA 1EE3P 2F7VA 4R8FA 5JH9A 3RAMA 1CX8A 2AFUA 2PJ4A 2PJ8A 2FVGA 1XRYA 2POKA 1QQ9A 2ZEMA 4P6YA 5K8OA 3IO1A 1Y0YA 3ISXA 5D8NA 2GLJA 3PB8X 4OMEA 2C6CA 2BCOA 4PXEA 3GLJA 3B7IA 2PJ1A 1FT7A 3S9MA 5CPAA 1CP7A 1CBXA 1LANA 4PXDA 1ZLHA 4ZI6A 2PJCA 4P4IA 3TC8A 1AMPA 1AYEA 4FAIA 2EK9A 3PRTA 3D7GA 5CBMA 4NJRA 2GU2A 3WC6A 4PXBA 3K2KA 2RB7A 2PIYA 2V8HA 4UEFA 1ELMP 4A38A 1TKHA 3KR4A 2EWBA 2QJ8A 2IQ6A 1BPNA 1VGYA 1LFWA 4Q7AA 4LQGA 2V77A 4ZX9A 5LYDA 4UEZA 1YW6A 2Q4ZA 5JM6A 3B3CA 5DS0A 4P44A 3SJFA 2AFXA 2QYVA 3B3TA 3V38A 2PJ3A 3KZWA 5LYLA 3WABA 3N5FA 4F8ZA 1BAVA 4WWVA 2NYQA 1TXRA 2ZEHA 5LRGA 2XEFA 2AFMA 3NH4A 2V8GA 4IHMA 3KQXA 4K3NA 3FECA 2PJ2A 3FF3A 1HDQA 4OC2A 1LAMA 4P4FA 7CPAA 5HXDA 4PPZA 2BO9A 3V7ZA 4OP4A 2PJ0A 4YU9A 3PB4X 2PJ9A 1QMUA 2VL1A 2EK8A 2AFOA 1CP6A 2PE3A 3FEDA 3CPXA 5HVFA 3K9TA 4ZY1A 3FEEA 2PJ7A 3QNVA 1BLLE 1XFOA 4TWEA 3NA6A 1CG2A 3FMCA 3H8EA 3SJGA 2ZEOA 1Q7LA 3CDXA 1HEEA 3PFEA 4JYWA 4NGNA 2O4HA 4NGMA 4W9YA 4Z65A 4P4EA 2Q43A 4OKOA 4OC4A 3WC7A 4NGPA 4B6ZA 3IWWA 4MHYA 1VHOA 2AFWA 4MHPA 4BD9A 3D68A 5ELYA 2PRQA 1ZG7A 3HUVA 5K8MA 4AXVA 4DUKA 3BXMA 4ZX8A 2XEGA 3ISZA 1NSAA 4R76A 1RTQA 5HVGA 1Z5RA 1XBUA 2C6PA 2I3CA 4MHZA 4O23A 1Y0RA 1TF9A 5LYIA 4R6TA 3KQZA 4F9UA 3CPAA 3PB7X 1FNOA 2ZEEA 3SJEA 4P4JA 3SI2A 3FJUA 2ZEPA 4OC1A 3IEHA 3B3VA 1JQGA 4NGRA 5I4MA 2PCUA 4P10A 2ZEGA 4JZ0A 3FX6A 1IGBA 6CPAA 1R3NA 2HB6A 4F9VA 2IMOA 3L2NA 4UIAA 2ZEDA 3KI9A 2NSMA 3JRUA 4RUHA 3LWUA 2PIZA 3HLPA 1Z2LA 3I1UA 3NFZA 8CPAA 1ARMA 2J9AA 1VHEA 3BI0A 3GB0A 2DEAA 3D7HA 1GYTA 1PCAA 1VIXA 4EFDA 1PYTB 4H2KA 3BI1A 4MCPA 2PJ5A 3IIBA 1BPMA 4YWYA 4IK2A 4R7MA 3B2YA 3IJ3A 1ELLP 3D66A 3RZAA 4EWTA 2V8VA 3PBEA 4CPAA 1DTDA 4NGSA 2F8HA 3FVLA 1F2PA 2G9DA 4ZY0A 4MHNA 4P4BA 5LRKA 2V8DA 4MCRA 4UEEA 1OBRA 4UIBA 2XEJA 3BHXA 3B3WA 1H8LA 4EMEA 2ABZA 3D7DA 3T8WA 3RBUA 2JEWA 4MCQA 3D67A 2OR4A 1ZLIA 1HDUA 3KGQA 5K8PA 3WT4A 2XEIA 3KHXA 2ZENA 3B35A 5HVHA 3KR5A 1XJOA 4OC0A 4NGQA 2CTBA 4ONWA 5J1QA 3PFOA 1TKJA 2C1CA 2WZNA 5LRJA 1YSJA 3DLJA 4GM5A 2QVPA 4OIWA 1ZG9A 5THWA 3MRUA 2JBKA 3KL9A 2OOTA 5D29A 3KHZA 1DE4C 3VATA 3TX8A 4MRIA 1LOKA 1F2OA 1ARLA 1M4LA 5JGFA 1YLOA 4OC5A 4FUUA 4PQAA 3DGVA 4MMOA 2ZOFA 2JBJA 3H8GA 2PJAA 5F09A 2PJBA 4MXUA 3S9NA 3PB9X 1YW4A 5K8NA 1XMBA 1IY7A 4OIDA 2WYRA 4ZY2A 2GLFA 4P4DA 4DYOA 4NFRA 1CPSA 4X3RA 4TNUA 2ZOGA 2PVVA 2RFHA 3NH5A 3FH4A 4KSIA 5IB9A 3D4UA 4NJQA 4A37A 3LMSA 4A39A 2IJZA 3IFEA 4ZYQA 2PJ6A 4FBEA 3CT9A 3KASA 4PXCA 3D7FA 2BOAA 2ANPA 3S9LA 1Y7EA 3VARA 4FWUA 2ZELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UF4 A;  2CIJ A;  2CTC A;  3PEI A;  4G1P A;  5LYF A;  3H8F A;  3NH8 A;  4IAV A;  3WC5 A;  1UWY A;  3PBB A;  3B3S A;  2O53 A;  1LAP A;  4NGT A;  2HC9 A;  3SJX A;  1F57 A;  2C6G A;  2AFZ A;  4DJL A;  3MN8 A;  4MCS A;  1LCP A;  4WJB A;  2ZEF A;  3SI1 A;  4A94 A;  2CF4 A;  3PB6 X;  2GRE A;  3IC1 A;  1Z8L A;  1ZG8 A;  4X2T A;  4OC3 A;  3GUX A;  1R43 A;  3SI0 A;  2AFS A;  4X8I A;  2Q51 A;  3VH9 A;  1TF8 A;  1TKF A;  1YME A;  2PVW A;  1CPX A;  4P45 A;  1KWM A;  1EE3 P;  2F7V A;  4R8F A;  5JH9 A;  3RAM A;  1CX8 A;  2AFU A;  2PJ4 A;  2PJ8 A;  2FVG A;  1XRY A;  2POK A;  1QQ9 A;  2ZEM A;  4P6Y A;  5K8O A;  3IO1 A;  1Y0Y A;  3ISX A;  5D8N A;  2GLJ A;  3PB8 X;  4OME A;  2C6C A;  2BCO A;  4PXE A;  3GLJ A;  3B7I A;  2PJ1 A;  1FT7 A;  3S9M A;  5CPA A;  1CP7 A;  1CBX A;  1LAN A;  4PXD A;  1ZLH A;  4ZI6 A;  2PJC A;  4P4I A;  3TC8 A;  1AMP A;  1AYE A;  4FAI A;  2EK9 A;  3PRT A;  3D7G A;  5CBM A;  4NJR A;  2GU2 A;  3WC6 A;  4PXB A;  3K2K A;  2RB7 A;  2PIY A;  2V8H A;  4UEF A;  1ELM P;  4A38 A;  1TKH A;  3KR4 A;  2EWB A;  2QJ8 A;  2IQ6 A;  1BPN A;  1VGY A;  1LFW A;  4Q7A A;  4LQG A;  2V77 A;  4ZX9 A;  5LYD A;  4UEZ A;  1YW6 A;  2Q4Z A;  5JM6 A;  3B3C A;  5DS0 A;  4P44 A;  3SJF A;  2AFX A;  2QYV A;  3B3T A;  3V38 A;  2PJ3 A;  3KZW A;  5LYL A;  3WAB A;  3N5F A;  4F8Z A;  1BAV A;  4WWV A;  2NYQ A;  1TXR A;  2ZEH A;  5LRG A;  2XEF A;  2AFM A;  3NH4 A;  2V8G A;  4IHM A;  3KQX A;  4K3N A;  3FEC A;  2PJ2 A;  3FF3 A;  1HDQ A;  4OC2 A;  1LAM A;  4P4F A;  7CPA A;  5HXD A;  4PPZ A;  2BO9 A;  3V7Z A;  4OP4 A;  2PJ0 A;  4YU9 A;  3PB4 X;  2PJ9 A;  1QMU A;  2VL1 A;  2EK8 A;  2AFO A;  1CP6 A;  2PE3 A;  3FED A;  3CPX A;  5HVF A;  3K9T A;  4ZY1 A;  3FEE A;  2PJ7 A;  3QNV A;  1BLL E;  1XFO A;  4TWE A;  3NA6 A;  1CG2 A;  3FMC A;  3H8E A;  3SJG A;  2ZEO A;  1Q7L A;  3CDX A;  1HEE A;  3PFE A;  4JYW A;  4NGN A;  2O4H A;  4NGM A;  4W9Y A;  4Z65 A;  4P4E A;  2Q43 A;  4OKO A;  4OC4 A;  3WC7 A;  4NGP A;  4B6Z A;  3IWW A;  4MHY A;  1VHO A;  2AFW A;  4MHP A;  4BD9 A;  3D68 A;  5ELY A;  2PRQ A;  1ZG7 A;  3HUV A;  5K8M A;  4AXV A;  4DUK A;  3BXM A;  4ZX8 A;  2XEG A;  3ISZ A;  1NSA A;  4R76 A;  1RTQ A;  5HVG A;  1Z5R A;  1XBU A;  2C6P A;  2I3C A;  4MHZ A;  4O23 A;  1Y0R A;  1TF9 A;  5LYI A;  4R6T A;  3KQZ A;  4F9U A;  3CPA A;  3PB7 X;  1FNO A;  2ZEE A;  3SJE A;  4P4J A;  3SI2 A;  3FJU A;  2ZEP A;  4OC1 A;  3IEH A;  3B3V A;  1JQG A;  4NGR A;  5I4M A;  2PCU A;  4P10 A;  2ZEG A;  4JZ0 A;  3FX6 A;  1IGB A;  6CPA A;  1R3N A;  2HB6 A;  4F9V A;  2IMO A;  3L2N A;  4UIA A;  2ZED A;  3KI9 A;  2NSM A;  3JRU A;  4RUH A;  3LWU A;  2PIZ A;  3HLP A;  1Z2L A;  3I1U A;  3NFZ A;  8CPA A;  1ARM A;  2J9A A;  1VHE A;  3BI0 A;  3GB0 A;  2DEA A;  3D7H A;  1GYT A;  1PCA A;  1VIX A;  4EFD A;  1PYT B;  4H2K A;  3BI1 A;  4MCP A;  2PJ5 A;  3IIB A;  1BPM A;  4YWY A;  4IK2 A;  4R7M A;  3B2Y A;  3IJ3 A;  1ELL P;  3D66 A;  3RZA A;  4EWT A;  2V8V A;  3PBE A;  4CPA A;  1DTD A;  4NGS A;  2F8H A;  3FVL A;  1F2P A;  2G9D A;  4ZY0 A;  4MHN A;  4P4B A;  5LRK A;  2V8D A;  4MCR A;  4UEE A;  1OBR A;  4UIB A;  2XEJ A;  3BHX A;  3B3W A;  1H8L A;  4EME A;  2ABZ A;  3D7D A;  3T8W A;  3RBU A;  2JEW A;  4MCQ A;  3D67 A;  2OR4 A;  1ZLI A;  1HDU A;  3KGQ A;  5K8P A;  3WT4 A;  2XEI A;  3KHX A;  2ZEN A;  3B35 A;  5HVH A;  3KR5 A;  1XJO A;  4OC0 A;  4NGQ A;  2CTB A;  4ONW A;  5J1Q A;  3PFO A;  1TKJ A;  2C1C A;  2WZN A;  5LRJ A;  1YSJ A;  3DLJ A;  4GM5 A;  2QVP A;  4OIW A;  1ZG9 A;  5THW A;  3MRU A;  2JBK A;  3KL9 A;  2OOT A;  5D29 A;  3KHZ A;  1DE4 C;  3VAT A;  3TX8 A;  4MRI A;  1LOK A;  1F2O A;  1ARL A;  1M4L A;  5JGF A;  1YLO A;  4OC5 A;  4FUU A;  4PQA A;  3DGV A;  4MMO A;  2ZOF A;  2JBJ A;  3H8G A;  2PJA A;  5F09 A;  2PJB A;  4MXU A;  3S9N A;  3PB9 X;  1YW4 A;  5K8N A;  1XMB A;  1IY7 A;  4OID A;  2WYR A;  4ZY2 A;  2GLF A;  4P4D A;  4DYO A;  4NFR A;  1CPS A;  4X3R A;  4TNU A;  2ZOG A;  2PVV A;  2RFH A;  3NH5 A;  3FH4 A;  4KSI A;  5IB9 A;  3D4U A;  4NJQ A;  4A37 A;  3LMS A;  4A39 A;  2IJZ A;  3IFE A;  4ZYQ A;  2PJ6 A;  4FBE A;  3CT9 A;  3KAS A;  4PXC A;  3D7F A;  2BOA A;  2ANP A;  3S9L A;  1Y7E A;  3VAR A;  4FWU A;  2ZEL A; 
#chains in the Genus database with same CATH topology
 4UF4 A;  1CJW A;  5G21 A;  2CIJ A;  2CTC A;  1BOB A;  3PGP A;  3PEI A;  2X7B A;  3P2H A;  2FSR A;  4G1P A;  5LYF A;  3H8F A;  3NH8 A;  3PP9 A;  4IAV A;  2I79 A;  4MY3 A;  4L8A A;  3WC5 A;  3IGR A;  1UWY A;  1OZP A;  1K4J A;  3TO9 A;  3EXN A;  3PBB A;  3B3S A;  2O53 A;  4X5K A;  1LAP A;  3S6H A;  4NGT A;  4C2X A;  2HC9 A;  4XPD C;  2HUZ A;  3SJX A;  3TCV A;  4NEX A;  1F57 A;  2Q7S A;  4AG9 A;  2C6G A;  2AFZ A;  2FCK A;  4FD6 A;  1B87 A;  4DJL A;  1PUA A;  3MN8 A;  4MFJ A;  4MCS A;  4E0A A;  1LCP A;  4WJB A;  2ZEF A;  1IYL A;  3SI1 A;  4A94 A;  2ZPA A;  4AG7 A;  2H5M A;  2CF4 A;  2C27 A;  3PB6 X;  2GRE A;  4C2Y A;  3IC1 A;  1CM0 A;  2ATR A;  1YLE A;  1KZF A;  1Z8L A;  4GS4 A;  1YGH A;  4PSW A;  1ZG8 A;  4CYN A;  4X2T A;  4KVX A;  4B11 A;  4OC3 A;  4QB9 A;  3GUX A;  1R43 A;  3SI0 A;  4B14 A;  5AG7 A;  2AFS A;  4IF5 A;  3FYN A;  2VZY A;  4X8I A;  2Q51 A;  1TIQ A;  2HQY A;  3VH9 A;  1TF8 A;  2Z3P A;  1TKF A;  4KOR A;  5JQ4 A;  2DPT A;  2R8V A;  2QML A;  1YME A;  2OU2 A;  1MK4 A;  5GCN A;  4EVY A;  2Q4V A;  1CPX A;  2PVW A;  4P45 A;  1KWM A;  2FS5 A;  1EE3 P;  2F7V A;  4R8F A;  4F0X A;  3RAM A;  5JH9 A;  2B3V A;  1CX8 A;  2AFU A;  2PJ4 A;  2PJ8 A;  4I49 A;  4J3G A;  2FVG A;  1XRY A;  2POK A;  3RYO A;  1QQ9 A;  3IWE A;  2ZEM A;  1M4I A;  4R3L A;  2G0B A;  4P6Y A;  2Y0M A;  4R9M A;  2RC4 A;  5K8O A;  4UFV A;  1I12 A;  3RO0 A;  3IO1 A;  4XPK A;  1Y0Y A;  3ISX A;  5D8N A;  2GLJ A;  4QBJ A;  4E2A A;  1QSO A;  2Z3O A;  3PB8 X;  4OME A;  2C6C A;  2BCO A;  3CXS A;  2DF5 A;  3GLJ A;  3B7I A;  4PXE A;  2PJ1 A;  4H6Z A;  1FT7 A;  4M6G A;  5EC4 A;  2OZH A;  3S9M A;  4JD6 A;  2REF A;  3NE7 A;  5CPA A;  3R9E A;  1CP7 A;  2HV2 A;  1CBX A;  3S6G A;  1LAN A;  4PXD A;  5G22 A;  3S6K A;  1ZLH A;  1XMT A;  4ZI6 A;  1GHE A;  2PJC A;  3R9G A;  4P4I A;  3TC8 A;  1AMP A;  2DPS A;  1AYE A;  1R57 A;  4FAI A;  2EK9 A;  3PRT A;  1X10 A;  2K5T A;  4JXQ A;  3D7G A;  5CBM A;  2Q04 A;  4C7H A;  1U6M A;  3GIU A;  4CGM A;  4NJR A;  2GU2 A;  3WC6 A;  2VI7 A;  4PXB A;  3IU2 A;  5HH1 A;  2Q44 A;  2PC1 A;  3K2K A;  2RB7 A;  5KTA A;  2P6G A;  2PIY A;  5AG5 A;  2V8H A;  4UEF A;  4OAE A;  1ELM P;  4A38 A;  1TKH A;  3KR4 A;  2GIV A;  2EWB A;  1YVO A;  2QJ8 A;  2IQ6 A;  2OZG A;  4MI4 A;  1BPN A;  1VGY A;  4MHD A;  1LFW A;  4U9Z A;  4Q7A A;  5F47 A;  3GKR A;  4LQG A;  2V77 A;  2QEC A;  4ZX9 A;  5H84 A;  1ZO0 A;  5LYD A;  4UEZ A;  1YW6 A;  2Q4Z A;  5JM6 A;  3B3C A;  5DS0 A;  2ARH A;  4P44 A;  3SJF A;  4CAF A;  2BUE A;  1KUX A;  2AFX A;  3E0K A;  2QYV A;  4A95 A;  3B3T A;  3V38 A;  2PJ3 A;  1S7L A;  3KZW A;  3A9L A;  5LYL A;  4HPS A;  3WAB A;  3N5F A;  4MFP A;  3F5B A;  4F8Z A;  1Y9K A;  2ZW6 A;  1Z9U A;  1BAV A;  1M4D A;  1UFH A;  3BLN A;  2FE7 A;  2PSW A;  3GYA A;  4WWV A;  2NYQ A;  4CGO A;  1TXR A;  4HNW B;  4B10 A;  2ZEH A;  3W6X A;  1S5K A;  5LRG A;  2XEF A;  4K30 A;  2AFM A;  2GFQ A;  3FXT A;  3ZJ0 A;  2VEZ A;  1YVK A;  2D4O A;  3NH4 A;  4KUA A;  2V8G A;  3JUW A;  1JWQ A;  5F48 A;  3TO7 A;  3FIX A;  4IHM A;  4PV6 A;  3KQX A;  1IOF A;  4K3N A;  3FEC A;  2PJ2 A;  3FF3 A;  4LUA A;  1HDQ A;  4MBU A;  4OC2 A;  1LAM A;  1YQE A;  4MFQ A;  4P4F A;  4RS2 A;  3DR8 A;  7CPA A;  3RNZ A;  5HXD A;  2YNC A;  4GXH A;  4KVO E;  4PPZ A;  2JDD A;  2BO9 A;  4Y49 C;  3V7Z A;  4OP4 A;  1QST A;  2PJ0 A;  1MJB A;  5E96 A;  4R3K A;  4FD7 A;  4XPD B;  4H89 A;  4CS0 B;  4B5P B;  5ISV A;  4YU9 A;  3PB4 X;  1S7N A;  2PJ9 A;  2EUI A;  1QMU A;  3LOD A;  2VL1 A;  2EK8 A;  3B8G A;  2AFO A;  5C88 A;  4CRZ B;  4B13 A;  1CP6 A;  2PE3 A;  3R95 A;  1FY7 A;  2YNE A;  3FED A;  3CPX A;  5HVF A;  3K9T A;  4YGO A;  4ZY1 A;  3FEE A;  2PJ7 A;  3QNV A;  1MJ9 A;  1BLL E;  1XFO A;  1BO4 A;  2FXF A;  4TWE A;  3NA6 A;  1CG2 A;  2CNT A;  3OWC A;  1X12 A;  1XOV A;  3FMC A;  3H8E A;  5F46 A;  3SJG A;  4M3S A;  2ZEO A;  1Q7L A;  2PR1 A;  4IUS A;  3TOB A;  2CNM A;  3C26 A;  1M44 A;  3CDX A;  1LRZ A;  1WWZ A;  4KZT A;  4MFL A;  1HEE A;  3PFE A;  4JYW A;  4MY0 A;  2O4H A;  4NGN A;  4NGM A;  1KUV A;  1KUY A;  1Y9W A;  4QUS A;  4ZGY B;  4W9Y A;  2G3T A;  4Z65 A;  4KUB A;  3VWE A;  4P4E A;  3V8I A;  2Q43 A;  4OKO A;  4OC4 A;  4KOX A;  1QSM A;  3WC7 A;  2FIW A;  4NGP A;  2WSA A;  4B6Z A;  2G3A A;  4Q38 A;  2ZW7 A;  2YNC C;  3IWW A;  4MHY A;  2Q0Y A;  4NF1 A;  1VHO A;  2AFW A;  4MHP A;  3N7Z A;  4CGN A;  4BD9 A;  3FNC A;  3BJ7 A;  3D68 A;  3VWD A;  2OH1 A;  3F8K A;  3K9U A;  5ELY A;  1IIC A;  2PRQ A;  3MGD A;  2I00 A;  1ZG7 A;  4UFX A;  1YK3 A;  4UBR A;  1S3Z A;  3G3S A;  3CZX A;  4JJX A;  4QVT A;  2GAN A;  2VZZ A;  3HUV A;  5K8M A;  1QSN A;  3FBU A;  5FVJ A;  4AXV A;  2GE3 A;  4KSA A;  4DUK A;  5AG4 A;  3BXM A;  4ZX8 A;  4KLV A;  1PU9 A;  2XEG A;  2J8M A;  1M4G A;  3SHP A;  1ON0 A;  3ISZ A;  2AJ6 A;  1NSA A;  4R76 A;  1RTQ A;  3T9Y A;  4UCM A;  4A31 A;  1Z5R A;  5HVG A;  5KTC A;  1XBU A;  2C6P A;  2ZW5 A;  1M1D A;  3QAH A;  4U9Y A;  2I3C A;  2OZU A;  2YND A;  4MHZ A;  1Y0R A;  4O23 A;  1TF9 A;  4F6A A;  4PK3 A;  5IV0 A;  4ORF A;  5LYI A;  4R6T A;  2P0W A;  2WPX A;  4KVM E;  3KQZ A;  4F9U A;  3CPA A;  3PB7 X;  4CAV A;  4AVC A;  4M6H A;  1Z8T A;  1FNO A;  2VBQ A;  2ZEE A;  4UA3 A;  3SJE A;  4P4J A;  2YGW A;  3SI2 A;  3FJU A;  2ZEP A;  4M85 A;  4KSF A;  4OC1 A;  4XNH C;  5DWN A;  4EFD A;  3R1K A;  3DR6 A;  3IEH A;  3B3V A;  4JLY A;  1JQG A;  4CAX A;  1P4N A;  4NGR A;  1NSL A;  3S6F A;  5I4M A;  3QB8 A;  2PCU A;  4P10 A;  4OAD A;  4II9 A;  2ZEG A;  3PZJ A;  4JZ0 A;  1Y7R A;  4CAW A;  4RN7 A;  3LD2 A;  4CYO A;  4KOU A;  5HMN A;  4DNC A;  3FX6 A;  3EY5 A;  5AGE A;  3R9F A;  2B4D B;  2PDO A;  1IGB A;  6CPA A;  1R3N A;  2HB6 A;  1Q2Y A;  4CAE A;  4F9V A;  2Z3K A;  2IMO A;  4KLW A;  1Z4E A;  4A33 A;  4MFZ A;  5IX3 A;  5EBV A;  3EC4 A;  4BIN A;  1A2Z A;  1NE9 A;  3L2N A;  4UIA A;  3WR7 A;  2ZED A;  3KI9 A;  4KOV A;  5H86 A;  4KOT A;  2FL4 A;  2NSM A;  1YR0 A;  4NCZ A;  3JRU A;  2B58 A;  2Z10 A;  3SXN A;  4B5P A;  4RUH A;  3TTH A;  3LWU A;  2Q7B A;  3UY5 A;  1S7K A;  5EMI A;  1YX0 A;  2PIZ A;  3G8W A;  3HLP A;  1I21 A;  1Z2L A;  1Z8X A;  2P6F A;  5JPH A;  3I1U A;  3W6S A;  3NFZ A;  4AVA A;  8CPA A;  1ARM A;  5C82 A;  2KCW A;  2J9A A;  1VHE A;  3BI0 A;  3GB0 A;  2B4B A;  3JVN A;  1MJA A;  3GY9 A;  2DEA A;  1I1D A;  2EVN A;  1GYT A;  1P0H A;  1PCA A;  1QSR A;  1VKC A;  1VIX A;  1AUG A;  3D7H A;  4Y49 B;  2WUU A;  4BBH A;  1PYT B;  4H2K A;  4E8O A;  1IID A;  2PR8 A;  3KKW A;  2A4N A;  4PK2 A;  3BI1 A;  4MCP A;  4AVB A;  2PJ5 A;  3BJ8 A;  4HKF A;  3W91 A;  2BEI A;  3IIB A;  1BPM A;  4YWY A;  3FRM A;  2Z3L A;  1Q2D A;  3FB3 A;  2R1I A;  1IB1 E;  4IK2 A;  4R7M A;  3B2Y A;  3IJ3 A;  2Z3M A;  4LX9 A;  4ZBG A;  1ELL P;  3D8P A;  4CYQ A;  5DWM A;  4NSQ A;  5AG6 A;  3D66 A;  4UCN A;  4KS9 A;  5IB0 A;  2WPW A;  3RZA A;  2B3U A;  4EWT A;  4A30 A;  2V8V A;  3PBE A;  4CPA A;  2B5G B;  3LAC A;  3TO6 A;  5BWA B;  1YRE A;  1DTD A;  4NGS A;  2F8H A;  3FVL A;  4UCP A;  1F2P A;  2G9D A;  2Z3N A;  3NE8 A;  4OLL A;  4ZY0 A;  3D2P A;  3H5Z A;  4MHN A;  4HNY B;  4P4B A;  4CGP A;  5LRK A;  1IOI A;  2V8D A;  4MCR A;  4UEE A;  3EFA A;  1OBR A;  4UIB A;  5F49 A;  2JEV A;  2XEJ A;  3BHX A;  3B3W A;  4L89 A;  1H8L A;  4ONU A;  1Z8W A;  2ZXV A;  2QIR A;  2OB0 A;  4EME A;  1L0C A;  4KOW A;  4LQ6 A;  3CXP A;  5KTD A;  2ABZ A;  3D7D A;  3T8W A;  3RBU A;  5A27 A;  2EBJ A;  3SXO A;  2JEW A;  4MCQ A;  4YRH A;  3D67 A;  2OR4 A;  4F0Y A;  1ZLI A;  3I3G A;  1HDU A;  3KGQ A;  4CYP A;  5K8P A;  2P6E A;  3WT4 A;  2XEI A;  4CGL A;  2BL1 A;  3KHX A;  2ZEN A;  3CXQ A;  2Q4Y A;  4Q36 A;  3B35 A;  3TT2 A;  5HVH A;  3JTK A;  3KR5 A;  1J4J A;  4JWP A;  1XJO A;  4OC0 A;  1B6B A;  2O28 A;  4NGQ A;  1XEB A;  3D3S A;  3DSB A;  2CTB A;  3EO4 A;  4ONW A;  5J1Q A;  3PFO A;  1TKJ A;  1Q2C A;  2C1C A;  1RXT A;  2WZN A;  3DNS A;  4R57 A;  4H6U A;  1YSJ A;  2PRB A;  2NMT A;  3DLJ A;  4GM5 A;  5LRJ A;  3TFY A;  4A32 A;  2QVP A;  2AE6 A;  4OIW A;  4UWJ A;  2IL4 A;  1ZG9 A;  5THW A;  3T90 A;  2B4D A;  3F0A A;  3MRU A;  1XF8 A;  2JBK A;  3KL9 A;  2J8N A;  2OOT A;  4FD5 A;  4YFJ A;  4B5O A;  5D29 A;  4HNX B;  3KHZ A;  1DE4 C;  1IYK A;  2BSW A;  4XNH B;  3TX8 A;  3VAT A;  3TE4 A;  2EO8 A;  2Z0Z A;  4MRI A;  4C2Z A;  2D4P A;  1LOK A;  5G20 A;  4AB7 A;  1F2O A;  1ARL A;  5J8C A;  3TOA A;  1M4L A;  3P2F A;  5JGF A;  1SQH A;  1YLO A;  4OC5 A;  2J8R A;  4KOY A;  2ODF A;  5G1Z A;  4FUU A;  4PQA A;  3DGV A;  4C7I A;  4MMO A;  2ZOF A;  2JBJ A;  2R98 A;  1WK4 A;  3H8G A;  2PJA A;  4NXY A;  5F09 A;  2DXQ A;  4MJ8 A;  5A28 A;  2REE A;  2PJB A;  4MXU A;  2F5I A;  2CY2 A;  4BMH A;  3S9N A;  2VXK A;  3H4Q A;  3PB9 X;  1YW4 A;  2R7H A;  4FD4 A;  4CRY B;  5I0C A;  4B12 A;  5K8N A;  4KOS A;  1XMB A;  1IY7 A;  1S60 A;  4R87 A;  4OID A;  2WYR A;  1NMT A;  4A2Z A;  1Z4R A;  3IU1 A;  4ZY2 A;  2GLF A;  1RO5 A;  4P4D A;  1N71 A;  1IU8 A;  3ZZI A;  3IWG A;  4DYO A;  4NFR A;  1XIX A;  2CXA A;  4MFK A;  1CPS A;  2CNS A;  4PSX A;  4M6I A;  4RI1 A;  4X3R A;  2JLM A;  3R96 A;  4TNU A;  5J8F A;  4C68 A;  3I9S A;  2FT0 A;  2ZOG A;  2PVV A;  2RFH A;  1XE4 A;  3NH5 A;  3FH4 A;  4KSI A;  4U5Y A;  3DDD A;  5IB9 A;  3D4U A;  4NJQ A;  1S7F A;  2ZW4 A;  4A37 A;  2FIA A;  3LMS A;  4A39 A;  2IJZ A;  3IFE A;  2Z11 A;  4ZYQ A;  2PJ6 A;  4FBE A;  2PQ8 A;  3CT9 A;  3KAS A;  1V0C A;  4QC6 A;  1VHS A;  4PXC A;  3D7F A;  2VQY A;  2BOA A;  5CNP A;  3QAY A;  2ANP A;  4UWI A;  3S9L A;  4XPL A;  4JXR A;  2JDC A;  1Y7E A;  2B5G A;  4UFW A;  3D2M A;  4FWU A;  3VAR A;  2ZEL A; 
#chains in the Genus database with same CATH homology
 4UF4 A;  2CIJ A;  2CTC A;  3PEI A;  4G1P A;  5LYF A;  3H8F A;  3NH8 A;  4IAV A;  3WC5 A;  1UWY A;  3PBB A;  3B3S A;  2O53 A;  1LAP A;  4NGT A;  2HC9 A;  3SJX A;  1F57 A;  2C6G A;  2AFZ A;  4DJL A;  3MN8 A;  4MCS A;  1LCP A;  4WJB A;  2ZEF A;  3SI1 A;  4A94 A;  2CF4 A;  3PB6 X;  2GRE A;  3IC1 A;  1Z8L A;  1ZG8 A;  4X2T A;  4OC3 A;  3GUX A;  1R43 A;  3SI0 A;  2AFS A;  4X8I A;  2Q51 A;  3VH9 A;  1TF8 A;  1TKF A;  1YME A;  2PVW A;  1CPX A;  4P45 A;  1KWM A;  1EE3 P;  2F7V A;  4R8F A;  5JH9 A;  3RAM A;  1CX8 A;  2AFU A;  2PJ4 A;  2PJ8 A;  2FVG A;  1XRY A;  2POK A;  1QQ9 A;  2ZEM A;  4P6Y A;  5K8O A;  3IO1 A;  1Y0Y A;  3ISX A;  5D8N A;  2GLJ A;  3PB8 X;  4OME A;  2C6C A;  2BCO A;  4PXE A;  3GLJ A;  3B7I A;  2PJ1 A;  1FT7 A;  3S9M A;  5CPA A;  1CP7 A;  1CBX A;  1LAN A;  4PXD A;  1ZLH A;  4ZI6 A;  2PJC A;  4P4I A;  3TC8 A;  1AMP A;  1AYE A;  4FAI A;  2EK9 A;  3PRT A;  3D7G A;  5CBM A;  4NJR A;  2GU2 A;  3WC6 A;  4PXB A;  3K2K A;  2RB7 A;  2PIY A;  2V8H A;  4UEF A;  1ELM P;  4A38 A;  1TKH A;  3KR4 A;  2EWB A;  2QJ8 A;  2IQ6 A;  1BPN A;  1VGY A;  1LFW A;  4Q7A A;  4LQG A;  2V77 A;  4ZX9 A;  5LYD A;  4UEZ A;  1YW6 A;  2Q4Z A;  5JM6 A;  3B3C A;  5DS0 A;  4P44 A;  3SJF A;  2AFX A;  2QYV A;  3B3T A;  3V38 A;  2PJ3 A;  3KZW A;  5LYL A;  3WAB A;  3N5F A;  4F8Z A;  1BAV A;  4WWV A;  2NYQ A;  1TXR A;  2ZEH A;  5LRG A;  2XEF A;  2AFM A;  3NH4 A;  2V8G A;  4IHM A;  3KQX A;  4K3N A;  3FEC A;  2PJ2 A;  3FF3 A;  1HDQ A;  4OC2 A;  1LAM A;  4P4F A;  7CPA A;  5HXD A;  4PPZ A;  2BO9 A;  3V7Z A;  4OP4 A;  2PJ0 A;  4YU9 A;  3PB4 X;  2PJ9 A;  1QMU A;  2VL1 A;  2EK8 A;  2AFO A;  1CP6 A;  2PE3 A;  3FED A;  3CPX A;  5HVF A;  3K9T A;  4ZY1 A;  3FEE A;  2PJ7 A;  3QNV A;  1BLL E;  1XFO A;  4TWE A;  3NA6 A;  1CG2 A;  3FMC A;  3H8E A;  3SJG A;  2ZEO A;  1Q7L A;  3CDX A;  1HEE A;  3PFE A;  4JYW A;  4NGN A;  2O4H A;  4NGM A;  4W9Y A;  4Z65 A;  4P4E A;  2Q43 A;  4OKO A;  4OC4 A;  3WC7 A;  4NGP A;  4B6Z A;  3IWW A;  4MHY A;  1VHO A;  2AFW A;  4MHP A;  4BD9 A;  3D68 A;  5ELY A;  2PRQ A;  1ZG7 A;  3HUV A;  5K8M A;  4AXV A;  4DUK A;  3BXM A;  4ZX8 A;  2XEG A;  3ISZ A;  1NSA A;  4R76 A;  1RTQ A;  5HVG A;  1Z5R A;  1XBU A;  2C6P A;  2I3C A;  4MHZ A;  4O23 A;  1Y0R A;  1TF9 A;  5LYI A;  4R6T A;  3KQZ A;  4F9U A;  3CPA A;  3PB7 X;  1FNO A;  2ZEE A;  3SJE A;  4P4J A;  3SI2 A;  3FJU A;  2ZEP A;  4OC1 A;  3IEH A;  3B3V A;  1JQG A;  4NGR A;  5I4M A;  2PCU A;  4P10 A;  2ZEG A;  4JZ0 A;  3FX6 A;  1IGB A;  6CPA A;  1R3N A;  2HB6 A;  4F9V A;  2IMO A;  3L2N A;  4UIA A;  2ZED A;  3KI9 A;  2NSM A;  3JRU A;  4RUH A;  3LWU A;  2PIZ A;  3HLP A;  1Z2L A;  3I1U A;  3NFZ A;  8CPA A;  1ARM A;  2J9A A;  1VHE A;  3BI0 A;  3GB0 A;  2DEA A;  3D7H A;  1GYT A;  1PCA A;  1VIX A;  4EFD A;  1PYT B;  4H2K A;  3BI1 A;  4MCP A;  2PJ5 A;  3IIB A;  1BPM A;  4YWY A;  4IK2 A;  4R7M A;  3B2Y A;  3IJ3 A;  1ELL P;  3D66 A;  3RZA A;  4EWT A;  2V8V A;  3PBE A;  4CPA A;  1DTD A;  4NGS A;  2F8H A;  3FVL A;  1F2P A;  2G9D A;  4ZY0 A;  4MHN A;  4P4B A;  5LRK A;  2V8D A;  4MCR A;  4UEE A;  1OBR A;  4UIB A;  2XEJ A;  3BHX A;  3B3W A;  1H8L A;  4EME A;  2ABZ A;  3D7D A;  3T8W A;  3RBU A;  2JEW A;  4MCQ A;  3D67 A;  2OR4 A;  1ZLI A;  1HDU A;  3KGQ A;  5K8P A;  3WT4 A;  2XEI A;  3KHX A;  2ZEN A;  3B35 A;  5HVH A;  3KR5 A;  1XJO A;  4OC0 A;  4NGQ A;  2CTB A;  4ONW A;  5J1Q A;  3PFO A;  1TKJ A;  2C1C A;  2WZN A;  5LRJ A;  1YSJ A;  3DLJ A;  4GM5 A;  2QVP A;  4OIW A;  1ZG9 A;  5THW A;  3MRU A;  2JBK A;  3KL9 A;  2OOT A;  5D29 A;  3KHZ A;  1DE4 C;  3VAT A;  3TX8 A;  4MRI A;  1LOK A;  1F2O A;  1ARL A;  1M4L A;  5JGF A;  1YLO A;  4OC5 A;  4FUU A;  4PQA A;  3DGV A;  4MMO A;  2ZOF A;  2JBJ A;  3H8G A;  2PJA A;  5F09 A;  2PJB A;  4MXU A;  3S9N A;  3PB9 X;  1YW4 A;  5K8N A;  1XMB A;  1IY7 A;  4OID A;  2WYR A;  4ZY2 A;  2GLF A;  4P4D A;  4DYO A;  4NFR A;  1CPS A;  4X3R A;  4TNU A;  2ZOG A;  2PVV A;  2RFH A;  3NH5 A;  3FH4 A;  4KSI A;  5IB9 A;  3D4U A;  4NJQ A;  4A37 A;  3LMS A;  4A39 A;  2IJZ A;  3IFE A;  4ZYQ A;  2PJ6 A;  4FBE A;  3CT9 A;  3KAS A;  4PXC A;  3D7F A;  2BOA A;  2ANP A;  3S9L A;  1Y7E A;  3VAR A;  4FWU A;  2ZEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...