1XRYA

Crystal structure of aeromonas proteolytica aminopeptidase in complex with bestatin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Interactions of Streptomyces griseus Aminopeptidase and Aeromonas proteolytica Aminopeptidase with Bestatin. Structural analysis of homologous enzymes with different binding modes.
rcsb
molecule tags Hydrolase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xryA00
1IY7A 5LYLA 3FJUA 1TF8A 3FX6A 1ZG7A 2PJAA 3KL9A 4IHMA 2AFWA 2PJ7A 3H8GA 4MHYA 4OC5A 3WC7A 4P4DA 1M4LA 4FWUA 2PJ4A 4JZ0A 5K8PA 2EK8A 2ZEPA 5D8NA 3NFZA 4BD9A 1YSJA 2XEIA 1QQ9A 2PJCA 4AXVA 3KGQA 4ZY0A 1LAPA 1TXRA 2PJ3A 3B3CA 2QJ8A 3D7DA 1YW6A 1ARMA 5ELYA 4EFDA 5JH9A 4ONWA 2V8HA 4MCRA 2ZEEA 2IQ6A 3CPXA 3ISZA 4UEZA 2BOAA 3PB4X 4P10A 2V8DA 3IEHA 2ZELA 4EMEA 3NH4A 2V8VA 3NH8A 5JM6A 3DGVA 3CPAA 3V7ZA 3DLJA 5HXDA 1XBUA 1TKJA 2GREA 4FAIA 3IFEA 2JBJA 1LAMA 3D4UA 2ZOGA 3B35A 4GM5A 3S9LA 3KASA 3GLJA 3S9NA 1VGYA 2POKA 1XMBA 4OC2A 4PXCA 4X2TA 4NGNA 2PE3A 5CPAA 4R76A 2OR4A 3D68A 1R3NA 4PXDA 4NGTA 3FMCA 4OP4A 3RBUA 3IWWA 3SI1A 4P4JA 2GU2A 4OC4A 1ELMP 4DJLA 4OMEA 2ZEOA 2PJ1A 3VARA 3D66A 1AYEA 4A94A 3PBBA 4F9VA 2I3CA 3D67A 1Z8LA 5DS0A 3N5FA 3PB7X 4ZYQA 1AMPA 4KSIA 4A38A 4MCSA 2XEGA 1JQGA 4OIWA 5LRGA 3PB6X 3SJGA 3V38A 3MRUA 4R8FA 1Z5RA 4MHNA 1OBRA 4ZX9A 7CPAA 2OOTA 2V8GA 2ZEHA 2PJ2A 4FUUA 3S9MA 4CPAA 2WZNA 4WJBA 4R7MA 2ZOFA 4PQAA 2QVPA 4ZY2A 2CTBA 4NGQA 2Q43A 3CT9A 1CP7A 4NJRA 4MCPA 4A37A 8CPAA 1BPMA 3SI0A 4ZX8A 1QMUA 3BI1A 5HVGA 5LYDA 2C6PA 1PCAA 2PIYA 1LFWA 3BXMA 3RAMA 2ZEGA 5K8OA 4UEFA 5K8MA 2VL1A 2IJZA 3SI2A 3FECA 5LRKA 1ARLA 1UWYA 3KQZA 1IGBA 4A39A 3KR5A 2NYQA 3IC1A 5J1QA 4OC1A 2PIZA 2WYRA 2ZEDA 5D29A 1CX8A 4YWYA 2PRQA 5F09A 6CPAA 3MN8A 4DUKA 1Y7EA 3WABA 2AFUA 1RTQA 4G1PA 1ZG8A 4PPZA 4JYWA 1BPNA 1CPXA 3PEIA 2ANPA 4EWTA 1XJOA 3VATA 1HDQA 2XEFA 1F2PA 1ELLP 1DE4C 3SJFA 3IIBA 2J9AA 3CDXA 1HEEA 1F2OA 3SJXA 4O23A 4PXEA 3BHXA 1YW4A 2ZENA 4NFRA 4R6TA 4DYOA 2AFSA 4OC3A 1R43A 3K2KA 5LYIA 4UIBA 4YU9A 3WC6A 4NGMA 1BLLE 2G9DA 2F7VA 3KQXA 4P4FA 5LRJA 2EWBA 5HVHA 2PJBA 3FVLA 4TNUA 2RFHA 2BO9A 2AFOA 1NSAA 2Q51A 4W9YA 3JRUA 4K3NA 4Q7AA 1FT7A 3KHXA 2C1CA 5IB9A 1H8LA 1DTDA 2Q4ZA 5THWA 1Y0RA 2GLFA 4X8IA 2PVVA 4IAVA 3D7FA 1Q7LA 1VHOA 3B3WA 3HUVA 4WWVA 4P44A 4MHZA 3TC8A 2AFZA 3K9TA 4PXBA 3B3TA 3KI9A 3QNVA 3BI0A 3L2NA 4NGSA 4OKOA 2CIJA 4P4EA 3GB0A 3PBEA 1CG2A 1ZLIA 2O53A 4MMOA 2ABZA 3D7GA 5I4MA 2EK9A 5CBMA 3D7HA 2XEJA 2C6CA 3PB8X 2PVWA 3HLPA 4MRIA 3H8FA 4X3RA 1YMEA 2FVGA 1ZG9A 2V77A 4OIDA 2C6GA 1HDUA 4UIAA 1LANA 5LYFA 1Z2LA 3FEDA 2NSMA 1PYTB 3NH5A 1EE3P 3IO1A 2JEWA 3T8WA 2PJ8A 4RUHA 3KR4A 3LWUA 1XRYA 3SJEA 1Y0YA 2DEAA 3I1UA 3PRTA 4B6ZA 4F9UA 3NA6A 3TX8A 3KHZA 3FEEA 2ZEFA 2JBKA 4TWEA 4NGPA 2PJ6A 1F57A 2ZEMA 1YLOA 4P4BA 1CP6A 4ZY1A 2CF4A 4IK2A 4UF4A 2PJ5A 1TKFA 5K8NA 3B2YA 5JGFA 4H2KA 2PJ9A 4UEEA 2HB6A 1LOKA 3WT4A 4P45A 4FBEA 2CTCA 3IJ3A 2PCUA 1GYTA 2RB7A 5HVFA 1CPSA 3WC5A 3FH4A 4ZI6A 1TKHA 3KZWA 3H8EA 2PJ0A 4P6YA 2AFXA 3B7IA 1XFOA 3LMSA 1FNOA 1KWMA 2BCOA 4MHPA 1TF9A 4NGRA 1VIXA 3FF3A 3VH9A 2IMOA 3PFOA 2AFMA 3B3SA 2HC9A 4Z65A 2QYVA 3PFEA 2F8HA 4NJQA 4F8ZA 3PB9X 3GUXA 4LQGA 1BAVA 4MCQA 1ZLHA 3RZAA 3B3VA 2GLJA 4P4IA 2O4HA 4OC0A 1LCPA 3ISXA 1VHEA 4MXUA 1CBXA
chains in the Genus database with same CATH superfamily
1S7NA 1IY7A 4C68A 1K4JA 5A27A 5LYLA 5JQ4A 2Q7SA 3FJUA 1TF8A 3FX6A 1I1DA 1S60A 2PSWA 2ZW5A 4KOVA 3IGRA 1ZG7A 4B12A 2PJAA 1AUGA 4M6IA 3KL9A 4CYOA 4FD7A 4IHMA 1I21A 2AFWA 4A95A 5DWMA 2PJ7A 3H8GA 4MHYA 4OC5A 3VWEA 3ZZIA 3WC7A 4P4DA 5CNPA 1YREA 1M4LA 3I9SA 4FWUA 2RC4A 4Y49C 4CAWA 2PJ4A 3BLNA 4JZ0A 5K8PA 3F0AA 4RI1A 3R9EA 1Z8WA 2EK8A 1XIXA 1YGHA 2ZEPA 4MFPA 5D8NA 3S6FA 4C7HA 2BUEA 3NFZA 5AGEA 5HH1A 3WR7A 1YSJA 3H4QA 4BD9A 5GCNA 2XEIA 1QQ9A 5AG6A 3R9FA 2PJCA 4C2XA 2AE6A 2I79A 1XOVA 4AXVA 5A28A 1OZPA 1S7LA 3EFAA 4B13A 3TO6A 3KGQA 3NE8A 2FIAA 4ZY0A 2JLMA 2QMLA 1LAPA 1TXRA 2ATRA 2PJ3A 3B3CA 4MFZA 3CZXA 2QJ8A 4MY0A 1S7KA 1XEBA 3D7DA 4XPDC 3TE4A 1YW6A 1ARMA 4MFQA 4QUSA 2YNDA 4E2AA 5ELYA 4EFDA 5JH9A 4ONWA 3TFYA 2V8HA 2OH1A 2FCKA 4MCRA 1FY7A 2ZEEA 2IQ6A 2B4DA 3CPXA 3ISZA 4UCMA 3E0KA 4UEZA 4A2ZA 2BOAA 1RO5A 3PB4X 4P10A 4IUSA 4UBRA 4AVCA 4XNHB 2V8DA 3IEHA 2ZELA 4EMEA 3NH4A 4CGMA 2V8VA 3NH8A 4II9A 3EXNA 1YR0A 4R87A 3TO9A 4C2ZA 5JM6A 5G1ZA 3DGVA 2VZYA 2VEZA 3CPAA 2BL1A 4A30A 3V7ZA 5C82A 1KUXA 3DLJA 1A2ZA 1XBUA 3IWGA 5HXDA 2ODFA 3W91A 1TKJA 2GREA 2VXKA 4FD6A 4XPDB 3R95A 4FAIA 4CGOA 1XE4A 3EO4A 3IFEA 3LACA 2JBJA 1LAMA 3D4UA 4CGNA 3SXNA 2ZOGA 3B35A 4GM5A 3S9LA 4MBUA 2A4NA 1CJWA 2O28A 3D2PA 4UWJA 5IB0A 3GYAA 3KASA 3GLJA 3S9NA 1VGYA 4JXQA 4NCZA 1L0CA 2POKA 1XMBA 4OC2A 3IWEA 4PXCA 3W6XA 2B3UA 4X2TA 5FVJA 4NGNA 2PRBA 2PE3A 1B87A 2OZGA 5CPAA 4R76A 2OR4A 4FD4A 3R1KA 4JLYA 1Z8XA 3D68A 1R3NA 2OZHA 1QSRA 4PXDA 4U5YA 4NGTA 3FMCA 2REFA 3EY5A 3GIUA 2B58A 1NE9A 5HMNA 4OP4A 5G21A 3PP9A 3RBUA 4CYNA 3IWWA 4KOTA 2G3AA 3SI1A 4P4JA 2AJ6A 2GU2A 4OC4A 2HV2A 1P0HA 2G0BA 2HUZA 3JVNA 3TTHA 1ELMP 4A31A 3FNCA 4OMEA 2CXAA 2ZEOA 2X7BA 4DJLA 2PJ1A 2VQYA 1Y9WA 3VARA 2CNMA 2Z0ZA 4M6GA 3D66A 1AYEA 1CM0A 4A94A 2GANA 2B3VA 3R9GA 2B5GA 3PBBA 2I3CA 3D67A 4F9VA 1PU9A 1Z8LA 5DS0A 4F0YA 4HPSA 3N5FA 3PB7X 4ZYQA 3ZJ0A 1I12A 1AMPA 4KSIA 3DR8A 3SXOA 4A38A 2CNTA 4MCSA 1BO4A 1JQGA 2XEGA 4UA3A 2P6EA 4OIWA 4PK3A 5LRGA 3PB6X 5G22A 4LX9A 3SJGA 5AG5A 3V38A 4KOXA 3MRUA 4JJXA 4R8FA 3RO0A 1Z5RA 3JTKA 1YVKA 4I49A 3TT2A 4MHNA 1OBRA 4LUAA 5F46A 4ZX9A 7CPAA 5I0CA 3QAHA 3IU1A 2OOTA 2V8GA 3S6GA 2ZEHA 4CGPA 2PJ2A 4UFVA 1YX0A 2I00A 4HNXB 1PUAA 4FUUA 3S9MA 2WZNA 4CPAA 5IV0A 2Z3NA 4KZTA 4WJBA 3F8KA 2DXQA 1IIDA 1Y9KA 2ZOFA 4R7MA 4A33A 4PQAA 4AB7A 2QVPA 4KVOE 4PSXA 4ZY2A 2CTBA 4NGQA 2Q43A 4BINA 3TOAA 2CNSA 3CT9A 1CP7A 1SQHA 4NJRA 4MCPA 4A37A 8CPAA 4PV6A 5E96A 1BPMA 1Z9UA 2Q4YA 3SI0A 4KOWA 4KS9A 4ZX8A 1QMUA 3BI1A 4KLWA 5HVGA 5LYDA 2C6PA 1PCAA 2PIYA 3MGDA 1LFWA 3BXMA 4KOYA 3RAMA 2ZEGA 2WUUA 3TOBA 4CAEA 4R57A 4B14A 5K8OA 4UEFA 1KZFA 3T90A 4CRYB 2J8RA 4NEXA 5K8MA 1Q2CA 1IOIA 1M4GA 2VL1A 4MFJA 2IJZA 3KKWA 1S5KA 2ARHA 3FECA 4H6UA 3SI2A 5LRKA 2Z3PA 4MJ8A 1ARLA 4UCNA 1UWYA 3KQZA 1IGBA 4K30A 4M6HA 1BOBA 1R57A 2OU2A 3PGPA 4A39A 4CGLA 1IICA 2D4OA 3KR5A 2NYQA 3IC1A 5F47A 4OC1A 5J1QA 2PIZA 2WYRA 4KVME 5KTAA 2ZEDA 2IL4A 5D29A 4Y49B 1YK3A 1CX8A 2FL4A 4YWYA 2PRQA 5F09A 2VI7A 4U9YA 6CPAA 3IU2A 3MN8A 4DUKA 3FRMA 1Y7EA 3WABA 4NSQA 2AFUA 1RTQA 4G1PA 1ZG8A 4PPZA 4ONUA 4JYWA 2GIVA 3DSBA 1BPNA 1CPXA 4KVXA 4B5PB 4CAVA 4ZGYB 2PDOA 2QECA 3PEIA 2ANPA 4EWTA 2Q04A 1XJOA 4JXRA 4CAXA 4KUAA 2VZZA 3OWCA 5F49A 1KUVA 2YNCA 3F5BA 2ZXVA 3VATA 1HDQA 5JPHA 2XEFA 1F2PA 5DWNA 1ELLP 1DE4C 3SJFA 3K9UA 4Q38A 1IYLA 3IIBA 2J9AA 4C2YA 2ZW4A 1M4DA 3CDXA 4XPLA 1HEEA 4CAFA 4JWPA 1F2OA 1IU8A 3SJXA 4O23A 4PXEA 1MK4A 3BHXA 1YW4A 2ZENA 4KOSA 2D4PA 4NFRA 4QVTA 4R6TA 1YLEA 4DYOA 1MJAA 4CYPA 2AFSA 1RXTA 3NE7A 4OC3A 4YGOA 1R43A 3FB3A 1YVOA 2YGWA 3R96A 5KTDA 3K2KA 5LYIA 4UIBA 3V8IA 3H5ZA 3D8PA 4YU9A 2YNEA 2Z3LA 3WC6A 4NGMA 4KSFA 1BLLE 4KSAA 2B4BA 2G9DA 2P6GA 3RNZA 2F7VA 3LODA 1IOFA 3KQXA 3DDDA 4P4FA 4UCPA 3FBUA 5AG7A 3BJ7A 5LRJA 2Q7BA 2EWBA 5HVHA 4IF5A 2BEIA 4R3LA 2PJBA 3QAYA 3FVLA 4TNUA 2RFHA 2BO9A 3EC4A 2AFOA 2HQYA 1NSAA 3DR6A 2Q51A 4W9YA 2Q0YA 3JRUA 1M1DA 4K3NA 4Q7AA 2GE3A 1FT7A 3KHXA 2C1CA 4MI4A 5IB9A 4KORA 1H8LA 2EUIA 4QB9A 4X5KA 4E0AA 1Q2DA 1MJ9A 2VBQA 1DTDA 2Q4ZA 5THWA 1Y0RA 4FD5A 3FXTA 5KTCA 2GLFA 4X8IA 4XPKA 1VKCA 3RYOA 2PVVA 4IAVA 3D7FA 4AVBA 4F6AA 1X10A 4BMHA 4B11A 1Q7LA 1VHOA 2NMTA 2ZW7A 3B3WA 3HUVA 4WWVA 4AVAA 4P44A 2FT0A 5F48A 2OZUA 1IB1E 2C27A 5C88A 1MJBA 4MHZA 1Q2YA 2AFZA 3TC8A 3CXQA 3K9TA 4PXBA 5EC4A 3B3TA 3KI9A 3QNVA 2J8NA 3BI0A 2B4DB 2H5MA 3L2NA 4RS2A 1GHEA 4NGSA 4YRHA 4OKOA 2CIJA 4P4EA 4JD6A 1UFHA 3UY5A 2FS5A 3GB0A 2Z3MA 2JDDA 3CXPA 3PBEA 1CG2A 2R7HA 4NXYA 3SHPA 1ZLIA 2O53A 3TCVA 4H6ZA 4MMOA 4QC6A 2ABZA 3D7GA 4KUBA 4NF1A 5I4MA 2EK9A 2DPTA 5CBMA 4M3SA 3D7HA 2XEJA 2C6CA 3PB8X 3QB8A 4MFLA 2PVWA 3HLPA 4MRIA 1YQEA 4RN7A 3H8FA 4X3RA 3W6SA 1YMEA 2FVGA 4ORFA 3G3SA 1ZG9A 2V77A 1J4JA 4OIDA 5ISVA 2C6GA 2FXFA 2REEA 4M85A 1HDUA 2PQ8A 4UIAA 1LANA 2WPWA 4XNHC 2Z3KA 5J8CA 4YFJA 5LYFA 1XMTA 1Z2LA 2OB0A 2Q44A 3FEDA 2NSMA 1QSMA 1PYTB 4MY3A 4Q36A 3T9YA 3NH5A 3PZJA 1NMTA 1EE3P 1KUYA 3VWDA 4LQ6A 3IO1A 1U6MA 4GXHA 1Z4EA 1JWQA 1ZO0A 2JEWA 4BBHA 4QBJA 3T8WA 2PR8A 1NSLA 4EVYA 2PJ8A 4RUHA 3KR4A 2EVNA 1XRYA 3LWUA 5EBVA 1N71A 3SJEA 1Y0YA 2DEAA 1WK4A 2Z11A 3I1UA 3PRTA 1P4NA 3JUWA 2EBJA 4B6ZA 4F9UA 3NA6A 2FE7A 2ZPAA 4B5OA 4UWIA 3TX8A 4R9MA 2FIWA 3KHZA 4KOUA 3FIXA 4L8AA 1VHSA 1V0CA 2JEVA 3FEEA 1WWZA 5H86A 2ZEFA 4ZBGA 2JBKA 4OLLA 3CXSA 2PJ6A 3P2HA 4NGPA 2R98A 4R3KA 4TWEA 4OAEA 1F57A 2ZEMA 1YLOA 4P4BA 1CP6A 4A32A 4ZY1A 4C7IA 2QIRA 2B5GB 2CF4A 4IK2A 4UF4A 2PJ5A 3TO7A 1S3ZA 1TKFA 1QSOA 4AG7A 5K8NA 3B2YA 5JGFA 1Y7RA 5H84A 4HKFA 4H2KA 4PSWA 4U9ZA 4KLVA 2PJ9A 4UEEA 2HB6A 1LOKA 3WT4A 4P45A 1Z8TA 3P2FA 2JDCA 4MHDA 4FBEA 1M4IA 1S7FA 2CTCA 3D3SA 3I3GA 3LD2A 3S6HA 3IJ3A 2PCUA 2DPSA 1GYTA 2RB7A 5HVFA 4DNCA 2R1IA 3A9LA 4E8OA 4MFKA 3FYNA 2F5IA 4CRZB 2ZW6A 1CPSA 3WC5A 5BWAB 4GS4A 4L89A 1LRZA 4HNYB 3FH4A 2KCWA 2R8VA 3GKRA 4ZI6A 1TKHA 3KZWA 1TIQA 2EO8A 2FSRA 3H8EA 2GFQA 4B5PA 2PJ0A 2BSWA 4P6YA 2AFXA 4AG9A 3B7IA 1XFOA 3LMSA 1FNOA 1KWMA 1B6BA 2Q4VA 2BCOA 4MHPA 2PR1A 1TF9A 3D2MA 2P0WA 2G3TA 1QSNA 4H89A 3G8WA 4NGRA 1VIXA 4F0XA 4CYQA 2WSAA 3B8GA 2IMOA 3FF3A 4UFXA 3VH9A 3PFOA 4CS0B 5AG4A 1M44A 2AFMA 3B3SA 5EMIA 2DF5A 2HC9A 4Z65A 2QYVA 2WPXA 2YNCC 3S6KA 3PFEA 2F8HA 4NJQA 4OADA 5G20A 2K5TA 4F8ZA 5J8FA 4B10A 3PB9X 2Z3OA 4PK2A 1X12A 3GUXA 3GY9A 4LQGA 1QSTA 2CY2A 4UFWA 1BAVA 3C26A 2Y0MA 3N7ZA 4MCQA 1ZLHA 3RZAA 1ON0A 2P6FA 3B3VA 3DNSA 2J8MA 2Z10A 2GLJA 4P4IA 1XF8A 5IX3A 1Z4RA 3BJ8A 1IYKA 2O4HA 4OC0A 2PC1A 1LCPA 3ISXA 1VHEA 4J3GA 4MXUA 4HNWB 1CBXA
chains in the Genus database with same CATH topology
1IY7A 5LYLA 3FJUA 1TF8A 3FX6A 1ZG7A 2PJAA 3KL9A 4IHMA 2AFWA 2PJ7A 3H8GA 4MHYA 4OC5A 3WC7A 4P4DA 1M4LA 4FWUA 2PJ4A 4JZ0A 5K8PA 2EK8A 2ZEPA 5D8NA 3NFZA 4BD9A 1YSJA 2XEIA 1QQ9A 2PJCA 4AXVA 3KGQA 4ZY0A 1LAPA 1TXRA 2PJ3A 3B3CA 2QJ8A 3D7DA 1YW6A 1ARMA 5ELYA 4EFDA 5JH9A 4ONWA 2V8HA 4MCRA 2ZEEA 2IQ6A 3CPXA 3ISZA 4UEZA 2BOAA 3PB4X 4P10A 2V8DA 3IEHA 2ZELA 4EMEA 3NH4A 2V8VA 3NH8A 5JM6A 3DGVA 3CPAA 3V7ZA 3DLJA 5HXDA 1XBUA 1TKJA 2GREA 4FAIA 3IFEA 2JBJA 1LAMA 3D4UA 2ZOGA 3B35A 4GM5A 3S9LA 3KASA 3GLJA 3S9NA 1VGYA 2POKA 1XMBA 4OC2A 4PXCA 4X2TA 4NGNA 2PE3A 5CPAA 4R76A 2OR4A 3D68A 1R3NA 4PXDA 4NGTA 3FMCA 4OP4A 3RBUA 3IWWA 3SI1A 4P4JA 2GU2A 4OC4A 1ELMP 4DJLA 4OMEA 2ZEOA 2PJ1A 3VARA 3D66A 1AYEA 4A94A 3PBBA 4F9VA 2I3CA 3D67A 1Z8LA 5DS0A 3N5FA 3PB7X 4ZYQA 1AMPA 4KSIA 4A38A 4MCSA 2XEGA 1JQGA 4OIWA 5LRGA 3PB6X 3SJGA 3V38A 3MRUA 4R8FA 1Z5RA 4MHNA 1OBRA 4ZX9A 7CPAA 2OOTA 2V8GA 2ZEHA 2PJ2A 4FUUA 3S9MA 4CPAA 2WZNA 4WJBA 4R7MA 2ZOFA 4PQAA 2QVPA 4ZY2A 2CTBA 4NGQA 2Q43A 3CT9A 1CP7A 4NJRA 4MCPA 4A37A 8CPAA 1BPMA 3SI0A 4ZX8A 1QMUA 3BI1A 5HVGA 5LYDA 2C6PA 1PCAA 2PIYA 1LFWA 3BXMA 3RAMA 2ZEGA 5K8OA 4UEFA 5K8MA 2VL1A 2IJZA 3SI2A 3FECA 5LRKA 1ARLA 1UWYA 3KQZA 1IGBA 4A39A 3KR5A 2NYQA 3IC1A 5J1QA 4OC1A 2PIZA 2WYRA 2ZEDA 5D29A 1CX8A 4YWYA 2PRQA 5F09A 6CPAA 3MN8A 4DUKA 1Y7EA 3WABA 2AFUA 1RTQA 4G1PA 1ZG8A 4PPZA 4JYWA 1BPNA 1CPXA 3PEIA 2ANPA 4EWTA 1XJOA 3VATA 1HDQA 2XEFA 1F2PA 1ELLP 1DE4C 3SJFA 3IIBA 2J9AA 3CDXA 1HEEA 1F2OA 3SJXA 4O23A 4PXEA 3BHXA 1YW4A 2ZENA 4NFRA 4R6TA 4DYOA 2AFSA 4OC3A 1R43A 3K2KA 5LYIA 4UIBA 4YU9A 3WC6A 4NGMA 1BLLE 2G9DA 2F7VA 3KQXA 4P4FA 5LRJA 2EWBA 5HVHA 2PJBA 3FVLA 4TNUA 2RFHA 2BO9A 2AFOA 1NSAA 2Q51A 4W9YA 3JRUA 4K3NA 4Q7AA 1FT7A 3KHXA 2C1CA 5IB9A 1H8LA 1DTDA 2Q4ZA 5THWA 1Y0RA 2GLFA 4X8IA 2PVVA 4IAVA 3D7FA 1Q7LA 1VHOA 3B3WA 3HUVA 4WWVA 4P44A 4MHZA 3TC8A 2AFZA 3K9TA 4PXBA 3B3TA 3KI9A 3QNVA 3BI0A 3L2NA 4NGSA 4OKOA 2CIJA 4P4EA 3GB0A 3PBEA 1CG2A 1ZLIA 2O53A 4MMOA 2ABZA 3D7GA 5I4MA 2EK9A 5CBMA 3D7HA 2XEJA 2C6CA 3PB8X 2PVWA 3HLPA 4MRIA 3H8FA 4X3RA 1YMEA 2FVGA 1ZG9A 2V77A 4OIDA 2C6GA 1HDUA 4UIAA 1LANA 5LYFA 1Z2LA 3FEDA 2NSMA 1PYTB 3NH5A 1EE3P 3IO1A 2JEWA 3T8WA 2PJ8A 4RUHA 3KR4A 3LWUA 1XRYA 3SJEA 1Y0YA 2DEAA 3I1UA 3PRTA 4B6ZA 4F9UA 3NA6A 3TX8A 3KHZA 3FEEA 2ZEFA 2JBKA 4TWEA 4NGPA 2PJ6A 1F57A 2ZEMA 1YLOA 4P4BA 1CP6A 4ZY1A 2CF4A 4IK2A 4UF4A 2PJ5A 1TKFA 5K8NA 3B2YA 5JGFA 4H2KA 2PJ9A 4UEEA 2HB6A 1LOKA 3WT4A 4P45A 4FBEA 2CTCA 3IJ3A 2PCUA 1GYTA 2RB7A 5HVFA 1CPSA 3WC5A 3FH4A 4ZI6A 1TKHA 3KZWA 3H8EA 2PJ0A 4P6YA 2AFXA 3B7IA 1XFOA 3LMSA 1FNOA 1KWMA 2BCOA 4MHPA 1TF9A 4NGRA 1VIXA 3FF3A 3VH9A 2IMOA 3PFOA 2AFMA 3B3SA 2HC9A 4Z65A 2QYVA 3PFEA 2F8HA 4NJQA 4F8ZA 3PB9X 3GUXA 4LQGA 1BAVA 4MCQA 1ZLHA 3RZAA 3B3VA 2GLJA 4P4IA 2O4HA 4OC0A 1LCPA 3ISXA 1VHEA 4MXUA 1CBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY7 A;  5LYL A;  3FJU A;  1TF8 A;  3FX6 A;  1ZG7 A;  2PJA A;  3KL9 A;  4IHM A;  2AFW A;  2PJ7 A;  3H8G A;  4MHY A;  4OC5 A;  3WC7 A;  4P4D A;  1M4L A;  4FWU A;  2PJ4 A;  4JZ0 A;  5K8P A;  2EK8 A;  2ZEP A;  5D8N A;  3NFZ A;  4BD9 A;  1YSJ A;  2XEI A;  1QQ9 A;  2PJC A;  4AXV A;  3KGQ A;  4ZY0 A;  1LAP A;  1TXR A;  2PJ3 A;  3B3C A;  2QJ8 A;  3D7D A;  1YW6 A;  1ARM A;  5ELY A;  4EFD A;  5JH9 A;  4ONW A;  2V8H A;  4MCR A;  2ZEE A;  2IQ6 A;  3CPX A;  3ISZ A;  4UEZ A;  2BOA A;  3PB4 X;  4P10 A;  2V8D A;  3IEH A;  2ZEL A;  4EME A;  3NH4 A;  2V8V A;  3NH8 A;  5JM6 A;  3DGV A;  3CPA A;  3V7Z A;  3DLJ A;  5HXD A;  1XBU A;  1TKJ A;  2GRE A;  4FAI A;  3IFE A;  2JBJ A;  1LAM A;  3D4U A;  2ZOG A;  3B35 A;  4GM5 A;  3S9L A;  3KAS A;  3GLJ A;  3S9N A;  1VGY A;  2POK A;  1XMB A;  4OC2 A;  4PXC A;  4X2T A;  4NGN A;  2PE3 A;  5CPA A;  4R76 A;  2OR4 A;  3D68 A;  1R3N A;  4PXD A;  4NGT A;  3FMC A;  4OP4 A;  3RBU A;  3IWW A;  3SI1 A;  4P4J A;  2GU2 A;  4OC4 A;  1ELM P;  4DJL A;  4OME A;  2ZEO A;  2PJ1 A;  3VAR A;  3D66 A;  1AYE A;  4A94 A;  3PBB A;  4F9V A;  2I3C A;  3D67 A;  1Z8L A;  5DS0 A;  3N5F A;  3PB7 X;  4ZYQ A;  1AMP A;  4KSI A;  4A38 A;  4MCS A;  2XEG A;  1JQG A;  4OIW A;  5LRG A;  3PB6 X;  3SJG A;  3V38 A;  3MRU A;  4R8F A;  1Z5R A;  4MHN A;  1OBR A;  4ZX9 A;  7CPA A;  2OOT A;  2V8G A;  2ZEH A;  2PJ2 A;  4FUU A;  3S9M A;  4CPA A;  2WZN A;  4WJB A;  4R7M A;  2ZOF A;  4PQA A;  2QVP A;  4ZY2 A;  2CTB A;  4NGQ A;  2Q43 A;  3CT9 A;  1CP7 A;  4NJR A;  4MCP A;  4A37 A;  8CPA A;  1BPM A;  3SI0 A;  4ZX8 A;  1QMU A;  3BI1 A;  5HVG A;  5LYD A;  2C6P A;  1PCA A;  2PIY A;  1LFW A;  3BXM A;  3RAM A;  2ZEG A;  5K8O A;  4UEF A;  5K8M A;  2VL1 A;  2IJZ A;  3SI2 A;  3FEC A;  5LRK A;  1ARL A;  1UWY A;  3KQZ A;  1IGB A;  4A39 A;  3KR5 A;  2NYQ A;  3IC1 A;  5J1Q A;  4OC1 A;  2PIZ A;  2WYR A;  2ZED A;  5D29 A;  1CX8 A;  4YWY A;  2PRQ A;  5F09 A;  6CPA A;  3MN8 A;  4DUK A;  1Y7E A;  3WAB A;  2AFU A;  1RTQ A;  4G1P A;  1ZG8 A;  4PPZ A;  4JYW A;  1BPN A;  1CPX A;  3PEI A;  2ANP A;  4EWT A;  1XJO A;  3VAT A;  1HDQ A;  2XEF A;  1F2P A;  1ELL P;  1DE4 C;  3SJF A;  3IIB A;  2J9A A;  3CDX A;  1HEE A;  1F2O A;  3SJX A;  4O23 A;  4PXE A;  3BHX A;  1YW4 A;  2ZEN A;  4NFR A;  4R6T A;  4DYO A;  2AFS A;  4OC3 A;  1R43 A;  3K2K A;  5LYI A;  4UIB A;  4YU9 A;  3WC6 A;  4NGM A;  1BLL E;  2G9D A;  2F7V A;  3KQX A;  4P4F A;  5LRJ A;  2EWB A;  5HVH A;  2PJB A;  3FVL A;  4TNU A;  2RFH A;  2BO9 A;  2AFO A;  1NSA A;  2Q51 A;  4W9Y A;  3JRU A;  4K3N A;  4Q7A A;  1FT7 A;  3KHX A;  2C1C A;  5IB9 A;  1H8L A;  1DTD A;  2Q4Z A;  5THW A;  1Y0R A;  2GLF A;  4X8I A;  2PVV A;  4IAV A;  3D7F A;  1Q7L A;  1VHO A;  3B3W A;  3HUV A;  4WWV A;  4P44 A;  4MHZ A;  3TC8 A;  2AFZ A;  3K9T A;  4PXB A;  3B3T A;  3KI9 A;  3QNV A;  3BI0 A;  3L2N A;  4NGS A;  4OKO A;  2CIJ A;  4P4E A;  3GB0 A;  3PBE A;  1CG2 A;  1ZLI A;  2O53 A;  4MMO A;  2ABZ A;  3D7G A;  5I4M A;  2EK9 A;  5CBM A;  3D7H A;  2XEJ A;  2C6C A;  3PB8 X;  2PVW A;  3HLP A;  4MRI A;  3H8F A;  4X3R A;  1YME A;  2FVG A;  1ZG9 A;  2V77 A;  4OID A;  2C6G A;  1HDU A;  4UIA A;  1LAN A;  5LYF A;  1Z2L A;  3FED A;  2NSM A;  1PYT B;  3NH5 A;  1EE3 P;  3IO1 A;  2JEW A;  3T8W A;  2PJ8 A;  4RUH A;  3KR4 A;  3LWU A;  1XRY A;  3SJE A;  1Y0Y A;  2DEA A;  3I1U A;  3PRT A;  4B6Z A;  4F9U A;  3NA6 A;  3TX8 A;  3KHZ A;  3FEE A;  2ZEF A;  2JBK A;  4TWE A;  4NGP A;  2PJ6 A;  1F57 A;  2ZEM A;  1YLO A;  4P4B A;  1CP6 A;  4ZY1 A;  2CF4 A;  4IK2 A;  4UF4 A;  2PJ5 A;  1TKF A;  5K8N A;  3B2Y A;  5JGF A;  4H2K A;  2PJ9 A;  4UEE A;  2HB6 A;  1LOK A;  3WT4 A;  4P45 A;  4FBE A;  2CTC A;  3IJ3 A;  2PCU A;  1GYT A;  2RB7 A;  5HVF A;  1CPS A;  3WC5 A;  3FH4 A;  4ZI6 A;  1TKH A;  3KZW A;  3H8E A;  2PJ0 A;  4P6Y A;  2AFX A;  3B7I A;  1XFO A;  3LMS A;  1FNO A;  1KWM A;  2BCO A;  4MHP A;  1TF9 A;  4NGR A;  1VIX A;  3FF3 A;  3VH9 A;  2IMO A;  3PFO A;  2AFM A;  3B3S A;  2HC9 A;  4Z65 A;  2QYV A;  3PFE A;  2F8H A;  4NJQ A;  4F8Z A;  3PB9 X;  3GUX A;  4LQG A;  1BAV A;  4MCQ A;  1ZLH A;  3RZA A;  3B3V A;  2GLJ A;  4P4I A;  2O4H A;  4OC0 A;  1LCP A;  3ISX A;  1VHE A;  4MXU A;  1CBX A; 
#chains in the Genus database with same CATH topology
 1S7N A;  1IY7 A;  4C68 A;  1K4J A;  5A27 A;  5LYL A;  5JQ4 A;  2Q7S A;  3FJU A;  1TF8 A;  3FX6 A;  1I1D A;  1S60 A;  2PSW A;  2ZW5 A;  4KOV A;  3IGR A;  1ZG7 A;  4B12 A;  2PJA A;  1AUG A;  4M6I A;  3KL9 A;  4CYO A;  4FD7 A;  4IHM A;  1I21 A;  2AFW A;  4A95 A;  5DWM A;  2PJ7 A;  3H8G A;  4MHY A;  4OC5 A;  3VWE A;  3ZZI A;  3WC7 A;  4P4D A;  5CNP A;  1YRE A;  1M4L A;  3I9S A;  4FWU A;  2RC4 A;  4Y49 C;  4CAW A;  2PJ4 A;  3BLN A;  4JZ0 A;  5K8P A;  3F0A A;  4RI1 A;  3R9E A;  1Z8W A;  2EK8 A;  1XIX A;  1YGH A;  2ZEP A;  4MFP A;  5D8N A;  3S6F A;  4C7H A;  2BUE A;  3NFZ A;  5AGE A;  5HH1 A;  3WR7 A;  1YSJ A;  3H4Q A;  4BD9 A;  5GCN A;  2XEI A;  1QQ9 A;  5AG6 A;  3R9F A;  2PJC A;  4C2X A;  2AE6 A;  2I79 A;  1XOV A;  4AXV A;  5A28 A;  1OZP A;  1S7L A;  3EFA A;  4B13 A;  3TO6 A;  3KGQ A;  3NE8 A;  2FIA A;  4ZY0 A;  2JLM A;  2QML A;  1LAP A;  1TXR A;  2ATR A;  2PJ3 A;  3B3C A;  4MFZ A;  3CZX A;  2QJ8 A;  4MY0 A;  1S7K A;  1XEB A;  3D7D A;  4XPD C;  3TE4 A;  1YW6 A;  1ARM A;  4MFQ A;  4QUS A;  2YND A;  4E2A A;  5ELY A;  4EFD A;  5JH9 A;  4ONW A;  3TFY A;  2V8H A;  2OH1 A;  2FCK A;  4MCR A;  1FY7 A;  2ZEE A;  2IQ6 A;  2B4D A;  3CPX A;  3ISZ A;  4UCM A;  3E0K A;  4UEZ A;  4A2Z A;  2BOA A;  1RO5 A;  3PB4 X;  4P10 A;  4IUS A;  4UBR A;  4AVC A;  4XNH B;  2V8D A;  3IEH A;  2ZEL A;  4EME A;  3NH4 A;  4CGM A;  2V8V A;  3NH8 A;  4II9 A;  3EXN A;  1YR0 A;  4R87 A;  3TO9 A;  4C2Z A;  5JM6 A;  5G1Z A;  3DGV A;  2VZY A;  2VEZ A;  3CPA A;  2BL1 A;  4A30 A;  3V7Z A;  5C82 A;  1KUX A;  3DLJ A;  1A2Z A;  1XBU A;  3IWG A;  5HXD A;  2ODF A;  3W91 A;  1TKJ A;  2GRE A;  2VXK A;  4FD6 A;  4XPD B;  3R95 A;  4FAI A;  4CGO A;  1XE4 A;  3EO4 A;  3IFE A;  3LAC A;  2JBJ A;  1LAM A;  3D4U A;  4CGN A;  3SXN A;  2ZOG A;  3B35 A;  4GM5 A;  3S9L A;  4MBU A;  2A4N A;  1CJW A;  2O28 A;  3D2P A;  4UWJ A;  5IB0 A;  3GYA A;  3KAS A;  3GLJ A;  3S9N A;  1VGY A;  4JXQ A;  4NCZ A;  1L0C A;  2POK A;  1XMB A;  4OC2 A;  3IWE A;  4PXC A;  3W6X A;  2B3U A;  4X2T A;  5FVJ A;  4NGN A;  2PRB A;  2PE3 A;  1B87 A;  2OZG A;  5CPA A;  4R76 A;  2OR4 A;  4FD4 A;  3R1K A;  4JLY A;  1Z8X A;  3D68 A;  1R3N A;  2OZH A;  1QSR A;  4PXD A;  4U5Y A;  4NGT A;  3FMC A;  2REF A;  3EY5 A;  3GIU A;  2B58 A;  1NE9 A;  5HMN A;  4OP4 A;  5G21 A;  3PP9 A;  3RBU A;  4CYN A;  3IWW A;  4KOT A;  2G3A A;  3SI1 A;  4P4J A;  2AJ6 A;  2GU2 A;  4OC4 A;  2HV2 A;  1P0H A;  2G0B A;  2HUZ A;  3JVN A;  3TTH A;  1ELM P;  4A31 A;  3FNC A;  4OME A;  2CXA A;  2ZEO A;  2X7B A;  4DJL A;  2PJ1 A;  2VQY A;  1Y9W A;  3VAR A;  2CNM A;  2Z0Z A;  4M6G A;  3D66 A;  1AYE A;  1CM0 A;  4A94 A;  2GAN A;  2B3V A;  3R9G A;  2B5G A;  3PBB A;  2I3C A;  3D67 A;  4F9V A;  1PU9 A;  1Z8L A;  5DS0 A;  4F0Y A;  4HPS A;  3N5F A;  3PB7 X;  4ZYQ A;  3ZJ0 A;  1I12 A;  1AMP A;  4KSI A;  3DR8 A;  3SXO A;  4A38 A;  2CNT A;  4MCS A;  1BO4 A;  1JQG A;  2XEG A;  4UA3 A;  2P6E A;  4OIW A;  4PK3 A;  5LRG A;  3PB6 X;  5G22 A;  4LX9 A;  3SJG A;  5AG5 A;  3V38 A;  4KOX A;  3MRU A;  4JJX A;  4R8F A;  3RO0 A;  1Z5R A;  3JTK A;  1YVK A;  4I49 A;  3TT2 A;  4MHN A;  1OBR A;  4LUA A;  5F46 A;  4ZX9 A;  7CPA A;  5I0C A;  3QAH A;  3IU1 A;  2OOT A;  2V8G A;  3S6G A;  2ZEH A;  4CGP A;  2PJ2 A;  4UFV A;  1YX0 A;  2I00 A;  4HNX B;  1PUA A;  4FUU A;  3S9M A;  2WZN A;  4CPA A;  5IV0 A;  2Z3N A;  4KZT A;  4WJB A;  3F8K A;  2DXQ A;  1IID A;  1Y9K A;  2ZOF A;  4R7M A;  4A33 A;  4PQA A;  4AB7 A;  2QVP A;  4KVO E;  4PSX A;  4ZY2 A;  2CTB A;  4NGQ A;  2Q43 A;  4BIN A;  3TOA A;  2CNS A;  3CT9 A;  1CP7 A;  1SQH A;  4NJR A;  4MCP A;  4A37 A;  8CPA A;  4PV6 A;  5E96 A;  1BPM A;  1Z9U A;  2Q4Y A;  3SI0 A;  4KOW A;  4KS9 A;  4ZX8 A;  1QMU A;  3BI1 A;  4KLW A;  5HVG A;  5LYD A;  2C6P A;  1PCA A;  2PIY A;  3MGD A;  1LFW A;  3BXM A;  4KOY A;  3RAM A;  2ZEG A;  2WUU A;  3TOB A;  4CAE A;  4R57 A;  4B14 A;  5K8O A;  4UEF A;  1KZF A;  3T90 A;  4CRY B;  2J8R A;  4NEX A;  5K8M A;  1Q2C A;  1IOI A;  1M4G A;  2VL1 A;  4MFJ A;  2IJZ A;  3KKW A;  1S5K A;  2ARH A;  3FEC A;  4H6U A;  3SI2 A;  5LRK A;  2Z3P A;  4MJ8 A;  1ARL A;  4UCN A;  1UWY A;  3KQZ A;  1IGB A;  4K30 A;  4M6H A;  1BOB A;  1R57 A;  2OU2 A;  3PGP A;  4A39 A;  4CGL A;  1IIC A;  2D4O A;  3KR5 A;  2NYQ A;  3IC1 A;  5F47 A;  4OC1 A;  5J1Q A;  2PIZ A;  2WYR A;  4KVM E;  5KTA A;  2ZED A;  2IL4 A;  5D29 A;  4Y49 B;  1YK3 A;  1CX8 A;  2FL4 A;  4YWY A;  2PRQ A;  5F09 A;  2VI7 A;  4U9Y A;  6CPA A;  3IU2 A;  3MN8 A;  4DUK A;  3FRM A;  1Y7E A;  3WAB A;  4NSQ A;  2AFU A;  1RTQ A;  4G1P A;  1ZG8 A;  4PPZ A;  4ONU A;  4JYW A;  2GIV A;  3DSB A;  1BPN A;  1CPX A;  4KVX A;  4B5P B;  4CAV A;  4ZGY B;  2PDO A;  2QEC A;  3PEI A;  2ANP A;  4EWT A;  2Q04 A;  1XJO A;  4JXR A;  4CAX A;  4KUA A;  2VZZ A;  3OWC A;  5F49 A;  1KUV A;  2YNC A;  3F5B A;  2ZXV A;  3VAT A;  1HDQ A;  5JPH A;  2XEF A;  1F2P A;  5DWN A;  1ELL P;  1DE4 C;  3SJF A;  3K9U A;  4Q38 A;  1IYL A;  3IIB A;  2J9A A;  4C2Y A;  2ZW4 A;  1M4D A;  3CDX A;  4XPL A;  1HEE A;  4CAF A;  4JWP A;  1F2O A;  1IU8 A;  3SJX A;  4O23 A;  4PXE A;  1MK4 A;  3BHX A;  1YW4 A;  2ZEN A;  4KOS A;  2D4P A;  4NFR A;  4QVT A;  4R6T A;  1YLE A;  4DYO A;  1MJA A;  4CYP A;  2AFS A;  1RXT A;  3NE7 A;  4OC3 A;  4YGO A;  1R43 A;  3FB3 A;  1YVO A;  2YGW A;  3R96 A;  5KTD A;  3K2K A;  5LYI A;  4UIB A;  3V8I A;  3H5Z A;  3D8P A;  4YU9 A;  2YNE A;  2Z3L A;  3WC6 A;  4NGM A;  4KSF A;  1BLL E;  4KSA A;  2B4B A;  2G9D A;  2P6G A;  3RNZ A;  2F7V A;  3LOD A;  1IOF A;  3KQX A;  3DDD A;  4P4F A;  4UCP A;  3FBU A;  5AG7 A;  3BJ7 A;  5LRJ A;  2Q7B A;  2EWB A;  5HVH A;  4IF5 A;  2BEI A;  4R3L A;  2PJB A;  3QAY A;  3FVL A;  4TNU A;  2RFH A;  2BO9 A;  3EC4 A;  2AFO A;  2HQY A;  1NSA A;  3DR6 A;  2Q51 A;  4W9Y A;  2Q0Y A;  3JRU A;  1M1D A;  4K3N A;  4Q7A A;  2GE3 A;  1FT7 A;  3KHX A;  2C1C A;  4MI4 A;  5IB9 A;  4KOR A;  1H8L A;  2EUI A;  4QB9 A;  4X5K A;  4E0A A;  1Q2D A;  1MJ9 A;  2VBQ A;  1DTD A;  2Q4Z A;  5THW A;  1Y0R A;  4FD5 A;  3FXT A;  5KTC A;  2GLF A;  4X8I A;  4XPK A;  1VKC A;  3RYO A;  2PVV A;  4IAV A;  3D7F A;  4AVB A;  4F6A A;  1X10 A;  4BMH A;  4B11 A;  1Q7L A;  1VHO A;  2NMT A;  2ZW7 A;  3B3W A;  3HUV A;  4WWV A;  4AVA A;  4P44 A;  2FT0 A;  5F48 A;  2OZU A;  1IB1 E;  2C27 A;  5C88 A;  1MJB A;  4MHZ A;  1Q2Y A;  2AFZ A;  3TC8 A;  3CXQ A;  3K9T A;  4PXB A;  5EC4 A;  3B3T A;  3KI9 A;  3QNV A;  2J8N A;  3BI0 A;  2B4D B;  2H5M A;  3L2N A;  4RS2 A;  1GHE A;  4NGS A;  4YRH A;  4OKO A;  2CIJ A;  4P4E A;  4JD6 A;  1UFH A;  3UY5 A;  2FS5 A;  3GB0 A;  2Z3M A;  2JDD A;  3CXP A;  3PBE A;  1CG2 A;  2R7H A;  4NXY A;  3SHP A;  1ZLI A;  2O53 A;  3TCV A;  4H6Z A;  4MMO A;  4QC6 A;  2ABZ A;  3D7G A;  4KUB A;  4NF1 A;  5I4M A;  2EK9 A;  2DPT A;  5CBM A;  4M3S A;  3D7H A;  2XEJ A;  2C6C A;  3PB8 X;  3QB8 A;  4MFL A;  2PVW A;  3HLP A;  4MRI A;  1YQE A;  4RN7 A;  3H8F A;  4X3R A;  3W6S A;  1YME A;  2FVG A;  4ORF A;  3G3S A;  1ZG9 A;  2V77 A;  1J4J A;  4OID A;  5ISV A;  2C6G A;  2FXF A;  2REE A;  4M85 A;  1HDU A;  2PQ8 A;  4UIA A;  1LAN A;  2WPW A;  4XNH C;  2Z3K A;  5J8C A;  4YFJ A;  5LYF A;  1XMT A;  1Z2L A;  2OB0 A;  2Q44 A;  3FED A;  2NSM A;  1QSM A;  1PYT B;  4MY3 A;  4Q36 A;  3T9Y A;  3NH5 A;  3PZJ A;  1NMT A;  1EE3 P;  1KUY A;  3VWD A;  4LQ6 A;  3IO1 A;  1U6M A;  4GXH A;  1Z4E A;  1JWQ A;  1ZO0 A;  2JEW A;  4BBH A;  4QBJ A;  3T8W A;  2PR8 A;  1NSL A;  4EVY A;  2PJ8 A;  4RUH A;  3KR4 A;  2EVN A;  1XRY A;  3LWU A;  5EBV A;  1N71 A;  3SJE A;  1Y0Y A;  2DEA A;  1WK4 A;  2Z11 A;  3I1U A;  3PRT A;  1P4N A;  3JUW A;  2EBJ A;  4B6Z A;  4F9U A;  3NA6 A;  2FE7 A;  2ZPA A;  4B5O A;  4UWI A;  3TX8 A;  4R9M A;  2FIW A;  3KHZ A;  4KOU A;  3FIX A;  4L8A A;  1VHS A;  1V0C A;  2JEV A;  3FEE A;  1WWZ A;  5H86 A;  2ZEF A;  4ZBG A;  2JBK A;  4OLL A;  3CXS A;  2PJ6 A;  3P2H A;  4NGP A;  2R98 A;  4R3K A;  4TWE A;  4OAE A;  1F57 A;  2ZEM A;  1YLO A;  4P4B A;  1CP6 A;  4A32 A;  4ZY1 A;  4C7I A;  2QIR A;  2B5G B;  2CF4 A;  4IK2 A;  4UF4 A;  2PJ5 A;  3TO7 A;  1S3Z A;  1TKF A;  1QSO A;  4AG7 A;  5K8N A;  3B2Y A;  5JGF A;  1Y7R A;  5H84 A;  4HKF A;  4H2K A;  4PSW A;  4U9Z A;  4KLV A;  2PJ9 A;  4UEE A;  2HB6 A;  1LOK A;  3WT4 A;  4P45 A;  1Z8T A;  3P2F A;  2JDC A;  4MHD A;  4FBE A;  1M4I A;  1S7F A;  2CTC A;  3D3S A;  3I3G A;  3LD2 A;  3S6H A;  3IJ3 A;  2PCU A;  2DPS A;  1GYT A;  2RB7 A;  5HVF A;  4DNC A;  2R1I A;  3A9L A;  4E8O A;  4MFK A;  3FYN A;  2F5I A;  4CRZ B;  2ZW6 A;  1CPS A;  3WC5 A;  5BWA B;  4GS4 A;  4L89 A;  1LRZ A;  4HNY B;  3FH4 A;  2KCW A;  2R8V A;  3GKR A;  4ZI6 A;  1TKH A;  3KZW A;  1TIQ A;  2EO8 A;  2FSR A;  3H8E A;  2GFQ A;  4B5P A;  2PJ0 A;  2BSW A;  4P6Y A;  2AFX A;  4AG9 A;  3B7I A;  1XFO A;  3LMS A;  1FNO A;  1KWM A;  1B6B A;  2Q4V A;  2BCO A;  4MHP A;  2PR1 A;  1TF9 A;  3D2M A;  2P0W A;  2G3T A;  1QSN A;  4H89 A;  3G8W A;  4NGR A;  1VIX A;  4F0X A;  4CYQ A;  2WSA A;  3B8G A;  2IMO A;  3FF3 A;  4UFX A;  3VH9 A;  3PFO A;  4CS0 B;  5AG4 A;  1M44 A;  2AFM A;  3B3S A;  5EMI A;  2DF5 A;  2HC9 A;  4Z65 A;  2QYV A;  2WPX A;  2YNC C;  3S6K A;  3PFE A;  2F8H A;  4NJQ A;  4OAD A;  5G20 A;  2K5T A;  4F8Z A;  5J8F A;  4B10 A;  3PB9 X;  2Z3O A;  4PK2 A;  1X12 A;  3GUX A;  3GY9 A;  4LQG A;  1QST A;  2CY2 A;  4UFW A;  1BAV A;  3C26 A;  2Y0M A;  3N7Z A;  4MCQ A;  1ZLH A;  3RZA A;  1ON0 A;  2P6F A;  3B3V A;  3DNS A;  2J8M A;  2Z10 A;  2GLJ A;  4P4I A;  1XF8 A;  5IX3 A;  1Z4R A;  3BJ8 A;  1IYK A;  2O4H A;  4OC0 A;  2PC1 A;  1LCP A;  3ISX A;  1VHE A;  4J3G A;  4MXU A;  4HNW B;  1CBX A; 
#chains in the Genus database with same CATH homology
 1IY7 A;  5LYL A;  3FJU A;  1TF8 A;  3FX6 A;  1ZG7 A;  2PJA A;  3KL9 A;  4IHM A;  2AFW A;  2PJ7 A;  3H8G A;  4MHY A;  4OC5 A;  3WC7 A;  4P4D A;  1M4L A;  4FWU A;  2PJ4 A;  4JZ0 A;  5K8P A;  2EK8 A;  2ZEP A;  5D8N A;  3NFZ A;  4BD9 A;  1YSJ A;  2XEI A;  1QQ9 A;  2PJC A;  4AXV A;  3KGQ A;  4ZY0 A;  1LAP A;  1TXR A;  2PJ3 A;  3B3C A;  2QJ8 A;  3D7D A;  1YW6 A;  1ARM A;  5ELY A;  4EFD A;  5JH9 A;  4ONW A;  2V8H A;  4MCR A;  2ZEE A;  2IQ6 A;  3CPX A;  3ISZ A;  4UEZ A;  2BOA A;  3PB4 X;  4P10 A;  2V8D A;  3IEH A;  2ZEL A;  4EME A;  3NH4 A;  2V8V A;  3NH8 A;  5JM6 A;  3DGV A;  3CPA A;  3V7Z A;  3DLJ A;  5HXD A;  1XBU A;  1TKJ A;  2GRE A;  4FAI A;  3IFE A;  2JBJ A;  1LAM A;  3D4U A;  2ZOG A;  3B35 A;  4GM5 A;  3S9L A;  3KAS A;  3GLJ A;  3S9N A;  1VGY A;  2POK A;  1XMB A;  4OC2 A;  4PXC A;  4X2T A;  4NGN A;  2PE3 A;  5CPA A;  4R76 A;  2OR4 A;  3D68 A;  1R3N A;  4PXD A;  4NGT A;  3FMC A;  4OP4 A;  3RBU A;  3IWW A;  3SI1 A;  4P4J A;  2GU2 A;  4OC4 A;  1ELM P;  4DJL A;  4OME A;  2ZEO A;  2PJ1 A;  3VAR A;  3D66 A;  1AYE A;  4A94 A;  3PBB A;  4F9V A;  2I3C A;  3D67 A;  1Z8L A;  5DS0 A;  3N5F A;  3PB7 X;  4ZYQ A;  1AMP A;  4KSI A;  4A38 A;  4MCS A;  2XEG A;  1JQG A;  4OIW A;  5LRG A;  3PB6 X;  3SJG A;  3V38 A;  3MRU A;  4R8F A;  1Z5R A;  4MHN A;  1OBR A;  4ZX9 A;  7CPA A;  2OOT A;  2V8G A;  2ZEH A;  2PJ2 A;  4FUU A;  3S9M A;  4CPA A;  2WZN A;  4WJB A;  4R7M A;  2ZOF A;  4PQA A;  2QVP A;  4ZY2 A;  2CTB A;  4NGQ A;  2Q43 A;  3CT9 A;  1CP7 A;  4NJR A;  4MCP A;  4A37 A;  8CPA A;  1BPM A;  3SI0 A;  4ZX8 A;  1QMU A;  3BI1 A;  5HVG A;  5LYD A;  2C6P A;  1PCA A;  2PIY A;  1LFW A;  3BXM A;  3RAM A;  2ZEG A;  5K8O A;  4UEF A;  5K8M A;  2VL1 A;  2IJZ A;  3SI2 A;  3FEC A;  5LRK A;  1ARL A;  1UWY A;  3KQZ A;  1IGB A;  4A39 A;  3KR5 A;  2NYQ A;  3IC1 A;  5J1Q A;  4OC1 A;  2PIZ A;  2WYR A;  2ZED A;  5D29 A;  1CX8 A;  4YWY A;  2PRQ A;  5F09 A;  6CPA A;  3MN8 A;  4DUK A;  1Y7E A;  3WAB A;  2AFU A;  1RTQ A;  4G1P A;  1ZG8 A;  4PPZ A;  4JYW A;  1BPN A;  1CPX A;  3PEI A;  2ANP A;  4EWT A;  1XJO A;  3VAT A;  1HDQ A;  2XEF A;  1F2P A;  1ELL P;  1DE4 C;  3SJF A;  3IIB A;  2J9A A;  3CDX A;  1HEE A;  1F2O A;  3SJX A;  4O23 A;  4PXE A;  3BHX A;  1YW4 A;  2ZEN A;  4NFR A;  4R6T A;  4DYO A;  2AFS A;  4OC3 A;  1R43 A;  3K2K A;  5LYI A;  4UIB A;  4YU9 A;  3WC6 A;  4NGM A;  1BLL E;  2G9D A;  2F7V A;  3KQX A;  4P4F A;  5LRJ A;  2EWB A;  5HVH A;  2PJB A;  3FVL A;  4TNU A;  2RFH A;  2BO9 A;  2AFO A;  1NSA A;  2Q51 A;  4W9Y A;  3JRU A;  4K3N A;  4Q7A A;  1FT7 A;  3KHX A;  2C1C A;  5IB9 A;  1H8L A;  1DTD A;  2Q4Z A;  5THW A;  1Y0R A;  2GLF A;  4X8I A;  2PVV A;  4IAV A;  3D7F A;  1Q7L A;  1VHO A;  3B3W A;  3HUV A;  4WWV A;  4P44 A;  4MHZ A;  3TC8 A;  2AFZ A;  3K9T A;  4PXB A;  3B3T A;  3KI9 A;  3QNV A;  3BI0 A;  3L2N A;  4NGS A;  4OKO A;  2CIJ A;  4P4E A;  3GB0 A;  3PBE A;  1CG2 A;  1ZLI A;  2O53 A;  4MMO A;  2ABZ A;  3D7G A;  5I4M A;  2EK9 A;  5CBM A;  3D7H A;  2XEJ A;  2C6C A;  3PB8 X;  2PVW A;  3HLP A;  4MRI A;  3H8F A;  4X3R A;  1YME A;  2FVG A;  1ZG9 A;  2V77 A;  4OID A;  2C6G A;  1HDU A;  4UIA A;  1LAN A;  5LYF A;  1Z2L A;  3FED A;  2NSM A;  1PYT B;  3NH5 A;  1EE3 P;  3IO1 A;  2JEW A;  3T8W A;  2PJ8 A;  4RUH A;  3KR4 A;  3LWU A;  1XRY A;  3SJE A;  1Y0Y A;  2DEA A;  3I1U A;  3PRT A;  4B6Z A;  4F9U A;  3NA6 A;  3TX8 A;  3KHZ A;  3FEE A;  2ZEF A;  2JBK A;  4TWE A;  4NGP A;  2PJ6 A;  1F57 A;  2ZEM A;  1YLO A;  4P4B A;  1CP6 A;  4ZY1 A;  2CF4 A;  4IK2 A;  4UF4 A;  2PJ5 A;  1TKF A;  5K8N A;  3B2Y A;  5JGF A;  4H2K A;  2PJ9 A;  4UEE A;  2HB6 A;  1LOK A;  3WT4 A;  4P45 A;  4FBE A;  2CTC A;  3IJ3 A;  2PCU A;  1GYT A;  2RB7 A;  5HVF A;  1CPS A;  3WC5 A;  3FH4 A;  4ZI6 A;  1TKH A;  3KZW A;  3H8E A;  2PJ0 A;  4P6Y A;  2AFX A;  3B7I A;  1XFO A;  3LMS A;  1FNO A;  1KWM A;  2BCO A;  4MHP A;  1TF9 A;  4NGR A;  1VIX A;  3FF3 A;  3VH9 A;  2IMO A;  3PFO A;  2AFM A;  3B3S A;  2HC9 A;  4Z65 A;  2QYV A;  3PFE A;  2F8H A;  4NJQ A;  4F8Z A;  3PB9 X;  3GUX A;  4LQG A;  1BAV A;  4MCQ A;  1ZLH A;  3RZA A;  3B3V A;  2GLJ A;  4P4I A;  2O4H A;  4OC0 A;  1LCP A;  3ISX A;  1VHE A;  4MXU A;  1CBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...