1XRYA

Crystal structure of aeromonas proteolytica aminopeptidase in complex with bestatin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Interactions of Streptomyces griseus Aminopeptidase and Aeromonas proteolytica Aminopeptidase with Bestatin. Structural analysis of homologous enzymes with different binding modes.
rcsb
molecule tags Hydrolase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xryA00
4P4IA 4X2TA 3KL9A 4X3RA 3ISXA 3PRTA 4ZY0A 2Q51A 3B3WA 4JYWA 4X8IA 1CPSA 2ZELA 2PJCA 4O23A 4EWTA 1F2OA 3BHXA 4IHMA 5IB9A 4GM5A 1R3NA 2ZEMA 1ZG9A 3IC1A 4P4JA 1VHEA 3BI1A 2PJ4A 3VATA 3PB4X 2BOAA 4P4FA 3LMSA 2HC9A 2AFOA 3NH4A 1Y0RA 2F8HA 3NH8A 4NGMA 4P4BA 3DGVA 4OIWA 4DJLA 3NA6A 3KHZA 4NGTA 3S9NA 3B3CA 3NFZA 3SJGA 4JZ0A 1XBUA 3B3TA 3BXMA 3B2YA 3H8GA 3KGQA 3HUVA 5K8OA 2HB6A 3BI0A 4MHPA 3IWWA 1RTQA 2PJ2A 1BPNA 4OMEA 4ZYQA 1PYTB 5THWA 2PVWA 4EMEA 4UEFA 1ARMA 1ELMP 2PE3A 2CTCA 2PJ3A 2PJ5A 2JBJA 4ZI6A 4R7MA 4MCQA 5HVGA 3D68A 3ISZA 5LRGA 5HVHA 2Q43A 2GLJA 4R8FA 2ZEDA 3S9MA 5LYFA 1BAVA 2RFHA 3D7GA 5J1QA 5LRJA 3IFEA 5D8NA 3VH9A 3FVLA 1YLOA 3FECA 3D7FA 4P6YA 1TKJA 1M4LA 4A38A 1KWMA 2ZEGA 3PB7X 3SI0A 3SJFA 1BPMA 1Z8LA 3K2KA 4MRIA 1AMPA 1TF9A 2PJ9A 2RB7A 2V8VA 3K9TA 3IJ3A 1HEEA 2PJ6A 3WABA 2PJAA 2IQ6A 2BO9A 4MCRA 4MCPA 1XMBA 4NGSA 3N5FA 3RZAA 3KR4A 3CPAA 2OOTA 2J9AA 4PXCA 1QMUA 3WC6A 1EE3P 2ZEOA 2ZEHA 1CP6A 3GUXA 4OC2A 2AFXA 1F57A 2V8HA 4RUHA 3GB0A 4UF4A 1VIXA 1LAMA 3MN8A 1ZLIA 2O53A 3D4UA 1CG2A 3TC8A 1LAPA 3QNVA 1F2PA 2NSMA 2PJ0A 4A39A 4AXVA 3H8FA 1DTDA 2OR4A 2V77A 2XEFA 4A94A 1FNOA 5LYLA 4R76A 4ZY2A 3PFEA 1OBRA 4K3NA 4PQAA 4NGNA 2JEWA 4W9YA 4NGRA 2PJ8A 3TX8A 2XEIA 4UEZA 1HDQA 2IJZA 5JM6A 4LQGA 2PVVA 4OC3A 3HLPA 1CP7A 1LFWA 2EWBA 1ZG7A 2AFZA 5I4MA 2F7VA 3B3VA 4P4DA 4F8ZA 2ZENA 4OKOA 3FJUA 3D7DA 4OC0A 2AFSA 1BLLE 2ZOGA 4MCSA 4P45A 4UIAA 4MHNA 1CX8A 1DE4C 2C6CA 4A37A 3PBEA 4NJQA 3KI9A 3NH5A 2WZNA 4ZY1A 4H2KA 1ARLA 2V8GA 2PJBA 2ANPA 4OC5A 4G1PA 3PEIA 2QYVA 3PFOA 4OC4A 3RBUA 3WC5A 1FT7A 3IIBA 4BD9A 5LYIA 2EK8A 4FWUA 4P4EA 4PXEA 4YWYA 4EFDA 2EK9A 4TNUA 2PJ1A 4WWVA 3SI2A 2FVGA 3B7IA 3WC7A 3D7HA 1IY7A 5LRKA 1NSAA 3VARA 2O4HA 4CPAA 7CPAA 4IAVA 5LYDA 5ELYA 1GYTA 2PIZA 2QVPA 1QQ9A 4F9VA 3KQXA 3FEEA 4NFRA 3L2NA 5HVFA 5CBMA 3FF3A 1JQGA 4NGPA 1PCAA 2AFUA 1LCPA 3IEHA 1TKHA 3B3SA 1AYEA 2CF4A 1TF8A 4WJBA 3RAMA 1UWYA 2POKA 3MRUA 4PXDA 4UIBA 3FEDA 1Y0YA 4IK2A 3WT4A 6CPAA 4FUUA 5F09A 3SJXA 5K8NA 3SI1A 4DYOA 3PBBA 3I1UA 3IO1A 5CPAA 2XEJA 3GLJA 3LWUA 1TXRA 2C1CA 2GREA 4P44A 2Q4ZA 1Y7EA 2BCOA 3CPXA 1LOKA 3DLJA 1VGYA 2ZEFA 3SJEA 1YW6A 4R6TA 2V8DA 4UEEA 4OIDA 2JBKA 2GU2A 4B6ZA 1R43A 1XFOA 3KZWA 1HDUA 1CPXA 2C6GA 3H8EA 5JGFA 1CBXA 3B35A 2ZEEA 4MXUA 3V7ZA 2GLFA 4ONWA 2G9DA 5JH9A 5D29A 2PIYA 3KQZA 1XJOA 4DUKA 1YW4A 4Z65A 2ABZA 2CIJA 3D67A 1LANA 2AFMA 4FBEA 2PRQA 3CT9A 4NGQA 1IGBA 2XEGA 1ZG8A 2ZEPA 1Z2LA 1Z5RA 4OP4A 2PJ7A 2DEAA 2I3CA 2NYQA 4PPZA 4MHZA 3KHXA 2CTBA 4MMOA 3KASA 3PB8X 1XRYA 2C6PA 2VL1A 8CPAA 2WYRA 3FH4A 1VHOA 1YMEA 3KR5A 4Q7AA 4KSIA 4ZX9A 1Q7LA 1YSJA 4MHYA 3FX6A 2ZOFA 2QJ8A 3CDXA 2PCUA 5HXDA 5K8MA 3FMCA 4F9UA 3V38A 4FAIA 4TWEA 2AFWA 3D66A 4YU9A 1ELLP 5DS0A 4PXBA 3T8WA 4P10A 1TKFA 2IMOA 3JRUA 4OC1A 1ZLHA 5K8PA 3PB9X 1H8LA 4ZX8A 3PB6X 3S9LA 4NJRA
chains in the Genus database with same CATH superfamily
4P4IA 2R7HA 3TO9A 4F0XA 4X2TA 3KL9A 3RYOA 4X3RA 4B12A 4C7IA 2WPWA 4LX9A 3ISXA 3PZJA 2VEZA 3PRTA 4CAXA 4ZY0A 2Q51A 1GHEA 3B3WA 4JYWA 2Z0ZA 1YK3A 4XNHB 1S60A 4X8IA 4GS4A 1Z4RA 1CPSA 2ZELA 4Q36A 4B11A 2PJCA 3DR6A 3IU2A 4O23A 4EWTA 1Z9UA 2CXAA 1F2OA 4KVXA 2Y0MA 3D8PA 3BHXA 2Q44A 4IHMA 4MFJA 4CAWA 5IB9A 4GM5A 1R3NA 5AGEA 2ZEMA 1ZG9A 3IC1A 5J8FA 5IX3A 3F5BA 1U6MA 3LACA 2DF5A 4P4JA 2Z11A 4HNWB 4NF1A 1VHEA 5DWMA 3TO6A 4KSAA 1QSMA 3BI1A 2YNDA 4MJ8A 4M6GA 1Q2YA 2PJ4A 3JVNA 5DWNA 3VATA 2G0BA 3PB4X 1YX0A 4HPSA 4MBUA 1CM0A 2BOAA 2FSRA 4UA3A 1S7KA 2ARHA 4P4FA 2ZW7A 2OU2A 3LMSA 1RXTA 2HC9A 5F46A 2BUEA 2AFOA 4X5KA 3NH4A 1Y0RA 2F8HA 2H5MA 2RC4A 3NH8A 4E0AA 1S5KA 4Q38A 4NGMA 2YNCA 2FT0A 2FXFA 4P4BA 2P6GA 3DGVA 4OIWA 4DJLA 3NA6A 5A27A 3KHZA 4NGTA 2AJ6A 3S9NA 3B3CA 3S6FA 4CYOA 4OADA 4R87A 3NFZA 3SJGA 4JZ0A 1XBUA 3B3TA 3BXMA 3B2YA 3H8GA 1X12A 1R57A 3KGQA 3HUVA 5K8OA 1VKCA 2HB6A 3BI0A 4MHPA 5F48A 4IUSA 2Q4VA 3IWWA 1RTQA 2PJ2A 3NE8A 1BPNA 3S6HA 3TO7A 2G3TA 4CGLA 4OMEA 4QB9A 4ZYQA 4JJXA 3B8GA 1PYTB 5THWA 4M6HA 2PVWA 4F6AA 4H6ZA 1KZFA 1JWQA 4U5YA 1M44A 4MY0A 4EMEA 2FIAA 4XPDC 3OWCA 4UEFA 1ARMA 1ELMP 4E2AA 1AUGA 3PP9A 2PE3A 4GXHA 2Q7SA 1B6BA 3R9GA 4B5PA 4CYQA 2CTCA 1TIQA 2PJ3A 2PJ5A 2JBJA 5EBVA 4ZI6A 4KVOE 2J8MA 1QSNA 4R7MA 4MCQA 5HVGA 3D68A 2K5TA 4XPLA 3ISZA 5LRGA 5HVHA 4CGMA 1MJ9A 2Q43A 5EC4A 3QAYA 2I79A 1RO5A 2GLJA 1Y7RA 4MFQA 4UFVA 5G22A 4R8FA 4BMHA 5CNPA 4AG9A 4DNCA 2FCKA 1X10A 2ZEDA 3S9MA 4B10A 4UCMA 5LYFA 1OZPA 1BAVA 2RFHA 3D7GA 4J3GA 5J1QA 5LRJA 2EVNA 3IFEA 1S7LA 4KVME 2Q0YA 5D8NA 5G20A 3VH9A 3EO4A 2Z3LA 3D2PA 4UCNA 5H86A 3FVLA 1YLOA 3FECA 3D7FA 4HNYB 4P6YA 3DSBA 1IYKA 2B58A 1TKJA 1M4LA 4PK3A 1KWMA 2ZEGA 4A38A 5AG4A 3PB7X 2JDDA 3SI0A 1BPMA 1Z8LA 3SJFA 3K2KA 1YGHA 4MRIA 5ISVA 1AMPA 1TF9A 2CNMA 4C2ZA 2Z3OA 4YFJA 4CRYB 2PJ9A 2RB7A 4C2YA 2V8VA 4KUAA 2Z3MA 3IWEA 3K9TA 1Y9WA 3IGRA 3IJ3A 1HEEA 2HUZA 5F49A 2B5GB 2PJ6A 4NCZA 3G8WA 4KOVA 3WABA 2PJAA 4ZBGA 3BJ7A 2FL4A 2IQ6A 2BO9A 2HQYA 4MCRA 3VWDA 4MCPA 4UCPA 1XMBA 2GE3A 4NGSA 3N5FA 3RZAA 1Z8XA 3KR4A 3CPAA 4L89A 2OOTA 2J9AA 4PXCA 2B4DA 2ZPAA 4CAFA 1QMUA 3WC6A 1LRZA 2ODFA 1YVOA 2P6FA 1EE3P 2X7BA 2ZEOA 1NE9A 2ZEHA 5KTDA 5FVJA 4CRZB 4ONUA 2BEIA 2WSAA 4FD7A 4IF5A 1XOVA 1CP6A 3GUXA 4KOUA 3JUWA 4OC2A 2AFXA 1F57A 2V8HA 4RUHA 4C2XA 2PSWA 3GB0A 4UF4A 5A28A 4QUSA 3TE4A 1WWZA 1VIXA 2DXQA 4I49A 4MFLA 1LAMA 3MN8A 3LODA 1ZLIA 2O53A 3D4UA 2ZW6A 1CG2A 2QECA 1A2ZA 3TC8A 1LAPA 3QNVA 4QC6A 2IL4A 1F2PA 1I12A 4A31A 2NSMA 1IICA 1M1DA 3R9EA 2PRBA 3TOAA 2PJ0A 4A39A 4AXVA 3A9LA 3H8FA 1DTDA 1Z8WA 2OR4A 2V77A 2I00A 2XEFA 5J8CA 4A94A 4KOTA 1NSLA 4RS2A 1FNOA 1MK4A 3GIUA 3EC4A 4M85A 5I4MA 5LYLA 3D2MA 4R76A 4ZY2A 4A2ZA 3PFEA 1OBRA 2B3UA 4MFKA 4K3NA 4PQAA 2NMTA 4RN7A 5KTCA 3FXTA 2JEWA 4NGNA 4MHDA 4NGRA 2PJ8A 4W9YA 3SXNA 3TT2A 3TX8A 4AVAA 2XEIA 4NSQA 4UEZA 1HDQA 2IJZA 2KCWA 2VQYA 3NE7A 2REFA 3FNCA 1M4GA 2OB0A 2Z3NA 4LQGA 4R3LA 3ZJ0A 5C82A 2PVVA 5EMIA 1QSRA 4OC3A 4R9MA 1S7FA 2REEA 3HLPA 4PSXA 1CP7A 1LFWA 1IU8A 1ZG7A 2AFZA 2DPSA 2EWBA 2F7VA 3FBUA 3B3VA 4JD6A 4P4DA 4R3KA 4F8ZA 2ZENA 4QBJA 4AG7A 4OKOA 3FJUA 3D7DA 3VWEA 4OC0A 2AFSA 1BLLE 2ZOGA 2VXKA 4MCSA 4CAEA 4P45A 4CGOA 4FD5A 4UIAA 4MHNA 1CX8A 4KSFA 4CYNA 1DE4C 2C6CA 4A37A 3PBEA 4NJQA 3KI9A 4BBHA 2CNSA 2OH1A 2WZNA 3NH5A 4ZY1A 1CJWA 1KUYA 2WUUA 4H2KA 4KOSA 3TTHA 5BWAB 1ARLA 2V8GA 2PJBA 2ANPA 4JXRA 4XPDB 3T9YA 3W6XA 4OC5A 2WPXA 5E96A 3W91A 4G1PA 3E0KA 2QYVA 3PEIA 3PFOA 4KS9A 4MFPA 3SXOA 4OC4A 3RBUA 3WC5A 1FT7A 5G1ZA 2ZXVA 2Z3PA 3IIBA 2ZW4A 5G21A 4BD9A 2VZYA 1Z4EA 5LYIA 2EK8A 4FWUA 2F5IA 4P4EA 4PXEA 5H84A 4YWYA 4UFXA 4EFDA 2EK9A 4TNUA 2PJ1A 3IWGA 4WWVA 3SI2A 3EXNA 4L8AA 5JGFA 1IYLA 3EFAA 2FVGA 1IOIA 3B7IA 5IV0A 4A95A 4ORFA 3WC7A 1I1DA 4KLVA 3D7HA 4UFWA 3KKWA 1IY7A 2PR8A 5LRKA 4II9A 1NSAA 3SHPA 3VARA 1P4NA 2C27A 1L0CA 2O4HA 5F47A 4CPAA 7CPAA 4IAVA 5LYDA 3R9FA 5ELYA 1GYTA 2PIZA 2QVPA 3RNZA 1QQ9A 4F9VA 3KQXA 5JPHA 3FEEA 4C68A 2YNEA 4NFRA 3L2NA 4H6UA 2OZHA 2Z3KA 4QVTA 1WK4A 1QSOA 3FF3A 5HVFA 4NXYA 5CBMA 3CXSA 1JQGA 4NGPA 1XEBA 1Z8TA 4CGPA 2PDOA 2BL1A 3DR8A 3C26A 1PCAA 2P6EA 3MGDA 2AFUA 1S7NA 1LCPA 2YNCC 3IEHA 4FD4A 3QB8A 1NMTA 1TKHA 3B3SA 3F0AA 1AYEA 2CF4A 2PC1A 1TF8A 4JLYA 4R57A 4B13A 4XNHC 4WJBA 2Q4YA 3RAMA 3S6KA 3DDDA 3RO0A 2GFQA 4B14A 4BINA 4UWJA 1BOBA 1UWYA 3JTKA 3UY5A 2POKA 3MRUA 2D4PA 4PXDA 4UIBA 3FEDA 1Y0YA 2CY2A 2FE7A 2R8VA 4IK2A 4UBRA 3I9SA 4A32A 4B5OA 2VBQA 4FUUA 6CPAA 5F09A 3SJXA 5K8NA 3SI1A 1K4JA 5AG7A 4DYOA 1Y9KA 3GY9A 3PBBA 3I1UA 4CAVA 3DNSA 3IO1A 5CPAA 5JM6A 4KORA 2JDCA 2XEJA 3GLJA 5KTAA 1PU9A 3LWUA 2Q7BA 3CZXA 1TXRA 2C1CA 2VZZA 2GREA 4P44A 2Q4ZA 1Y7EA 2BCOA 2FIWA 4KLWA 3CPXA 1LOKA 4KUBA 3DLJA 1VGYA 1QSTA 2ZEFA 3BLNA 3R95A 2O28A 3SJEA 3N7ZA 1YW6A 2QIRA 3K9UA 4MI4A 3BJ8A 1M4IA 3P2HA 4R6TA 2B5GA 4FD6A 4HNXB 1P0HA 2DPTA 4A30A 2V8DA 4UEEA 4OIDA 4M3SA 2JBKA 2GU2A 4B6ZA 1R43A 3CXPA 4A33A 1XFOA 2OZGA 3KZWA 2JEVA 1HDUA 1CPXA 2C6GA 2EO8A 3H8EA 1CBXA 2GANA 3B35A 3R1KA 5GCNA 2EBJA 2GIVA 2AE6A 2ZEEA 4KOXA 1KUXA 4RI1A 3W6SA 4B5PB 4MXUA 3V7ZA 1BO4A 2GLFA 3FIXA 4ONWA 3FYNA 3G3SA 1Q2DA 5AG6A 2G9DA 4U9YA 5JH9A 5D29A 2PIYA 2Q04A 1XJOA 3KQZA 4F0YA 3T90A 5AG5A 4DUKA 4XPKA 1YW4A 3TOBA 4JWPA 4PV6A 3TCVA 4Z65A 3FB3A 5HMNA 4LUAA 2ABZA 1YR0A 1YLEA 2CIJA 2VI7A 1LANA 3D67A 4KOYA 2CNTA 1XIXA 1M4DA 3TFYA 3ZZIA 2AFMA 3WT4A 2FS5A 4FBEA 2PRQA 2EUIA 3V8IA 3CT9A 4NGQA 3R96A 1IGBA 1YREA 1ZG8A 2XEGA 2ZEPA 3H5ZA 1Z2LA 1Z5RA 4OP4A 3GYAA 4KOWA 2PJ7A 3P2FA 1ON0A 5JQ4A 2DEAA 2I3CA 4H89A 4C7HA 2J8RA 2OZUA 4MY3A 2NYQA 4M6IA 4MHZA 3KHXA 1S3ZA 4KZTA 4PPZA 1IOFA 4E8OA 2CTBA 2D4OA 4K30A 4MMOA 3KASA 5I0CA 3PB8X 1XE4A 1XRYA 2C6PA 2VL1A 2Z10A 4NEXA 4JXQA 8CPAA 2WYRA 3FH4A 2B4BA 1VHOA 4OLLA 1YMEA 3KR5A 1J4JA 4HKFA 2YGWA 4YRHA 4Q7AA 4AB7A 2A4NA 4ZGYB 2G3AA 4KSIA 3EY5A 4ZX9A 3S6GA 1XF8A 1Q7LA 4OAEA 4PSWA 1YSJA 2ATRA 3CXQA 1PUAA 3F8KA 4MHYA 1VHSA 1MJBA 3FX6A 2ZOFA 2QJ8A 1Q2CA 1ZO0A 4AVBA 3CDXA 1FY7A 2R1IA 1UFHA 2PCUA 3QAHA 5HXDA 5K8MA 2B3VA 4LQ6A 4UWIA 1SQHA 3FMCA 4F9UA 1V0CA 1XMTA 1KUVA 3V38A 4CYPA 4FAIA 4TWEA 3FRMA 2AFWA 3D66A 2P0WA 3PGPA 4Y49C 4YU9A 1ELLP 3GKRA 2B4DB 4PXBA 5DS0A 3T8WA 3WR7A 4U9ZA 1YQEA 1IIDA 3LD2A 4YGOA 4CGNA 1N71A 2BSWA 2J8NA 3D3SA 4P10A 1TKFA 2PQ8A 5C88A 2ZW5A 4Y49B 4AVCA 2IMOA 3JRUA 5HH1A 4OC1A 1ZLHA 1B87A 3I3GA 4CS0B 5K8PA 2HV2A 4EVYA 3PB9X 3H4QA 4MFZA 1H8LA 1I21A 4ZX8A 3IU1A 1IB1E 3PB6X 2JLMA 3S9LA 2R98A 1YVKA 4NJRA 2QMLA 2PR1A 5IB0A 1MJAA 4PK2A
chains in the Genus database with same CATH topology
4P4IA 4X2TA 3KL9A 4X3RA 3ISXA 3PRTA 4ZY0A 2Q51A 3B3WA 4JYWA 4X8IA 1CPSA 2ZELA 2PJCA 4O23A 4EWTA 1F2OA 3BHXA 4IHMA 5IB9A 4GM5A 1R3NA 2ZEMA 1ZG9A 3IC1A 4P4JA 1VHEA 3BI1A 2PJ4A 3VATA 3PB4X 2BOAA 4P4FA 3LMSA 2HC9A 2AFOA 3NH4A 1Y0RA 2F8HA 3NH8A 4NGMA 4P4BA 3DGVA 4OIWA 4DJLA 3NA6A 3KHZA 4NGTA 3S9NA 3B3CA 3NFZA 3SJGA 4JZ0A 1XBUA 3B3TA 3BXMA 3B2YA 3H8GA 3KGQA 3HUVA 5K8OA 2HB6A 3BI0A 4MHPA 3IWWA 1RTQA 2PJ2A 1BPNA 4OMEA 4ZYQA 1PYTB 5THWA 2PVWA 4EMEA 4UEFA 1ARMA 1ELMP 2PE3A 2CTCA 2PJ3A 2PJ5A 2JBJA 4ZI6A 4R7MA 4MCQA 5HVGA 3D68A 3ISZA 5LRGA 5HVHA 2Q43A 2GLJA 4R8FA 2ZEDA 3S9MA 5LYFA 1BAVA 2RFHA 3D7GA 5J1QA 5LRJA 3IFEA 5D8NA 3VH9A 3FVLA 1YLOA 3FECA 3D7FA 4P6YA 1TKJA 1M4LA 4A38A 1KWMA 2ZEGA 3PB7X 3SI0A 3SJFA 1BPMA 1Z8LA 3K2KA 4MRIA 1AMPA 1TF9A 2PJ9A 2RB7A 2V8VA 3K9TA 3IJ3A 1HEEA 2PJ6A 3WABA 2PJAA 2IQ6A 2BO9A 4MCRA 4MCPA 1XMBA 4NGSA 3N5FA 3RZAA 3KR4A 3CPAA 2OOTA 2J9AA 4PXCA 1QMUA 3WC6A 1EE3P 2ZEOA 2ZEHA 1CP6A 3GUXA 4OC2A 2AFXA 1F57A 2V8HA 4RUHA 3GB0A 4UF4A 1VIXA 1LAMA 3MN8A 1ZLIA 2O53A 3D4UA 1CG2A 3TC8A 1LAPA 3QNVA 1F2PA 2NSMA 2PJ0A 4A39A 4AXVA 3H8FA 1DTDA 2OR4A 2V77A 2XEFA 4A94A 1FNOA 5LYLA 4R76A 4ZY2A 3PFEA 1OBRA 4K3NA 4PQAA 4NGNA 2JEWA 4W9YA 4NGRA 2PJ8A 3TX8A 2XEIA 4UEZA 1HDQA 2IJZA 5JM6A 4LQGA 2PVVA 4OC3A 3HLPA 1CP7A 1LFWA 2EWBA 1ZG7A 2AFZA 5I4MA 2F7VA 3B3VA 4P4DA 4F8ZA 2ZENA 4OKOA 3FJUA 3D7DA 4OC0A 2AFSA 1BLLE 2ZOGA 4MCSA 4P45A 4UIAA 4MHNA 1CX8A 1DE4C 2C6CA 4A37A 3PBEA 4NJQA 3KI9A 3NH5A 2WZNA 4ZY1A 4H2KA 1ARLA 2V8GA 2PJBA 2ANPA 4OC5A 4G1PA 3PEIA 2QYVA 3PFOA 4OC4A 3RBUA 3WC5A 1FT7A 3IIBA 4BD9A 5LYIA 2EK8A 4FWUA 4P4EA 4PXEA 4YWYA 4EFDA 2EK9A 4TNUA 2PJ1A 4WWVA 3SI2A 2FVGA 3B7IA 3WC7A 3D7HA 1IY7A 5LRKA 1NSAA 3VARA 2O4HA 4CPAA 7CPAA 4IAVA 5LYDA 5ELYA 1GYTA 2PIZA 2QVPA 1QQ9A 4F9VA 3KQXA 3FEEA 4NFRA 3L2NA 5HVFA 5CBMA 3FF3A 1JQGA 4NGPA 1PCAA 2AFUA 1LCPA 3IEHA 1TKHA 3B3SA 1AYEA 2CF4A 1TF8A 4WJBA 3RAMA 1UWYA 2POKA 3MRUA 4PXDA 4UIBA 3FEDA 1Y0YA 4IK2A 3WT4A 6CPAA 4FUUA 5F09A 3SJXA 5K8NA 3SI1A 4DYOA 3PBBA 3I1UA 3IO1A 5CPAA 2XEJA 3GLJA 3LWUA 1TXRA 2C1CA 2GREA 4P44A 2Q4ZA 1Y7EA 2BCOA 3CPXA 1LOKA 3DLJA 1VGYA 2ZEFA 3SJEA 1YW6A 4R6TA 2V8DA 4UEEA 4OIDA 2JBKA 2GU2A 4B6ZA 1R43A 1XFOA 3KZWA 1HDUA 1CPXA 2C6GA 3H8EA 5JGFA 1CBXA 3B35A 2ZEEA 4MXUA 3V7ZA 2GLFA 4ONWA 2G9DA 5JH9A 5D29A 2PIYA 3KQZA 1XJOA 4DUKA 1YW4A 4Z65A 2ABZA 2CIJA 3D67A 1LANA 2AFMA 4FBEA 2PRQA 3CT9A 4NGQA 1IGBA 2XEGA 1ZG8A 2ZEPA 1Z2LA 1Z5RA 4OP4A 2PJ7A 2DEAA 2I3CA 2NYQA 4PPZA 4MHZA 3KHXA 2CTBA 4MMOA 3KASA 3PB8X 1XRYA 2C6PA 2VL1A 8CPAA 2WYRA 3FH4A 1VHOA 1YMEA 3KR5A 4Q7AA 4KSIA 4ZX9A 1Q7LA 1YSJA 4MHYA 3FX6A 2ZOFA 2QJ8A 3CDXA 2PCUA 5HXDA 5K8MA 3FMCA 4F9UA 3V38A 4FAIA 4TWEA 2AFWA 3D66A 4YU9A 1ELLP 5DS0A 4PXBA 3T8WA 4P10A 1TKFA 2IMOA 3JRUA 4OC1A 1ZLHA 5K8PA 3PB9X 1H8LA 4ZX8A 3PB6X 3S9LA 4NJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4I A;  4X2T A;  3KL9 A;  4X3R A;  3ISX A;  3PRT A;  4ZY0 A;  2Q51 A;  3B3W A;  4JYW A;  4X8I A;  1CPS A;  2ZEL A;  2PJC A;  4O23 A;  4EWT A;  1F2O A;  3BHX A;  4IHM A;  5IB9 A;  4GM5 A;  1R3N A;  2ZEM A;  1ZG9 A;  3IC1 A;  4P4J A;  1VHE A;  3BI1 A;  2PJ4 A;  3VAT A;  3PB4 X;  2BOA A;  4P4F A;  3LMS A;  2HC9 A;  2AFO A;  3NH4 A;  1Y0R A;  2F8H A;  3NH8 A;  4NGM A;  4P4B A;  3DGV A;  4OIW A;  4DJL A;  3NA6 A;  3KHZ A;  4NGT A;  3S9N A;  3B3C A;  3NFZ A;  3SJG A;  4JZ0 A;  1XBU A;  3B3T A;  3BXM A;  3B2Y A;  3H8G A;  3KGQ A;  3HUV A;  5K8O A;  2HB6 A;  3BI0 A;  4MHP A;  3IWW A;  1RTQ A;  2PJ2 A;  1BPN A;  4OME A;  4ZYQ A;  1PYT B;  5THW A;  2PVW A;  4EME A;  4UEF A;  1ARM A;  1ELM P;  2PE3 A;  2CTC A;  2PJ3 A;  2PJ5 A;  2JBJ A;  4ZI6 A;  4R7M A;  4MCQ A;  5HVG A;  3D68 A;  3ISZ A;  5LRG A;  5HVH A;  2Q43 A;  2GLJ A;  4R8F A;  2ZED A;  3S9M A;  5LYF A;  1BAV A;  2RFH A;  3D7G A;  5J1Q A;  5LRJ A;  3IFE A;  5D8N A;  3VH9 A;  3FVL A;  1YLO A;  3FEC A;  3D7F A;  4P6Y A;  1TKJ A;  1M4L A;  4A38 A;  1KWM A;  2ZEG A;  3PB7 X;  3SI0 A;  3SJF A;  1BPM A;  1Z8L A;  3K2K A;  4MRI A;  1AMP A;  1TF9 A;  2PJ9 A;  2RB7 A;  2V8V A;  3K9T A;  3IJ3 A;  1HEE A;  2PJ6 A;  3WAB A;  2PJA A;  2IQ6 A;  2BO9 A;  4MCR A;  4MCP A;  1XMB A;  4NGS A;  3N5F A;  3RZA A;  3KR4 A;  3CPA A;  2OOT A;  2J9A A;  4PXC A;  1QMU A;  3WC6 A;  1EE3 P;  2ZEO A;  2ZEH A;  1CP6 A;  3GUX A;  4OC2 A;  2AFX A;  1F57 A;  2V8H A;  4RUH A;  3GB0 A;  4UF4 A;  1VIX A;  1LAM A;  3MN8 A;  1ZLI A;  2O53 A;  3D4U A;  1CG2 A;  3TC8 A;  1LAP A;  3QNV A;  1F2P A;  2NSM A;  2PJ0 A;  4A39 A;  4AXV A;  3H8F A;  1DTD A;  2OR4 A;  2V77 A;  2XEF A;  4A94 A;  1FNO A;  5LYL A;  4R76 A;  4ZY2 A;  3PFE A;  1OBR A;  4K3N A;  4PQA A;  4NGN A;  2JEW A;  4W9Y A;  4NGR A;  2PJ8 A;  3TX8 A;  2XEI A;  4UEZ A;  1HDQ A;  2IJZ A;  5JM6 A;  4LQG A;  2PVV A;  4OC3 A;  3HLP A;  1CP7 A;  1LFW A;  2EWB A;  1ZG7 A;  2AFZ A;  5I4M A;  2F7V A;  3B3V A;  4P4D A;  4F8Z A;  2ZEN A;  4OKO A;  3FJU A;  3D7D A;  4OC0 A;  2AFS A;  1BLL E;  2ZOG A;  4MCS A;  4P45 A;  4UIA A;  4MHN A;  1CX8 A;  1DE4 C;  2C6C A;  4A37 A;  3PBE A;  4NJQ A;  3KI9 A;  3NH5 A;  2WZN A;  4ZY1 A;  4H2K A;  1ARL A;  2V8G A;  2PJB A;  2ANP A;  4OC5 A;  4G1P A;  3PEI A;  2QYV A;  3PFO A;  4OC4 A;  3RBU A;  3WC5 A;  1FT7 A;  3IIB A;  4BD9 A;  5LYI A;  2EK8 A;  4FWU A;  4P4E A;  4PXE A;  4YWY A;  4EFD A;  2EK9 A;  4TNU A;  2PJ1 A;  4WWV A;  3SI2 A;  2FVG A;  3B7I A;  3WC7 A;  3D7H A;  1IY7 A;  5LRK A;  1NSA A;  3VAR A;  2O4H A;  4CPA A;  7CPA A;  4IAV A;  5LYD A;  5ELY A;  1GYT A;  2PIZ A;  2QVP A;  1QQ9 A;  4F9V A;  3KQX A;  3FEE A;  4NFR A;  3L2N A;  5HVF A;  5CBM A;  3FF3 A;  1JQG A;  4NGP A;  1PCA A;  2AFU A;  1LCP A;  3IEH A;  1TKH A;  3B3S A;  1AYE A;  2CF4 A;  1TF8 A;  4WJB A;  3RAM A;  1UWY A;  2POK A;  3MRU A;  4PXD A;  4UIB A;  3FED A;  1Y0Y A;  4IK2 A;  3WT4 A;  6CPA A;  4FUU A;  5F09 A;  3SJX A;  5K8N A;  3SI1 A;  4DYO A;  3PBB A;  3I1U A;  3IO1 A;  5CPA A;  2XEJ A;  3GLJ A;  3LWU A;  1TXR A;  2C1C A;  2GRE A;  4P44 A;  2Q4Z A;  1Y7E A;  2BCO A;  3CPX A;  1LOK A;  3DLJ A;  1VGY A;  2ZEF A;  3SJE A;  1YW6 A;  4R6T A;  2V8D A;  4UEE A;  4OID A;  2JBK A;  2GU2 A;  4B6Z A;  1R43 A;  1XFO A;  3KZW A;  1HDU A;  1CPX A;  2C6G A;  3H8E A;  5JGF A;  1CBX A;  3B35 A;  2ZEE A;  4MXU A;  3V7Z A;  2GLF A;  4ONW A;  2G9D A;  5JH9 A;  5D29 A;  2PIY A;  3KQZ A;  1XJO A;  4DUK A;  1YW4 A;  4Z65 A;  2ABZ A;  2CIJ A;  3D67 A;  1LAN A;  2AFM A;  4FBE A;  2PRQ A;  3CT9 A;  4NGQ A;  1IGB A;  2XEG A;  1ZG8 A;  2ZEP A;  1Z2L A;  1Z5R A;  4OP4 A;  2PJ7 A;  2DEA A;  2I3C A;  2NYQ A;  4PPZ A;  4MHZ A;  3KHX A;  2CTB A;  4MMO A;  3KAS A;  3PB8 X;  1XRY A;  2C6P A;  2VL1 A;  8CPA A;  2WYR A;  3FH4 A;  1VHO A;  1YME A;  3KR5 A;  4Q7A A;  4KSI A;  4ZX9 A;  1Q7L A;  1YSJ A;  4MHY A;  3FX6 A;  2ZOF A;  2QJ8 A;  3CDX A;  2PCU A;  5HXD A;  5K8M A;  3FMC A;  4F9U A;  3V38 A;  4FAI A;  4TWE A;  2AFW A;  3D66 A;  4YU9 A;  1ELL P;  5DS0 A;  4PXB A;  3T8W A;  4P10 A;  1TKF A;  2IMO A;  3JRU A;  4OC1 A;  1ZLH A;  5K8P A;  3PB9 X;  1H8L A;  4ZX8 A;  3PB6 X;  3S9L A;  4NJR A; 
#chains in the Genus database with same CATH topology
 4P4I A;  2R7H A;  3TO9 A;  4F0X A;  4X2T A;  3KL9 A;  3RYO A;  4X3R A;  4B12 A;  4C7I A;  2WPW A;  4LX9 A;  3ISX A;  3PZJ A;  2VEZ A;  3PRT A;  4CAX A;  4ZY0 A;  2Q51 A;  1GHE A;  3B3W A;  4JYW A;  2Z0Z A;  1YK3 A;  4XNH B;  1S60 A;  4X8I A;  4GS4 A;  1Z4R A;  1CPS A;  2ZEL A;  4Q36 A;  4B11 A;  2PJC A;  3DR6 A;  3IU2 A;  4O23 A;  4EWT A;  1Z9U A;  2CXA A;  1F2O A;  4KVX A;  2Y0M A;  3D8P A;  3BHX A;  2Q44 A;  4IHM A;  4MFJ A;  4CAW A;  5IB9 A;  4GM5 A;  1R3N A;  5AGE A;  2ZEM A;  1ZG9 A;  3IC1 A;  5J8F A;  5IX3 A;  3F5B A;  1U6M A;  3LAC A;  2DF5 A;  4P4J A;  2Z11 A;  4HNW B;  4NF1 A;  1VHE A;  5DWM A;  3TO6 A;  4KSA A;  1QSM A;  3BI1 A;  2YND A;  4MJ8 A;  4M6G A;  1Q2Y A;  2PJ4 A;  3JVN A;  5DWN A;  3VAT A;  2G0B A;  3PB4 X;  1YX0 A;  4HPS A;  4MBU A;  1CM0 A;  2BOA A;  2FSR A;  4UA3 A;  1S7K A;  2ARH A;  4P4F A;  2ZW7 A;  2OU2 A;  3LMS A;  1RXT A;  2HC9 A;  5F46 A;  2BUE A;  2AFO A;  4X5K A;  3NH4 A;  1Y0R A;  2F8H A;  2H5M A;  2RC4 A;  3NH8 A;  4E0A A;  1S5K A;  4Q38 A;  4NGM A;  2YNC A;  2FT0 A;  2FXF A;  4P4B A;  2P6G A;  3DGV A;  4OIW A;  4DJL A;  3NA6 A;  5A27 A;  3KHZ A;  4NGT A;  2AJ6 A;  3S9N A;  3B3C A;  3S6F A;  4CYO A;  4OAD A;  4R87 A;  3NFZ A;  3SJG A;  4JZ0 A;  1XBU A;  3B3T A;  3BXM A;  3B2Y A;  3H8G A;  1X12 A;  1R57 A;  3KGQ A;  3HUV A;  5K8O A;  1VKC A;  2HB6 A;  3BI0 A;  4MHP A;  5F48 A;  4IUS A;  2Q4V A;  3IWW A;  1RTQ A;  2PJ2 A;  3NE8 A;  1BPN A;  3S6H A;  3TO7 A;  2G3T A;  4CGL A;  4OME A;  4QB9 A;  4ZYQ A;  4JJX A;  3B8G A;  1PYT B;  5THW A;  4M6H A;  2PVW A;  4F6A A;  4H6Z A;  1KZF A;  1JWQ A;  4U5Y A;  1M44 A;  4MY0 A;  4EME A;  2FIA A;  4XPD C;  3OWC A;  4UEF A;  1ARM A;  1ELM P;  4E2A A;  1AUG A;  3PP9 A;  2PE3 A;  4GXH A;  2Q7S A;  1B6B A;  3R9G A;  4B5P A;  4CYQ A;  2CTC A;  1TIQ A;  2PJ3 A;  2PJ5 A;  2JBJ A;  5EBV A;  4ZI6 A;  4KVO E;  2J8M A;  1QSN A;  4R7M A;  4MCQ A;  5HVG A;  3D68 A;  2K5T A;  4XPL A;  3ISZ A;  5LRG A;  5HVH A;  4CGM A;  1MJ9 A;  2Q43 A;  5EC4 A;  3QAY A;  2I79 A;  1RO5 A;  2GLJ A;  1Y7R A;  4MFQ A;  4UFV A;  5G22 A;  4R8F A;  4BMH A;  5CNP A;  4AG9 A;  4DNC A;  2FCK A;  1X10 A;  2ZED A;  3S9M A;  4B10 A;  4UCM A;  5LYF A;  1OZP A;  1BAV A;  2RFH A;  3D7G A;  4J3G A;  5J1Q A;  5LRJ A;  2EVN A;  3IFE A;  1S7L A;  4KVM E;  2Q0Y A;  5D8N A;  5G20 A;  3VH9 A;  3EO4 A;  2Z3L A;  3D2P A;  4UCN A;  5H86 A;  3FVL A;  1YLO A;  3FEC A;  3D7F A;  4HNY B;  4P6Y A;  3DSB A;  1IYK A;  2B58 A;  1TKJ A;  1M4L A;  4PK3 A;  1KWM A;  2ZEG A;  4A38 A;  5AG4 A;  3PB7 X;  2JDD A;  3SI0 A;  1BPM A;  1Z8L A;  3SJF A;  3K2K A;  1YGH A;  4MRI A;  5ISV A;  1AMP A;  1TF9 A;  2CNM A;  4C2Z A;  2Z3O A;  4YFJ A;  4CRY B;  2PJ9 A;  2RB7 A;  4C2Y A;  2V8V A;  4KUA A;  2Z3M A;  3IWE A;  3K9T A;  1Y9W A;  3IGR A;  3IJ3 A;  1HEE A;  2HUZ A;  5F49 A;  2B5G B;  2PJ6 A;  4NCZ A;  3G8W A;  4KOV A;  3WAB A;  2PJA A;  4ZBG A;  3BJ7 A;  2FL4 A;  2IQ6 A;  2BO9 A;  2HQY A;  4MCR A;  3VWD A;  4MCP A;  4UCP A;  1XMB A;  2GE3 A;  4NGS A;  3N5F A;  3RZA A;  1Z8X A;  3KR4 A;  3CPA A;  4L89 A;  2OOT A;  2J9A A;  4PXC A;  2B4D A;  2ZPA A;  4CAF A;  1QMU A;  3WC6 A;  1LRZ A;  2ODF A;  1YVO A;  2P6F A;  1EE3 P;  2X7B A;  2ZEO A;  1NE9 A;  2ZEH A;  5KTD A;  5FVJ A;  4CRZ B;  4ONU A;  2BEI A;  2WSA A;  4FD7 A;  4IF5 A;  1XOV A;  1CP6 A;  3GUX A;  4KOU A;  3JUW A;  4OC2 A;  2AFX A;  1F57 A;  2V8H A;  4RUH A;  4C2X A;  2PSW A;  3GB0 A;  4UF4 A;  5A28 A;  4QUS A;  3TE4 A;  1WWZ A;  1VIX A;  2DXQ A;  4I49 A;  4MFL A;  1LAM A;  3MN8 A;  3LOD A;  1ZLI A;  2O53 A;  3D4U A;  2ZW6 A;  1CG2 A;  2QEC A;  1A2Z A;  3TC8 A;  1LAP A;  3QNV A;  4QC6 A;  2IL4 A;  1F2P A;  1I12 A;  4A31 A;  2NSM A;  1IIC A;  1M1D A;  3R9E A;  2PRB A;  3TOA A;  2PJ0 A;  4A39 A;  4AXV A;  3A9L A;  3H8F A;  1DTD A;  1Z8W A;  2OR4 A;  2V77 A;  2I00 A;  2XEF A;  5J8C A;  4A94 A;  4KOT A;  1NSL A;  4RS2 A;  1FNO A;  1MK4 A;  3GIU A;  3EC4 A;  4M85 A;  5I4M A;  5LYL A;  3D2M A;  4R76 A;  4ZY2 A;  4A2Z A;  3PFE A;  1OBR A;  2B3U A;  4MFK A;  4K3N A;  4PQA A;  2NMT A;  4RN7 A;  5KTC A;  3FXT A;  2JEW A;  4NGN A;  4MHD A;  4NGR A;  2PJ8 A;  4W9Y A;  3SXN A;  3TT2 A;  3TX8 A;  4AVA A;  2XEI A;  4NSQ A;  4UEZ A;  1HDQ A;  2IJZ A;  2KCW A;  2VQY A;  3NE7 A;  2REF A;  3FNC A;  1M4G A;  2OB0 A;  2Z3N A;  4LQG A;  4R3L A;  3ZJ0 A;  5C82 A;  2PVV A;  5EMI A;  1QSR A;  4OC3 A;  4R9M A;  1S7F A;  2REE A;  3HLP A;  4PSX A;  1CP7 A;  1LFW A;  1IU8 A;  1ZG7 A;  2AFZ A;  2DPS A;  2EWB A;  2F7V A;  3FBU A;  3B3V A;  4JD6 A;  4P4D A;  4R3K A;  4F8Z A;  2ZEN A;  4QBJ A;  4AG7 A;  4OKO A;  3FJU A;  3D7D A;  3VWE A;  4OC0 A;  2AFS A;  1BLL E;  2ZOG A;  2VXK A;  4MCS A;  4CAE A;  4P45 A;  4CGO A;  4FD5 A;  4UIA A;  4MHN A;  1CX8 A;  4KSF A;  4CYN A;  1DE4 C;  2C6C A;  4A37 A;  3PBE A;  4NJQ A;  3KI9 A;  4BBH A;  2CNS A;  2OH1 A;  2WZN A;  3NH5 A;  4ZY1 A;  1CJW A;  1KUY A;  2WUU A;  4H2K A;  4KOS A;  3TTH A;  5BWA B;  1ARL A;  2V8G A;  2PJB A;  2ANP A;  4JXR A;  4XPD B;  3T9Y A;  3W6X A;  4OC5 A;  2WPX A;  5E96 A;  3W91 A;  4G1P A;  3E0K A;  2QYV A;  3PEI A;  3PFO A;  4KS9 A;  4MFP A;  3SXO A;  4OC4 A;  3RBU A;  3WC5 A;  1FT7 A;  5G1Z A;  2ZXV A;  2Z3P A;  3IIB A;  2ZW4 A;  5G21 A;  4BD9 A;  2VZY A;  1Z4E A;  5LYI A;  2EK8 A;  4FWU A;  2F5I A;  4P4E A;  4PXE A;  5H84 A;  4YWY A;  4UFX A;  4EFD A;  2EK9 A;  4TNU A;  2PJ1 A;  3IWG A;  4WWV A;  3SI2 A;  3EXN A;  4L8A A;  5JGF A;  1IYL A;  3EFA A;  2FVG A;  1IOI A;  3B7I A;  5IV0 A;  4A95 A;  4ORF A;  3WC7 A;  1I1D A;  4KLV A;  3D7H A;  4UFW A;  3KKW A;  1IY7 A;  2PR8 A;  5LRK A;  4II9 A;  1NSA A;  3SHP A;  3VAR A;  1P4N A;  2C27 A;  1L0C A;  2O4H A;  5F47 A;  4CPA A;  7CPA A;  4IAV A;  5LYD A;  3R9F A;  5ELY A;  1GYT A;  2PIZ A;  2QVP A;  3RNZ A;  1QQ9 A;  4F9V A;  3KQX A;  5JPH A;  3FEE A;  4C68 A;  2YNE A;  4NFR A;  3L2N A;  4H6U A;  2OZH A;  2Z3K A;  4QVT A;  1WK4 A;  1QSO A;  3FF3 A;  5HVF A;  4NXY A;  5CBM A;  3CXS A;  1JQG A;  4NGP A;  1XEB A;  1Z8T A;  4CGP A;  2PDO A;  2BL1 A;  3DR8 A;  3C26 A;  1PCA A;  2P6E A;  3MGD A;  2AFU A;  1S7N A;  1LCP A;  2YNC C;  3IEH A;  4FD4 A;  3QB8 A;  1NMT A;  1TKH A;  3B3S A;  3F0A A;  1AYE A;  2CF4 A;  2PC1 A;  1TF8 A;  4JLY A;  4R57 A;  4B13 A;  4XNH C;  4WJB A;  2Q4Y A;  3RAM A;  3S6K A;  3DDD A;  3RO0 A;  2GFQ A;  4B14 A;  4BIN A;  4UWJ A;  1BOB A;  1UWY A;  3JTK A;  3UY5 A;  2POK A;  3MRU A;  2D4P A;  4PXD A;  4UIB A;  3FED A;  1Y0Y A;  2CY2 A;  2FE7 A;  2R8V A;  4IK2 A;  4UBR A;  3I9S A;  4A32 A;  4B5O A;  2VBQ A;  4FUU A;  6CPA A;  5F09 A;  3SJX A;  5K8N A;  3SI1 A;  1K4J A;  5AG7 A;  4DYO A;  1Y9K A;  3GY9 A;  3PBB A;  3I1U A;  4CAV A;  3DNS A;  3IO1 A;  5CPA A;  5JM6 A;  4KOR A;  2JDC A;  2XEJ A;  3GLJ A;  5KTA A;  1PU9 A;  3LWU A;  2Q7B A;  3CZX A;  1TXR A;  2C1C A;  2VZZ A;  2GRE A;  4P44 A;  2Q4Z A;  1Y7E A;  2BCO A;  2FIW A;  4KLW A;  3CPX A;  1LOK A;  4KUB A;  3DLJ A;  1VGY A;  1QST A;  2ZEF A;  3BLN A;  3R95 A;  2O28 A;  3SJE A;  3N7Z A;  1YW6 A;  2QIR A;  3K9U A;  4MI4 A;  3BJ8 A;  1M4I A;  3P2H A;  4R6T A;  2B5G A;  4FD6 A;  4HNX B;  1P0H A;  2DPT A;  4A30 A;  2V8D A;  4UEE A;  4OID A;  4M3S A;  2JBK A;  2GU2 A;  4B6Z A;  1R43 A;  3CXP A;  4A33 A;  1XFO A;  2OZG A;  3KZW A;  2JEV A;  1HDU A;  1CPX A;  2C6G A;  2EO8 A;  3H8E A;  1CBX A;  2GAN A;  3B35 A;  3R1K A;  5GCN A;  2EBJ A;  2GIV A;  2AE6 A;  2ZEE A;  4KOX A;  1KUX A;  4RI1 A;  3W6S A;  4B5P B;  4MXU A;  3V7Z A;  1BO4 A;  2GLF A;  3FIX A;  4ONW A;  3FYN A;  3G3S A;  1Q2D A;  5AG6 A;  2G9D A;  4U9Y A;  5JH9 A;  5D29 A;  2PIY A;  2Q04 A;  1XJO A;  3KQZ A;  4F0Y A;  3T90 A;  5AG5 A;  4DUK A;  4XPK A;  1YW4 A;  3TOB A;  4JWP A;  4PV6 A;  3TCV A;  4Z65 A;  3FB3 A;  5HMN A;  4LUA A;  2ABZ A;  1YR0 A;  1YLE A;  2CIJ A;  2VI7 A;  1LAN A;  3D67 A;  4KOY A;  2CNT A;  1XIX A;  1M4D A;  3TFY A;  3ZZI A;  2AFM A;  3WT4 A;  2FS5 A;  4FBE A;  2PRQ A;  2EUI A;  3V8I A;  3CT9 A;  4NGQ A;  3R96 A;  1IGB A;  1YRE A;  1ZG8 A;  2XEG A;  2ZEP A;  3H5Z A;  1Z2L A;  1Z5R A;  4OP4 A;  3GYA A;  4KOW A;  2PJ7 A;  3P2F A;  1ON0 A;  5JQ4 A;  2DEA A;  2I3C A;  4H89 A;  4C7H A;  2J8R A;  2OZU A;  4MY3 A;  2NYQ A;  4M6I A;  4MHZ A;  3KHX A;  1S3Z A;  4KZT A;  4PPZ A;  1IOF A;  4E8O A;  2CTB A;  2D4O A;  4K30 A;  4MMO A;  3KAS A;  5I0C A;  3PB8 X;  1XE4 A;  1XRY A;  2C6P A;  2VL1 A;  2Z10 A;  4NEX A;  4JXQ A;  8CPA A;  2WYR A;  3FH4 A;  2B4B A;  1VHO A;  4OLL A;  1YME A;  3KR5 A;  1J4J A;  4HKF A;  2YGW A;  4YRH A;  4Q7A A;  4AB7 A;  2A4N A;  4ZGY B;  2G3A A;  4KSI A;  3EY5 A;  4ZX9 A;  3S6G A;  1XF8 A;  1Q7L A;  4OAE A;  4PSW A;  1YSJ A;  2ATR A;  3CXQ A;  1PUA A;  3F8K A;  4MHY A;  1VHS A;  1MJB A;  3FX6 A;  2ZOF A;  2QJ8 A;  1Q2C A;  1ZO0 A;  4AVB A;  3CDX A;  1FY7 A;  2R1I A;  1UFH A;  2PCU A;  3QAH A;  5HXD A;  5K8M A;  2B3V A;  4LQ6 A;  4UWI A;  1SQH A;  3FMC A;  4F9U A;  1V0C A;  1XMT A;  1KUV A;  3V38 A;  4CYP A;  4FAI A;  4TWE A;  3FRM A;  2AFW A;  3D66 A;  2P0W A;  3PGP A;  4Y49 C;  4YU9 A;  1ELL P;  3GKR A;  2B4D B;  4PXB A;  5DS0 A;  3T8W A;  3WR7 A;  4U9Z A;  1YQE A;  1IID A;  3LD2 A;  4YGO A;  4CGN A;  1N71 A;  2BSW A;  2J8N A;  3D3S A;  4P10 A;  1TKF A;  2PQ8 A;  5C88 A;  2ZW5 A;  4Y49 B;  4AVC A;  2IMO A;  3JRU A;  5HH1 A;  4OC1 A;  1ZLH A;  1B87 A;  3I3G A;  4CS0 B;  5K8P A;  2HV2 A;  4EVY A;  3PB9 X;  3H4Q A;  4MFZ A;  1H8L A;  1I21 A;  4ZX8 A;  3IU1 A;  1IB1 E;  3PB6 X;  2JLM A;  3S9L A;  2R98 A;  1YVK A;  4NJR A;  2QML A;  2PR1 A;  5IB0 A;  1MJA A;  4PK2 A; 
#chains in the Genus database with same CATH homology
 4P4I A;  4X2T A;  3KL9 A;  4X3R A;  3ISX A;  3PRT A;  4ZY0 A;  2Q51 A;  3B3W A;  4JYW A;  4X8I A;  1CPS A;  2ZEL A;  2PJC A;  4O23 A;  4EWT A;  1F2O A;  3BHX A;  4IHM A;  5IB9 A;  4GM5 A;  1R3N A;  2ZEM A;  1ZG9 A;  3IC1 A;  4P4J A;  1VHE A;  3BI1 A;  2PJ4 A;  3VAT A;  3PB4 X;  2BOA A;  4P4F A;  3LMS A;  2HC9 A;  2AFO A;  3NH4 A;  1Y0R A;  2F8H A;  3NH8 A;  4NGM A;  4P4B A;  3DGV A;  4OIW A;  4DJL A;  3NA6 A;  3KHZ A;  4NGT A;  3S9N A;  3B3C A;  3NFZ A;  3SJG A;  4JZ0 A;  1XBU A;  3B3T A;  3BXM A;  3B2Y A;  3H8G A;  3KGQ A;  3HUV A;  5K8O A;  2HB6 A;  3BI0 A;  4MHP A;  3IWW A;  1RTQ A;  2PJ2 A;  1BPN A;  4OME A;  4ZYQ A;  1PYT B;  5THW A;  2PVW A;  4EME A;  4UEF A;  1ARM A;  1ELM P;  2PE3 A;  2CTC A;  2PJ3 A;  2PJ5 A;  2JBJ A;  4ZI6 A;  4R7M A;  4MCQ A;  5HVG A;  3D68 A;  3ISZ A;  5LRG A;  5HVH A;  2Q43 A;  2GLJ A;  4R8F A;  2ZED A;  3S9M A;  5LYF A;  1BAV A;  2RFH A;  3D7G A;  5J1Q A;  5LRJ A;  3IFE A;  5D8N A;  3VH9 A;  3FVL A;  1YLO A;  3FEC A;  3D7F A;  4P6Y A;  1TKJ A;  1M4L A;  4A38 A;  1KWM A;  2ZEG A;  3PB7 X;  3SI0 A;  3SJF A;  1BPM A;  1Z8L A;  3K2K A;  4MRI A;  1AMP A;  1TF9 A;  2PJ9 A;  2RB7 A;  2V8V A;  3K9T A;  3IJ3 A;  1HEE A;  2PJ6 A;  3WAB A;  2PJA A;  2IQ6 A;  2BO9 A;  4MCR A;  4MCP A;  1XMB A;  4NGS A;  3N5F A;  3RZA A;  3KR4 A;  3CPA A;  2OOT A;  2J9A A;  4PXC A;  1QMU A;  3WC6 A;  1EE3 P;  2ZEO A;  2ZEH A;  1CP6 A;  3GUX A;  4OC2 A;  2AFX A;  1F57 A;  2V8H A;  4RUH A;  3GB0 A;  4UF4 A;  1VIX A;  1LAM A;  3MN8 A;  1ZLI A;  2O53 A;  3D4U A;  1CG2 A;  3TC8 A;  1LAP A;  3QNV A;  1F2P A;  2NSM A;  2PJ0 A;  4A39 A;  4AXV A;  3H8F A;  1DTD A;  2OR4 A;  2V77 A;  2XEF A;  4A94 A;  1FNO A;  5LYL A;  4R76 A;  4ZY2 A;  3PFE A;  1OBR A;  4K3N A;  4PQA A;  4NGN A;  2JEW A;  4W9Y A;  4NGR A;  2PJ8 A;  3TX8 A;  2XEI A;  4UEZ A;  1HDQ A;  2IJZ A;  5JM6 A;  4LQG A;  2PVV A;  4OC3 A;  3HLP A;  1CP7 A;  1LFW A;  2EWB A;  1ZG7 A;  2AFZ A;  5I4M A;  2F7V A;  3B3V A;  4P4D A;  4F8Z A;  2ZEN A;  4OKO A;  3FJU A;  3D7D A;  4OC0 A;  2AFS A;  1BLL E;  2ZOG A;  4MCS A;  4P45 A;  4UIA A;  4MHN A;  1CX8 A;  1DE4 C;  2C6C A;  4A37 A;  3PBE A;  4NJQ A;  3KI9 A;  3NH5 A;  2WZN A;  4ZY1 A;  4H2K A;  1ARL A;  2V8G A;  2PJB A;  2ANP A;  4OC5 A;  4G1P A;  3PEI A;  2QYV A;  3PFO A;  4OC4 A;  3RBU A;  3WC5 A;  1FT7 A;  3IIB A;  4BD9 A;  5LYI A;  2EK8 A;  4FWU A;  4P4E A;  4PXE A;  4YWY A;  4EFD A;  2EK9 A;  4TNU A;  2PJ1 A;  4WWV A;  3SI2 A;  2FVG A;  3B7I A;  3WC7 A;  3D7H A;  1IY7 A;  5LRK A;  1NSA A;  3VAR A;  2O4H A;  4CPA A;  7CPA A;  4IAV A;  5LYD A;  5ELY A;  1GYT A;  2PIZ A;  2QVP A;  1QQ9 A;  4F9V A;  3KQX A;  3FEE A;  4NFR A;  3L2N A;  5HVF A;  5CBM A;  3FF3 A;  1JQG A;  4NGP A;  1PCA A;  2AFU A;  1LCP A;  3IEH A;  1TKH A;  3B3S A;  1AYE A;  2CF4 A;  1TF8 A;  4WJB A;  3RAM A;  1UWY A;  2POK A;  3MRU A;  4PXD A;  4UIB A;  3FED A;  1Y0Y A;  4IK2 A;  3WT4 A;  6CPA A;  4FUU A;  5F09 A;  3SJX A;  5K8N A;  3SI1 A;  4DYO A;  3PBB A;  3I1U A;  3IO1 A;  5CPA A;  2XEJ A;  3GLJ A;  3LWU A;  1TXR A;  2C1C A;  2GRE A;  4P44 A;  2Q4Z A;  1Y7E A;  2BCO A;  3CPX A;  1LOK A;  3DLJ A;  1VGY A;  2ZEF A;  3SJE A;  1YW6 A;  4R6T A;  2V8D A;  4UEE A;  4OID A;  2JBK A;  2GU2 A;  4B6Z A;  1R43 A;  1XFO A;  3KZW A;  1HDU A;  1CPX A;  2C6G A;  3H8E A;  5JGF A;  1CBX A;  3B35 A;  2ZEE A;  4MXU A;  3V7Z A;  2GLF A;  4ONW A;  2G9D A;  5JH9 A;  5D29 A;  2PIY A;  3KQZ A;  1XJO A;  4DUK A;  1YW4 A;  4Z65 A;  2ABZ A;  2CIJ A;  3D67 A;  1LAN A;  2AFM A;  4FBE A;  2PRQ A;  3CT9 A;  4NGQ A;  1IGB A;  2XEG A;  1ZG8 A;  2ZEP A;  1Z2L A;  1Z5R A;  4OP4 A;  2PJ7 A;  2DEA A;  2I3C A;  2NYQ A;  4PPZ A;  4MHZ A;  3KHX A;  2CTB A;  4MMO A;  3KAS A;  3PB8 X;  1XRY A;  2C6P A;  2VL1 A;  8CPA A;  2WYR A;  3FH4 A;  1VHO A;  1YME A;  3KR5 A;  4Q7A A;  4KSI A;  4ZX9 A;  1Q7L A;  1YSJ A;  4MHY A;  3FX6 A;  2ZOF A;  2QJ8 A;  3CDX A;  2PCU A;  5HXD A;  5K8M A;  3FMC A;  4F9U A;  3V38 A;  4FAI A;  4TWE A;  2AFW A;  3D66 A;  4YU9 A;  1ELL P;  5DS0 A;  4PXB A;  3T8W A;  4P10 A;  1TKF A;  2IMO A;  3JRU A;  4OC1 A;  1ZLH A;  5K8P A;  3PB9 X;  1H8L A;  4ZX8 A;  3PB6 X;  3S9L A;  4NJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...