1XSBA

Structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp. no atp restraints included
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
153
Chain Sequence
b'GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bis(5'-nucleosyl)-tetraphosphatase
publication title Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 153
sequence length 153
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1xsbA00
1IRYA 3A6UA 3A6SA 4DYWA 1JKNA 1VC9A 1HX3A 2Q9PA 3MCFA 3CNGA 4JZTA 3Q4IA 4KG4A 5CFIA 3X0PA 3GRNA 3ZR0A 3GZ6A 2A8PA 3BM4A 1V8NA 3N9UA 2ICKA 5FSOA 4JZSA 4NFWA 2DUKA 2CL3A 3X0KA 2AZWA 2KDVA 4KYXA 1V8MA 1KTGA 2VNPA 3X0MA 2YVNA 3GZ5A 4HVYA 4N1TA 2QJOA 3ZR1A 2W4EA 2RRKA 2I8UA 3ACAA 2DSDA 1PPWA 1Q33A 4JZUA 3MDGA 1F3YA 2YYHA 3HHJA 2JVBA 1I9AA 2A8SA 1VHGA 2B2KA 3BHOA 3I7UA 1VIQA 3ID9A 4IJXA 1SOIA 1KT9A 3SMDA 3N77A 5GHIA 5DD4A 2O1CA 3GG6A 2O5WA 4V14A 1XSBA 5GHOA 3GWYA 1R67A 2ICJA 1VK6A 1MP2A 5GHNA 4JZVA 1X83A 5GHJA 1GA7A 1HZTA 4ICKA 3HYQA 2B0VA 3DKUA 1PPXA 3O52A 4S2WA 5FSNA 1JRKA 5I8UA 4N1UA 1Q27A 4KTBA 1V8VA 5ANSA 3I9XA 2QKMB 3A6TA 2A6TA 1SJYA 1X84A 2GB5A 3FJYA 3L85A 3QSJA 5BONA 4YPRA 1VC8A 3EEUA 3GZ8A 4YOQA 2A8RA 2DHOA 2YVPA 3MGMA 2YVMA 1KHZA 1X51A 2DSCA 5ANUA 1VHZA 3X0OA 5IW5A 2J8QA 2B06A 2PQVA 1PUSA 3O61A 3Q1PA 3SONA 3O69A 1K2EA 3Q2SA 5ANVA 1NQZA 5GHQA 2FMLA 1XSCA 2A8QA 1MR2A 2XSQA 1V8UA 2GT2A 1PUQA 5FSLA 1MUTA 3DUPA 1RRQA 4S2XA 1SU2A 2GT4A 4NFXA 3X0LA 3F6AA 5FSIA 4C9WA 5GHPA 1RRSA 1MK1A 1G9QA 1V8YA 2G74A 4C9XA 5C8LA 5LPGA 2FKBA 3KVHA 1NQYA 4HFQA 1TUMA 1VIUA 2I6KA 3O6ZA 5BS6A 1SZ3A 2FVVA 2R5WA 3AC9A 3FK9A 3SHDA 1MQEA 2G73A 5FSMA 3I7VA 2A8TA 3R03A 4S2YA 4YPHA 3F13A 4MPOA 5DEQA 3X0QA 1V8RA 3J7Ye 1XSAA 3X0NA 3BAPA 3EF5A 3X0JA 5C7TA 1K26A 2I8TA 3A6VA 1Q54A 3G0QA 5FSKA 3COUA 2PNYA 3Q93A 1PPVA 5IW4A 2DSBA 3MDIA 3EXQA 3FFUA 3Q91A 4KG3A 5GHMA 5ANWA 1V8TA 1V8LA 4ILQA 4ZG0A 5DDGA 1RYAA 2VNQA 3FCMA 5C7QA 3X0SA 3RH7A 3OGAA 3E57A 3U53A 3EESA 3P5TA 1OW2A 4S2VA 5ISYA 4K6EA 1QVJA 1VCDA 1MQWA 1V8SA 1NFSA 1V8WA 3WHWA 5CFJA 1VRLA 1U20A 1V8IA 5ANTA 3FSPA 1NFZA 1PVFA 2O5FA 2YVOA 3P6YA 5DPKA 3X0IA 3Q2TA 3H95A 2KDWA 3X0RA 1G0SA 5HZXA 2QJTA 1PUNA 3O8SA
chains in the Genus database with same CATH superfamily
1IRYA 3A6UA 3A6SA 4DYWA 1JKNA 1VC9A 1HX3A 2Q9PA 3MCFA 3CNGA 4JZTA 3Q4IA 4KG4A 5CFIA 3X0PA 3GRNA 3ZR0A 3GZ6A 2A8PA 4J7GA 3BM4A 1V8NA 3N9UA 2ICKA 5FSOA 4JZSA 4NFWA 2DUKA 2CL3A 3X0KA 2AZWA 2KDVA 4KYXA 1V8MA 1KTGA 2VNPA 3X0MA 2YVNA 3GZ5A 4HVYA 4N1TA 2QJOA 3ZR1A 2W4EA 2RRKA 2I8UA 3ACAA 2DSDA 1PPWA 1Q33A 4JZUA 3MDGA 1F3YA 2YYHA 3HHJA 2JVBA 1I9AA 2A8SA 1VHGA 2B2KA 3BHOA 3I7UA 1VIQA 3ID9A 4IJXA 1SOIA 1KT9A 3SMDA 3N77A 5GHIA 5DD4A 2O1CA 3GG6A 2O5WA 4V14A 1XSBA 5GHOA 3GWYA 1R67A 2ICJA 1VK6A 1MP2A 5GHNA 4JZVA 1X83A 5GHJA 1GA7A 1HZTA 4ICKA 3HYQA 2B0VA 3DKUA 1PPXA 3O52A 4S2WA 5FSNA 1JRKA 5I8UA 4N1UA 1Q27A 4KTBA 1V8VA 5ANSA 3I9XA 2QKMB 3A6TA 2A6TA 1SJYA 1X84A 2GB5A 3FJYA 3L85A 3QSJA 5BONA 4YPRA 1VC8A 3EEUA 3GZ8A 4YOQA 2A8RA 2DHOA 2YVPA 3MGMA 2YVMA 1KHZA 1X51A 2DSCA 5ANUA 1VHZA 3X0OA 5IW5A 2J8QA 2B06A 2PQVA 1PUSA 3O61A 3Q1PA 3SONA 3O69A 1K2EA 3Q2SA 5ANVA 1NQZA 5GHQA 2FMLA 1XSCA 2A8QA 1MR2A 2XSQA 1V8UA 2GT2A 1PUQA 5FSLA 1MUTA 3DUPA 1RRQA 4S2XA 1SU2A 2GT4A 4NFXA 3X0LA 3F6AA 5FSIA 4C9WA 5GHPA 1RRSA 1MK1A 1G9QA 1V8YA 2G74A 4C9XA 5C8LA 5LPGA 2FKBA 3KVHA 1NQYA 4HFQA 1TUMA 1VIUA 2I6KA 3O6ZA 5BS6A 1SZ3A 2FVVA 2R5WA 3AC9A 3FK9A 3SHDA 1MQEA 2G73A 5FSMA 3I7VA 2A8TA 3R03A 4S2YA 4YPHA 3F13A 4MPOA 5DEQA 3X0QA 1V8RA 3J7Ye 1XSAA 3X0NA 3BAPA 3EF5A 3X0JA 5C7TA 1K26A 2I8TA 3A6VA 1Q54A 3G0QA 5FSKA 3COUA 2PNYA 3Q93A 1PPVA 5IW4A 2DSBA 3MDIA 3EXQA 3FFUA 3Q91A 4KG3A 5GHMA 5ANWA 1V8TA 1V8LA 4ILQA 4ZG0A 5DDGA 1RYAA 2VNQA 3FCMA 5C7QA 2CZRA 3X0SA 3RH7A 3OGAA 3E57A 3U53A 3EESA 3P5TA 1OW2A 4S2VA 5ISYA 4K6EA 1QVJA 1VCDA 1MQWA 1V8SA 1NFSA 1V8WA 3WHWA 5CFJA 1VRLA 1U20A 1V8IA 5ANTA 3FSPA 1NFZA 1PVFA 2O5FA 2YVOA 3P6YA 5DPKA 3X0IA 3Q2TA 3H95A 4J7HA 2KDWA 3X0RA 1G0SA 5HZXA 2QJTA 1PUNA 3O8SA
chains in the Genus database with same CATH topology
1IRYA 3A6UA 3A6SA 4DYWA 1JKNA 1VC9A 1HX3A 2Q9PA 3MCFA 3CNGA 4JZTA 3Q4IA 4KG4A 5CFIA 3X0PA 3GRNA 3ZR0A 3GZ6A 2A8PA 4J7GA 3BM4A 1V8NA 3N9UA 2ICKA 5FSOA 4JZSA 4NFWA 2DUKA 2CL3A 3X0KA 2AZWA 2KDVA 4KYXA 1V8MA 1KTGA 2VNPA 3X0MA 2YVNA 3GZ5A 4HVYA 4N1TA 2QJOA 3ZR1A 2W4EA 2RRKA 2I8UA 3ACAA 2DSDA 1PPWA 1Q33A 4JZUA 3MDGA 1F3YA 2YYHA 3HHJA 2JVBA 1I9AA 2A8SA 1VHGA 2B2KA 3BHOA 3I7UA 1VIQA 3ID9A 4IJXA 1SOIA 1KT9A 3SMDA 3N77A 5GHIA 5DD4A 2O1CA 3GG6A 2O5WA 4V14A 1XSBA 5GHOA 3GWYA 1R67A 2ICJA 1VK6A 1MP2A 5GHNA 4JZVA 1X83A 5GHJA 1GA7A 1HZTA 4ICKA 3HYQA 2B0VA 3DKUA 1PPXA 3O52A 4S2WA 5FSNA 1JRKA 5I8UA 4N1UA 1Q27A 4KTBA 1V8VA 5ANSA 3I9XA 2QKMB 3A6TA 2A6TA 1SJYA 1X84A 2GB5A 3FJYA 3L85A 3QSJA 5BONA 4YPRA 1VC8A 3EEUA 3GZ8A 4YOQA 2A8RA 2DHOA 2YVPA 3MGMA 2YVMA 1KHZA 1X51A 2DSCA 5ANUA 1VHZA 3X0OA 5IW5A 2J8QA 2B06A 2PQVA 1PUSA 3O61A 3Q1PA 3SONA 3O69A 1K2EA 3Q2SA 5ANVA 1NQZA 5GHQA 2FMLA 1XSCA 2A8QA 1MR2A 2XSQA 1V8UA 2GT2A 1PUQA 5FSLA 1MUTA 3DUPA 1RRQA 4S2XA 1SU2A 2GT4A 4NFXA 3X0LA 3F6AA 5FSIA 4C9WA 5GHPA 1RRSA 1MK1A 1G9QA 1V8YA 2G74A 4C9XA 5C8LA 5LPGA 2FKBA 3KVHA 1NQYA 4HFQA 1TUMA 1VIUA 2I6KA 3O6ZA 5BS6A 1SZ3A 2FVVA 2R5WA 3AC9A 3FK9A 3SHDA 1MQEA 2G73A 5FSMA 3I7VA 2A8TA 3R03A 4S2YA 4YPHA 3F13A 4MPOA 5DEQA 3X0QA 1V8RA 3J7Ye 1XSAA 3X0NA 3BAPA 3EF5A 3X0JA 5C7TA 1K26A 2I8TA 3A6VA 1Q54A 3G0QA 5FSKA 3COUA 2PNYA 3Q93A 1PPVA 5IW4A 2DSBA 3MDIA 3EXQA 3FFUA 3Q91A 4KG3A 5GHMA 5ANWA 1V8TA 1V8LA 4ILQA 4ZG0A 5DDGA 1RYAA 2VNQA 3FCMA 5C7QA 2CZRA 3X0SA 3RH7A 3OGAA 3E57A 3U53A 3EESA 3P5TA 1OW2A 4S2VA 5ISYA 4K6EA 1QVJA 1VCDA 1MQWA 1V8SA 1NFSA 1V8WA 3WHWA 5CFJA 1VRLA 1U20A 1V8IA 5ANTA 3FSPA 1NFZA 1PVFA 2O5FA 2YVOA 3P6YA 5DPKA 3X0IA 3Q2TA 3H95A 4J7HA 2KDWA 3X0RA 1G0SA 5HZXA 2QJTA 1PUNA 3O8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRY A;  3A6U A;  3A6S A;  4DYW A;  1JKN A;  1VC9 A;  1HX3 A;  2Q9P A;  3MCF A;  3CNG A;  4JZT A;  3Q4I A;  4KG4 A;  5CFI A;  3X0P A;  3GRN A;  3ZR0 A;  3GZ6 A;  2A8P A;  3BM4 A;  1V8N A;  3N9U A;  2ICK A;  5FSO A;  4JZS A;  4NFW A;  2DUK A;  2CL3 A;  3X0K A;  2AZW A;  2KDV A;  4KYX A;  1V8M A;  1KTG A;  2VNP A;  3X0M A;  2YVN A;  3GZ5 A;  4HVY A;  4N1T A;  2QJO A;  3ZR1 A;  2W4E A;  2RRK A;  2I8U A;  3ACA A;  2DSD A;  1PPW A;  1Q33 A;  4JZU A;  3MDG A;  1F3Y A;  2YYH A;  3HHJ A;  2JVB A;  1I9A A;  2A8S A;  1VHG A;  2B2K A;  3BHO A;  3I7U A;  1VIQ A;  3ID9 A;  4IJX A;  1SOI A;  1KT9 A;  3SMD A;  3N77 A;  5GHI A;  5DD4 A;  2O1C A;  3GG6 A;  2O5W A;  4V14 A;  1XSB A;  5GHO A;  3GWY A;  1R67 A;  2ICJ A;  1VK6 A;  1MP2 A;  5GHN A;  4JZV A;  1X83 A;  5GHJ A;  1GA7 A;  1HZT A;  4ICK A;  3HYQ A;  2B0V A;  3DKU A;  1PPX A;  3O52 A;  4S2W A;  5FSN A;  1JRK A;  5I8U A;  4N1U A;  1Q27 A;  4KTB A;  1V8V A;  5ANS A;  3I9X A;  2QKM B;  3A6T A;  2A6T A;  1SJY A;  1X84 A;  2GB5 A;  3FJY A;  3L85 A;  3QSJ A;  5BON A;  4YPR A;  1VC8 A;  3EEU A;  3GZ8 A;  4YOQ A;  2A8R A;  2DHO A;  2YVP A;  3MGM A;  2YVM A;  1KHZ A;  1X51 A;  2DSC A;  5ANU A;  1VHZ A;  3X0O A;  5IW5 A;  2J8Q A;  2B06 A;  2PQV A;  1PUS A;  3O61 A;  3Q1P A;  3SON A;  3O69 A;  1K2E A;  3Q2S A;  5ANV A;  1NQZ A;  5GHQ A;  2FML A;  1XSC A;  2A8Q A;  1MR2 A;  2XSQ A;  1V8U A;  2GT2 A;  1PUQ A;  5FSL A;  1MUT A;  3DUP A;  1RRQ A;  4S2X A;  1SU2 A;  2GT4 A;  4NFX A;  3X0L A;  3F6A A;  5FSI A;  4C9W A;  5GHP A;  1RRS A;  1MK1 A;  1G9Q A;  1V8Y A;  2G74 A;  4C9X A;  5C8L A;  5LPG A;  2FKB A;  3KVH A;  1NQY A;  4HFQ A;  1TUM A;  1VIU A;  2I6K A;  3O6Z A;  5BS6 A;  1SZ3 A;  2FVV A;  2R5W A;  3AC9 A;  3FK9 A;  3SHD A;  1MQE A;  2G73 A;  5FSM A;  3I7V A;  2A8T A;  3R03 A;  4S2Y A;  4YPH A;  3F13 A;  4MPO A;  5DEQ A;  3X0Q A;  1V8R A;  3J7Y e;  1XSA A;  3X0N A;  3BAP A;  3EF5 A;  3X0J A;  5C7T A;  1K26 A;  2I8T A;  3A6V A;  1Q54 A;  3G0Q A;  5FSK A;  3COU A;  2PNY A;  3Q93 A;  1PPV A;  5IW4 A;  2DSB A;  3MDI A;  3EXQ A;  3FFU A;  3Q91 A;  4KG3 A;  5GHM A;  5ANW A;  1V8T A;  1V8L A;  4ILQ A;  4ZG0 A;  5DDG A;  1RYA A;  2VNQ A;  3FCM A;  5C7Q A;  3X0S A;  3RH7 A;  3OGA A;  3E57 A;  3U53 A;  3EES A;  3P5T A;  1OW2 A;  4S2V A;  5ISY A;  4K6E A;  1QVJ A;  1VCD A;  1MQW A;  1V8S A;  1NFS A;  1V8W A;  3WHW A;  5CFJ A;  1VRL A;  1U20 A;  1V8I A;  5ANT A;  3FSP A;  1NFZ A;  1PVF A;  2O5F A;  2YVO A;  3P6Y A;  5DPK A;  3X0I A;  3Q2T A;  3H95 A;  2KDW A;  3X0R A;  1G0S A;  5HZX A;  2QJT A;  1PUN A;  3O8S A; 
#chains in the Genus database with same CATH topology
 1IRY A;  3A6U A;  3A6S A;  4DYW A;  1JKN A;  1VC9 A;  1HX3 A;  2Q9P A;  3MCF A;  3CNG A;  4JZT A;  3Q4I A;  4KG4 A;  5CFI A;  3X0P A;  3GRN A;  3ZR0 A;  3GZ6 A;  2A8P A;  4J7G A;  3BM4 A;  1V8N A;  3N9U A;  2ICK A;  5FSO A;  4JZS A;  4NFW A;  2DUK A;  2CL3 A;  3X0K A;  2AZW A;  2KDV A;  4KYX A;  1V8M A;  1KTG A;  2VNP A;  3X0M A;  2YVN A;  3GZ5 A;  4HVY A;  4N1T A;  2QJO A;  3ZR1 A;  2W4E A;  2RRK A;  2I8U A;  3ACA A;  2DSD A;  1PPW A;  1Q33 A;  4JZU A;  3MDG A;  1F3Y A;  2YYH A;  3HHJ A;  2JVB A;  1I9A A;  2A8S A;  1VHG A;  2B2K A;  3BHO A;  3I7U A;  1VIQ A;  3ID9 A;  4IJX A;  1SOI A;  1KT9 A;  3SMD A;  3N77 A;  5GHI A;  5DD4 A;  2O1C A;  3GG6 A;  2O5W A;  4V14 A;  1XSB A;  5GHO A;  3GWY A;  1R67 A;  2ICJ A;  1VK6 A;  1MP2 A;  5GHN A;  4JZV A;  1X83 A;  5GHJ A;  1GA7 A;  1HZT A;  4ICK A;  3HYQ A;  2B0V A;  3DKU A;  1PPX A;  3O52 A;  4S2W A;  5FSN A;  1JRK A;  5I8U A;  4N1U A;  1Q27 A;  4KTB A;  1V8V A;  5ANS A;  3I9X A;  2QKM B;  3A6T A;  2A6T A;  1SJY A;  1X84 A;  2GB5 A;  3FJY A;  3L85 A;  3QSJ A;  5BON A;  4YPR A;  1VC8 A;  3EEU A;  3GZ8 A;  4YOQ A;  2A8R A;  2DHO A;  2YVP A;  3MGM A;  2YVM A;  1KHZ A;  1X51 A;  2DSC A;  5ANU A;  1VHZ A;  3X0O A;  5IW5 A;  2J8Q A;  2B06 A;  2PQV A;  1PUS A;  3O61 A;  3Q1P A;  3SON A;  3O69 A;  1K2E A;  3Q2S A;  5ANV A;  1NQZ A;  5GHQ A;  2FML A;  1XSC A;  2A8Q A;  1MR2 A;  2XSQ A;  1V8U A;  2GT2 A;  1PUQ A;  5FSL A;  1MUT A;  3DUP A;  1RRQ A;  4S2X A;  1SU2 A;  2GT4 A;  4NFX A;  3X0L A;  3F6A A;  5FSI A;  4C9W A;  5GHP A;  1RRS A;  1MK1 A;  1G9Q A;  1V8Y A;  2G74 A;  4C9X A;  5C8L A;  5LPG A;  2FKB A;  3KVH A;  1NQY A;  4HFQ A;  1TUM A;  1VIU A;  2I6K A;  3O6Z A;  5BS6 A;  1SZ3 A;  2FVV A;  2R5W A;  3AC9 A;  3FK9 A;  3SHD A;  1MQE A;  2G73 A;  5FSM A;  3I7V A;  2A8T A;  3R03 A;  4S2Y A;  4YPH A;  3F13 A;  4MPO A;  5DEQ A;  3X0Q A;  1V8R A;  3J7Y e;  1XSA A;  3X0N A;  3BAP A;  3EF5 A;  3X0J A;  5C7T A;  1K26 A;  2I8T A;  3A6V A;  1Q54 A;  3G0Q A;  5FSK A;  3COU A;  2PNY A;  3Q93 A;  1PPV A;  5IW4 A;  2DSB A;  3MDI A;  3EXQ A;  3FFU A;  3Q91 A;  4KG3 A;  5GHM A;  5ANW A;  1V8T A;  1V8L A;  4ILQ A;  4ZG0 A;  5DDG A;  1RYA A;  2VNQ A;  3FCM A;  5C7Q A;  2CZR A;  3X0S A;  3RH7 A;  3OGA A;  3E57 A;  3U53 A;  3EES A;  3P5T A;  1OW2 A;  4S2V A;  5ISY A;  4K6E A;  1QVJ A;  1VCD A;  1MQW A;  1V8S A;  1NFS A;  1V8W A;  3WHW A;  5CFJ A;  1VRL A;  1U20 A;  1V8I A;  5ANT A;  3FSP A;  1NFZ A;  1PVF A;  2O5F A;  2YVO A;  3P6Y A;  5DPK A;  3X0I A;  3Q2T A;  3H95 A;  4J7H A;  2KDW A;  3X0R A;  1G0S A;  5HZX A;  2QJT A;  1PUN A;  3O8S A; 
#chains in the Genus database with same CATH homology
 1IRY A;  3A6U A;  3A6S A;  4DYW A;  1JKN A;  1VC9 A;  1HX3 A;  2Q9P A;  3MCF A;  3CNG A;  4JZT A;  3Q4I A;  4KG4 A;  5CFI A;  3X0P A;  3GRN A;  3ZR0 A;  3GZ6 A;  2A8P A;  4J7G A;  3BM4 A;  1V8N A;  3N9U A;  2ICK A;  5FSO A;  4JZS A;  4NFW A;  2DUK A;  2CL3 A;  3X0K A;  2AZW A;  2KDV A;  4KYX A;  1V8M A;  1KTG A;  2VNP A;  3X0M A;  2YVN A;  3GZ5 A;  4HVY A;  4N1T A;  2QJO A;  3ZR1 A;  2W4E A;  2RRK A;  2I8U A;  3ACA A;  2DSD A;  1PPW A;  1Q33 A;  4JZU A;  3MDG A;  1F3Y A;  2YYH A;  3HHJ A;  2JVB A;  1I9A A;  2A8S A;  1VHG A;  2B2K A;  3BHO A;  3I7U A;  1VIQ A;  3ID9 A;  4IJX A;  1SOI A;  1KT9 A;  3SMD A;  3N77 A;  5GHI A;  5DD4 A;  2O1C A;  3GG6 A;  2O5W A;  4V14 A;  1XSB A;  5GHO A;  3GWY A;  1R67 A;  2ICJ A;  1VK6 A;  1MP2 A;  5GHN A;  4JZV A;  1X83 A;  5GHJ A;  1GA7 A;  1HZT A;  4ICK A;  3HYQ A;  2B0V A;  3DKU A;  1PPX A;  3O52 A;  4S2W A;  5FSN A;  1JRK A;  5I8U A;  4N1U A;  1Q27 A;  4KTB A;  1V8V A;  5ANS A;  3I9X A;  2QKM B;  3A6T A;  2A6T A;  1SJY A;  1X84 A;  2GB5 A;  3FJY A;  3L85 A;  3QSJ A;  5BON A;  4YPR A;  1VC8 A;  3EEU A;  3GZ8 A;  4YOQ A;  2A8R A;  2DHO A;  2YVP A;  3MGM A;  2YVM A;  1KHZ A;  1X51 A;  2DSC A;  5ANU A;  1VHZ A;  3X0O A;  5IW5 A;  2J8Q A;  2B06 A;  2PQV A;  1PUS A;  3O61 A;  3Q1P A;  3SON A;  3O69 A;  1K2E A;  3Q2S A;  5ANV A;  1NQZ A;  5GHQ A;  2FML A;  1XSC A;  2A8Q A;  1MR2 A;  2XSQ A;  1V8U A;  2GT2 A;  1PUQ A;  5FSL A;  1MUT A;  3DUP A;  1RRQ A;  4S2X A;  1SU2 A;  2GT4 A;  4NFX A;  3X0L A;  3F6A A;  5FSI A;  4C9W A;  5GHP A;  1RRS A;  1MK1 A;  1G9Q A;  1V8Y A;  2G74 A;  4C9X A;  5C8L A;  5LPG A;  2FKB A;  3KVH A;  1NQY A;  4HFQ A;  1TUM A;  1VIU A;  2I6K A;  3O6Z A;  5BS6 A;  1SZ3 A;  2FVV A;  2R5W A;  3AC9 A;  3FK9 A;  3SHD A;  1MQE A;  2G73 A;  5FSM A;  3I7V A;  2A8T A;  3R03 A;  4S2Y A;  4YPH A;  3F13 A;  4MPO A;  5DEQ A;  3X0Q A;  1V8R A;  3J7Y e;  1XSA A;  3X0N A;  3BAP A;  3EF5 A;  3X0J A;  5C7T A;  1K26 A;  2I8T A;  3A6V A;  1Q54 A;  3G0Q A;  5FSK A;  3COU A;  2PNY A;  3Q93 A;  1PPV A;  5IW4 A;  2DSB A;  3MDI A;  3EXQ A;  3FFU A;  3Q91 A;  4KG3 A;  5GHM A;  5ANW A;  1V8T A;  1V8L A;  4ILQ A;  4ZG0 A;  5DDG A;  1RYA A;  2VNQ A;  3FCM A;  5C7Q A;  2CZR A;  3X0S A;  3RH7 A;  3OGA A;  3E57 A;  3U53 A;  3EES A;  3P5T A;  1OW2 A;  4S2V A;  5ISY A;  4K6E A;  1QVJ A;  1VCD A;  1MQW A;  1V8S A;  1NFS A;  1V8W A;  3WHW A;  5CFJ A;  1VRL A;  1U20 A;  1V8I A;  5ANT A;  3FSP A;  1NFZ A;  1PVF A;  2O5F A;  2YVO A;  3P6Y A;  5DPK A;  3X0I A;  3Q2T A;  3H95 A;  4J7H A;  2KDW A;  3X0R A;  1G0S A;  5HZX A;  2QJT A;  1PUN A;  3O8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...