1XSBA

Structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp. no atp restraints included
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
153
Chain Sequence
GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bis(5'-nucleosyl)-tetraphosphatase
publication title Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 153
sequence length 153
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1xsbA00
2B2KA 2O5WA 2DUKA 1V8RA 1PUSA 2YVPA 3Q93A 3SMDA 5CFIA 5ANTA 3MGMA 3Q2TA 1X51A 2AZWA 2JVBA 2A6TA 2PNYA 3KVHA 4C9WA 4JZSA 1PUNA 1KT9A 3FK9A 2PQVA 1HZTA 3DKUA 4HFQA 3U53A 3X0JA 2I8UA 5DPKA 2I8TA 1V8MA 1V8YA 3FCMA 5ANWA 4S2XA 5GHPA 1MQWA 1SJYA 3X0NA 2G74A 4KG3A 1V8TA 1V8SA 4IJXA 5DDGA 2YVNA 1RRSA 2DSCA 1X84A 2YYHA 3I9XA 5GHMA 4S2YA 2B0VA 5DEQA 4ILQA 3X0QA 4YPHA 4MPOA 2A8QA 3EEUA 4V14A 3E57A 3Q91A 4JZTA 5ISYA 3HYQA 1I9AA 3X0KA 3O69A 3X0OA 3EESA 3I7UA 5FSNA 5GHQA 4KG4A 3SHDA 1G0SA 2QJOA 3SONA 2YVOA 5ANUA 1NFZA 1NQZA 1V8UA 3O6ZA 3X0PA 3OGAA 3EF5A 3A6VA 3X0RA 4DYWA 5CFJA 1IRYA 1VK6A 3R03A 5DD4A 1TUMA 1VHGA 3GWYA 1VIQA 1VRLA 1VCDA 2RRKA 1QVJA 5GHOA 3GZ6A 4NFXA 3BM4A 4KYXA 3MDIA 1OW2A 1V8IA 3Q2SA 1MQEA 5IW5A 1PPVA 5BS6A 3X0IA 1U20A 3ID9A 1G9QA 2VNPA 1XSAA 2A8SA 2QJTA 1MUTA 2R5WA 2FVVA 3L85A 2Q9PA 4N1UA 1PVFA 5C7TA 3P6YA 4JZUA 3F6AA 1SOIA 5I8UA 1RYAA 1V8LA 3MCFA 1MP2A 5GHIA 3COUA 3G0QA 5GHJA 1V8NA 3O52A 3DUPA 3FSPA 1K26A 3O8SA 1VHZA 2YVMA 5FSMA 3X0LA 3GRNA 4JZVA 4ICKA 5ANSA 1R67A 3AC9A 3BHOA 1X83A 5LPGA 4HVYA 2GT4A 1GA7A 2O1CA 3J7Ye 3QSJA 2B06A 1JRKA 4C9XA 4S2WA 1NFSA 5GHNA 4NFWA 3Q1PA 1SU2A 5C8LA 1V8WA 3Q4IA 3X0MA 1VC8A 1KTGA 4K6EA 5FSLA 3H95A 3I7VA 5FSOA 5BONA 1RRQA 2FKBA 1Q27A 4ZG0A 3FJYA 1JKNA 3CNGA 5FSKA 5FSIA 2FMLA 3P5TA 4KTBA 1MK1A 2DSDA 2DHOA 2KDVA 4YOQA 2A8TA 2G73A 3A6SA 1Q33A 1XSBA 2GT2A 3GG6A 2J8QA 3GZ8A 1XSCA 3RH7A 3ZR1A 5IW4A 2GB5A 2QKMB 1VC9A 3WHWA 5C7QA 2I6KA 3MDGA 2A8PA 2ICJA 3A6TA 1KHZA 3EXQA 3BAPA 1NQYA 2A8RA 3ACAA 5HZXA 2O5FA 1VIUA 3GZ5A 5ANVA 3N77A 1PUQA 3HHJA 1PPWA 2ICKA 3O61A 2VNQA 2DSBA 2CL3A 2KDWA 2XSQA 3A6UA 1K2EA 4YPRA 1V8VA 2W4EA 3X0SA 3F13A 1MR2A 1PPXA 4S2VA 3N9UA 3ZR0A 4N1TA 1F3YA 1HX3A 1Q54A 3FFUA 1SZ3A
chains in the Genus database with same CATH superfamily
2B2KA 2O5WA 2DUKA 1V8RA 1PUSA 2YVPA 3Q93A 3SMDA 5CFIA 5ANTA 3MGMA 4J7GA 3Q2TA 1X51A 2AZWA 2JVBA 2A6TA 2PNYA 3KVHA 4C9WA 4JZSA 1PUNA 1KT9A 3FK9A 2PQVA 1HZTA 3DKUA 4HFQA 3U53A 3X0JA 2I8UA 5DPKA 2I8TA 1V8MA 1V8YA 3FCMA 5ANWA 4S2XA 5GHPA 1MQWA 1SJYA 3X0NA 2G74A 4KG3A 1V8TA 1V8SA 4IJXA 5DDGA 2YVNA 1RRSA 2DSCA 1X84A 2YYHA 3I9XA 5GHMA 4S2YA 2B0VA 5DEQA 4ILQA 3X0QA 4YPHA 4MPOA 2A8QA 3EEUA 4V14A 3E57A 3Q91A 4JZTA 5ISYA 3HYQA 1I9AA 3X0KA 3O69A 3X0OA 3EESA 3I7UA 5FSNA 5GHQA 4KG4A 3SHDA 1G0SA 2QJOA 3SONA 2YVOA 5ANUA 1NFZA 1NQZA 1V8UA 3O6ZA 3X0PA 3OGAA 3EF5A 3A6VA 3X0RA 4DYWA 5CFJA 1IRYA 1VK6A 3R03A 5DD4A 1TUMA 1VHGA 3GWYA 1VIQA 1VRLA 1VCDA 2RRKA 1QVJA 5GHOA 3GZ6A 4NFXA 3BM4A 4KYXA 3MDIA 1OW2A 1V8IA 3Q2SA 1MQEA 5IW5A 1PPVA 5BS6A 3X0IA 1U20A 3ID9A 1G9QA 2VNPA 1XSAA 2A8SA 2QJTA 1MUTA 2R5WA 2FVVA 3L85A 2Q9PA 4N1UA 1PVFA 5C7TA 3P6YA 4JZUA 3F6AA 1SOIA 5I8UA 1RYAA 1V8LA 3MCFA 1MP2A 5GHIA 3COUA 3G0QA 4J7HA 5GHJA 1V8NA 3O52A 3DUPA 3FSPA 1K26A 3O8SA 1VHZA 2YVMA 5FSMA 3X0LA 3GRNA 4JZVA 4ICKA 5ANSA 1R67A 3AC9A 3BHOA 1X83A 5LPGA 4HVYA 2GT4A 1GA7A 2O1CA 3J7Ye 3QSJA 2B06A 1JRKA 4C9XA 4S2WA 1NFSA 5GHNA 4NFWA 3Q1PA 1SU2A 5C8LA 1V8WA 3Q4IA 3X0MA 1VC8A 1KTGA 4K6EA 5FSLA 3H95A 3I7VA 5FSOA 5BONA 1RRQA 2FKBA 1Q27A 4ZG0A 3FJYA 1JKNA 3CNGA 5FSKA 5FSIA 2FMLA 3P5TA 4KTBA 1MK1A 2DSDA 2DHOA 2KDVA 4YOQA 2A8TA 2G73A 3A6SA 1Q33A 1XSBA 2GT2A 3GG6A 2J8QA 3GZ8A 1XSCA 3RH7A 3ZR1A 5IW4A 2GB5A 2QKMB 1VC9A 3WHWA 5C7QA 2I6KA 3MDGA 2A8PA 2ICJA 3A6TA 1KHZA 3EXQA 3BAPA 2CZRA 1NQYA 2A8RA 3ACAA 5HZXA 2O5FA 1VIUA 3GZ5A 5ANVA 3N77A 1PUQA 3HHJA 1PPWA 2ICKA 3O61A 2VNQA 2DSBA 2CL3A 2KDWA 2XSQA 3A6UA 1K2EA 4YPRA 1V8VA 2W4EA 3X0SA 3F13A 1MR2A 1PPXA 4S2VA 3N9UA 3ZR0A 4N1TA 1F3YA 1HX3A 1Q54A 3FFUA 1SZ3A
chains in the Genus database with same CATH topology
2B2KA 2O5WA 2DUKA 1V8RA 1PUSA 2YVPA 3Q93A 3SMDA 5CFIA 5ANTA 3MGMA 4J7GA 3Q2TA 1X51A 2AZWA 2JVBA 2A6TA 2PNYA 3KVHA 4C9WA 4JZSA 1PUNA 1KT9A 3FK9A 2PQVA 1HZTA 3DKUA 4HFQA 3U53A 3X0JA 2I8UA 5DPKA 2I8TA 1V8MA 1V8YA 3FCMA 5ANWA 4S2XA 5GHPA 1MQWA 1SJYA 3X0NA 2G74A 4KG3A 1V8TA 1V8SA 4IJXA 5DDGA 2YVNA 1RRSA 2DSCA 1X84A 2YYHA 3I9XA 5GHMA 4S2YA 2B0VA 5DEQA 4ILQA 3X0QA 4YPHA 4MPOA 2A8QA 3EEUA 4V14A 3E57A 3Q91A 4JZTA 5ISYA 3HYQA 1I9AA 3X0KA 3O69A 3X0OA 3EESA 3I7UA 5FSNA 5GHQA 4KG4A 3SHDA 1G0SA 2QJOA 3SONA 2YVOA 5ANUA 1NFZA 1NQZA 1V8UA 3O6ZA 3X0PA 3OGAA 3EF5A 3A6VA 3X0RA 4DYWA 5CFJA 1IRYA 1VK6A 3R03A 5DD4A 1TUMA 1VHGA 3GWYA 1VIQA 1VRLA 1VCDA 2RRKA 1QVJA 5GHOA 3GZ6A 4NFXA 3BM4A 4KYXA 3MDIA 1OW2A 1V8IA 3Q2SA 1MQEA 5IW5A 1PPVA 5BS6A 3X0IA 1U20A 3ID9A 1G9QA 2VNPA 1XSAA 2A8SA 2QJTA 1MUTA 2R5WA 2FVVA 3L85A 2Q9PA 4N1UA 1PVFA 5C7TA 3P6YA 4JZUA 3F6AA 1SOIA 5I8UA 1RYAA 1V8LA 3MCFA 1MP2A 5GHIA 3COUA 3G0QA 4J7HA 5GHJA 1V8NA 3O52A 3DUPA 3FSPA 1K26A 3O8SA 1VHZA 2YVMA 5FSMA 3X0LA 3GRNA 4JZVA 4ICKA 5ANSA 1R67A 3AC9A 3BHOA 1X83A 5LPGA 4HVYA 2GT4A 1GA7A 2O1CA 3J7Ye 3QSJA 2B06A 1JRKA 4C9XA 4S2WA 1NFSA 5GHNA 4NFWA 3Q1PA 1SU2A 5C8LA 1V8WA 3Q4IA 3X0MA 1VC8A 1KTGA 4K6EA 5FSLA 3H95A 3I7VA 5FSOA 5BONA 1RRQA 2FKBA 1Q27A 4ZG0A 3FJYA 1JKNA 3CNGA 5FSKA 5FSIA 2FMLA 3P5TA 4KTBA 1MK1A 2DSDA 2DHOA 2KDVA 4YOQA 2A8TA 2G73A 3A6SA 1Q33A 1XSBA 2GT2A 3GG6A 2J8QA 3GZ8A 1XSCA 3RH7A 3ZR1A 5IW4A 2GB5A 2QKMB 1VC9A 3WHWA 5C7QA 2I6KA 3MDGA 2A8PA 2ICJA 3A6TA 1KHZA 3EXQA 3BAPA 2CZRA 1NQYA 2A8RA 3ACAA 5HZXA 2O5FA 1VIUA 3GZ5A 5ANVA 3N77A 1PUQA 3HHJA 1PPWA 2ICKA 3O61A 2VNQA 2DSBA 2CL3A 2KDWA 2XSQA 3A6UA 1K2EA 4YPRA 1V8VA 2W4EA 3X0SA 3F13A 1MR2A 1PPXA 4S2VA 3N9UA 3ZR0A 4N1TA 1F3YA 1HX3A 1Q54A 3FFUA 1SZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2K A;  2O5W A;  2DUK A;  1V8R A;  1PUS A;  2YVP A;  3Q93 A;  3SMD A;  5CFI A;  5ANT A;  3MGM A;  3Q2T A;  1X51 A;  2AZW A;  2JVB A;  2A6T A;  2PNY A;  3KVH A;  4C9W A;  4JZS A;  1PUN A;  1KT9 A;  3FK9 A;  2PQV A;  1HZT A;  3DKU A;  4HFQ A;  3U53 A;  3X0J A;  2I8U A;  5DPK A;  2I8T A;  1V8M A;  1V8Y A;  3FCM A;  5ANW A;  4S2X A;  5GHP A;  1MQW A;  1SJY A;  3X0N A;  2G74 A;  4KG3 A;  1V8T A;  1V8S A;  4IJX A;  5DDG A;  2YVN A;  1RRS A;  2DSC A;  1X84 A;  2YYH A;  3I9X A;  5GHM A;  4S2Y A;  2B0V A;  5DEQ A;  4ILQ A;  3X0Q A;  4YPH A;  4MPO A;  2A8Q A;  3EEU A;  4V14 A;  3E57 A;  3Q91 A;  4JZT A;  5ISY A;  3HYQ A;  1I9A A;  3X0K A;  3O69 A;  3X0O A;  3EES A;  3I7U A;  5FSN A;  5GHQ A;  4KG4 A;  3SHD A;  1G0S A;  2QJO A;  3SON A;  2YVO A;  5ANU A;  1NFZ A;  1NQZ A;  1V8U A;  3O6Z A;  3X0P A;  3OGA A;  3EF5 A;  3A6V A;  3X0R A;  4DYW A;  5CFJ A;  1IRY A;  1VK6 A;  3R03 A;  5DD4 A;  1TUM A;  1VHG A;  3GWY A;  1VIQ A;  1VRL A;  1VCD A;  2RRK A;  1QVJ A;  5GHO A;  3GZ6 A;  4NFX A;  3BM4 A;  4KYX A;  3MDI A;  1OW2 A;  1V8I A;  3Q2S A;  1MQE A;  5IW5 A;  1PPV A;  5BS6 A;  3X0I A;  1U20 A;  3ID9 A;  1G9Q A;  2VNP A;  1XSA A;  2A8S A;  2QJT A;  1MUT A;  2R5W A;  2FVV A;  3L85 A;  2Q9P A;  4N1U A;  1PVF A;  5C7T A;  3P6Y A;  4JZU A;  3F6A A;  1SOI A;  5I8U A;  1RYA A;  1V8L A;  3MCF A;  1MP2 A;  5GHI A;  3COU A;  3G0Q A;  5GHJ A;  1V8N A;  3O52 A;  3DUP A;  3FSP A;  1K26 A;  3O8S A;  1VHZ A;  2YVM A;  5FSM A;  3X0L A;  3GRN A;  4JZV A;  4ICK A;  5ANS A;  1R67 A;  3AC9 A;  3BHO A;  1X83 A;  5LPG A;  4HVY A;  2GT4 A;  1GA7 A;  2O1C A;  3J7Y e;  3QSJ A;  2B06 A;  1JRK A;  4C9X A;  4S2W A;  1NFS A;  5GHN A;  4NFW A;  3Q1P A;  1SU2 A;  5C8L A;  1V8W A;  3Q4I A;  3X0M A;  1VC8 A;  1KTG A;  4K6E A;  5FSL A;  3H95 A;  3I7V A;  5FSO A;  5BON A;  1RRQ A;  2FKB A;  1Q27 A;  4ZG0 A;  3FJY A;  1JKN A;  3CNG A;  5FSK A;  5FSI A;  2FML A;  3P5T A;  4KTB A;  1MK1 A;  2DSD A;  2DHO A;  2KDV A;  4YOQ A;  2A8T A;  2G73 A;  3A6S A;  1Q33 A;  1XSB A;  2GT2 A;  3GG6 A;  2J8Q A;  3GZ8 A;  1XSC A;  3RH7 A;  3ZR1 A;  5IW4 A;  2GB5 A;  2QKM B;  1VC9 A;  3WHW A;  5C7Q A;  2I6K A;  3MDG A;  2A8P A;  2ICJ A;  3A6T A;  1KHZ A;  3EXQ A;  3BAP A;  1NQY A;  2A8R A;  3ACA A;  5HZX A;  2O5F A;  1VIU A;  3GZ5 A;  5ANV A;  3N77 A;  1PUQ A;  3HHJ A;  1PPW A;  2ICK A;  3O61 A;  2VNQ A;  2DSB A;  2CL3 A;  2KDW A;  2XSQ A;  3A6U A;  1K2E A;  4YPR A;  1V8V A;  2W4E A;  3X0S A;  3F13 A;  1MR2 A;  1PPX A;  4S2V A;  3N9U A;  3ZR0 A;  4N1T A;  1F3Y A;  1HX3 A;  1Q54 A;  3FFU A;  1SZ3 A; 
#chains in the Genus database with same CATH topology
 2B2K A;  2O5W A;  2DUK A;  1V8R A;  1PUS A;  2YVP A;  3Q93 A;  3SMD A;  5CFI A;  5ANT A;  3MGM A;  4J7G A;  3Q2T A;  1X51 A;  2AZW A;  2JVB A;  2A6T A;  2PNY A;  3KVH A;  4C9W A;  4JZS A;  1PUN A;  1KT9 A;  3FK9 A;  2PQV A;  1HZT A;  3DKU A;  4HFQ A;  3U53 A;  3X0J A;  2I8U A;  5DPK A;  2I8T A;  1V8M A;  1V8Y A;  3FCM A;  5ANW A;  4S2X A;  5GHP A;  1MQW A;  1SJY A;  3X0N A;  2G74 A;  4KG3 A;  1V8T A;  1V8S A;  4IJX A;  5DDG A;  2YVN A;  1RRS A;  2DSC A;  1X84 A;  2YYH A;  3I9X A;  5GHM A;  4S2Y A;  2B0V A;  5DEQ A;  4ILQ A;  3X0Q A;  4YPH A;  4MPO A;  2A8Q A;  3EEU A;  4V14 A;  3E57 A;  3Q91 A;  4JZT A;  5ISY A;  3HYQ A;  1I9A A;  3X0K A;  3O69 A;  3X0O A;  3EES A;  3I7U A;  5FSN A;  5GHQ A;  4KG4 A;  3SHD A;  1G0S A;  2QJO A;  3SON A;  2YVO A;  5ANU A;  1NFZ A;  1NQZ A;  1V8U A;  3O6Z A;  3X0P A;  3OGA A;  3EF5 A;  3A6V A;  3X0R A;  4DYW A;  5CFJ A;  1IRY A;  1VK6 A;  3R03 A;  5DD4 A;  1TUM A;  1VHG A;  3GWY A;  1VIQ A;  1VRL A;  1VCD A;  2RRK A;  1QVJ A;  5GHO A;  3GZ6 A;  4NFX A;  3BM4 A;  4KYX A;  3MDI A;  1OW2 A;  1V8I A;  3Q2S A;  1MQE A;  5IW5 A;  1PPV A;  5BS6 A;  3X0I A;  1U20 A;  3ID9 A;  1G9Q A;  2VNP A;  1XSA A;  2A8S A;  2QJT A;  1MUT A;  2R5W A;  2FVV A;  3L85 A;  2Q9P A;  4N1U A;  1PVF A;  5C7T A;  3P6Y A;  4JZU A;  3F6A A;  1SOI A;  5I8U A;  1RYA A;  1V8L A;  3MCF A;  1MP2 A;  5GHI A;  3COU A;  3G0Q A;  4J7H A;  5GHJ A;  1V8N A;  3O52 A;  3DUP A;  3FSP A;  1K26 A;  3O8S A;  1VHZ A;  2YVM A;  5FSM A;  3X0L A;  3GRN A;  4JZV A;  4ICK A;  5ANS A;  1R67 A;  3AC9 A;  3BHO A;  1X83 A;  5LPG A;  4HVY A;  2GT4 A;  1GA7 A;  2O1C A;  3J7Y e;  3QSJ A;  2B06 A;  1JRK A;  4C9X A;  4S2W A;  1NFS A;  5GHN A;  4NFW A;  3Q1P A;  1SU2 A;  5C8L A;  1V8W A;  3Q4I A;  3X0M A;  1VC8 A;  1KTG A;  4K6E A;  5FSL A;  3H95 A;  3I7V A;  5FSO A;  5BON A;  1RRQ A;  2FKB A;  1Q27 A;  4ZG0 A;  3FJY A;  1JKN A;  3CNG A;  5FSK A;  5FSI A;  2FML A;  3P5T A;  4KTB A;  1MK1 A;  2DSD A;  2DHO A;  2KDV A;  4YOQ A;  2A8T A;  2G73 A;  3A6S A;  1Q33 A;  1XSB A;  2GT2 A;  3GG6 A;  2J8Q A;  3GZ8 A;  1XSC A;  3RH7 A;  3ZR1 A;  5IW4 A;  2GB5 A;  2QKM B;  1VC9 A;  3WHW A;  5C7Q A;  2I6K A;  3MDG A;  2A8P A;  2ICJ A;  3A6T A;  1KHZ A;  3EXQ A;  3BAP A;  2CZR A;  1NQY A;  2A8R A;  3ACA A;  5HZX A;  2O5F A;  1VIU A;  3GZ5 A;  5ANV A;  3N77 A;  1PUQ A;  3HHJ A;  1PPW A;  2ICK A;  3O61 A;  2VNQ A;  2DSB A;  2CL3 A;  2KDW A;  2XSQ A;  3A6U A;  1K2E A;  4YPR A;  1V8V A;  2W4E A;  3X0S A;  3F13 A;  1MR2 A;  1PPX A;  4S2V A;  3N9U A;  3ZR0 A;  4N1T A;  1F3Y A;  1HX3 A;  1Q54 A;  3FFU A;  1SZ3 A; 
#chains in the Genus database with same CATH homology
 2B2K A;  2O5W A;  2DUK A;  1V8R A;  1PUS A;  2YVP A;  3Q93 A;  3SMD A;  5CFI A;  5ANT A;  3MGM A;  4J7G A;  3Q2T A;  1X51 A;  2AZW A;  2JVB A;  2A6T A;  2PNY A;  3KVH A;  4C9W A;  4JZS A;  1PUN A;  1KT9 A;  3FK9 A;  2PQV A;  1HZT A;  3DKU A;  4HFQ A;  3U53 A;  3X0J A;  2I8U A;  5DPK A;  2I8T A;  1V8M A;  1V8Y A;  3FCM A;  5ANW A;  4S2X A;  5GHP A;  1MQW A;  1SJY A;  3X0N A;  2G74 A;  4KG3 A;  1V8T A;  1V8S A;  4IJX A;  5DDG A;  2YVN A;  1RRS A;  2DSC A;  1X84 A;  2YYH A;  3I9X A;  5GHM A;  4S2Y A;  2B0V A;  5DEQ A;  4ILQ A;  3X0Q A;  4YPH A;  4MPO A;  2A8Q A;  3EEU A;  4V14 A;  3E57 A;  3Q91 A;  4JZT A;  5ISY A;  3HYQ A;  1I9A A;  3X0K A;  3O69 A;  3X0O A;  3EES A;  3I7U A;  5FSN A;  5GHQ A;  4KG4 A;  3SHD A;  1G0S A;  2QJO A;  3SON A;  2YVO A;  5ANU A;  1NFZ A;  1NQZ A;  1V8U A;  3O6Z A;  3X0P A;  3OGA A;  3EF5 A;  3A6V A;  3X0R A;  4DYW A;  5CFJ A;  1IRY A;  1VK6 A;  3R03 A;  5DD4 A;  1TUM A;  1VHG A;  3GWY A;  1VIQ A;  1VRL A;  1VCD A;  2RRK A;  1QVJ A;  5GHO A;  3GZ6 A;  4NFX A;  3BM4 A;  4KYX A;  3MDI A;  1OW2 A;  1V8I A;  3Q2S A;  1MQE A;  5IW5 A;  1PPV A;  5BS6 A;  3X0I A;  1U20 A;  3ID9 A;  1G9Q A;  2VNP A;  1XSA A;  2A8S A;  2QJT A;  1MUT A;  2R5W A;  2FVV A;  3L85 A;  2Q9P A;  4N1U A;  1PVF A;  5C7T A;  3P6Y A;  4JZU A;  3F6A A;  1SOI A;  5I8U A;  1RYA A;  1V8L A;  3MCF A;  1MP2 A;  5GHI A;  3COU A;  3G0Q A;  4J7H A;  5GHJ A;  1V8N A;  3O52 A;  3DUP A;  3FSP A;  1K26 A;  3O8S A;  1VHZ A;  2YVM A;  5FSM A;  3X0L A;  3GRN A;  4JZV A;  4ICK A;  5ANS A;  1R67 A;  3AC9 A;  3BHO A;  1X83 A;  5LPG A;  4HVY A;  2GT4 A;  1GA7 A;  2O1C A;  3J7Y e;  3QSJ A;  2B06 A;  1JRK A;  4C9X A;  4S2W A;  1NFS A;  5GHN A;  4NFW A;  3Q1P A;  1SU2 A;  5C8L A;  1V8W A;  3Q4I A;  3X0M A;  1VC8 A;  1KTG A;  4K6E A;  5FSL A;  3H95 A;  3I7V A;  5FSO A;  5BON A;  1RRQ A;  2FKB A;  1Q27 A;  4ZG0 A;  3FJY A;  1JKN A;  3CNG A;  5FSK A;  5FSI A;  2FML A;  3P5T A;  4KTB A;  1MK1 A;  2DSD A;  2DHO A;  2KDV A;  4YOQ A;  2A8T A;  2G73 A;  3A6S A;  1Q33 A;  1XSB A;  2GT2 A;  3GG6 A;  2J8Q A;  3GZ8 A;  1XSC A;  3RH7 A;  3ZR1 A;  5IW4 A;  2GB5 A;  2QKM B;  1VC9 A;  3WHW A;  5C7Q A;  2I6K A;  3MDG A;  2A8P A;  2ICJ A;  3A6T A;  1KHZ A;  3EXQ A;  3BAP A;  2CZR A;  1NQY A;  2A8R A;  3ACA A;  5HZX A;  2O5F A;  1VIU A;  3GZ5 A;  5ANV A;  3N77 A;  1PUQ A;  3HHJ A;  1PPW A;  2ICK A;  3O61 A;  2VNQ A;  2DSB A;  2CL3 A;  2KDW A;  2XSQ A;  3A6U A;  1K2E A;  4YPR A;  1V8V A;  2W4E A;  3X0S A;  3F13 A;  1MR2 A;  1PPX A;  4S2V A;  3N9U A;  3ZR0 A;  4N1T A;  1F3Y A;  1HX3 A;  1Q54 A;  3FFU A;  1SZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...