1XSEA

Crystal structure of guinea pig 11beta-hydroxysteroid dehydrogenase type 1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
274
structure length
274
Chain Sequence
NEKFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDNVLSNEKLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of guinea pig 11beta-hydroxysteroid dehydrogenase type 1 provides a model for enzyme-lipid bilayer interactions
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase
molecule keywords 11beta-hydroxysteroid dehydrogenase type 1
total genus 101
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xseA00
4MIOA 5G0TA 4MVJM 1I3NA 4ZGWA 5FI5A 2GN8A 5AXCA 2XXJA 5KCZA 4NMHA 3BXXA 4K28A 2G76A 3K2BA 3RUAA 1Q0QA 4ZD6A 5F21A 5CDSA 1U5AA 2AQHA 4LISA 4RDHA 1E77A 2X58A 3HDQA 4MP8A 5JAZA 3F5SA 4CMBA 1FMCA 3RC7A 2TMDA 5B4UA 1A5ZA 2Y93A 2Y99A 1NNUA 2FSVA 4F46A 2HJSA 1YQXA 4WLUA 4CV1A 3S1LA 1MGOA 2J3IA 1I10A 4HXYA 5B4VA 4XGIA 1VL8A 2D0IA 5IF3A 3JYOA 1EK6A 1N9GB 1XQ1A 3WB9A 1EE9A 1KVTA 3VDRA 4XB1A 1LRKA 2VHXA 1C1XA 1MG5A 4DGSA 3ENKA 1GYRA 4WLNA 4BO5A 3IDSA 2HK8A 2NNLD 4WCFB 4BNHA 4NFYA 3BMOA 2EW8A 3AK4A 2RIRA 1IHXA 2BKAA 4N7RA 1E7RA 3C85A 4KDEA 3I5MA 4WLOA 3RKUA 3T4XA 2QX7A 5JCJD 1GY8A 3GT0A 5LCXA 3GNSA 2VUSA 4RPKA 4U6SA 1PL6A 4IJVA 3GDGA 2P2SA 3D5QA 4TRNA 4GX1A 4KUGA 1PS8A 1Z7EA 4M8SA 3QIVA 4ZICA 1K2WA 3FTNA 1V6AA 4M55A 3JQFC 3GHHA 1DFIA 3RC9A 3D5TA 1N8KA 5DBIA 4EITA 1QXSA 2YFQA 1PS9A 3QLJA 2VRCA 1LLDA 2C2XA 3ETEA 2AEJA 2HLPA 1HDYA 1OI7A 1ZZEA 5I9MA 1HE3A 3CSDA 3OMLA 1O89A 1NM5A 1W4ZA 3F6YA 2VRBA 3WGZA 3HE3A 4MIYA 3UFXA 4ALMA 3UAGA 4QT0A 3KETA 2HMSA 1NPYA 3HADA 3PGJA 1SMKA 2I76A 4IMPA 2BGMA 2P5YA 4OSOA 3CEAA 1JKFA 2C29D 4RVSA 1E1NA 4BUCA 1B8PA 5K9ZA 1UXIA 3RBVA 3JD2A 3ULKA 1FK8A 2CD9A 4D44A 2GN9A 4R3WA 1P33A 3I9MA 2CFCA 3DHNA 3QA9A 3BIOA 5DF1A 5AVOA 3S2FA 2QW8A 1N7GA 3D7LA 3TF5A 4TZTA 1Z74A 3PQFA 1T2FA 4XR9A 4MVJA 3FNHA 3MEQA 3DO5A 4FJ1A 4URFA 3U49A 3KYCA 1ADFA 4GSKA 1HDGO 1N9GA 1U5CA 4WEQA 3E8XA 5A1TA 3ENNA 3PYLA 3BTUA 2ZIZA 4LSWA 1Y9AA 2WSBA 1MUUA 1WPQA 4MKRA 5I9NA 4CM9A 4KQWA 4XIYA 4N54A 4FW8A 2VT2A 4TQGA 3BTVA 4P4NA 4GMFA 5I9LA 3DR3A 2AW5A 3DDNA 3KTDA 3WIDA 4XGNA 1DRUA 4EJ6A 1G0NA 2NUAA 4JIGA 1O9BA 4MVJE 1U8FO 1YBMA 3JQ8B 2PTGA 4II3A 1UJMA 1HZJA 1P0FA 1WW8A 4UVDA 4Z6KA 1IZ9A 1JWAB 2PZMA 4BNZA 1B7GO 1E3JA 1HKUA 4RL6A 3KSUA 4CUZA 4KQXA 1XR3A 3ETDA 4IQGA 4PG6A 2CDAA 4PLVA 3LC7O 4XRRA 1GPDG 4GVLA 3AOEA 2A35A 2W2LA 4DBZA 4D0SA 1F06A 3C8MA 3NJ8A 4W6ZA 3RU9A 1KS9A 2E82A 5I7SA 1Y8RA 2OP0A 1KYQA 1PGJA 3JQAB 3PQEA 3NDJA 4E2ZA 4GH5A 1ZO8A 2PGLA 4LGVA 3OM9A 1MFPA 4YT4A 5CEJA 2C7VA 5CFZA 5JW6A 1FDTA 3ZU4A 1CEQA 1ZK0A 3RFVA 4CL3A 2JCYA 3LF2A 3U0BA 1ZSNA 4HX5A 3RD5A 1RM3A 1PZHA 3LT2A 4BGIA 1LSSA 4CODB 2ZYDA 5AXDA 4CMEA 1SB8A 1SOVA 2OORA 2V6MA 4AJPA 3IP3A 3DC2A 1YJ8A 4IDBA 5KJ1A 1QYCA 1DC6A 1PGNA 3DOJA 1JVBA 3O38A 5KIAA 2F1KA 3HN2A 3WQSB 3QVTA 3UICA 1XWFA 1A9ZA 3C7DB 4XDYA 1H9BA 2CF5A 2ZQYA 4R5HA 5U9CA 4PCVA 3Q2IA 1B14A 1GYPA 4YA6A 1JWBB 3ZV6A 3ZGYA 2C07A 1R0KA 3L4BC 1G1AA 3OJEA 1TT5A 1NWHA 1IY8A 1GR0A 4R3NA 5BNFA 1L7EA 2UDPA 3DOCA 3HDHA 1ZNQO 2WYWA 1NVMB 5DNAA 3W4JA 3N7UA 4H3VA 4FDAA 4X54A 1A7AA 2GDZA 4B4UA 4CMEC 4WJZA 3FNGA 4KUEA 3DBRA 3OBBA 3X2FA 4DBVO 4F6CA 1S6YA 2ET6A 4XQCA 3AI1A 3JQGB 2P9CA 2GYYA 3GZ4A 1ONNA 1E0DA 4L4RA 2DTXA 4PLGA 3DZIA 1DLIA 2HK7A 3W6UA 3BZUA 2VWHA 3JQDA 4TVBA 5DCYA 5KNLA 3GHYA 4CM9D 3NTRA 5JPIA 1LDNA 5B4TA 3TNLA 3GAZA 6LDHA 1GL3A 3KBOA 1YO6A 4NJMA 3AY6A 5MDHA 3HDJA 2NTNA 2V6BA 3E18A 3SBOA 4W82A 1Z7BA 2GN4A 5GZ1A 1HDOA 3TJRA 4QFCA 1DSSG 3DHEA 1U7HA 3TWOA 3C3XA 2DBVO 2OUIA 3GNQA 1BXGB 2QHXA 4YJDA 5HS4A 1SEPA 3K9QO 3NT4A 4YXFA 1Y8QA 3OJFA 4IJWA 4CMJA 1BVRA 1ZJYA 3N58A 5AOVA 5IN5A 3SXPA 4J7CA 1V3UA 4A0SA 3JQBC 4OGWA 4L76A 4FFOA 4ZQBA 5I7FA 5IDXA 1UZNA 1LEHA 1V35A 4XA8A 4BO0A 5CEFA 1HDRA 4OOFA 4D7AA 1B8UA 4L75A 3SC6A 3GOHA 3G1UA 4RJTA 4R1NA 2PH3A 2VOEA 2PK3A 4N18A 1IOLA 4LK3A 3HFSA 3HWRA 3ITDA 4TZKA 5TC4A 4IMRA 1P77A 4OXNA 2BI7A 4LCEA 1B8VA 3GA0A 4JNKA 2G0TA 2J5RA 4FS3A 3WLFA 4CM4A 5KVCA 5ILGA 2GRAA 4L9RA 1HE2A 1CQJA 4ALNA 3S2GA 1OZAA 1JW9B 1ZKMA 1DPGA 2NVWA 1PJLA 1K0UA 4ZU3A 1YB5A 2HUNA 1H9AA 3LQFA 4Z0TA 2GUGA 3AUUA 2WTBA 5L7YA 3ZV5A 5IZCA 3ZDFA 4CMCA 1CJCA 1GFSA 3MOIA 2VQ3A 3JQEA 5ILOA 1DIHA 3EGOA 2B69A 3GPIA 4CPDA 1GZ6A 3BMCA 4WNCA 3RUEA 5DP1A 4MVJH 3WSWA 2X86A 3TZCA 1LDEA 3BMQB 4J49A 1QLJA 2J3HA 2VNSA 4WE3A 3R3SA 4YJGA 4FCCA 1GYQA 1F8FA 2CNBA 1Y6JA 2DPGA 2EIHA 1E7WA 1VPDA 2OFPA 3WNQA 1UP4A 3DAPA 2DFDA 1UR5A 1BVUA 1B0AA 1DRWA 2ZK7A 3I6QA 3WYCA 4YWJA 4BMSA 3EW7A 4IS2A 7MDHA 5FEUA 3OQ1A 5HA5A 2YY7A 4Z3KA 1HDZA 3LT4A 3I9JA 4CQMD 2B37A 3UHAA 4IDCA 1LQUA 2X5KO 5JDCC 1OC4A 5A02A 1QYVA 3F4BA 3NDIA 4B79A 1PJTA 3O4RA 3EZLA 3W4IA 1XSEA 2Y0CA 1RM0A 4NK4A 3OF2A 4RGBA 5EQFA 3EZYA 1JN0A 4ND1A 1R4MA 1YQGA 1IPEA 3GPDG 5TIIA 4NH4A 1K5HA 2QYTA 2PKQO 2Y0DA 5JAMA 1NHGA 3IKVA 5L9AA 1H6BA 1MLDA 1SCUA 4UUPA 1D1TA 4PZEA 3RC1A 2A94A 1JAYA 3ZI0A 4IZHA 4UUNA 5JC1A 4AJOA 2VRCD 1TEHA 4NJOA 4K6CA 1M75A 2YW9A 4J4TA 4R01A 3KB6A 3KSZO 1WLYA 2RHRA 3G79A 4B8ZA 1O0SA 3A1NA 2HQ1A 1ISIA 2NVUA 3HDYA 4LCJA 3UH1A 1KETA 4BO8A 4S1VA 1U9JA 4GLOA 3A28A 3D3EA 4IDGA 3UCXA 3FRJA 1O6ZA 1R12A 3ASUA 1AN9A 4DPMA 4IDDA 4A10A 4BNMA 4UVGA 2O2YA 5CEEA 3KM0A 4BNNA 1O5IA 3UKOA 1KVRA 4BV8A 1ZK1A 3B1JA 2ZKLA 4MPDA 1A72A 3ZU3A 3ZWNA 4W99A 1DEHA 3VZRA 5T6BA 1E3SA 1ISJA 4IQ0A 1SBYA 3MJTA 3GEMA 2EP7A 4IBOA 1T24A 1E6EA 3ON5A 5IN4A 3H65A 1R0SA 4KZPA 2YV3A 2DBQA 2GZ3A 2PY6A 2X0IA 4B4OA 1YJQA 2Q2WA 3FF4A 3VTFA 1C1XB 3V2GA 4XEHA 2UAGA 1NX6A 3MTJA 4J1TA 4L74A 4QO8A 3PFWO 3B20A 1I01A 2DTDA 3JCZA 1IB6A 4XYGA 3ZV3A 3BMQA 3WGYA 4CR7A 1GQQA 5BNIA 1VJ0A 1U4OA 5L40A 1QYWA 9LDBA 2B35A 1MA0A 1A4IA 4K1LA 1Y7TA 3RU7A 2OO5A 1JQBA 2H63A 4CQMB 1ENPA 1D3AA 1P1FA 3N74A 3O9ZA 1PR9A 3JQCA 2I3AA 2QRKA 4BNYA 5A06A 1PGQA 1NFRA 3W8FA 1Y5RA 2PV7A 5F1PA 4DL9A 2I67A 2NQTA 2E6UX 4QQRA 1R15A 3DWFA 3E5MA 5TJ9A 1EQ2A 1EUDA 2YHIB 3QRWA 3SEFA 2C5EA 4XX0A 4GGOA 1HYEA 5ICMA 3HB4X 5HTOA 1P9LA 2WDZA 2V7PA 4CUJA 3UGKA 1YGYA 3KEQA 1JAXA 2WE8A 4PG5A 1E7SA 4M86A 3ZHZA 3HUDA 1SAYA 2VHVA 1P1HA 4EJMA 2P4HX 5TRTA 4ZHSA 3WFJA 3T4EA 3PQDA 5JAIA 3A4VA 4U0KA 4Z9FA 3IQDB 2PFGA 1C0IA 3RIHA 4BB5A 2EKLA 4KP7A 4N5MA 4NFSA 1F12A 4JX8A 4J43A 1VL6A 3LVFO 3AM3A 4ILKA 4H16A 5TGDA 2GNAA 4MDHA 1LDGA 4LW8A 4OXKA 3VZPA 3DQPA 1ONPA 4DA9A 3GDFA 3IMFA 5G2OA 3PJGA 2Q1UA 3R6DA 3ZNOA 2G5CA 2PKQP 3PLRA 1LLUA 2X22A 4R5MA 4F3YA 1HZZA 5DN9A 1HDCA 1K6JA 3ONDA 4HNGA 4NJMB 4BIIA 2HK9A 3NJ4A 5GMOA 2VHZA 5IFLA 1T2EA 1DIBA 2Y1CA 3WYBA 4BNFA 5C7OO 3QVOA 3GVPA 3PZBA 4RQTA 2VYVD 3WBFA 3S55A 2JKVA 3C1TA 4YRAA 4F6LA 3A14A 1ZIDA 3ADOA 3OQBA 3VVCA 1SPXA 4Q3EA 5TNXA 1D7OA 5G4LA 4LMPA 1WXDA 4HY3A 4O1MA 3TFQA 1CIVA 4UEOA 1PJSA 3GN2A 2EJVA 4B4VA 4R1UA 5EIOA 2BD0A 3AI3A 4INAA 1ZMOA 4KDFA 5A04A 2AXQA 2Z1NA 3GUYA 3LSYA 3Q2KA 3DMTC 4E5NA 5KOIA 1GDHA 4G81A 1EE2A 2C59A 2P4QA 5DZSA 4CLOB 3EK2A 2B4QA 1JA9A 1E3WA 2VZ0A 3CXRA 3MJEA 1LUAA 3ZV4A 3UCEA 2P9GA 1FDWA 2C20A 4MKXA 3INRA 2BMAA 1AUPA 2X0JA 1VJ1A 3CMMA 1KERA 2H1SA 1LA2A 5FF9A 1ZJZA 4BL5A 2X7HA 1NPTO 4PLFA 4DC0A 2P68A 3O8QA 5EMHA 1VI2A 1N5DA 4I9NA 3FHLA 1H5QA 1P0CA 2AG8A 1XYGA 4HWKA 3RUHA 3F46A 3IUSA 1M6HA 4OHUA 4RPJA 2EP5A 4YT8A 1YOVB 1ZK4A 3EUWA 4DXHA 5ENVA 2GASA 4E0BA 1CYDA 1NQTA 2E37A 3SJUA 3F9IA 2PGDA 1P1IA 4DMMA 1FJHA 1GQYA 2VTDA 5HS6A 5TT1A 1KEUA 1T1RA 1I5RA 4GGPA 3IAHA 1K89A 4ND2A 1YE3A 2ZYGA 1HSZA 4ITUA 4DIOA 2OOSA 4E2XA 3CZRA 3DTYA 1VL0A 4N5NA 5L7TA 5IZCC 3GQVA 1KEVA 1NYTA 4E32A 4PLTA 2D4AA 3Q6IA 1W6UA 3WGGA 4XD2A 3NDRA 4DQVA 4XKJA 5L4LA 1U3UA 1OFGA 1ZCJA 4GLLA 4II2A 3WNVA 3U09A 1FXSA 3JQ6A 1W73A 4DYVA 4Q9NA 2IEBA 4R1TA 3EVTA 3VC7A 5TLSA 4WKGA 3PRJA 2Z95A 3U4DA 2NADA 1HRDA 3MJCA 3ORFA 1ZW1A 2HSDA 3WDSA 2V6GA 1T2CA 1YL5A 5A03A 4I9HA 5A5FA 4CR8A 3TSCA 5MGBA 4RLHA 1JU9A 2WM3A 5CDTA 1EVZA 3S8MA 3PWSA 5JXWA 4I9UA 2AEFA 5I7EA 2WE7A 3HZZA 5G4KA 2O23A 2CVOA 1F0YA 5COAA 1WZIA 5DP2A 4JBHA 3ICPA 1MX3A 3NT5A 1UDBA 4ZN6A 4EBFA 2O2SA 3JTMA 1XA0A 3CH6A 1WDLA 4L73A 4WNIA 4Q3NA 4EUEA 3PYXA 4RCVA 1T2DA 1KEPA 3D1LA 3RVDA 3NV9A 4DLLA 5I8WA 1A27A 2O3JA 3H6KA 3IJPA 1OOEA 5L95A 2HMWA 1Z6ZA 4QO7A 3WWYA 1A7KA 3VZQA 3MZ0A 4IDAA 4XDZA 3NRCA 5DCUA 1ZXBA 3MOGA 4K26A 1J5PA 1L7DA 3MCVA 2X0NA 1T2AA 1TVEA 3SC4A 4BNXA 2AHRA 2RH8A 1RYEA 9LDTA 2EEZA 2CVQA 5I8ZA 1K6XA 4FOSA 2D5AA 2ZCUA 2VZ9A 3LK7A 1Q0LA 1GUFA 3C1OA 3ADPA 2OXIA 3S2EA 1UZMA 4IXWA 4BNKA 1LLQA 3VZSA 1EFLA 4XWYA 3K73O 3JQGA 4R54A 1H94A 4WLFA 4BKRA 1PJCA 4AJ1A 3DBVO 5T57A 3WWZA 1Y81A 2EERA 2O3RA 3GF4A 1D4FA 4E30A 4YPOA 2NM0A 5JY1A 3V1UA 1M76A 1OC2A 3ASVA 1F14A 3H9UA 4FFPA 3AY3A 3KLMX 3WBBA 4Y6SA 1KC3A 1BXZA 3PHJA 3H3JA 4M87A 1DBVO 2VNAA 2RCYA 3SVTA 4AFNA 3UW3A 3AU8A 1U7TA 4UVIA 2AQIA 1S7CA 2UVDA 2Q49A 1EVJA 4CMHA 4GPD1 4J2OA 4YT2A 1WWKA 3HFGA 1EBUA 1HWYA 1K3TA 3MJVA 4IQ8A 2PZKA 2J6IA 3AUTA 1UDCA 4FIZA 5BSEA 4MINA 2A9FA 4MVJP 4NBVA 3AOEC 5BNTA 4WCDA 4WLVA 1EEHA 4BO4A 3HHPA 2BLLA 3TZ6A 1EBFA 1NTOA 4IPTA 5B12A 2WD7B 3T7CA 3DL2A 3OJ0A 1Q1NA 4DIBA 4BKQA 4CV0A 4M89A 1E6UA 3ROQA 4Y8VA 2JHFA 3GNTA 4W9NC 2AE2A 3FWNA 2X5JO 3DAFA 1VSVA 4BMVA 4CV3A 1EDOA 4OO3A 1NQOA 3QWIA 3BHMA 4Z0HO 3KXDA 1BWSA 2NQ8A 4Y6RA 4E13A 2DUWA 2O3QA 2D3TA 5KJEA 3I52A 2D1YA 3KHUA 4JJGA 2XOXA 4O63O 3CPSA 2QIOA 3GFGA 2JD2A 4WEOA 4GL4A 2BFAA 4HP8A 3GGGA 5ENDA 3ZWYA 1DAOA 3JYNA 4ID9A 4IM7A 4OOEA 5F3RA 2ZB7A 2BRUA 4QSMA 3PWZA 1O8CA 5BT9A 2W4QA 2YQ4A 4UEJA 3WX0A 2HO5A 1NR1A 1P45A 4ZQHA 2Y1EA 4NHEA 1HL3A 1VJTA 1ZVMA 1YDWA 5BQFA 3L9WA 5A9RA 1XDWA 4O59O 2WD8A 4WECA 4Z0PA 3WYEA 1DJNA 5ITWA 4W9NA 1BGVA 4AICA 3NX4A 4E33A 3MWEB 4DRYA 4UVEA 2I66A 5DBGA 1X1TA 3G3EA 1NQAO 3U4CA 4EGFA 4MIEA 1H93A 1OBFO 5TS3A 3WTCA 4WGGA 4Y98A 4BNLA 1SEVA 3MTGA 2O3TA 4NIMA 2NACA 4DQXA 1MV8A 2AG5A 3R3JA 3D3WA 2O50A 3JQ8A 4EW6A 2HKIA 4IGFA 2C5AA 3ANMA 2H5LA 2E4AA 3H3FA 2X5OA 5TX7A 3QVSA 1R6DA 1ADBA 4OMUA 4JK3A 4BO9A 2BGKA 2VWPA 4OQZA 4YAKA 1LDMA 3ABIA 4UREA 1JTVA 5KJFA 4JGBA 5CHEA 5CP8A 3QW2A 1KOLA 4B3IA 4EYEA 4TVOA 1Y9EA 4I8XA 3ZWWA 4OXYA 2DC1A 3Q3CA 4XYBA 2W2LD 4CUKA 3TZKA 4BNTA 3GVIA 3AW9A 1I8TA 3INTA 3LC2O 2DT5A 2FWMX 4AVYA 4I08A 3RQSA 3DFUA 3GGPA 1X7DA 4CMIB 2JAHA 2PNFA 4MVJI 3G1TA 1YQDA 4Z9XA 1Y8QB 4BS9A 1HDXA 1YBVA 4BNUA 4PVDA 3U62A 4EEXA 4GX5A 5FI3A 1J6UA 2YQ5A 4RVFA 3Q1LA 3RC2A 1IE3A 4R69A 3RCBA 4GAEA 4DREA 4R51A 1KEWA 3H5RA 4JJIA 1RJWA 1PJBA 5JS6A 3L6DA 2JD1A 3Q9UA 4CM8A 2HU2A 4J6FA 1WP4A 2Q1WA 3OIGA 4IY1A 4OQYA 5KJ6A 4HADA 2J5KA 4F45A 5HM8A 3QWBA 4IUYA 4EDFA 3P7MA 5A3VA 2NVBA 5EERA 4R4JA 3GG2A 4FD3A 4J90A 4B4WA 1VKNA 1DHRA 4MP6A 4JJFA 2VOJA 5A3JA 3GK3A 1I3LA 1YH3A 1BDBA 3BTOA 4PRKA 1A9YA 3GR6A 1UH5A 2CDCA 1E1MA 1Q7BA 1WZEA 4XZ3A 5JYEA 4BQPA 1I2CA 4GQAA 1NHWA 1IYZA 2X4GA 3HQ4O 3ZWPA 3WMWA 1GAEO 1LC3A 4NPCA 1SO8A 4O6VA 1DLJA 5T8KC 4E2WA 2YDXA 2EKQA 2NU7A 4KTTE 3GEGA 4Q39A 1TI7A 4WK6A 3I9KA 1KVUA 1DIRA 2GGSA 2XPCA 4Y67A 2Q99A 3AWDA 3JQ7B 3UVEA 3RASA 3OA0A 1NPDA 3PI7A 1HETA 2FPPA 4J4BA 4UVHA 1CERA 4ONEA 4DMLA 2Y66A 5H81A 5ER6A 3VH3A 1IL0A 4CLOA 1PIWA 3I9OA 5J23A 3GLQA 1XGKA 4QX6A 1U28A 4C7JA 3VPHA 3D0OA 3KV3O 4R9SA 3FSRA 3GG9A 2PKRA 3HG7A 3BA1A 4A03A 5KKCA 1NWCA 1PQWA 4GMGA 2FY8A 4J7XA 5LDGA 1DIAA 4PGFA 4BNVA 3IOYA 5KVQA 1PL7A 2AEMA 5CG1A 3V5NA 3JQAD 5DT9A 5DULA 3MJSA 5IAAA 2PD6A 2OBNA 2DVMA 3QVXA 1RWBA 2DLDA 1GTMA 1E3WB 2P5UA 2CUKA 2G17A 4CL8A 2R00A 4ROSA 3VDQA 1E6WA 1R37A 2G82A 3FNEA 1ADCA 3RAJA 4E21A 3K2EA 2VHWA 1C0PA 5IJZA 3K96A 1EQUA 3L77A 4AJHA 4U0JA 4YACA 4YJHA 2GF2A 3GDOA 3RFXA 1BTOA 1IUKA 3MJ4A 4QUKA 4MVJF 1ZBQA 1ZK3A 4YQYA 4Y6PA 4RPLA 1I0ZA 4NBWA 3TZHA 1WDMA 3W1VA 2BFPA 4GWKA 4HBGA 1X1EA 3DONA 3HJAA 4J0FA 4W4TA 1GV1A 2O3UA 3COSA 1T1SA 1DC5A 4GWGA 1QP8A 3WMXA 3RUDA 1I3KA 5A9SB 3VAZA 3DMYA 4EUFA 1UXHA 2VZ8A 2DUUA 1QLHA 2FPIA 3QVWA 4Q3AA 4FJ0A 3IIEA 1VKOA 5DBFA 3TZQA 4CMIA 2Y1FA 1EUCA 2GCGA 1RM4A 4O0LA 2YV1A 1E5LA 5A9TA 3A06A 3GRPA 1LDBA 1DFHA 2I5PO 3H2SA 4NG5A 1CDOA 4ND4A 3DOOA 5KWEA 2CDBA 4FQ8A 2JL1A 1HLPA 3D4PA 1LDYA 1AHHA 3JQ9A 1SOWA 5A5EA 3U4IA 3OHSX 3ZU2A 3DXFA 4ALLA 1AXGA 4P38A 3F47A 4BNWA 4E12A 4LVUA 3G49A 4J0EA 3TL3A 4ZQFA 1NR7A 1WDKA 3WTBA 3PIDA 3GVXA 4P22A 1U1IA 2PWZA 4PZCA 3VPFA 4A7PA 5G4KB 1J49A 1BXKA 1PJ4A 4A5OA 5KVVA 3NKLA 3ZWCA 4K9DA 5GZ6A 5JNLA 3BHIA 4FGWA 2JFHA 4WLEA 3AY7A 5EQDA 5ADHA 2NLOA 1E92A 1YL7A 3PTZA 1U2DA 4PG4A 4YRBA 4D3DA 4YCAA 1M67A 4AJJA 3VOSA 4CLDA 4XRGA 1RYDA 3EY4A 5T8KA 4JLWA 3DMTA 3K92A 4HFMA 1ZEMA 3ZHXA 1P3DA 1BDMA 4XYLA 4XQGA 4L8VA 3E9MA 3OH8A 4BNGA 1H0KA 4L0QA 2J8ZA 1X15A 2YUTA 4G65A 2WJPA 5C37A 4I1IA 4ZQEA 3PHIA 1NFQA 3LC1O 1U8XX 5IDWA 4JROA 4D45A 4J3FA 1GADO 4I5DA 4YT5A 1HYGA 2WYUA 4BO7A 5BSFA 3H7AA 2ZYAA 3DEYX 5AYVA 4NU5A 3G0OA 4G5HA 5THQA 4IJKA 1DDOA 3RJ9A 2W90A 3GEDA 5EPOA 2PA3A 3ETGA 3KSDO 2GLXA 4CM3A 5JY6A 4S3MA 1OAAA 5JDCA 2JFGA 2LDBA 3O8QB 4FC7A 1YL6A 3TDKA 2YJZA 3GRKA 4YYZA 2VUTA 1XKQA 3K5PA 1U3VA 1IULA 1UP7A 4J7UA 1A71A 4H7PA 2NV6A 4BKPA 2ZJ1A 2EXXA 4NBUA 5KJCA 1KY5A 1CF2O 1HXHA 4FFLA 1CQIA 4PLWA 2V6FA 1Z45A 4YVFA 1PQPA 4NR0A 1ZFNA 3TOXA 2LDXA 1I32A 2ZTUA 4RVHA 3QHAA 3O03A 3ZH2A 1T26A 5EINA 5TF4A 3WGIA 4E5MA 4U7WA 3WG9A 2D2IA 3UUWA 5COQA 2UUPA 3NGXA 2YYYA 1DIGA 1ENOA 3DBHB 5A4DA 1ISGA 2W2KB 3RUFA 1YB4A 3V1TC 2FRDA 5KTKA 3QQPA 2E48A 3TFOA 1J4AA 2IE0A 1RKXA 4RV9A 3ZNNA 1LI4A 4OYRA 4UULA 5A05A 3JYPA 4LRTB 4M54A 5IXYA 2GERA 3PJEA 4B7UA 1QRRA 1BXGA 3G17A 2WD7A 2UV8A 3GH3A 3H9QA 3FR7A 1IHYA 1KBZA 5JDIC 2JD0A 1YBAA 1V9LA 2GPTA 2FR1A 1VE9A 2JAPA 3FCOA 3F4LA 1CRWG 4BO2A 1GQ2A 2IEDA 4FC6A 3WGOA 1XEAA 1DC4A 4IDEA 5JBIA 3PHLA 1N2SA 2JCXA 3FTPA 1LXCA 1JKJA 4E6PA 2PD3A 4YAGA 5JCXA 1PQUA 3GVHA 3QJ5A 5HBRA 1EFKA 3STHA 1XELA 4CQLB 2ZJ0A 4RO0A 4IZIA 4HUJA 1LSUA 2NU9A 4A73A 2H6EA 2Z1MA 3H9GA 1GPJA 1ISHA 3DHYA 3K6JA 2IYPA 4QEDA 3HNPA 5ICSA 1HYHA 3P19A 4PLHA 3BHJA 3K30A 2AQ8A 1LTHR 2X8LA 4NZ9A 1ADGA 1Q7CA 4R16A 4UUOA 1FDUA 1GD1O 1ZK2A 2X9NA 1LU9A 4UEKA 1O94A 3L6EA 1PTJA 1MXHA 3OFSA 2VUUA 1DHTA 4CM4B 1P1JA 1M6WA 3CUKA 2I65A 4GI2A 2W8ZA 3E6AA 4JCOA 4BO6A 5AQ1A 1QSGA 3LF1A 4XQEA 2CY0A 1IZ0A 5F1OA 1EMDA 5L53A 4MJLA 3E9QA 4U8GA 4J1NA 4RDIA 5HWSA 1H2BA 3ZHBA 2VYNA 5L7WA 4J91A 2I6TA 1YB1A 1YXMA 1E3EA 4GKBA 2EV9A 3HB5X 5BSHA 5LDHA 1TT7A 2ZTLA 2B83A 2DBZA 2JFFA 3ZU5A 4B8WA 3OJLA 3LU1A 1YRLA 3UN1A 1O95A 3WQQA 3C24A 1WNTA 4QTZA 3F5QA 1VC2A 3JQBA 2D59A 4OM8A 3INGA 4OKIA 4PVCA 1P31A 2NU8A 3RUCA 4AJKA 5JMWA 3JD4A 5CDYA 1E7MA 5G0VA 3U3XA 1PJ2A 3EAGA 4BOYA 1G0OA 4W7HA 1NQ5A 3EVNA 3DBLB 4RZIA 2EHDA 2Q2QA 3SX2A 4BNJA 5C7IO 4ALIA 2JCVA 3DZGA 5THKA 4AJIA 1ISFA 3PYMA 1K6IA 3I83A 4XJTA 5JMPA 1H6DA 2EGHA 2IYOA 4LVCA 4JP2A 2PD4A 3F1LA 4CR6A 2D5CA 2GD1O 4KWIA 4B3HA 2ZATA 2B36A 3U5TA 3JQ7A 2HMVA 4MO2A 1JKIA 2WYVA 3DFZA 1ZMTA 1HEUA 1LC0A 2P9EA 2BFMA 1P74A 3JQFA 1F17A 1U3TA 1E3IA 3H5AA 4PLZA 4RORA 2C2YA 4Y9DA 1X0XA 2BF7A 4IJUA 1MB4A 4XQ9A 2HDHA 5K6AA 1Y8RB 4CQLA 1XQ6A 4GX2A 1HE4A 4QFDA 2B5VA 3KYDA 1HF3A 1C0KA 4WOKA 2FZEA 1CETA 4FPXA 2OL4A 3BMNB 2O4CA 1JDJA 3C7AA 3RUIA 3UOGA 2O48X 1JVSA 3LLVA 4RPGA 4TRMA 3SLKA 5C3MA 2V65A 2Q2VA 4LN1A 1TLTA 5F5NA 4WASA 4L4SA 4BV9A 2X23A 1WVGA 5JLAA 1TB4A 1T25A 1PL8A 5CAEA 3RROA 4C7KA 4GVXA 4IGEA 1ZXLA 1YKFA 4YDRA 1UZLA 1U3WA 2XF8A 3NAQA 5T67A 3ZZNA 2CF6A 3FPCA 3OSUA 1XU9A 2GSDA 4BGEA 1HLDA 1LNQA 3AFNA 5CG2A 3I3OA 4MOWA 3OJOA 3QY9A 4IIUA 5H82A 4BO1A 4PN3A 4XB2A 5K6AC 3I9NA 3Q0EA 1DB3A 2E49A 1SZJG 2X6TA 3VPSA 1XCBA 4NBRA 1DOHA 2DM6A 2Z5LA 4FFRA 2R6JA 1R4MB 4RVDA 5DOZA 4NNJA 4JXKA 3P2YA 5U4QA 1AE1A 1B2LA 4BB6A 3ZWXA 1UAYA 5JSFA 2BHLA 3FN4A 3W6ZA 3I9LA 1Z82A 3GFBA 1PWZA 3KYCB 3OICA 3PJDA 2Q46A 4CLHA 3FBGA 4GBJA 3ITKA 1KVSA 1ML3A 2A4KA 3QWFA 4PFJA 3B70A 4IXTA 4OL9A 1H6AA 1R16A 1LJ8A 2W2KA 4NI5A 4D0RA 1EUZA 4E2YA 1E7YA 3C7CB 3D3WB 4GKVA 3TOZA 3P2OA 3V1YA 1DFGA 4HFRA 1L1FA 2IXAA 1ONOA 1HT0A 1YDEA 4A26A 5A9SA 4PLYA 2EW2A 1XIVA 1X13A 1MG0A 3QSGA 1PU2A 3HN7A 1GCOA 3ONEA 4DPLA 1BMDA 4J4HA 3ST7A 4J9UE 4BGUA 2FPGA 3EHEA 3GN1A 1T4BA 2X9GA 4CLXA 3NEPX 1QKIA 3PWKA 3LLSA 2BH9A 3PGXA 2ZQZA 3IJRA 3DZJA 1RM5A 3W8DA 4XYEA 3KYDB 1SNYA 3GGOA 3H4VA 3QE3A 2JJYA 4XGKA 4DIFA 4ZA2A 1TA4A 3PJFA 3ANLA 1E1LA 3OIDA 4MP3A 4U5QA 3VKUA 3E03A 4PG8A 1LX6A 1XHLA 2O7SA 2IRWA 4MVJD 5L4SA 3K8ZA 4J1SA 3JD0A 4HNHA 3RSHA 2DQ4A 1PZEA 4CLRA 2NWQA 1C0LA 3I4CA 3WOHA 2O3SA 4AJNA 3CTMA 4RLSA 1LRJA 4J9VA 3NTOA 2RH4A 5U1PA 3DBLA 1GEEA 2XAAA 5F5LA 2HRZA 4PLCA 2BGLA 3ZNPA 4UAGA 3I6IA 3OA2A 3B6ZA 4FSHA 2PGJA 3RBZA 3JV7A 1V8BA 3WGHA 4FFNA 5L4NA 3PDJA 2EWMA 3U9LA 3ZCXA 4BKUA 3ZWVA 1B3BA 3AI2A 4FJ2A 2EGGA 1TXGA 3PVZA 4XCVA 1HSOA 1FDVA 1WMAA 4EZBA 4YEDA 3VH4A 4LSMA 3E9NA 4YQZA 5CDUA 3OETA 5AXBA 1NXQA 1DRVA 2AQKA 2O4UX 2JHGA 3PLNA 1N7HA 2OGUA 1G6KA 2YHUA 1UAGA 3AM5A 4QXMA 2NTVA 1QR6A 1EVYA 4E5YA 3L0DA 3K31A 4A2CA 4WCFC 3GMSA 3FD8A 3PEFA 1U2GA 2RAFA 3LT0A 3JQ9C 3PPIA 1YONA 3WGTA 2QYSA 1QV7A 1P44A 3HSKA 4AJLA 4YAJA 4ALKA 1EDZA 4A27A 3OQ6A 3O26A 3WIEA 4CMGA 3E48A 4FOOA 1IPFA 2D8AA 3WLEA 2I9PA 1NAHA 4CQMA 2Q45A 4KTVE 8ADHA 5I7VA 2G1UA 1ZSYA 3D64A 4Q3DA 4ALJA 2QRLA 2Q4BA 3JSAA 3KZVA 3NT2A 1RPNA 4NQZA 3FI9A 4GSLA 5DCWA 3V2HA 4CM8B 4JQCA 4CM1A 1LLCA 2PLAA 2Q50A 5COBA 4D41A 3DBRB 1BG6A 1H2HA 2IDZA 3ZW9A 1ENZA 3VPXA 3OEWA 4OKNA 3L4SO 3DTTA 4EUHA 5G0SA 1UP6A 5FWNA 3PXXA 4R68A 1BHSA 1V3VA 1MC4A 2Q1SA 5HRUA 3EMKA 1ARZA 4KUHA 3VH2A 3ZWOA 1B3RA 4G2NA 1X7HA 3H2ZA 4CV2A 2FP4A 3GZNA 1U4SA 2B4TO 4PRLA 4XR4A 2GN6A 3A9WA 4M49A 4TRRA 1BW9A 4YB8A 4BMNA 1PWXA 3UF0A 4RZHA 4TKLA 3QWAA 3KEOA 5L3ZA 3M2TA 1FF9A 2C0CA 3H5NA 5H83A 1D1SA 1NASA 3GMDA 2X0RA 1YS4A 3B1FA 3W4KA 4Z9YA 3RKRA 2DFVA 3ONFA 4PIVA 1C1DA 1LQTA 2FHSA 2GZ2A 4IIVA 2POQX 3D4OA 5DDIP 2QG4A 2YFHA 4OAQA 4Q3BA 5JC8A 1PEDA 4JN6B 3JD3A 3ANNA 2Y1DA 1OMOA 1UUFA 3ZNQA 2ILTA 3R0IA 3CINA 1I2BA 4YJGB 4CM5A 4CMKA 1I36A 2C82A 4D79A 3QWHA 1LSOA 1H6CA 1BW9B 4RVGA 1Z73A 5JAQA 1WMBA 4IDFA 1X0VA 2BELA 2XXBA 3DZFA 3H8VA 3IC5A 3NYWA 4DLAA 4JBIA 4YR9A 2O7QA 2FMUA 5KKAA 4CJXA 1I24A 3L07A 4KWHA 2DTEA 1DJQA 1PZFA 2VN8A 3AM4A 3RFTA 5GZ3A 3UXYA 4IS3A 3D4NA 4K6FA 2OMEA 1VM6A 1PGOA 1X7GA 1V3TA 5DOVA 5B37A 1E3LA 3AU9A 3IKTA 3H9JA 3KOUA 1DXYA 1XG5A 2VTEA 3TPCA 3NGLA 1UDAA 3KLPX 4E31A 2DBRA 2Y68A 4D43A 3JYLA 5IDYA 2ZB3A 1X14A 2CVZA 2C54A 1GZ3A 3RI3A 4TKMA 2DKNA 4E4YA 3GY0A 1TT5B 3VH1A 5T64A 4OIMA 3EYWA 2NU6A 4NU6A 3Q11A 2FOIA 1GEGA 3VHRA 4CM7A 1Q2XA 4M1QA 3TN7A 1N92A 4AJ2A 1DO8A 5ITVA 1V0JA 1MC5A 4RF2A 4DPKA 3FR8A 4BVAA 3ZWMA 1I2ZA 2UYYA 1E1KA 3E1KA 5ER9A 3TL2A 4TMFA 4E5KA 2QZ9A 2PR2A 2IODA 4GX0A 2OHXA 2HJRA 2NVUB 1J0XO 3PFFA 4ESOA 1ZUD1 4E5PA 2YZ7A 5B1YA 1HE5A 3UCFA 2Q1TA 2WMDA 3GZNB 3NUGA 4XYMA 1C1DB 4PG7A 2VT3A 2Q3EA 1PZGA 4YRDA 4D46A 2YV2A 5IZ4A 3AJRA 4W7IA 3VKVA 2VYVA 5L45A 1QV6A 4P8RA 1ENYA 4NBTA 2FR0A 4HKTA 3L6OO 3JD1A 4LRSB 1C3VA 3VTZA 1I30A 4DQUA 4MVJG 3TQHA 3GUCA 4BGVA 1ZH8A 1T4DA 3S2IA 3T7EA 3BMCB 5G0WA 4ZJUA 4O5OA 4R41A 3WXBA 2OZPA 1BRMA 2VCYA 1E5QA 4B7CA 2FN7A 2GO1A 3P5SA 4FR5A 2J3KA 3IS3A 4WCFA 3AUAA 7ADHA 4WOJA 1LBEA 3VPGA 1NVGA 2Q4EA 4C4OA 4ZVVA 2HAEA 1PX0A 4YAEA 5JDIA 3FBTA 3L9XA 1AGNA 4DC1A 3CMCO 2NSDA 1ULSA 3F1KA 3PHGA 3LDHA 1W8DA 3V2UA 1GZ4A 2BFOA 4ND3A 1KVQA 1DC3A 4LMRA 1ISMA 4FFMA 4PLPA 1R0LA 3U4HA 4YJFB 1NBOA 2BI8A 4YJHB 1ORRA 2VWGA 5JCJA 5ES3A 1E7QA 4J2HA 3F3SA 1W0CA 3V8BA 5KVSA 1PJ3A 2DU8A 3E5RA 4CMAA 2J5QA 5CDGA 4PZDA 2IXBA 1ID1A 4Q3CA 1CWUA 2ZTMA 2H9IA 2EKPA 1SC6A 3L4BA 4CLEA 4I5EA 3IL2A 4RF5A 1N1GA 1R4NA 4TRJA 1Z75A 3IP1A 1EVIA 5AXAA 4U6QA 3FPLA 1B16A 2AA3A 5TJHA 1HTBA 3R1IA 1MP0A 4TSKA 3JYQA 1KY4A 4E3ZA 3PHHA 1BSVA 5G0UA 5CPFA 1NP3A 1F8GA 2GZ1A 2IZ1A 4DUPA 1R4NB 3TRIA 2WWRA 1PSDA 2A92A 4D42A 1P1RA 2QRJA 3DZBA 4J16A 3PP8A 4NDNE 2IZZA 1KIFA 1ULUA 3M1LA 4H15A 1DAPA 3WGQA 3ZWBA 4BO3A 1EK5A 3CZMA 5F1KA 1Q7GA 3QV1A 5IDQA 3OEYA 2J3JA 3AOGA 3C1AA 2WEKA 4BNIA 4N5LA 4B7XA 1GUZA 1NVTA 4KMSA 1UXKA 3I4FA 4R1SA 3ICCA 3CIFA 4I5GA 3BYZA 1UXJA 4CLRB 3X2EA 3WJ7A 4ND5A 4XIJA 1Q0HA 1Y1PA 2R00C 4DLBA 5BSGA 8LDHA 1P1KA 4P4GA 1SB9A 3ZN2A 4Z3DA 4RPHA 3WJAA 1I33A 1QG6A 1XLTA 4AL4A 5C5IA 1VRWA 2HMTA 3BAZA 5IG2A 1YVEI 4I5FA 1JLLA 3SLGA 4EI2A 3PK0A 3GVCA 3WSVA 3DAGA 4IINA 2TMGA 1QYDA 4FB5A 2PH5A 4JP3A 2OP1A 4BQRA 3WFIA 3EDMA 5BR7A 2CSUA 4UUMA 2UUOA 1M2WA 5TSDA 2VWQA 2EF1A 1PJQA 5CPBA 2PZJA 3WQRA 3WR5A 1EZ4A 4DVJA 1VSUA 2YDYA 5FFFA 5TQVA 3DZKA 1PR3A 2VHYA 2DPHA 4L4XA 2EG9A 3ZW8A 2PZLA 3M2PA 5EN4A 4XJSA 5JO0A 4D3SA 3BMOB 4RQUA 5JFOA 1M66A 4YBZA 4NK5A 3ROKA 1ZEJA 2QZZA 3PDUA 1PGPA 4FBGA 1Y5MA 2GR9A 4HV4A 1NFFA 3KUXA 5LC1A 1FDSA 4JBGA 1QYXA 3RBXA 1QORA 2HRBA 4HFJA 1WAMA 2NTJA 1MXFA 2IZ0A 4OH1A 3AFMA 3M6IA 1I3MA 1GCUA 4OJNA 5L51A 1YOVA 2SCUA 3E82A 5IXSA 5JYDA 2W98A 2FR8A 1NAIA 2ZTVA 2B0JA 4EJ0A 1VLLA 5T5QA 2FSSA 4ZRNA 3FNFA 2C7GA 1C14A 3H9EO 2YHIA 4BHTA 4D3FA 2FZWA 1B26A 3I23A 4DWVA 3FWZA 2P91A 3AUSA 4J1QA 4QECA 5EESA 2HMUA 3RWBA 3NTQA 3DBHA 4FN4A 3KO8A 4RF3A 1R66A 4NFHA 1LSJA 4ZQGA 4ZRMA 4P4LA 4HFNA 2B4RO 3W8EA 4CM6A 3JQAA 2AMFA 4BKOA 2R2GA 3OECA 3OP4A 3KYBA 1GU7A 3WICA 2Y05A 3LYLA 1GUYA 1AHIA 3DB2A 1AXEA 2X1HA 1LRLA 4AG3A 4B3JA 5EL0A 4YJFA 5K0ZA 3MWDB 4RVUA 1PS0A 3KVOA 2F00A 2ZB4A 4YAIA 2ZCVA 4KOAA 3ZWAA 3DZHA 5JE8A 3ZHYA 2I3GA 2Y0EA 5FYDA 3SJ7A 5C7LO 1B15A 2B5WA 3GAFA 1UXGA 5EJ2A 2I99A 1D8AA 1YWGO 2RHCA 3B1KA 4AJEA 3IUPA 4DTIA 1GV0A 1A4UA 4AJ4A 4EEZA 3GC6A 2CZCA 2EJWA 3ROMA 3OIFA 4R9RA 3PZRA 2HCTA 1QMGA 3EC7A 1N1EA 1KC1A 3M1AA 5TT0A 4OSPA 5GY7A 3WS7A 3CKYA 4YTEA 2AE1A 2CMDA 4FGSA 3LT1A 3PIIA 4WUVA 3LZ6A 2Y67A 3BMNA 3CE6A 4MKZA 2QQ5A 6ADHA 2VYND 2Y1OA 2ZB8A 3I1JA 4TROA 4DYDA 2Y1GA 2OBYA 3BTSA 3QP9A 1XU7A 2DAPA 3KRTA 4RF4A 3VVBA 4TWRA 5JO9A 3ROPA 3Q9NA 1MFZA 1ZSVA 3RJ5A 4WPGA 2RBEA 2X9VA
chains in the Genus database with same CATH superfamily
2CMKA 1X3LA 2DQKA 3GV0A 3H13A 4J0CA 5K0JA 2GA8A 4MVJM 5EP3A 1MPXA 3C4JA 1MJNA 2FWRA 3ENQA 4ZGWA 1E62A 1R6BX 2XXJA 3ZCSA 5KYNA 1KH2A 1XNQB 3TPZA 4NCNA 4ISBA 4BNDB 5B1EA 2HZ7A 4IIGA 2IHYA 3GFRA 3WK8A 4P3YA 1XROA 1EM8B 3PUWA 3EQ2A 4LISA 4EJSA 3AHFA 5LKRA 3OCUA 3HDQA 4HXGA 5LQUA 3L7KA 5EP1A 1TCVA 5I7WA 2C7PA 1XEFA 4MTLA 1CUJA 2NT4A 4WA8A 1A5ZA 3VO1A 3WNCA 1NNUA 4JOBA 1X94A 2NXCA 3EB9A 3II6X 4NZPA 2J3IA 1EGQA 1UMDB 4RV4A 4HXYA 3C5WP 1EB9A 4EG5A 1VL8A 3P20A 2NXEA 4WKBA 1PWHA 5BSMA 1EK6A 1N9GB 1NUSA 1XC7A 4N1AA 3UWPA 5JFGA 4H35A 1EE9A 3AUYA 1KSHA 3GAAA 1E6KA 3TI7A 5LXTA 3PUIA 2NUBA 2OR3A 1W5BA 5FORA 1IBLB 2P9FA 3L8EA 3FOCA 2EL7A 4QYIB 4CW7A 5A0VA 3D8TA 1DOZA 1Z83A 3D3JA 5LU9A 3OIVA 3RVJA 5CD9A 4CU2A 5KREA 5I48A 3BUSA 1M1YA 2PU7A 4F9EA 1TC1A 1G8MA 1SBZA 1JEOA 1JIQA 1ZM4A 1V8OA 2A3NA 2EW8A 1IHXA 2BKAA 3AK4A 3C85A 4QLAA 1SHZA 4WLOA 4A82A 2JLYA 2GZAA 3PHBE 5JCJD 4WBNA 3FJ1A 2O8EA 3GJ7A 1INLA 3CEHA 1VKRA 3JVEA 4M88A 1YSCA 2WLSA 5LCXA 2H1VA 4Q7LA 3M83A 1J00A 5SICE 4YUAA 5FI0B 4QXPA 1PL6A 4MI9A 3A4MA 2BGIA 3GDGA 3ILSA 4IG4A 3IEXA 1PS8A 1Z7EA 2PU5A 2R6ZA 4M8SA 4GKAA 4RESA 3TQSA 1CZKA 1K2WA 1XP8A 3E7XA 3FTNA 4M55A 1PCXA 4ZVRA 3W3AH 3GHHA 4DA7A 3RS4A 3D5TA 1N8KA 3VVMA 1WPXA 3QPDA 1EX7A 2QN6A 1JQEA 1PG2A 4TYWA 1LLDA 5DX8A 4O2RA 3A3YA 4QATA 5BRJA 5KQGA 3VSCA 4DR1B 1AKMA 3MW8A 1XLWA 2HZBA 1ZZEA 4QPPA 4LTMA 3N76A 3OMLA 5TDHA 1W4ZA 2WYHA 5KS2A 1U9IC 1W1UA 2BUBA 2Y9MB 4O2AB 3VI3B 3DOHA 5K0BA 3KQVA 1GLNA 1NPYA 4N8DA 1UAAA 1SMKA 2I76A 4FZ3A 2BGMA 4YRIA 1VLJA 3ENVA 4OSOA 3CEAA 2C29D 1YZNA 1QHNA 1SK8A 3CUUA 2I78A 3GPCA 3UBMA 1AU9A 4PAMA 3JD2A 4IRMA 4KQEA 1F0NA 2G1JA 1KI9A 4D44A 4R3WA 3OOEA 2AI2A 4EPWA 3DHNA 5FA5A 4UQLA 3BEOA 3U3MA 1IZ8A 2PZAA 2W6PA 5LQNA 1FTNA 2QTAA 1G38A 1M7GA 1C8KA 1Z74A 4ZGBA 3E0QA 3JALB 1RVDA 5L8VA 4CT0A 5CA1A 1JIVA 3QIAA 3FX2A 2CNDA 1AGRA 1RKBA 2QAGB 5LUBA 4GSKA 3RU3A 4B7ZA 2PBRA 1R0BA 2EGUA 3ZQ4A 3LMKA 5FWYA 3L1HA 1KI6B 2W4IA 3SX0A 2PT9A 2FG7C 4KYTA 4Z4CA 1NIPA 4NCKA 3ZI4A 1MUUA 4MKRA 1W88A 3H86A 3WIBA 1N1MA 4CM9A 3SM9A 3UWKA 4FW8A 4IWYA 3DVQX 2B7BA 1M6VA 4AW9A 2AW5A 1TJ3A 2PFKA 2GAIA 2V0CA 3WIDA 1UEIA 3GA5A 1A5SB 1UODA 5K8LA 2HCFA 3FWKA 3H16A 2CCJA 5JQGF 2CXRA 3V1KA 1U8FO 2XDQA 3JQ8B 4PPGA 4II3A 4B43A 1M3SA 1N0HA 1PYGA 1WW8A 3ZLTA 1U7XA 1JWAB 1AC5A 1VRCA 5FV7A 3V32A 2GJKA 1V43A 1E3JA 5F98A 1HKUA 1ZH6A 2XGSA 3DZCA 3HVIA 3JQQA 3WAGA 4F9TA 1KP2A 3Q7RA 4KQXA 1XR3A 3ETDA 4H77A 2ONJA 3MXTA 4KPEC 4PLVA 4CQJA 4NH0A 5CLHA 2XYRA 5JHHB 2YY5A 5D7NA 3AOEA 1U1GA 4N0QA 4O4IF 3C6BA 4ETMA 1WKBA 1JBQA 3GDWA 2FPGB 2XNJA 3C8MA 1Z37A 3U7HB 5FYQA 3GBPA 5LNK1 1TQ4A 2OXEA 3G2MA 1Z0UA 2VQDA 2OP0A 2IF2A 2D06A 5CU7A 3PQEA 1N33B 4H6WA 4E2ZA 4GH5A 2PGLA 3TQTA 5L40A 1AQNA 3NMUF 4H7HA 2FJUA 3MN1A 4LGVA 4MGIR 1ZUIA 1GL6A 3SCZA 5H0IA 3K05A 1NN5A 4YT4A 1FDTA 3GIDA 3RFVA 5BV0A 4JL6A 3FZQA 4UXJA 4HX5A 1XZPA 1RM3A 4KLRA 5E7JA 2ZYDA 5AXDA 4HATA 3MJDA 1SB8A 2ZQ5A 4LHWA 1UANA 4AJPA 2OV2A 3DC2A 3M3HA 1QYCA 4IRXA 3BWYA 1QIIA 4RLQA 2M9MA 5DFAA 2GAFA 1GT6A 2DPYA 1JL3A 3HCDA 4RVOA 5KIAA 1MOSA 2PL9A 5GOTA 1EB8A 3SE7A 3A05A 4NCHA 5ITZB 2RSLA 5FL7D 1V4VA 3QVTA 3HJRA 4ZIRA 5B6JA 5EE3A 1WBBA 2P2ZA 2WHPB 4MMYB 3FLAA 4PAWA 4C7MA 4E4RA 3C7DB 4XDYA 3REQA 4ZOEA 3U44A 1YVRA 2HDNB 1GYPA 4YA6A 4NBNA 4WI1A 1UJNA 3A1EA 4FU0A 3K8YA 4R2IA 3K0EA 2REQA 1NWHA 2AJDA 4CKWA 5LIRA 2H52A 4GP6A 3F73A 3AYZB 1SIUA 2XGJA 1L7EA 2UDPA 3V2IA 1MB9A 1ZNQO 3SDBA 1H4SA 4O8ZA 4ZYVA 1QQ6A 4K0RA 3AVYA 4X54A 2GDZA 2YMQA 4B3CA 4CMEC 3FNGA 1SU4A 2GM5A 3DOIA 4DBVO 4DJEC 2R96A 4YJ2F 1S6YA 2ET6A 2P2NA 5JSYA 4G1VA 2P9CA 2ZYIA 4EECA 4HDKB 2IYUA 2ZI6A 1CUYA 1SJ9A 2DWOA 3L18A 3Q9LA 4H1WA 1Q3TA 1UKEA 3E9RA 4RA9B 2AKEA 3GYBA 5FEMA 1W0JD 1XAIA 3PNOA 3H9CA 2JGAA 4FCWA 4L15A 3VU9A 4AKIA 1W49A 2HK7A 1ULZA 4EHDA 4UOEA 3BZUA 3JQDA 1D9XA 4P54A 3KEFA 5EUMA 2ZBRA 3EEQA 5EXPA 5KNLA 2G9ZA 3GEIA 1Z88A 4PC3A 4MZDA 2FFBA 3F3MA 2E2WA 2C99A 4V2IA 3QKSA 2YOFA 3I09A 4Z1MA 1U7ZA 2ZKIA 3KBOA 2F67A 1YO6A 3LPAA 5AM1A 5BQ5A 2Q5HA 4B1FA 5MDHA 3FVRA 2YS7A 3CNLA 2HA3A 3B3GA 2B94A 4JLOA 4JEUA 1TK3A 3N2GB 3N1UA 2ICAA 4G9BA 3W34A 1AXRA 3C3BA 4C5BA 4BX3A 4W82A 2KPOA 3Q8LA 4W5RA 1EP3B 1BFKA 5TQ0A 1DV1A 5F5XA 4EABA 2QVYX 1P3JA 1H1LA 3CF0A 2HF9A 2K7ZA 2RGNC 1U7HA 2WKPA 1HY3A 3EVGA 3P9SA 4UC0A 1CJKC 3L43A 2O8NA 3SZOA 3U7GA 2N42A 3FPAA 1XTZA 2ZM5A 2RGYA 3BBLA 4L95C 4P36A 4YJKA 1BXGB 5HS4A 4OLJA 1SEPA 3NT4A 4YXFA 1NE2A 4V1CA 2I6UA 4TTVA 3F5MA 2X40A 1XZJA 4LBYA 4QXOA 1ZJYA 4CMJA 5ESRA 2CJWA 3JQBC 3R09A 1T0PA 3WYGA 4ZQBA 1KWKA 5I7FA 3LQKA 3RK0A 5C5CA 4JHLA 4C88A 1UQRA 5CEFA 3K70C 5BYJA 3FYDA 4YCDA 5AUPB 3QTLA 1AHNA 1VPLA 4BN5A 4R1NA 1YUMA 2Q41A 1L9KA 2VOEA 5IVPA 2FEKA 1TDJA 3GRVA 1TYBE 1OHHD 4JD5A 3EYAA 3OE4A 4LK3A 3I04M 3HWRA 3STUA 1B74A 1NY6A 1Y4DE 2H17A 2JK1A 3NIWA 4IMRA 1DBSA 4OXNA 1WD7A 2BI7A 5DWDA 1B8VA 4LZJA 1AS2A 5BUCA 3WLFA 3BEDA 4N5HX 2O5CA 2AW3A 4CWAA 5ILGA 4J76A 2PUBA 2P7IA 2H48A 2Q5EA 2NZYA 1HE2A 4DOMA 4DDTA 3CLUC 1N2CE 1ZKMA 4JH0A 1AZLA 1CXZA 2QOEA 3K5WA 1PJLA 2GEVA 4H3HB 1YB5A 2HUNA 4X92A 1H9AA 3FVVA 3QLUC 2VZEA 2WTBA 3IVGA 4D6PA 4OD0A 3V4RA 3FFWA 1SKBA 2NGRA 2IOYA 4OAPA 4YCBA 1M2FA 4DLTA 5IZCA 5KYYA 4OAOA 1QP0A 1ORVA 2B2XA 2RH9B 2G25A 5AUNB 1B6GA 3T1VA 4UCQA 1YT5A 3KFLA 3MOIA 2AR9A 1THTA 1WUYA 2QJFA 2WIAA 2A67A 2PAAA 4OTZA 4DCOA 1DIHA 3EGOA 2ENWA 1M6VB 4CPDA 3TLXA 5DP1A 3EOBI 1NJ5A 3LGAA 2X86A 3TZCA 1QLJA 2VNSA 2B3DA 5G41A 1PR1A 1F9AA 4GPTA 1L6IA 3WLTA 1GYQA 3EGWA 2EIHA 1E7WA 5AFSA 1XRSB 4US1R 3OEHD 4R0MA 5IFKA 3NV7A 3Q0IA 1JRLA 4O4JA 5HUQA 3H83A 4BCDA 1UR5A 3ZDZB 1ABEA 3EF0A 2ZK7A 1B0AA 2H1WA 3KPJA 5K6TA 3WB2A 4BMSA 4LPKA 1EINA 2HRDA 3ABZA 2C7BA 4QRDA 1A9QA 1BIFA 2YY7A 1UC4B 2F3PA 3LT4A 2PUAA 2B37A 1NMZA 1DTWA 1KIMA 2WFLA 1LQUA 3EGXA 3ELWA 4IDCA 4I50A 1N2XA 5JDCC 5K2MA 2Q3DA 3EZ2A 3WADA 4JI6B 1G16A 1O77A 4M60A 4A2PA 3F4BA 4KQHA 2EF0A 3LBNA 4JA0A 1PJTA 3FLEA 2GYUA 4Y2SA 2O2HA 4R40A 1RZVA 4XJXA 4OUKX 2Y0CA 4MQFA 4WRRA 5JOQA 1IN4A 4J2TA 3FRIA 1II0A 1PWYE 2ZUBA 5AJVB 1SG6A 5CLFA 1JN0A 2OB1A 3QE2A 4H6PA 1Z13A 4ND1A 4B2LA 1IPEA 1OWOA 3GPDG 2AD5A 2F64A 4M1EA 3ZHRA 1K5HA 5TIIA 3LHIA 3FPHA 3NCHA 4O2AF 1YZGA 5JAMA 1MQAA 4UDOA 5L9AA 1GGMA 4O4JF 1OTYA 2JFUA 3JVVA 4HDNA 1SCUA 3C3CA 2V4UA 3KFXA 1R6VA 1Y3FE 2CVFA 4X6UA 3ZJTA 5FI1B 2DWPA 2Z57A 4O3FA 3BM5A 5I4BA 1JKMA 4K9QA 5JC1A 2X2OA 3EVCA 1OWLA 2JIBA 5H68A 3REQB 1TEHA 3OCJA 4HDCA 4B6QA 2AOTB 4FI3C 1N36B 2QZSA 3DLTA 4MAMA 3ETCA 3LBHA 2P9HA 2BL4A 3PQ6A 1N5OX 3KSZO 4OH7A 4R01A 4R2MA 2RHRA 3G79A 5ELMA 4QFMA 4PTLA 4B8ZA 1HG1A 4KBYA 2NVUA 3UH1A 2DR2A 5JD6A 4S1VA 3SZMA 3UCXA 1YVUA 2FF5A 3MSXA 1O6ZA 4OV6B 4TXJA 4G9EA 5TXGA 4DPMA 4K9KA 3JVUA 4B8YA 4YMHA 5B7GA 4URHA 5E1BA 1X8KA 3OOYA 3QOFA 3SN6A 1ODSA 3BD7A 3L0BA 2YXEA 4RAOA 3D7NA 3G9ZA 2QSJA 1YOBA 4MMXB 4TGLA 3TZLA 1YAJA 2J46A 1KL7A 1YI0A 3UFXB 2O2YA 2GLTA 4FZ5A 1OZFA 4FHFA 3P27A 2WZQA 4BNNA 1ZK1A 2ZKLA 3ZWNA 3H0EA 3S5UA 3VZRA 4IQ0A 2RJNA 2CZQA 2QQGA 1I4OA 1DRKA 1CTQA 2EP7A 4LHVA 1SBCA 5DEOA 1E6EA 2W0MA 3NP9A 5IN4A 4ZJPA 2JGLA 2JFQA 2YBEA 5G1OA 2FRVA 3LBIA 3DKRA 2YV3A 2DBQA 4P7KA 4B4OA 3R7BA 2YQZA 1YJQA 4F2WA 4PCAA 2NZ2A 5EI5A 1C1XB 4LXTA 3FZGA 5AVVA 1SKYB 3AFIA 3M5PA 4YROA 3MTIA 3MTJA 3W5VA 3LOQA 2CE2X 1JLSA 3AVOA 2QM7A 1VSTA 3BMQA 4QYSA 1GQQA 1QH1B 5SYAA 3WGYA 4U7JA 1JPUA 1XZLA 1QYWA 3REFA 3WQBA 4G37A 4JKOA 1O6BA 3MB5A 3ZHSA 4C4YA 3KKEA 4D96A 4HXEB 1Y7TA 4RHYA 5EIWA 5JWRA 2ANCA 4U9HS 3RU7A 2OO5A 3EZ7A 3FHCB 5CX1B 2BFCB 3L41A 1ENPA 1G3RA 2P9YA 3N74A 3KKQA 3WISA 4MV1A 4C2BA 3O9ZA 5KOJA 4HDMB 2NU8B 1FTWA 1H2ZA 1MJGA 2I3AA 3VYRB 2MSEB 3FB4A 4RUKA 4TS9A 5KWSA 2QRKA 1EM8A 4BNYA 4ESEA 1CR2A 1UQTA 3DG9A 5LP6F 1PGQA 5IC6A 1AZWA 4DMHA 1DQNA 5F1PA 5EQJB 1IN7A 2GXQA 2E6UX 2WP8J 4ZC1A 3OX4A 2BFWA 5TJ9A 4HNUA 1ZRSA 1XD8A 2VFAA 2YHIB 5DBEX 4K2AA 4R7GA 2GX6A 3DBIA 1XMIA 1JI0A 1P5JA 2J45A 1X19A 3E3MA 3EFOA 1LVGA 2ZJOA 5DHAA 5SZKB 3MRXA 2WDZA 1J0CA 3H18A 3N7AA 3EEYA 3LKVA 4AROA 4UXHA 1JAXA 4NICA 4Q0MA 4PG5A 3R44A 3ZE2B 3I42A 4R9VA 4AI6A 1TRHA 4XFJA 3HVUA 2JBHA 5CM9C 1VCMA 4M86A 4MQEA 3ZHZA 3WRVA 4ENUA 4BTEA 4PGMA 1SAYA 1ZJ5A 3ZLVA 3TIFA 1UFKA 2R85A 1P1HA 1VRVA 3BDVA 3JASA 3VR4A 3KXPA 1M6YA 2N75A 3EC1A 1EUCB 4JYBA 3W9UA 3ZXIA 1O97C 4YONB 2XBUA 4GYYA 2R5FA 1Q0RA 1ZOSA 1W4BA 3INNA 2XQFA 2FGKA 2JJQA 4PZAA 3DT8A 5ALLA 3SD7A 3LX8A 1TMGE 3AM3A 4PC7A 4LW8A 3WMRA 5L6MB 3QVUA 1QCDA 4A2QA 1QONA 1KE1A 1J5XA 2IIBA 1NLFA 1YFLA 2XECA 3NHKA 4P80A 2GS9A 3QTBA 2BR3A 4LZNA 1WO8A 3X1KA 2PKQP 3HNOA 3PLRA 5ALKA 5I7HA 2QF7A 4LQDA 1DELA 2OCYC 1HDCA 1K6JA 1CRQA 2IYZA 1XOIA 2HCJB 3KJQA 4JLBA 5EJAA 4PANA 1M74A 3CBGA 3T9AA 4BIIA 4KGDA 2HK9A 3S2UA 4CHTA 4NYIR 5GMOA 4BBAA 3PEVA 1USKA 1AKUA 4D4HA 3QEMA 1KJYA 1CR6A 1SCKA 4BNFA 2ZB2A 4LC1A 1JH8A 1RAAA 1SRRA 3PZBA 2WD9A 4UHDA 4EKGA 3EY9A 4W7SA 4X3PA 4GS5A 1S8AA 1U0RA 4MDEA 1LPNA 4MW6A 3ADOA 1SPXA 2JFVA 4IVPA 3VU0A 4LYDA 1JKJB 1WXDA 1MQ9A 2DT8A 4WSOA 2YVLA 3BREA 3O93A 1CIVA 2KHZA 4N65A 1I3CA 1WUJS 2EJVA 2VHCA 5EIOA 4DV3B 1RDFA 4GBED 1ZJ4A 4OU4A 1O08A 2CEAA 2FZVA 2P11A 4FEEA 1RYYA 4KDFA 3IDZA 2ZT8A 3TDNA 3T3OA 1E9EA 2IDMA 4PW0A 2QRZA 3L7DA 3LSYA 5I4IA 2OLEA 2W48A 4I50F 1IEVA 3B3QA 4QFBA 4BVJA 3FTEA 2XMPA 4X44A 2ZAOA 1S3FA 3L2OB 2P4QA 2DECA 4N3GA 4LZPA 1GG8A 3V4VB 2AZMA 1S1MA 3CXRA 2CSXA 1WZNA 3FNBA 3C3WA 4P0TA 2P9GA 4FE4A 4L5YA 2RK6A 3U1BA 2I34A 3CPEA 3QKRA 1GM5A 4TQ9A 1NBMA 1K5DA 1M2VB 4D9NA 1LA2A 4JWTA 3PE4A 5FF9A 1KHTA 3DCNA 5CJ2A 4UAUA 4CYMA 1ILEA 4G0QA 7REQB 2OM2A 3ZVLA 2QR5A 2VBGA 3IMGA 1IZYA 3CA8A 1FFEA 4MV0A 4POAA 1JG1A 1TUEA 2PS0A 3NEAA 2AG8A 1XYGA 3F46A 1M6HA 4OHUA 3BSSA 3U7IA 2OXCA 3B9PA 4ETWA 4AM8A 2ZJZA 5JU6A 4YT8A 2O7NA 2VPXA 4IVRA 1ZK4A 4TV9F 4Q19A 5KMGA 3WGIA 2R7LA 1CYDA 3G2PA 3NATA 2PGDA 2XE4A 4M38A 3RVKA 3KQKA 4Q7JB 3KXLA 4BUJA 1T1RA 1I5RA 4JLVA 3EQ9A 4UCWA 1K89A 1HSZA 4M0DA 4E2XA 2OOSA 4REOA 4EPXA 3CZRA 2QMHA 4EB3A 4JLAA 2V7EA 4GXNA 3CH4B 4K9PA 1GPMA 1KU0A 2ORIA 1GQSA 3C4VA 4E32A 4PLTA 1XPRA 3Q6IA 4Q7EA 4G41A 4QUBA 4UATA 3A32A 4AY3A 4DQVA 4XKJA 5L4LA 2CXUA 1E2NA 3Q4GA 3ZJYA 1YAHA 1UC5B 3DDSA 3JQ6A 4Q9NA 1JFFA 4GBGA 1Z06A 4AMUA 3OUZA 5CB4A 3BZWA 3E70C 5C1OA 3PRJA 4PIMA 1A82A 3CIOA 4RKQA 3ZIAA 4F1WA 1K7CA 1Y1SA 4KYIB 3CEPB 4MRVA 2V6GA 3M1IA 4QTTB 1U2QA 2G07A 4ZKEA 4MVWA 4DJJA 2IXDA 2OT3B 4A8JB 5A03A 5A5FA 1T91A 3C5EA 2D7DA 2ZOSA 5EWMB 4KKXB 1GHTA 1JU9A 4IHJF 4RLHA 1CU1A 3HDVA 4C5AA 3PWSA 4LK2A 1FJ2A 3AL2A 4EO9A 2QLBA 1G6OA 1N5RA 4F4IA 2IC5A 3DOFA 4WKOA 1RYNA 2X5NA 1U8EA 2O23A 4LHXA 5JI2E 2E1PA 3R75A 5I9SA 1YS7A 1PDOA 2ZYHA 3C3YA 5IKEA 2PCJA 1VL5A 3AHCA 4YBRA 1XA0A 2XMDA 3G6KA 1BVYF 1KE2A 3SX4A 4WNIA 3N8IA 1KOGA 3PYXA 1Z47A 3TW4A 3PX7A 4ESHA 3PEWA 1HFJA 1AK9A 2ZAMA 3D54D 3RVDA 3SC3A 9MHTA 3KLNA 1FYEA 2A5FA 3IJPA 3RFCA 3FZYA 3KG2A 2H5EA 1WXXA 4Q4JA 1Z6ZA 4FYYA 4QO7A 1X7XB 3WWYA 1QH0A 5K99A 5IAGA 2N9UA 3KUDA 4LE1A 4KQMA 2GMWA 1BD4A 4E6EA 4HGPA 1TQDA 5DCUA 4J0GA 1M5UA 1YZKA 1ZXBA 1BE1A 2WHQA 2ACWA 2NTEA 1I6WA 2WNSA 2G5GX 3FUWA 1DBRA 1HMPA 2WF6A 3G8CA 3MOGA 3ZDXB 3QVKA 3IUBA 4ISCA 5DK4A 2WHXA 2X3YA 1J5PA 4S1TA 1L7DA 4XVRA 1N8TA 3MCVA 2X0NA 4FLFA 5F3DA 1T2AA 1RC8A 3GMIA 3NNNA 3IMCA 2ZWAA 3KR2A 4U2CA 1K6XA 4FOSA 5GV8A 3LHSA 1FFWA 4B35A 3C1OA 4MWEA 4N7JA 1B1CA 3CJQA 3JATB 4TMVA 1H23A 2JI4A 4KO3S 2IIPA 3LP6A 3MCZA 3MMXA 4XWYA 1KAGA 1LPAB 1SURA 3KOOA 4I9GA 2HF2A 5T57A 4N3AA 1Y81A 2W6ZA 1FU4A 1RMQA 4RKEA 2KLBA 2O3RA 2ODBA 1JIJA 4MUKA 5CVTA 3V1UA 4FDTA 1M76A 4ZV4A 3DGEC 5K0SA 2UVQA 4CQNA 3VAYA 3R8CA 2ILVA 2IVFA 4D9GA 4CTOA 1MB0A 2TYSB 4Y6SA 2YWFA 1BXZA 3PHJA 3H3JA 2JBAB 4M0FA 4P92A 3WL7A 1DBVO 4BVLA 2V6JA 5LOVA 4DR3B 3HI6A 1S7CA 3DO8A 2Q49A 2ASVA 3SYTA 3KOMA 3PPYA 1X38A 4GPD1 3NPMA 4J2OA 4YT2A 4OUDB 3AIOA 4E11A 4BATA 1HWYA 3MLEA 2HYIC 1GAWA 2J6IA 3B7GA 1Z38A 1UDCA 4IGIA 1G6Q1 5FPSA 4NPAA 2GTHA 4RD6A 3CW9A 1O9HA 1M10A 5IVDA 4EY5A 5BNTA 5EJ4A 5ALFA 4WLVA 1EEHA 4RJJA 3ZGYA 4EI7A 2YJ3A 2RE8A 3L93A 5DYNA 1TVMA 3N8DA 3EFOB 4QPJC 4Q9HA 4Y2VA 3MOSA 1D09A 1XXHE 2GZDA 2IEAA 1Q6ZA 1WEHA 3PUZA 4NWIA 3OJ0A 1NZFA 4JUBA 4HQKA 5DLYA 3HBJA 3ROQA 4Y8VA 1U1EA 5HQ3A 5A4IS 5FHRA 4A9AA 2H0AA 2OILA 1EFTA 3GNTA 1CZNA 2HD4A 4OG2A 3FWNA 5ARBA 4JBYA 1J2YA 5EHNA 3E3LA 3B1XA 4MW4A 2CFRA 1NQOA 1W4LA 2Q6TA 1BWSA 1OASA 3FDXA 2G83A 1GNQA 3L49A 3M6WA 5J1SB 2O3QA 1ZLYA 3ETLA 5CBKA 4YMLA 4GM0A 2AJTA 1R6XA 3G7SA 1XQ9A 1A5BB 3U17A 1AZTA 4PWYA 2X1VA 4QRIA 4B5LA 3FYCA 4AQDA 4TWBA 1U1DA 3CPSA 2PX5A 3GFGA 3P45A 1BWQA 2VSXA 1TYAE 4HDQB 4X1YB 5CH5A 3FE2A 1G3MA 4D80A 1IM5A 1FTSA 4HO1X 2QT9A 1DCKA 4PC6A 1XZMA 5ELXA 1J33A 2VH1A 2ZB7A 4NMXB 4Q4AA 4YI5A 5FV4A 3PWZA 3QTTA 2HBZA 3UM9A 4AUMA 1TO6A 4S0XA 4FMPA 5K6RA 2VJYA 3FB1A 4UEJA 3WX0A 4EI9A 4V1CB 1DKUA 4ZQHA 4D9KA 3R5TA 4NHEA 1FP4A 4X8LA 1ZVMA 1N7IA 1YDWA 2YWJA 3H2YA 4QU5A 1AKRA 1ZHOA 1Q74A 3QELB 5E0KB 1ZHFA 1DEXA 3IDAA 4K40A 4WAUA 3WYEA 3TQRA 5ITWA 5TGZA 1YK0A 3BILA 4R84A 4WNAA 3CUEF 3SKXA 1NQXA 2PGXA 1P29A 1P60A 1EM6A 4FSXA 2VTBB 2MSCB 1COWD 1E8DA 2AFRA 2I66A 3X0DA 4KU4A 4PZZA 3G3EA 2Z09A 1NQAO 3BH6A 3OI7A 1YIDA 1YQWA 3CQ9A 4RTRA 4WGGA 1B6SA 4JP1A 2PANA 4A0FA 3HUFA 4BNLA 4GUAA 1SEVA 2FPMA 1H5NA 2HPAA 5HDQA 3BT7A 2GESA 2LCFA 2UXDB 2Z04A 2W4MA 1MAAA 2RONA 2YRFA 4NARA 1DTSA 1JLMA 1X7WB 1CS0B 3SSNA 4G5FA 1MOQA 1SCJA 1I9CA 1T5TA 2O50A 2XDQB 3JQ8A 3KNZA 4LBVA 4DR4B 4Q3OA 1QVAA 2ZPAA 2YVAA 3H3FA 4NRDA 5IJXA 3DULA 3G88A 3BK7A 3EIHA 4JK3A 2YIDA 1P2FA 2QQFA 3T41A 3CT6A 4GR5A 5K03A 1VLVA 1JTVA 4HGYA 5LZ7A 3E1SA 5JZBA 5JD5A 3F9RA 5F23A 1Z6YA 4PRYA 1Y9EA 2IEZA 2E4XA 3NUQA 4H0NA 4ZAXA 5IH3A 3ZWWA 4L50A 3RIMA 1USUA 2OM6A 1F8XA 1ZD9A 2QI9C 1ITZA 2FYTA 5EFOA 2IF0A 3QX7A 4QOEA 1F2TB 5KHAA 3UWMA 5F51A 3ZYZA 4BNTA 4HUTA 3F96A 2VA8A 4HS4A 2F4VB 4B2PA 3HNRA 3OP1A 1WCIB 4BQEA 4ARCA 4GPEA 2WFLB 4I50B 4COOA 4I08A 5BW6B 3GGPA 3KUUA 4TYPA 4BPBA 3ZCQA 2OXRA 2IA5A 4NONA 2IUSA 2WHPA 3OX3A 1YQDA 4Z9XA 4BS9A 1IOVA 2XWQA 2VJPA 4PVDA 1S9HA 3HEMA 2XNSA 1NBHA 2HPZA 4N3CA 1W1WA 1D0SA 1XXLA 2CCGA 4WL0A 1FOEB 5CJPA 3KUKA 4ZTBA 5K8UA 2WTUA 4GYWA 3EZGA 4R69A 2YNMC 4X45A 2ODQA 4LA4A 4OGGA 2O8FA 1KEWA 2HU7A 4EGCB 1YFJA 2JIRA 5JS6A 2WIKA 2NAFA 3QKTA 4DLZA 2HU2A 4ZRDA 1WP4A 2HFKA 3CR3C 4HEA6 1QUEA 2YN4A 4IY1A 5KJ6A 2IYYA 5EMMA 4E5UA 3AUJB 3NWJA 5HM8A 3LS2A 3LYAA 1MH9A 4IUYA 4PGAA 3VSEA 4EDFA 1O6CA 2NVBA 1DO2A 5BRNA 3C5HA 4B4WA 1DHRA 1H2AS 1NF9A 3VYTB 5HK9A 1T4CB 4WDQA 5A4JA 4YXWD 2D1TA 2V1XA 3A2LA 5JD3A 1IONA 4PRKA 2BEVA 2WF5A 4WZBE 4TKVA 1UH5A 5CT4A 1ABBA 5IAJA 5FLKA 1WZEA 4E15A 2VTBA 2CNWA 3R5KA 3VC1A 3OOSA 1I2CA 3WFZA 1CJMA 1E9CA 4L16A 2BE7A 2B78A 4U4AA 4UHBA 2NO6A 4BUZA 2JW5A 3EVAA 4KX5A 2WUVA 3HQ4O 3H5LA 3ZWPA 1AVTA 2IZOA 3L6UA 1DADA 2R1VA 1W9MA 3X1YA 1E64A 4QBHA 4QXQA 3RSOA 1EA7A 3AONB 5T8KC 1P2BA 2FPKA 3QMMA 1AQYA 4GU5A 1PDWA 4RGYA 1TI7A 1M1YB 3T94A 3LA6A 1L5MA 3KT0A 4UBIA 2RAVA 3AWDA 3LQ2A 4BN4A 1A8PA 1NKVA 5DM0A 3PI7A 1PK8A 5AHOA 2FEXA 1UM8A 2IZ6A 1HFEL 3UB2A 5LZ4A 4UBLA 2ZSDA 1NQUA 5ER6A 1O7JA 4Y7DA 1K63A 1EHCA 5LWQA 4MQEB 1IL0A 3DE1X 5DRTA 3SM3A 3OF5A 2FPXA 1O5TA 4C76A 4CLOA 1XGKA 2SBTA 5LJIA 2WAYA 4C7JA 2FTKE 3I5AA 2GPAA 4MV3A 4CCYA 3FKSA 2PT5A 3BCSA 5LYJB 1ZR4A 4LOKA 4C06A 1R4ZA 1GKKA 1MT0A 3SMQA 4A03A 1VGVA 1N8SA 2PGOA 2FY8A 1JXOA 4G3XA 5TQ2B 3TXXA 4AIIA 4BNVA 3IOYA 3CSSA 4GLJA 4NOJA 2AOVA 1GO2A 3CX3A 1HEYA 4AAYA 3V5NA 3PXAA 4LX8A 4M1WA 5IAAA 2PD6A 1MF7A 1XTRA 2PT6A 1J56A 4Q7MB 4C3VA 3KK0A 2DLDA 2JFBA 5F52A 3HU2A 1E3WB 4UFNA 1W46A 2P5UA 1BS1A 3WNZA 1MN6A 2NUTB 4EY4A 1XYVA 1XDUA 3WIVA 4JI1B 2OQ2A 3VDQA 1R37A 2LD4A 3RAJA 5AICA 1G5FA 3U4GA 2VHWA 1C0PA 4F5WA 5IJZA 3N2EA 3DV9A 3C3MA 5GADl 1FJGB 1VIMA 1P2DA 2Q5CA 3V42A 4TS3A 3FOFC 1BTOA 2QD5A 3BXEA 2PYDA 4HQNA 1H5UA 1ZBQA 1Y8ZA 4G84A 1I0ZA 1AS3A 1WDMA 4DHEA 1M7HA 2WHYA 1JJBA 1X1EA 3HJAA 4HBGA 4R2JA 1PJZA 2ZIUB 2CV1A 1KBOA 3COSA 3R3YA 5JNRA 4YV0A 5ESWA 1AKQA 6GPBA 3IE1A 1MCZA 4X1IA 3AB7A 1NATA 3DEAA 1GQFA 5FL3A 5BVGA 1FP7A 4YIHA 2X19A 1FDIA 1A2KC 3M6MD 2W83A 3KVYA 3ICOA 3FROA 3IIEA 5DNCA 3B6IA 4C08A 5LMNB 5BNZA 4QTYA 3CWCA 3OCCA 4QBGB 1RM4A 5D3MA 3COYA 2Q3CA 3MF4A 4YMUA 2EVWX 4WUTA 9ATCA 4Q1EA 5K8CA 1BWRA 4XX0A 2N3ZA 1LDBA 1E4VA 3GRPA 1Q2UA 3GGDA 3UENA 1TYCA 5FJIA 1SCQA 4G97A 5K1ZA 3SR4A 4KNWA 2I2CA 1FMJA 2FE4A 1L8XA 1RE1A 1QGZA 3MTEA 2D0DA 1NR5A 1Y4AE 3A6PC 2I2XB 3H5TA 3R3HA 2VXBA 3F47A 4XARA 4BNWA 4E12A 4ZOQI 3G49A 4EQZA 4OMCA 1TKBA 2DF8A 3HSSA 3RRJA 1OJ7A 3IT0A 4G26A 2RGGA 2ZJFA 3UYKA 1D4AA 1G4UR 2XA1A 4W1QA 3VPFA 4Q1BA 4A7PA 3RO7A 1RP1A 4KMMA 4A5OA 5KVVA 3NRJA 3MUEA 1AK1A 3PC8C 3R0VA 4K9DA 1OFIA 3FMPB 4XUEA 5HDBB 2IS2A 1XNJA 3NWBA 4PYOA 5JNLA 4HVTA 4C2TA 3EARA 3SU8A 5EWMA 1TYDE 3L7CA 1E92A 3PTZA 2JG3A 4D3DA 1U2ZA 2H5IA 3GFQA 3T35A 3V8NA 2X4IA 3M3PA 1RLMA 3VKWA 3WKDA 1Z0IA 3PFKA 4CI9A 4CEJA 4U2DA 2L0XA 2WVHA 2IYLD 2RJOA 3EAQA 3AX6A 4HFMA 4V03A 2UYQA 4DG5A 1DUSA 4DXAA 3R0QA 4ASUA 4ZEVA 1OAOA 1I1OA 1LWOA 2HDOA 2G9QA 2A86A 2ORYA 3ELDA 3ELUA 4V0MA 4HT3B 1E59A 3TR5A 1P7WA 4AMVA 2ZSUA 4ITVA 3F71A 4KXMA 4RJLA 3CF4G 1QFSA 3S2SA 1P19A 2AG0A 1QZZA 4BJ5A 4I1IA 1JFVA 3VJLA 5K5EA 4ZQEA 3SXUA 1SXJD 3MMZA 5EGSA 3GFOA 4IUCS 3L8YA 3BIFA 4OQ4A 3VR1A 3LK6A 5E9AA 2OGWA 4JROA 2ZJAA 3O8RA 2CLIB 3QFTA 3SG0A 4PGHA 4EFMA 1E69A 2WYUA 1OX4A 2ZE7A 2J9ZB 3MWFA 3EN0A 4X62B 3QLVA 4LV8B 4DIEA 3GGCA 3TUZC 2AXPA 3N07A 5THQA 5F4ZA 3SIXA 3HKCA 3UJ3X 4WXPA 4OGLA 1GG9A 1DDOA 2YHSA 3OQMA 4F71A 3NBYC 3NBKA 2G08A 4WCVA 4DABA 3VR5A 4CM3A 4IR7A 5C46F 4HAWA 4CKBA 3EMBA 2EZ8A 3C8UA 4A1OA 4Y2UA 2E4ZA 1NVAA 2LDBA 3RYIB 4TYQA 3FFTA 4WVLA 3TDKA 4BASA 3LXRA 4ZQCB 1HZZC 1VB5A 2AZ4A 3K5PA 4E5DA 4YYZA 2FZGA 4GZ5A 3HVJA 3PUJA 4QUHA 4TLCA 4JB2A 2HBYA 2FFRA 3G1WA 1B73A 1K86A 1L5SA 1JGTA 1R5JA 4B87A 1SCAA 1Y6RA 1CF2O 1X9HA 4ZVLA 3EG9B 3VXKA 4ZYUA 5JCZA 1OB2A 2MR5A 4B0PA 4IIYA 4YVFA 1CDEA 3HH8A 2BTQB 3RAFC 1LJLA 2LDXA 2PSFA 3JVDA 4RVHA 3R0ZA 4WNYA 4EKNB 2QGZA 4IUDS 2QBYB 3LPDA 3HJGA 3RDPA 3WLSA 2OK8A 5E9JA 1PR2A 2D2IA 1S2OA 3H0CA 3AG5A 4BEWA 5AVRA 4RTNA 1X8JA 3CHYA 1GPH1 1UEJA 2IZ5A 4LVNA 3OIYA 3UUWA 5BV7A 3NGXA 1W5TA 3WHKA 1BROA 1ENOA 4MDFA 5HILA 2ZYSA 3AHIA 4GC5A 1CIPA 2AXEA 3LW8A 1OI4A 2HBRA 4H31A 4PHCA 4DIDA 3R8FA 1Q77A 4RV9A 2MU1A 1GAQA 4BJ1A 2CJWB 3H42B 2H11A 2OBLA 2XVYA 1T9BA 3JYPA 1VBFA 1P7ZA 2HF7A 6NULA 2C2HA 1NI4B 4RK4A 4EDHA 3L7NA 3VDNB 2A9PA 3G17A 2WD7A 2YZ2A 1DAIA 2W37A 2UV8A 1AB5A 1KBZA 3LI2A 3F7TA 4LG1A 3J7AC 4AP9A 5AK6A 1L7OA 2E89A 3ADBA 5CH3A 1ZITA 1V9LA 1ZJ6A 2GPTA 4P7FA 5F7ZA 3KLBA 4EIWA 2JAPA 1X2EA 4BO2A 3L0CA 3E3NA 4MA4A 2IEDA 4DDVA 4FC6A 3OZBA 3CLSC 2HIAA 3IOCA 5DCLA 1DC4A 4YRZA 2CN1A 2HSZA 1P7PA 1CRLA 3LUAA 3BWEA 4GE0A 1N2SA 3CX7A 4LHYA 4Q47A 5FNVA 2HA4A 1ILWA 2PD3A 4YAGA 5BNWA 2VT6A 4FR2A 4C7XA 1XELA 1MEJA 3ZY6A 4RPIA 2B2CA 2NU9A 3QBTA 2WQZA 2Z1MA 4GOLD 3DO6A 1PD1A 4FFSA 2EFCB 1XVUA 3DHYA 5EJ7A 3PQ4A 1QHSA 2FZKA 2K6GA 1HYHA 1A69A 4PLHA 3VI4B 4C43A 2JLUA 3EF1A 1C8BA 5ADVA 1T10A 2AQ8A 1LTHR 1WPGA 4NZ9A 2PL1A 4RE5A 5G53C 1K4MA 2OTCA 5AW0A 4R16A 1GD1O 2QSUA 3NQ41 1GRVA 4JVMA 1ZC3A 4CIWA 4GNRA 1O94A 3L6EA 1MXHA 1EJ0A 1VSQA 2FKAA 5B1SA 2Z5GA 2RGNA 2WMYA 1N4AA 3U40A 4Z1MD 3PA6A 1JLKA 1NJ2A 2PGIA 5LP6A 2I65A 1O87A 2W8ZA 4GI2A 4HRVA 4OA8A 1NXSA 1YZLA 3AV0B 1QSGA 3C41J 3LF1A 4FEYA 4L85A 1AHPA 4KCGA 3ZUPA 4D5GA 2V7QA 1Y1KE 3PC2A 5F1OA 5KTRA 1EMDA 4UQPA 2Y92A 3A2MA 4CZ2A 1O6GA 1KI6A 2A6PA 3DZ8A 3IO5A 3LHKA 4J1NA 4MWSA 5HWSA 5JXHA 2YOGA 3CZCA 1R3UA 5L7WA 3D6JA 3IXLA 2IS6A 1YB1A 1YXMA 1E3EA 2BOVA 1AKNA 3A9UA 4GKBA 3VKFA 1UT5A 4Z7OB