1XT3A

Structure basis of venom citrate-dependent heparin sulfate-mediated cell surface retention of cobra cardiotoxin a3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of citrate-dependent and heparan sulfate-mediated cell surface retention of cobra cardiotoxin A3
pubmed doi rcsb
molecule tags Toxin
molecule keywords Cytotoxin 3
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1xt3A00
2J8BA 1CTXA 2H8UA 1ERAA 3EBXA 2PJYC 1JGKA 2LCRA 1CDRA 2ERAA 4FAOE 2MFAA 2CTXA 1CVOA 3KFDE 2H62C 2NBTA 1VB0A 3NH7A 1YWHA 1KBTA 1HAAA 1KTZB 2OFSA 1CDQA 2MJYA 1IDHA 1NEAA 1CXOA 5DU1A 1FFJA 4AEAA 4FAOC 1HC9B 2N99A 3U73U 1KL8A 4HQPF 4RUDA 2H62D 1F94A 2ABXA 1NTXA 3FEVA 1HOYA 1FF4A 4P7UA 1DRSA 2UWRA 1KU6B 1TXBA 2I9BE 2JQPA 3ERAA 1NORA 2MUOA 1CXNA 3BT2U 5EBXA 1LXGA 3VTSA 2MJ0A 2UX2A 3U74U 1FRAA 1ABTA 2HLQA 1CRFA 1JBDA 1L4WA 1ES7B 1IDIA 1H0JA 1KS6A 5DZ5A 1PLOA 2H7ZA 1NTNA 2FD6U 1FSSB 4OM4A 1BXPA 1G6MA 1JE9A 6EBXA 2CCXA 2BHIA 1CHVS 4LFTA 2H64B 1NYUA 1RGJA 2CRTA 1IDLA 2JVEA 1TFSA 2GOOC 1ERGA 4DO8A 1RL5A 1NXBA 1S4YA 1TXAA 1QKEA 4OM5A 4UY2C 2BTXA 1CODA 2L03A 1CREA 3PLCA 2GOOB 2X8BB 3QB4B 4BDTB 1F8UB 2CDXA 1CDTA 1REWC 2K3GA 2MUPA 4EY8B 2MHYA 2H7ZB 1CDSA 1QM7A 1LXHA 4BIKB 1LJZA 1M9ZA 1IKCA 1HAJA 1I02A 1CB9A 3EVSC 1NYSA 2QJBC 1MAHF 3HH7A 1W6BA 1KC4A 1KBAA 2HLRA 2QJ9C 1LX5B 3KFDI 1ONJA 4QTIU 4XJJA 5DO6A 1KXIA 1QKDA 5IMYC 2LA1A 1ZADA 3LAQU 1BTEA 1COEA 3NDSA 4ZQYA 2VLWA 1B41B 1MR6A 4IYEA 1HC9A 2MJ4A 3BT1U 1CCQA 1KFHA 2H5FA 2QC1A 2CRSA 5IMTD 1IJCA 2H64C 1LSIA 1FSCA 2PJYB 1V6PA 1IDGA 1UG4A 2QJAC 1TGXA 2L5SA 1IK8A 1XT3A 1FASA 1KBSA 1IQ9A 3NEQA
chains in the Genus database with same CATH superfamily
2J8BA 1CTXA 2H8UA 1ERAA 3EBXA 2PJYC 1JGKA 2LCRA 1CDRA 2ERAA 4FAOE 2MFAA 2CTXA 1CVOA 3KFDE 2H62C 2NBTA 1VB0A 3NH7A 1YWHA 1KBTA 1HAAA 1KTZB 2OFSA 1CDQA 2MJYA 1IDHA 1NEAA 1CXOA 5DU1A 1FFJA 4AEAA 4FAOC 1HC9B 2N99A 3U73U 1KL8A 4HQPF 4RUDA 2H62D 1F94A 2ABXA 1NTXA 3FEVA 1HOYA 1FF4A 4P7UA 1DRSA 2UWRA 1KU6B 1TXBA 2I9BE 2JQPA 3ERAA 1NORA 2MUOA 1CXNA 3BT2U 5EBXA 1LXGA 3VTSA 2MJ0A 2UX2A 3U74U 1FRAA 1ABTA 2HLQA 1CRFA 1JBDA 1L4WA 1ES7B 1IDIA 1H0JA 1KS6A 5DZ5A 1PLOA 2H7ZA 1NTNA 2FD6U 1FSSB 4OM4A 1BXPA 1G6MA 1JE9A 6EBXA 2CCXA 2BHIA 1CHVS 4LFTA 2H64B 1NYUA 1RGJA 2CRTA 1IDLA 2JVEA 1TFSA 2GOOC 1ERGA 4DO8A 1RL5A 1NXBA 1S4YA 1TXAA 1QKEA 4OM5A 4UY2C 2BTXA 1CODA 2L03A 1CREA 3PLCA 2GOOB 2X8BB 3QB4B 4BDTB 1F8UB 2CDXA 1CDTA 1REWC 2K3GA 2MUPA 4EY8B 2MHYA 2H7ZB 1CDSA 1QM7A 1LXHA 4BIKB 1LJZA 1M9ZA 1IKCA 1HAJA 1I02A 1CB9A 3EVSC 1NYSA 2QJBC 1MAHF 3HH7A 1W6BA 1KC4A 1KBAA 2HLRA 2QJ9C 1LX5B 3KFDI 1ONJA 4QTIU 4XJJA 5DO6A 1KXIA 1QKDA 5IMYC 2LA1A 1ZADA 3LAQU 1BTEA 1COEA 3NDSA 4ZQYA 2VLWA 1B41B 1MR6A 4IYEA 1HC9A 2MJ4A 3BT1U 1CCQA 1KFHA 2H5FA 2QC1A 2CRSA 5IMTD 1IJCA 2H64C 1LSIA 1FSCA 2PJYB 1V6PA 4KSNA 1IDGA 1UG4A 2QJAC 1TGXA 2L5SA 1IK8A 1XT3A 1FASA 1KBSA 1IQ9A 3NEQA
chains in the Genus database with same CATH topology
2J8BA 1CTXA 2H8UA 1ERAA 3EBXA 2PJYC 1JGKA 2LCRA 1CDRA 2ERAA 4FAOE 2MFAA 2CTXA 1CVOA 3KFDE 2H62C 2NBTA 1VB0A 3NH7A 1YWHA 1KBTA 1HAAA 1KTZB 2OFSA 1CDQA 2MJYA 1IDHA 1NEAA 1CXOA 5DU1A 1FFJA 4AEAA 4FAOC 1HC9B 2N99A 3U73U 1KL8A 4HQPF 4RUDA 2H62D 1F94A 2ABXA 1NTXA 3FEVA 1HOYA 1FF4A 4P7UA 1DRSA 2UWRA 1KU6B 1TXBA 2I9BE 2JQPA 3ERAA 1NORA 2MUOA 1CXNA 3BT2U 5EBXA 1LXGA 3VTSA 2MJ0A 2UX2A 3U74U 1FRAA 1ABTA 2HLQA 1CRFA 1JBDA 1L4WA 1ES7B 1IDIA 1H0JA 1KS6A 5DZ5A 1PLOA 2H7ZA 1NTNA 2FD6U 1FSSB 4OM4A 1BXPA 1G6MA 1JE9A 6EBXA 2CCXA 2BHIA 1CHVS 4LFTA 2H64B 1NYUA 1RGJA 2CRTA 1IDLA 2JVEA 1TFSA 2GOOC 1ERGA 4DO8A 1RL5A 1NXBA 1S4YA 1TXAA 1QKEA 4OM5A 4UY2C 2BTXA 1CODA 2L03A 1CREA 3PLCA 2GOOB 2X8BB 3QB4B 4BDTB 1F8UB 2CDXA 1CDTA 1REWC 2K3GA 2MUPA 4EY8B 2MHYA 2H7ZB 1CDSA 1QM7A 1LXHA 4BIKB 1LJZA 1M9ZA 1IKCA 1HAJA 1I02A 1CB9A 3EVSC 1NYSA 2QJBC 1MAHF 3HH7A 1W6BA 1KC4A 1KBAA 2HLRA 2QJ9C 1LX5B 3KFDI 1ONJA 4QTIU 4XJJA 5DO6A 1KXIA 1QKDA 5IMYC 2LA1A 1ZADA 3LAQU 1BTEA 1COEA 3NDSA 4ZQYA 2VLWA 1B41B 1MR6A 4IYEA 1HC9A 2MJ4A 3BT1U 1CCQA 1KFHA 2H5FA 2QC1A 2CRSA 5IMTD 1IJCA 2H64C 1LSIA 1FSCA 2PJYB 1V6PA 4KSNA 1IDGA 1UG4A 2QJAC 1TGXA 2L5SA 1IK8A 1XT3A 1FASA 1KBSA 1IQ9A 3NEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8B A;  1CTX A;  2H8U A;  1ERA A;  3EBX A;  2PJY C;  1JGK A;  2LCR A;  1CDR A;  2ERA A;  4FAO E;  2MFA A;  2CTX A;  1CVO A;  3KFD E;  2H62 C;  2NBT A;  1VB0 A;  3NH7 A;  1YWH A;  1KBT A;  1HAA A;  1KTZ B;  2OFS A;  1CDQ A;  2MJY A;  1IDH A;  1NEA A;  1CXO A;  5DU1 A;  1FFJ A;  4AEA A;  4FAO C;  1HC9 B;  2N99 A;  3U73 U;  1KL8 A;  4HQP F;  4RUD A;  2H62 D;  1F94 A;  2ABX A;  1NTX A;  3FEV A;  1HOY A;  1FF4 A;  4P7U A;  1DRS A;  2UWR A;  1KU6 B;  1TXB A;  2I9B E;  2JQP A;  3ERA A;  1NOR A;  2MUO A;  1CXN A;  3BT2 U;  5EBX A;  1LXG A;  3VTS A;  2MJ0 A;  2UX2 A;  3U74 U;  1FRA A;  1ABT A;  2HLQ A;  1CRF A;  1JBD A;  1L4W A;  1ES7 B;  1IDI A;  1H0J A;  1KS6 A;  5DZ5 A;  1PLO A;  2H7Z A;  1NTN A;  2FD6 U;  1FSS B;  4OM4 A;  1BXP A;  1G6M A;  1JE9 A;  6EBX A;  2CCX A;  2BHI A;  1CHV S;  4LFT A;  2H64 B;  1NYU A;  1RGJ A;  2CRT A;  1IDL A;  2JVE A;  1TFS A;  2GOO C;  1ERG A;  4DO8 A;  1RL5 A;  1NXB A;  1S4Y A;  1TXA A;  1QKE A;  4OM5 A;  4UY2 C;  2BTX A;  1COD A;  2L03 A;  1CRE A;  3PLC A;  2GOO B;  2X8B B;  3QB4 B;  4BDT B;  1F8U B;  2CDX A;  1CDT A;  1REW C;  2K3G A;  2MUP A;  4EY8 B;  2MHY A;  2H7Z B;  1CDS A;  1QM7 A;  1LXH A;  4BIK B;  1LJZ A;  1M9Z A;  1IKC A;  1HAJ A;  1I02 A;  1CB9 A;  3EVS C;  1NYS A;  2QJB C;  1MAH F;  3HH7 A;  1W6B A;  1KC4 A;  1KBA A;  2HLR A;  2QJ9 C;  1LX5 B;  3KFD I;  1ONJ A;  4QTI U;  4XJJ A;  5DO6 A;  1KXI A;  1QKD A;  5IMY C;  2LA1 A;  1ZAD A;  3LAQ U;  1BTE A;  1COE A;  3NDS A;  4ZQY A;  2VLW A;  1B41 B;  1MR6 A;  4IYE A;  1HC9 A;  2MJ4 A;  3BT1 U;  1CCQ A;  1KFH A;  2H5F A;  2QC1 A;  2CRS A;  5IMT D;  1IJC A;  2H64 C;  1LSI A;  1FSC A;  2PJY B;  1V6P A;  1IDG A;  1UG4 A;  2QJA C;  1TGX A;  2L5S A;  1IK8 A;  1XT3 A;  1FAS A;  1KBS A;  1IQ9 A;  3NEQ A; 
#chains in the Genus database with same CATH topology
 2J8B A;  1CTX A;  2H8U A;  1ERA A;  3EBX A;  2PJY C;  1JGK A;  2LCR A;  1CDR A;  2ERA A;  4FAO E;  2MFA A;  2CTX A;  1CVO A;  3KFD E;  2H62 C;  2NBT A;  1VB0 A;  3NH7 A;  1YWH A;  1KBT A;  1HAA A;  1KTZ B;  2OFS A;  1CDQ A;  2MJY A;  1IDH A;  1NEA A;  1CXO A;  5DU1 A;  1FFJ A;  4AEA A;  4FAO C;  1HC9 B;  2N99 A;  3U73 U;  1KL8 A;  4HQP F;  4RUD A;  2H62 D;  1F94 A;  2ABX A;  1NTX A;  3FEV A;  1HOY A;  1FF4 A;  4P7U A;  1DRS A;  2UWR A;  1KU6 B;  1TXB A;  2I9B E;  2JQP A;  3ERA A;  1NOR A;  2MUO A;  1CXN A;  3BT2 U;  5EBX A;  1LXG A;  3VTS A;  2MJ0 A;  2UX2 A;  3U74 U;  1FRA A;  1ABT A;  2HLQ A;  1CRF A;  1JBD A;  1L4W A;  1ES7 B;  1IDI A;  1H0J A;  1KS6 A;  5DZ5 A;  1PLO A;  2H7Z A;  1NTN A;  2FD6 U;  1FSS B;  4OM4 A;  1BXP A;  1G6M A;  1JE9 A;  6EBX A;  2CCX A;  2BHI A;  1CHV S;  4LFT A;  2H64 B;  1NYU A;  1RGJ A;  2CRT A;  1IDL A;  2JVE A;  1TFS A;  2GOO C;  1ERG A;  4DO8 A;  1RL5 A;  1NXB A;  1S4Y A;  1TXA A;  1QKE A;  4OM5 A;  4UY2 C;  2BTX A;  1COD A;  2L03 A;  1CRE A;  3PLC A;  2GOO B;  2X8B B;  3QB4 B;  4BDT B;  1F8U B;  2CDX A;  1CDT A;  1REW C;  2K3G A;  2MUP A;  4EY8 B;  2MHY A;  2H7Z B;  1CDS A;  1QM7 A;  1LXH A;  4BIK B;  1LJZ A;  1M9Z A;  1IKC A;  1HAJ A;  1I02 A;  1CB9 A;  3EVS C;  1NYS A;  2QJB C;  1MAH F;  3HH7 A;  1W6B A;  1KC4 A;  1KBA A;  2HLR A;  2QJ9 C;  1LX5 B;  3KFD I;  1ONJ A;  4QTI U;  4XJJ A;  5DO6 A;  1KXI A;  1QKD A;  5IMY C;  2LA1 A;  1ZAD A;  3LAQ U;  1BTE A;  1COE A;  3NDS A;  4ZQY A;  2VLW A;  1B41 B;  1MR6 A;  4IYE A;  1HC9 A;  2MJ4 A;  3BT1 U;  1CCQ A;  1KFH A;  2H5F A;  2QC1 A;  2CRS A;  5IMT D;  1IJC A;  2H64 C;  1LSI A;  1FSC A;  2PJY B;  1V6P A;  4KSN A;  1IDG A;  1UG4 A;  2QJA C;  1TGX A;  2L5S A;  1IK8 A;  1XT3 A;  1FAS A;  1KBS A;  1IQ9 A;  3NEQ A; 
#chains in the Genus database with same CATH homology
 2J8B A;  1CTX A;  2H8U A;  1ERA A;  3EBX A;  2PJY C;  1JGK A;  2LCR A;  1CDR A;  2ERA A;  4FAO E;  2MFA A;  2CTX A;  1CVO A;  3KFD E;  2H62 C;  2NBT A;  1VB0 A;  3NH7 A;  1YWH A;  1KBT A;  1HAA A;  1KTZ B;  2OFS A;  1CDQ A;  2MJY A;  1IDH A;  1NEA A;  1CXO A;  5DU1 A;  1FFJ A;  4AEA A;  4FAO C;  1HC9 B;  2N99 A;  3U73 U;  1KL8 A;  4HQP F;  4RUD A;  2H62 D;  1F94 A;  2ABX A;  1NTX A;  3FEV A;  1HOY A;  1FF4 A;  4P7U A;  1DRS A;  2UWR A;  1KU6 B;  1TXB A;  2I9B E;  2JQP A;  3ERA A;  1NOR A;  2MUO A;  1CXN A;  3BT2 U;  5EBX A;  1LXG A;  3VTS A;  2MJ0 A;  2UX2 A;  3U74 U;  1FRA A;  1ABT A;  2HLQ A;  1CRF A;  1JBD A;  1L4W A;  1ES7 B;  1IDI A;  1H0J A;  1KS6 A;  5DZ5 A;  1PLO A;  2H7Z A;  1NTN A;  2FD6 U;  1FSS B;  4OM4 A;  1BXP A;  1G6M A;  1JE9 A;  6EBX A;  2CCX A;  2BHI A;  1CHV S;  4LFT A;  2H64 B;  1NYU A;  1RGJ A;  2CRT A;  1IDL A;  2JVE A;  1TFS A;  2GOO C;  1ERG A;  4DO8 A;  1RL5 A;  1NXB A;  1S4Y A;  1TXA A;  1QKE A;  4OM5 A;  4UY2 C;  2BTX A;  1COD A;  2L03 A;  1CRE A;  3PLC A;  2GOO B;  2X8B B;  3QB4 B;  4BDT B;  1F8U B;  2CDX A;  1CDT A;  1REW C;  2K3G A;  2MUP A;  4EY8 B;  2MHY A;  2H7Z B;  1CDS A;  1QM7 A;  1LXH A;  4BIK B;  1LJZ A;  1M9Z A;  1IKC A;  1HAJ A;  1I02 A;  1CB9 A;  3EVS C;  1NYS A;  2QJB C;  1MAH F;  3HH7 A;  1W6B A;  1KC4 A;  1KBA A;  2HLR A;  2QJ9 C;  1LX5 B;  3KFD I;  1ONJ A;  4QTI U;  4XJJ A;  5DO6 A;  1KXI A;  1QKD A;  5IMY C;  2LA1 A;  1ZAD A;  3LAQ U;  1BTE A;  1COE A;  3NDS A;  4ZQY A;  2VLW A;  1B41 B;  1MR6 A;  4IYE A;  1HC9 A;  2MJ4 A;  3BT1 U;  1CCQ A;  1KFH A;  2H5F A;  2QC1 A;  2CRS A;  5IMT D;  1IJC A;  2H64 C;  1LSI A;  1FSC A;  2PJY B;  1V6P A;  4KSN A;  1IDG A;  1UG4 A;  2QJA C;  1TGX A;  2L5S A;  1IK8 A;  1XT3 A;  1FAS A;  1KBS A;  1IQ9 A;  3NEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...