1XT9B

Crystal structure of den1 in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complex between Nedd8 and the Ulp/Senp Protease Family Member Den1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Sentrin-specific protease 8
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1xt9B00
1WX9A 4URKA 1X1MA 3A1QA 3HIZA 4NQLB 1VD2A 3S2AA 4BFRA 1GC6A 2NVUI 4MGIE 4PS7A 1NI2A 4B6WA 4GOCA 4NY0A 1UELA 2KK8A 2WYQA 2FIDA 4KIKB 1OEYA 2OJRA 2M0XA 3QC8B 5CHFA 1I42A 4FHKA 1V5TA 4NJ7A 4YL8A 2BKFA 2CKHB 2LRWA 2KOXA 3QA8A 4G50A 3SHQA 1E5WA 4TUUA 2K6DB 2WX1A 3Q3JA 4MEMA 1WJUA 4WWNA 4TV3A 4LJPB 4W9DA 4FHJA 2G45B 2XK5B 2ZPYA 4B9KA 2IY1B 1IYFA 4M0WB 2JZ3B 2KJHB 3KYDD 2JT4B 4KDIC 1LQBA 3NZSA 1WX7A 2KFJA 1L7YA 2KNBA 2V3SA 4A3PA 5CHVC 1UH6A 2KFKA 2WWZA 2WDTB 2KQ7A 4TQ1A 5JZEB 3OLMD 3ZO5B 3PVLA 1NDDA 1GNUA 2CHXA 1YQBA 3RZFA 4BKSD 1YX6B 4WJOA 3X0WA 1G6JA 1LXDA 3QARA 3ENEA 1OQYA 1WI0A 3PHWB 2HTHA 4J6IA 4WJQA 1Q0WB 5E6NA 4MGKE 3CF6E 3BY4B 3ZIMA 3WAOA 3N32A 4EZLA 3ZKJC 2L0FA 1M94A 4K7WA 1V6EA 1ZW7A 2JUOA 4ZRKA 5LLIA 4AWJA 5HKHA 3APCA 2FCSA 3DQVA 2CR5A 2MBHA 2DAJA 2IBIB 1PQSA 2LGXA 1ISNA 1WM2A 2I1KA 1WX8A 4F8CB 3RT3B 4AUQC 4HPLB 1V2YA 3IBEA 1OGWA 1GUAB 4RM8A 3VQIA 4W9HA 2FUHB 5JHAA 4W9FA 1WYWB 1YJ1A 3ECIA 2UWQA 2D3GA 1TGZB 3SD5A 3M62B 2D2QA 2Z59B 2KO3A 2BWES 4KZCA 2O6VA 1WIAA 3KVFB 2GBJA 3AULA 4WWPA 3D32A 2I1JA 2MX2A 3UGBB 5LXHA 5GMVA 4IM3A 2MWSB 4LJOB 1I35A 4ZDVA 2NBWB 3ZNID 4E3CA 4MSMB 3HHMA 3K9OB 2JRHA 3IHPC 3H1UA 3O65B 3ZUNA 4B95A 4PS8A 4IG7B 4BKGA 1A5RA 2K25A 2LZ6A 4DHZE 2KMCA 2M17A 1TZ1A 2HD5B 3BINA 2YLMA 5TR5A 2FIFA 2KTRA 3V6CB 2A4ZA 3V62A 4OVUA 1P0RA 4TQ0A 1IPGA 1WGGA 3PHXB 4CHKA 3T9LA 4FBJB 2MSED 1UBIA 2Y5BB 3KUDB 1WH3A 2C60A 2ZEQA 3IVFA 1EF5A 1ZKHA 3RULA 3OJ3A 5E6OA 3L54A 4BVUC 2FNJB 4GGQA 1V49A 1RFAA 2ZPNA 3TMPB 4K7SA 4FA6A 4AOFA 4GDKA 2KTRB 1C3TA 2BYVE 3H7PA 2KQSA 3HM3A 3ZTDA 3QX1A 4G11A 4AP4C 2EKEC 4HVBA 1KJTA 2DZMA 3I3TB 3VUXA 3VUWA 1YX5B 1WXSA 4KSKC 4NPNA 1WE6A 2KX0A 2LVPA 2KX3A 3DVNV 3KUCB 1H8CA 2FCNA 3ZNZB 1WXVA 3DBLI 4MJSB 3W1SC 3UIOB 2LGYA 3PRMB 2RR9A 5C23A 3IFWB 4HLEA 3VTUA 4PYUA 5G55A 2N9XA 4K1RB 2O6VD 3PV1A 3K9PB 5G2NA 4ANUA 1P1AA 3H7SA 2JXXA 4EEWA 4JGHB 2BKRB 2MLBA 4II2B 4FJZA 4I6LB 3CSTA 2N7DA 2KD0A 4HXDA 4IWQA 4II3B 3PTFC 2LRUA 4P7IA 5LXIB 1R4NI 1TTNA 4GB9A 2K8CA 4M8MA 1QZEA 2BF8B 2LXCA 3LJ3A 4W9EA 1UBQA 2IYDB 2KWUB 4HDQA 3DBRI 1KM7A 4GDLA 3IG3A 2GBMA 2YVCA 3C0RB 3DVNU 4KIKA 4CO7A 3ZTCA 2IY0B 3DBSA 3HM6X 3DDCB 2AWTA 3JW0X 3M95A 3PREA 3VVWB 5L95C 3TIXA 3DVGY 2IZVB 3L08A 2OOBB 3PRPB 3PGEA 2ZCBA 4FN2A 4GMVA 3RZWC 5D2MB 2O2VB 3UIPB 1NBFC 4WWOA 1V9JA 1WZ0A 2REXA 4TKNA 5EDSA 4CYEA 3EECA 1TBEA 4EOYA 3PRZA 1WR6E 2DZIA 3WIMA 3HK0A 3VH4B 3RUIB 5AEKB 3B0AA 4HK2A 2DZKA 4W9GA 1J0GA 1WGYA 2CHZA 2V4LA 3MTNB 3EC8A 4WQOB 4DHZB 2KVRA 1UGMA 4XX5A 3PZDA 2NCNA 4IWPA 2CHWA 2ZVNA 2BYEA 3GOEA 1WE7A 1KOTA 4F1SA 2JY6A 4NAWA 3VTWA 5DPSA 4JLCA 3PLVA 2NBVB 4NAWB 3OJ4B 3VDZA 2MBBB 3NS8A 3VAWA 2N9EB 3PS6A 3TCAA 1Q1OA 1UZXB 4JIOU 2CS4A 2BPSA 4FULA 2DHZA 4KV2A 1HE8A 4MH0E 4ZYNA 2LI5A 2ZJDA 1E7UA 2MBOA 4FJVB 2L76A 1T0YA 4KVGB 1EO6A 1E8YA 1LM8B 2MP2A 3A9JB 3NOBA 1WM3A 4WAAA 2DYMA 3N30A 1BT0A 3QHTA 3R3MA 3JYUA 1E8XA 2J0JA 5AZFA 3R66C 1CMXB 1WGRA 1IP9A 1LFDA 3L16A 3APFA 2B3AA 2JPHA 2AL6A 3L0WB 2XBBC 3KUZA 3B1LX 2N1VA 2PPHA 2PE9A 3Q3FA 4IM0A 3W1SA 1D3ZA 4PYZA 2ZNVB 1GJZA 3PT2B 3ZVVA 4A20A 1K8RB 2ZZPB 4XZ4A 4DDID 4HPMB 1J8CA 1OEYJ 2KLCA 2DENB 2K8HA 2JRIB 1RRBA 3DBHI 2C7HA 5L83A 4DK5A 3UINB 2HE7A 2HJ8A 3AU4A 2R2OA 2WX0A 3CSFA 3VXWA 1S3SG 2MP2B 3A9JA 4A3OA 4PS3A 4W9JA 2JZZA 3R7QA 4GDLB 3NY5A 3V60A 2KMAA 4KSLC 4NJ6A 2ZCCA 4MDKE 2KXJA 3QJZA 2N7EA 3NHEB 2KZRA 3VHTC 2NPTA 2AEHA 4ANVA 1RLFA 2RD0A 4BBNF 3VFKA 5J17A 1WMHA 2KJRA 2KDBA 2XEWA 5CHWA 5J2RA 3TBLD 1L2NA 2DYBA 1P3QU 4W9IA 3KYCD 4MM3A 4BKTA 1R4MI 2G3QB 2KDIA 4BOZB 3A4RA 4EKUA 1E8ZA 2W9NA 2RSUA 3H6NA 5CTRC 2L8JA 4F7ZA 2KJ6A 1WFYA 3SDLC 3WANA 4LDTD 1SGHA 3MHSD 2LWPA 2RPQA 4EUTA 4NNJB 2MBQA 3KH0A 4K81A 3QIJA 2DAFA 3PSEB 1AARA 1V5OA 4DWFA 2O6VB 4W9KA 3DOWA 4LDTB 2C7MB 3AI5A 3GZNI 3TL5A 5IA7A 4GXBA 3M63B 4W9LA 4ICVA 2FCQA 1MG8A 1P9DU 3ML9A 1YD8U 3QWZB 2PEAA 3U8ZA 1FXTB 1WJ4A 3U7DA 2LXAA 4W9CA 2MBEA 3EHVA 3OAWA 3TJPA 1VCBA 1WJNA 4HCNB 4IM2A 1Z2MA 2K1FA 4HDOA 4EZKA 1SIFA 3RD2A 1Y8RC 1ZGUB 5DPRA 3NZUA 3SU8X 4EFOA 4IC7B 2BGFA 2G4SA 2DYOA 2D07B 4MJSA 2AYOB 4RM9A 3EFUA 3WA0A 5KHOA 1WXMA 2A5UA 2EMSA 2MRPA 3AU5A 2G4DB 3T8MA 2MQJA 3AXCA 4MSQB 1V81A 2GOWA 5AZGA 3ZDMC 3ML8A 4G0NB 1E7VA 2LVOA 2L3ZA 4HCPB 3WALA 4AJYB 2K6QA 3UF8A 4GDKB 4I6NB 1Q5WB 3L13A 4N9F4 1V86A 2M1MA 4OVVA 2JF5A 3V6EB 3DVGX 4WJNA 2BWFA 1U4AA 4GSWA 2LD9A 2M8SA 3M3JA 2BYFA 3ZNGC 5J18A 5C1ZA 2XK5A 4GN1A 4ICUA 3A1QB 3WAMA 1E8WA 2J0MA 1WMHB 4HJKA 2L0TA 1YIWA 4WJPA 5E6PA 2LGDA 4DDGD 5JHBA 4FJYA 2GBNA 1OTRB 2J0KA 2LVQA 3PPAA 3QQ8B 5JH5C 2KDFB 4E71A 2GBRA 2FCMA 2L7RA 3DCGA 3N3KB 2PJHA 4I6PA 2NS5A 3QCAA 5DPTA 2M4NA 4DHJD 4LCDE 4MELA 3JSVA 5D6JB 4BBNC 4K7UA 2VRRB 3APDA 5BO4B 2L05A 2IO0B 5CX3A 4BKSA 2ZVOA 5KHQA 2FAZA 2EMTA 2JWZA 2ZNVC 1H4RA 1RAXA 2QHOA 3ZNHB 4GU2A 2C9WB 3CMMB 4NQKE 4KZ0A 2RGFA 3RCZA 4XC2A 2MA9B 4JL9A 4BOSC 2KLGA 3ZW3A 2KDEB 2K8BA 2PE6B 3UQBA 2GBKA 3JVZX 5FR6A 1KLVA 4IW0A 1WGHA 2IO3B 4MGYE 3LDZE 2AL3A 4DBGA 1F9JA 3A4SC 2O2VA 5DPWA 1WF9A 1WR1A 1XQQA 2K39A 1WJ6A 2MW5A 2R2QA 4RMAA 2N4FA 3QK0A 4IWOA 2IO2B 2N1WA 3L17A 4ZRIA 4ZRJA 1UD7A 5DCNA 2C5LC 3UQAA 3V61A 3W1YA 5D94A 1GC7A 3RYTA 3VUYA 3R7RA 3B08A 5D7GA 1Z5SB 4JQWC 3ALBA 3X23A 4X57B 3A9KA 4ASWC 3KW5B 1WRDB 2N9PC 3U30A 2UYZB 2KTFA 3P2BA 3QAQA 4M8NA 5AZHA 2LUEA 2Z0DB 5IAAC 1SE9A 4ANXA 2LASA 1EUVB 1WXAA 1WZ3A 2D11A 2KKCA 3ZLZA 2KANA 3H9DA 4EZJA 1C1YB 2NPTB 4IUMB 2DX5B 2KC1A 2C7NB 2D10A 3H7PB 1XD3B 3A33B 2KWCA 3PLUA 4E74A 3WAPA 4KDLB 1V80A 2KN5A 2MCNB 4DHJB 4ANWA 2GMIC 2KWVB 2LJ5A 1S1QB 1EF1A 2DZJA 2IO1B 4MGZE 1GG3A 2ASQA 4HWIB 3VH3B 2J7QB 4FLHA 3JSVB 3ONSA 1E90A 2NBUA 4GIVA 3ZRFA 2KHWB 4DXAB 1J19A 1WY8A 1WGDA 3MJWA 3VTVA 1XT9B 4FADA 3L10B 1JRUA 2CU1A 2Z0EB 3ZRCA 2V1YA 3A9KB 2L00B 4G3XB 1P98A 3DPDA 4AJWA 3ZDTA 2KC2A 2NR2A 2KFKB 2JVCA
chains in the Genus database with same CATH superfamily
3P1MA 2GLSA 3GZNB 3V05A 1TS2A 1HXYD 1JCKB 4JWUC 2KK8A 1OEYA 2OJRA 3Q69A 3AE8B 3SFEB 4NJ7A 4YL8A 3GB1A 2WXOA 3RNEC 3NJTA 2E3TA 4IDIA 4MEMA 1WJUA 1KLUD 2K9XA 3VRAB 2ZPYA 1QT9A 2PIAA 1IYFA 4M0WB 2KJHB 3KYDD 2BBCA 4KDIC 1L7YA 1EWYC 2KFKA 1IGDA 2LGIA 5JZEB 5TSSA 3PVLA 4JWSC 2CHXA 5BYRA 3MC8A 4FXCA 1YX6B 4JE3B 4WJOA 1G6JA 1PGAA 2AQ2B 2HTHA 1YN3A 5E6NA 3BWUD 4RNAA 3VR9B 1YOVB 1QF6A 1JMLA 4EZLA 4KGTA 2WXLA 2FCSA 3KWVA 2LGXA 2I1KA 3DBLB 4XE0A 3IBEA 1V1PA 4RM8A 3VQIA 4W9FA 1YJ1A 3RNGC 3SD5A 1JRPA 2O6VA 2GBJA 3D32A 3Q8BA 2MX2A 3AN1A 3UGBB 1XCQL 2BW2A 5LXHA 4KKJA 5GMVA 4EE2A 4IM3A 4R3DA 4GLSC 1C76A 2BB6A 2KMCA 3BINA 2YLMA 1KTKA 3V6CB 3V62A 1I4GA 1IPGA 4CHKA 4FBJB 1XLNA 1P7EA 1QOFA 1I4XA 4M00A 2JXTA 3N1XC 3OJ3A 3I57A 4BVUC 2FNJB 4GGQA 3P4PB 3TMPB 4K7SA 1I4HA 4GDKA 2KTRB 1C3TA 1CJEA 1QKZA 3H7PA 3ZTDA 4G11A 1TIFA 4HVBA 3I3TB 1V8CA 1YX5B 3MC0B 3ZJTA 2LGYA 5C23A 1TYGB 3IFWB 1HQRD 4ANUA 3AV8A 4MACA 4II2B 1C4CA 4FJZA 4I6LB 2KD0A 4ZRQA 4WAFA 1E0ZA 3PTFC 1UUPA 2LRUA 4P7IA 4YSYB 4B0EA 2K8CA 3LJ3A 2JSVX 2EELA 1N5WA 2GBMA 3CWIA 2IY0B 3DDCB 3JW0X 2OOBB 4FN2A 1I4QA 1V9JA 4NAMA 3EECA 1PFDA 1TBEA 3IT6B 3PRZA 3WIMA 4KGSA 4N58A 2DZKA 4W9GA 1WGYA 2V4LA 3MTNB 3EC8A 4USAA 2KVRA 4XX5A 2IDYA 3PZDA 1JROA 2ZVNA 2VZKD 3GOEA 1WE7A 3FILB 4NAWA 4OZBA 4TMAB 1VZ7A 2NBVB 2X8XX 3NS8A 1F2RC 1BMLC 3NZ3A 3B2FA 2WXJA 4A9AA 4JIOU 2BPSA 1HE8A 4ZYNA 5BYSA 3Q8EA 2JYTA 1FRRA 3NOBA 4YXDB 2WLBA 2PTLA 3R3MA 3R66C 2Y5PA 1B9RA 2AL6A 1DOIA 1QILA 3AEFB 1L4DB 2PPHA 1L0XB 5EE0A 1HEZE 3W5UB 3Q3FA 4IM0A 3W1SA 1YN4A 2WXPA 4PYZA 4ZHOA 2D5GA 4L23A 1ACCA 2OJWA 3FAHA 4XZ4A 1FRDA 2L83A 2K8HA 2HE7A 1MG4A 3GE3C 4YTPB 2MP2B 3EFCA 4A3OA 1GAQB 3V60A 2ZCCA 4LNFA 2W3SA 3QJZA 2KZRA 2KN4A 1WXQA 2NPTA 3VHTC 2AEHA 4ANVA 5HFYA 2KDBA 5J2RA 1YQ4B 3TBLD 3FILA 4MM3A 4BOZB 2RSUA 2QCZA 4F7ZA 4RCOA 3WANA 3MHSD 1CZPA 4EUTA 2MBQA 3KH0A 3QIJA 4DWFA 3DOWA 5H8YE 2I38A 3TL5A 5IA7A 1K53A 2FCQA 2INDC 2I2YA 3Q3NC 2LXAA 3TJPA 1VCBA 2K1FA 4HDOA 1SIFA 3RD2A 1Y8RC 1ZGUB 1J7CA 1RWSA 3CIRB 2G4SA 2AQ1B 3B9JA 1HZ5A 5H92C 2YEPF 3WA0A 1WXMA 3E9SA 2GI9A 3T8MA 4RGNA 3TEWA 5AZGA 3ZDMC 2K5PA 3ML8A 1E7VA 3LXFA 4HCPB 4AJYB 4I6NB 1CQVA 1NYRA 3L13A 4N9F4 2M1MA 2JF5A 4YT0B 3V6EB 3DVGX 3NUHB 2KT7A 1E8WA 1OTRB 1NVID 3EUB2 3Q3OC 4MM3B 1AN8A 4E71A 4K3CA 3DCGA 3N20C 4A6QA 1J7AA 1EM7A 2NS5A 1JW9D 5DPTA 2M4NA 5AUIA 4JPSA 3U4EG 4BBNC 3MC9A 4C00A 2V0GA 1TKEA 2VRRB 5CX3A 2IO0B 5KHQA 2EMTA 4GU2A 2C9WB 3RCZA 1DYQA 3LB8C 1UWMA 1F77A 2MA9B 4JL9A 4BOSC 3U52E 4ZHPA 2K8BA 3HVZA 5FR6A 1ZUD2 2IGHA 2AL3A 2KDMA 1F9JA 4MGYE 2O2VA 3AH7A 1WF9A 2PLPA 2K39A 1IBXA 2JU6X 3R8BA 4ZRJA 3RNFC 2C5LC 3W1YA 3RYTA 4D2KA 5HI1A 5D7GA 4X57B 3KW5B 3L4PA 3RNBC 3U30A 3P2BA 5IAAC 3PO0A 2LUEA 1EUVB 2LASA 2M56B 2W55A 3ZLZA 2KANA 3AEAB 1XD3B 3A33B 2KWCA 3PLUA 4MT5A 4WQMA 1V80A 5IKCM 3IAS1 2GMIC 2V3NA 3U2SC 4MGZE 2IO1B 5I4DA 2ASQA 4HWIB 4LK0M 4GIVA 1E90A 2D3CA 5FK9C 4UDUC 1XT9B 4FADA 1JRUA 3ZRCA 1I7HA 3A9KB 2KC2A 2BB5A 1WYGA 2QSDA 4URKA 1R4MB 1I4PA 2RDHA 4MGIE 3N1YC 3Q8CA 4PS7A 1UELA 4XGAB 4DXGA 1TKYA 2FIDA 4KIKB 3QC8B 4HPPA 5CHFA 4FHKA 4WWMA 4C7YA 2CKHB 4HKQA 1ZXIA 4G50A 3SHQA 1AWDA 2V3PA 2GRIA 3BVMA 2K6DB 2WX1A 2G45B 3AE9B 5BMGA 2JZ3B 1UWXA 2N9LA 1WX7A 5CHVC 2WDTB 4LNOA 3RZFA 4BKSD 3X0WA 3QARA 1WI0A 1Q0WB 4MGKE 3CF6E 3BY4B 3ZKJC 2L0FA 1F1HA 3DHHC 1ZW7A 4AWJA 3APCA 2DAJA 2IBIB 1WM2A 4AUQC 4HPLB 1OGWA 4W9HA 1WYWB 4B0MA 3BIID 1TGZB 2D2QA 1V1PB 4KZCA 1WIAA 4OZAA 2ON8A 2MWSB 5BMIA 3ZYYX 4DXFA 2WU2B 2NBWB 1HTOA 4E3CA 4MSMB 3HHMA 2HJ1A 2JRHA 3ZUNA 3H1UA 1R7SA 2RDBC 4IG7B 2K25A 2LZ6A 4C4VB 1ROEA 4RH6A 1TZ1A 2FIFA 1KLGD 2KTRA 2IPKD 1FFUA 3RI7C 3T9LA 1SJHD 2ZEQA 3IVFA 1N61A 1WWTA 5E6OA 3L54A 2ZPNA 4AOFA 5BMHA 2BYVE 3FKYA 3QX1A 3AB5A 3VUXA 2FBWB 1WXSA 2LVPA 2KX3A 2WXNA 3DVNV 2MHJA 5EE3A 1WXVA 3DBLI 1ZE3D 2N9XA 3W5VB 4EEWA 2JXXA 2BKRB 2MLBA 4PT5A 1NEKB 3CSTA 4HXDA 2QILA 4XWTA 3SEBA 1TTNA 4GB9A 4M8MA 1QZEA 1UBQA 2WXMA 1KM7A 3IG3A 3C0RB 1VJKA 1XCTL 2AWTA 4A55A 1KH0A 2WP9B 3M95A 3PREA 5E6JA 3VVWB 2IZVB 2EKIA 3PGEA 4GMVA 1EWCA 4J3OD 5D2MB 2WDRB 1NBFC 4YTNB 4CYEA 1WR6E 3B0AA 2SAKA 4DHZB 4IWPA 1FIQA 2CHWA 3I5JC 2JY6A 3VTWA 4JLCA 3PLVA 1QQRA 3OJ4B 1A70A 2KVZA 2N9EB 1D4BA 1Q1OA 4Q2JA 3AE1B 2DHZA 2ZJDA 1E7UA 2MBOA 4FJVB 1K50A 2MP2A 1WM3A 2J42A 4LNIA 1JALA 2DYMA 1HTQA 1E8XA 5AZFA 1WGRA 2Y3AA 3L16A 3APFA 1XLPA 2OEDA 3KUZA 2N7JA 1DOYA 3GE8C 4ZYSA 1M4VA 2KQ4X 4IKGA 2XN9C 2ZNVB 4A20A 2AX5A 4C80A 4ITKA 2LHDA 2C7HA 2WDVB 4DK5A 2GB1A 2R2OA 2WX0A 3CSFA 1KRHA 4KSLC 2ONQA 4MDKE 2KXJA 2VH2A 3P63A 3RPFC 4C7ZA 1SEBD 1BUIC 1XLOA 2RD0A 5J17A 1SBBB 2HTME 5CHWA 4IOIE 1P3QU 4BKTA 3AEDB 3A4RA 2FE8A 4EKUA 2W9NA 3H6NA 5CTRC 4KGRA 2RPQA 2JYEA 2DAFA 4P6VF 4LLGM 4W9KA 4LDTB 2D3AA 1ET6A 2C7MB 3AI5A 3M63B 4ICVA 2BVCA 1N62A 3DWMA 4OVZA 1WJ4A 1TS3A 3EHVA 1WJNA 1E10A 1K51A 4IM2A 1T0RC 3SU8X 4IC7B 3B2GA 2DYOA 4ACFA 5IO9A 2D07B 4MJSA 4RM9A 3EFUA 1CK1A 5KHOA 2EMSA 1YJIA 2MQJA 3AXCA 1MPEA 1V81A 1ESFA 2GOWA 4YWGG 4G0NB 2L3ZA 4GDKB 4WJNA 3PZ8A 5D3IB 3N1ZC 5GXGB 4GSWA 1ZDXA 1YMHE 1JWSD 2JQRB 2BYFA 1SXTA 1N63A 4GN1A 4ICUA 4N59A 2J0MA 2JX5A 1FM0D 1RFKA 2WDQB 3Q8AA 5E6PA 4FJYA 2GBNA 3QQ8B 3ZXRA 2FCMA 3N3KB 2PJHA 1C9FA 2QIEB 2W82A 4MELA 3JSVA 5D6JB 1SF0A 3APDA 5BO4B 1N6ZA 1AW7A 2JWZA 2ZNVC 1I4RA 1H4RA 1XO3A 2KLGA 3ZW3A 2PE6B 2ZW0A 1KFYB 4IW0A 4DBGA 3A4SC 4CQNA 2VH1A 3QK0A 2N1WA 4RF0A 4HRSA 1TZOA 2LJIA 1Z5SB 4JQWC 3ALBA 3X23A 1WRDB 2N9PC 2WXRA 2WXGA 2K22A 5AZHA 3DHGC 1WXAA 1V97A 2INPE 1WZ3A 1UNSA 2PMVA 4EZJA 2DX5B 1NENB 2D10A 4E74A 2KN5A 3ABVB 2KWVB 3VH3B 1PGXA 2Z8LA 3GS2A 4HJGE 1WGKA 2NBUA 3IXSA 2KHWB 1WY8A 2BYTA 1WGDA 3VTVA 2QMTA 2V1YA 5G5HA 5IP4D 2L00B 4G3XB 3DPDA 4P1CC 3ZDTA 2KFKB 4ASWC 2ZW1A 1X1MA 3A1QA 3HIZA 4NQLB 4TSSA 1FMAD 1GC6A 4A8XC 1E6EB 4B6WA 2MJEA 2NMQA 3RMKC 2MEKA 4ARCA 2M0XA 1I42A 1V5TA 2PVOD 2BKFA 2K0PA 3AM9A 2KOXA 4AS1A 4TUUA 3Q3JA 1D6EC 4WWNA 5C3JB 4FHJA 2XK5B 1ZOYB 2WNMA 1FCCC 1LQBA 3NZSA 2KNBA 2V3SA 1UH6A 2WWZA 2KQ7A 4TQ1A 4XYCA 3ZO5B 1GNUA 2WU5B 1YQBA 1LXDA 3ENEA 1OQYA 2R61A 3WAOA 1VLBA 1ZPSA 3N32A 2FUG1 1M94A 2ICIA 4K7WA 1V6EA 1QOAA 1NYQA 1QOGA 5LLIA 4K3BA 3AE4B 3DQVA 3E56A 1L0VB 1JWAD 1WX8A 4M0WA 2G9HD 3RT3B 3I9V1 4RF1A 3AMZA 1FXAA 2FUHB 1QLBB 4OW0A 3ECIA 2UWQA 1YN5A 2Z59B 1C77A 2KO3A 3KVFB 3AULA 4WWPA 1JQ4A 2I1JA 2CU3A 2L52A 4HROA 4LJOB 2JWUA 4ZDVA 2WHIA 3ZNID 1AYFA 3O65B 3IHPC 4B95A 4PS8A 1A5RA 4BKGA 3Q6BA 2HD5B 5TR5A 3P4SB 1C79A 2A4ZA 1P0RA 3KLSX 4TQ0A 2MSED 3AEBB 1OQQA 3Q8FA 1SSNA 3MP9A 4AP4C 2EKEC 2KAJA 4C4VA 2Q5WD 4KSKC 1WE6A 3BYYB 3KUCB 2FCNA 1HZ6A 2NTSA 2PKOA 4MJSB 3W1SC 3UIOB 2RR9A 3IAM1 4HLEA 3VTUA 4PYUA 4K1RB 2O6VD 3PV1A 5G2NA 4AQ7A 2M0AA 2N7DA 4IWQA 3RNAC 5LXIB 1R4NI 3NS1A 2LXCA 2IYDB 4HDQA 3DBRI 4GDLA 5EE1A 4KIKA 3ZTCA 3HM6X 3TIXA 3DVGY 2ZCBA 4WWOA 2REXA 4TKNA 5EDSA 4L1BA 2DZIA 3HK0A 4HK2A 1J0GA 2WGSA 2CHZA 3V3XA 1UGMA 3GP7A 2NCNA 1L6VA 5IOIA 4F1SA 1KOTA 1D5XC 5DPSA 1PUTA 1IUEA 3AE3B 3P42A 3VAWA 3TCAA 4KKIA 4FULA 4KV2A 4DQOC 1T0YA 1EO6A 1TT5B 1FPYA 3N30A 3QHTA 3JYUA 1CMXB 1IP9A 1LFDA 1JWMD 2L32A 3W9CB 3L0WB 3B1LX 2HDEA 2PE9A 1E7PB 2M19A 2IGGA 4NZLB 1HA5A 2QJLA 4NJCA 4C56C 1GJZA 1T5XD 3ZVVA 1D5ZC 4DDID 4HPMB 3KQ4A 1OEYJ 2DENB 3NRZA 1T0QC 2W3RA 3NVVA 5L83A 1VDVA 1WSPA 3AU4A 1FNWA 3A9JA 2JZZA 3R7QA 4GDLB 2KMAA 2LUMA 1FO4A 2H88B 1TY2A 3SR6A 3VFKA 1WMHA 2KJRA 2XEWA 4QAYA 1SB3C 2QEJC 3HUIA 1L2NA 4P1BC 5HHDG 4W9IA 2KDIA 1E8ZA 1MJDA 2RPVA 1SIJA 2L8JA 3ZXVA 3SDLC 4LDTD 1SGHA 4NNJB 3MFGA 3PSEB 1IGCA 2W54A 2O6VB 4BZAA 2BT6A 3GZNI 4GXBA 3VR8B 1P9DU 3FC4A 1YD8U 3QWZB 3U8ZA 1FXTB 4OHJA 3U7DA 4LNNA 1Z2MA 4EZKA 1N60A 5DPRA 3MHZA 4EFOA 1IBXB 1D5MC 2AYOB 3ETRA 1EU4A 1R4NB 1SE4A 2G4DB 4N6EB 1FNVA 1RYJA 1F0ZA 2LVOA 3WALA 5AUKA 2K6QA 3UF8A 1QOBA 1Q5WB 1V86A 1SE3A 3HRDD 1U4AA 2K3UA 3TSSA 3VRBB 2LD9A 2M8SA 3M3JA 2PVGC 3ZNGC 5J18A 3BK2A 2XK5A 1WMHB 4HJKA 2L0TA 1YIWA 4WJPA 2LGDA 4DDGD 3PPAA 5JH5C 2KDFB 1FFVA 2GBRA 4I6PA 3QCAA 4DHJD 4LCDE 1PGBA 3BZDB 1PYWD 5T8IA 2ZVOA 1OQRA 2FAZA 3ZNHB 2KMMA 4REZA 3BVGA 4XDCA 2GBKA 3JVZX 1SJED 1TKGA 1SE2A 1WGHA 1C78A 3LDZE 5DPWA 1JWBD 1TS5A 1WR1A 1XQQA 1VZ8A 1L0YB 1WJ6A 2MW5A 4US8A 2R2QA 4RGOS 4RMAA 2N4FA 3RNCC 2IO2B 3L17A 3DWGC 3SFDB 4ZRIA 1UD7A 5DCNA 3UQAA 1BXTA 1PDXA 5D94A 4BAXA 2BTEA 3VUYA 3A9KA 1LGRA 3I63C 2UYZB 2KTFA 4ANXA 1SE9A 3KWLA 2KKCA 1ET9A 2QC8A 1C1YB 4IUMB 3H7PB 3NVWA 4DHJB 1MI0A 4ANWA 2BS2B 3LYYA 2DZJA 2J7QB 1TY0A 3ONSA 3ZRFA 1J19A 1MHHE 3MJWA 2KYWA 3R2TA 2Z0EB 2G1EA 3PZ7A 1P98A 2OHFA 2NR2A 2JVCA 4A90A 1WX9A 5HG2A 1VD2A 3S2AA 4BFRA 2NVUI 2XNAC 2WXFA 1NI2A 4ZRPA 4GOCA 4NY0A 2WQYB 2WYQA 2IGDA 3OG5A 3Q2AC 3IT4B 1TJEA 3AE7B 1C4AA 2LRWA 3QA8A 1MFWA 1E5WA 5BYQA 3J9CA 4TV3A 4LJPB 4W9DA 4B9KA 2IY1B 4RFBA 2JT4B 3MJ5A 2KFJA 4A3PA 2KWDA 3NG0A 3OLMD 1NDDA 2BS3B 2VZKB 1B1ZA 2WS3B 2QDFA 3PHWB 2L1AA 1FEHA 4J6IA 4WJQA 3U7ZA 3ZJVA 2YEPB 3ZIMA 4RGTA 5HKHA 2JUOA 4ZRKA 2CR5A 2MBHA 1PQSA 1ISNA 2AQ3B 2N9KA 4F8CB 2N0SB 1V2YA 2J53A 3O13A 1GUAB 5JHAA 3EA6A 2WXQA 2D3GA 3M62B 2BWES 4WIPA 5FKAC 1FCLA 1GPXA 5EE9A 1I35A 1E9MA 1DGJA 3K9OB 2WXKA 4DHZE 2M17A 2TSSA 1ZDVA 1GB4A 2V4IB 1T6BX 1Y56A 3AECB 4OVUA 1WGGA 3PHXB 1UBIA 2Y5BB 3KUDB 1WH3A 2C60A 1EU3A 1ZXHA 1EF5A 1FXIA 1ZKHA 3RULA 2DNFA 1YNTE 2DLBA 1V49A 1RFAA 4FA6A 3ZJUA 2KQSA 3HM3A 1KJTA 2B76B 1UF0A 2DZMA 2LFIA 4MH8A 3VUWA 4NPNA 3TEZA 2KX0A 1LO5D 1H8CA 3ZNZB 5IN7A 2Y5CA 3PRMB 5C2TB 2MH7A 3HVDA 1FNUA 5G55A 3K9PB 1P1AA 3H7SA 2UU7A 4JGHB 2RDGA 4O1NA 2J4XA 2LHEA 4M02A 4II3B 1MHXA 3TUOA 1UGJA 2BF8B 4W9EA 2KWUB 3RFZB 4H2AA 2YVCA 3DVNU 4CO7A 3DBSA 1GB1A 1VZ6A 4M01A 5L95C 2BQQA 2DWQA 3L08A 3PRPB 3RZWC 2O2VB 5D3DA 3UIPB 1RM6C 1WZ0A 3DHIC 1YQ3B 4L2YA 4EOYA 3AE5B 1P7FA 3VH4B 3RUIB 5AEKB 3BVZA 4WH4A 4WQOB 1MVKA 2BYEA 1GOZA 3T3OA 4JX1C 2CJOA 4HEA1 4NAWB 3VDZA 3EGRA 2ACZB 2MBBB 3PS6A 5JXVA 1V1OA 1WRIA 1UZXB 2CS4A 4MH0E 2LI5A 1ENFA 5MPOA 2L76A 4KVGB 1E8YA 1LM8B 3A9JB 1VRAB 4WAAA 4YTMB 1BT0A 4OZCA 2INCC 2J0JA 1T0SC 2B3AA 3P4QB 2JPHA 3C19A 2XBBC 2LGSA 3R2IA 2N1VA 5LNK1 5G5GA 3Q14C 3W2DA 2D3BA 1D3ZA 2MJ3A 3PT2B 1Q10A 1K8RB 2ZZPB 2IJ0A 1J8CA 2KLCA 2JRIB 1RRBA 3DBHI 3UINB 2HJ8A 3VXWA 1S3SG 4PS3A 3URYA 4W9JA 3NY5A 4NJ6A 2E6XA 2N7EA 3NHEB 2WXHA 1XLQA 1RLFA 4BBNF 4S17A 2DYBA 3KYCD 1R4MI 2G3QB 1FD6A 1L4ZB 4XWWA 1K52A 2LMCA 2KJ6A 1WFYA 2DBYA 2LWPA 4K81A 1AARA 1V5OA 3TEXA 1T3QA 2KACA 3OWEB 4W9LA 1MG8A 3ML9A 1J7BA 2PEAA 1L5PA 4W9CA 2MBEA 3OAWA 4HCNB 3UI3A 1NI3A 3AE6B 3NZUA 2BGFA 1STEA 4S0RA 3N9YC 2NTTA 1F2RI 1JWUD 2A5UA 2MRPA 1C4PA 3AU5A 4MSQB 5FR3A 3TEYA 3P4RB 2CJNA 4US9A 3WCQA 2H89B 4OVVA 1DOXA 2BWFA 1YJJA 3BYTB 5C1ZA 1VR9A 3A1QB 3WAMA 4ARIA 2BS4B 4LNKA 5JHBA 2LVQA 2J0KA 3AEGB 4P16A 4YSXB 3H8HA 1N5XA 4ZOHC 2L7RA 3Q3MC 2LEKA 2INNE 4K7UA 2L05A 4BKSA 1OFFA 2QHOA 1RAXA 3CMMB 4KX6B 2JZPA 4KZ0A 4NQKE 2RGFA 4WURA 4XC2A 3AE2B 3DBRB 2KDEB 3UQBA 1TS4A 4YSZB 1KLVA 2IO3B 4HKZE 4IWOA 3ZGZA 3V61A 1GC7A 1XF5L 3R7RA 2WXIA 3B08A 2X38A 3DBHB 3AEEB 4PK1A 3QAQA 4M8NA 2Z0DB 1L6UA 3NVZA 1F52A 2D11A 3T3NA 3H9DA 2SEBD 2NPTB 2RMMA 2KC1A 2C7NB 2V9HA 3WAPA 4KDLB 2PW9A 2MCNB 2LJ5A 1S1QB 1EF1A 3ZQ4A 2J52A 1GG3A 1XXGA 1KF6B 3C8YA 1ZP0B 1XEEA 4FLHA 3JSVB 3NVYA 4DXAB 3BK1A 4LTUA 3L10B 4XDDA 4RGMA 2CU1A 2MJDA 4AJWA 3RN9C
chains in the Genus database with same CATH topology
1WX9A 4URKA 1X1MA 3A1QA 3HIZA 4NQLB 1VD2A 3S2AA 4BFRA 1GC6A 2NVUI 4MGIE 4PS7A 1NI2A 4B6WA 4GOCA 4NY0A 1UELA 2KK8A 2WYQA 2FIDA 4KIKB 1OEYA 2OJRA 2M0XA 3QC8B 5CHFA 1I42A 4FHKA 1V5TA 4NJ7A 4YL8A 2BKFA 2CKHB 2LRWA 2KOXA 3QA8A 4G50A 3SHQA 1E5WA 4TUUA 2K6DB 2WX1A 3Q3JA 4MEMA 1WJUA 4WWNA 4TV3A 4LJPB 4W9DA 4FHJA 2G45B 2XK5B 2ZPYA 4B9KA 2IY1B 1IYFA 4M0WB 2JZ3B 2KJHB 3KYDD 2JT4B 4KDIC 1LQBA 3NZSA 1WX7A 2KFJA 1L7YA 2KNBA 2V3SA 4A3PA 5CHVC 1UH6A 2KFKA 2WWZA 2WDTB 2KQ7A 4TQ1A 5JZEB 3OLMD 3ZO5B 3PVLA 1NDDA 1GNUA 2CHXA 1YQBA 3RZFA 4BKSD 1YX6B 4WJOA 3X0WA 1G6JA 1LXDA 3QARA 3ENEA 1OQYA 1WI0A 3PHWB 2HTHA 4J6IA 4WJQA 1Q0WB 5E6NA 4MGKE 3CF6E 3BY4B 3ZIMA 3WAOA 3N32A 4EZLA 3ZKJC 2L0FA 1M94A 4K7WA 1V6EA 1ZW7A 2JUOA 4ZRKA 5LLIA 4AWJA 5HKHA 3APCA 2FCSA 3DQVA 2CR5A 2MBHA 2DAJA 2IBIB 1PQSA 2LGXA 1ISNA 1WM2A 2I1KA 1WX8A 4F8CB 3RT3B 4AUQC 4HPLB 1V2YA 3IBEA 1OGWA 1GUAB 4RM8A 3VQIA 4W9HA 2FUHB 5JHAA 4W9FA 1WYWB 1YJ1A 3ECIA 2UWQA 2D3GA 1TGZB 3SD5A 3M62B 2D2QA 2Z59B 2KO3A 2BWES 4KZCA 2O6VA 1WIAA 3KVFB 2GBJA 3AULA 4WWPA 3D32A 2I1JA 2MX2A 3UGBB 5LXHA 5GMVA 4IM3A 2MWSB 4LJOB 1I35A 4ZDVA 2NBWB 3ZNID 4E3CA 4MSMB 3HHMA 3K9OB 2JRHA 3IHPC 3H1UA 3O65B 3ZUNA 4B95A 4PS8A 4IG7B 4BKGA 1A5RA 2K25A 2LZ6A 4DHZE 2KMCA 2M17A 1TZ1A 2HD5B 3BINA 2YLMA 5TR5A 2FIFA 2KTRA 3V6CB 2A4ZA 3V62A 4OVUA 1P0RA 4TQ0A 1IPGA 1WGGA 3PHXB 4CHKA 3T9LA 4FBJB 2MSED 1UBIA 2Y5BB 3KUDB 1WH3A 2C60A 2ZEQA 3IVFA 1EF5A 1ZKHA 3RULA 3OJ3A 5E6OA 3L54A 4BVUC 2FNJB 4GGQA 1V49A 1RFAA 2ZPNA 3TMPB 4K7SA 4FA6A 4AOFA 4GDKA 2KTRB 1C3TA 2BYVE 3H7PA 2KQSA 3HM3A 3ZTDA 3QX1A 4G11A 4AP4C 2EKEC 4HVBA 1KJTA 2DZMA 3I3TB 3VUXA 3VUWA 1YX5B 1WXSA 4KSKC 4NPNA 1WE6A 2KX0A 2LVPA 2KX3A 3DVNV 3KUCB 1H8CA 2FCNA 3ZNZB 1WXVA 3DBLI 4MJSB 3W1SC 3UIOB 2LGYA 3PRMB 2RR9A 5C23A 3IFWB 4HLEA 3VTUA 4PYUA 5G55A 2N9XA 4K1RB 2O6VD 3PV1A 3K9PB 5G2NA 4ANUA 1P1AA 3H7SA 2JXXA 4EEWA 4JGHB 2BKRB 2MLBA 4II2B 4FJZA 4I6LB 3CSTA 2N7DA 2KD0A 4HXDA 4IWQA 4II3B 3PTFC 2LRUA 4P7IA 5LXIB 1R4NI 1TTNA 4GB9A 2K8CA 4M8MA 1QZEA 2BF8B 2LXCA 3LJ3A 4W9EA 1UBQA 2IYDB 2KWUB 4HDQA 3DBRI 1KM7A 4GDLA 3IG3A 2GBMA 2YVCA 3C0RB 3DVNU 4KIKA 4CO7A 3ZTCA 2IY0B 3DBSA 3HM6X 3DDCB 2AWTA 3JW0X 3M95A 3PREA 3VVWB 5L95C 3TIXA 3DVGY 2IZVB 3L08A 2OOBB 3PRPB 3PGEA 2ZCBA 4FN2A 4GMVA 3RZWC 5D2MB 2O2VB 3UIPB 1NBFC 4WWOA 1V9JA 1WZ0A 2REXA 4TKNA 5EDSA 4CYEA 3EECA 1TBEA 4EOYA 3PRZA 1WR6E 2DZIA 3WIMA 3HK0A 3VH4B 3RUIB 5AEKB 3B0AA 4HK2A 2DZKA 4W9GA 1J0GA 1WGYA 2CHZA 2V4LA 3MTNB 3EC8A 4WQOB 4DHZB 2KVRA 1UGMA 4XX5A 3PZDA 2NCNA 4IWPA 2CHWA 2ZVNA 2BYEA 3GOEA 1WE7A 1KOTA 4F1SA 2JY6A 4NAWA 3VTWA 5DPSA 4JLCA 3PLVA 2NBVB 4NAWB 3OJ4B 3VDZA 2MBBB 3NS8A 3VAWA 2N9EB 3PS6A 3TCAA 1Q1OA 1UZXB 4JIOU 2CS4A 2BPSA 4FULA 2DHZA 4KV2A 1HE8A 4MH0E 4ZYNA 2LI5A 2ZJDA 1E7UA 2MBOA 4FJVB 2L76A 1T0YA 4KVGB 1EO6A 1E8YA 1LM8B 2MP2A 3A9JB 3NOBA 1WM3A 4WAAA 2DYMA 3N30A 1BT0A 3QHTA 3R3MA 3JYUA 1E8XA 2J0JA 5AZFA 3R66C 1CMXB 1WGRA 1IP9A 1LFDA 3L16A 3APFA 2B3AA 2JPHA 2AL6A 3L0WB 2XBBC 3KUZA 3B1LX 2N1VA 2PPHA 2PE9A 3Q3FA 4IM0A 3W1SA 1D3ZA 4PYZA 2ZNVB 1GJZA 3PT2B 3ZVVA 4A20A 1K8RB 2ZZPB 4XZ4A 4DDID 4HPMB 1J8CA 1OEYJ 2KLCA 2DENB 2K8HA 2JRIB 1RRBA 3DBHI 2C7HA 5L83A 4DK5A 3UINB 2HE7A 2HJ8A 3AU4A 2R2OA 2WX0A 3CSFA 3VXWA 1S3SG 2MP2B 3A9JA 4A3OA 4PS3A 4W9JA 2JZZA 3R7QA 4GDLB 3NY5A 3V60A 2KMAA 4KSLC 4NJ6A 2ZCCA 4MDKE 2KXJA 3QJZA 2N7EA 3NHEB 2KZRA 3VHTC 2NPTA 2AEHA 4ANVA 1RLFA 2RD0A 4BBNF 3VFKA 5J17A 1WMHA 2KJRA 2KDBA 2XEWA 5CHWA 5J2RA 3TBLD 1L2NA 2DYBA 1P3QU 4W9IA 3KYCD 4MM3A 4BKTA 1R4MI 2G3QB 2KDIA 4BOZB 3A4RA 4EKUA 1E8ZA 2W9NA 2RSUA 3H6NA 5CTRC 2L8JA 4F7ZA 2KJ6A 1WFYA 3SDLC 3WANA 4LDTD 1SGHA 3MHSD 2LWPA 2RPQA 4EUTA 4NNJB 2MBQA 3KH0A 4K81A 3QIJA 2DAFA 3PSEB 1AARA 1V5OA 4DWFA 2O6VB 4W9KA 3DOWA 4LDTB 2C7MB 3AI5A 3GZNI 3TL5A 5IA7A 4GXBA 3M63B 4W9LA 4ICVA 2FCQA 1MG8A 1P9DU 3ML9A 1YD8U 3QWZB 2PEAA 3U8ZA 1FXTB 1WJ4A 3U7DA 2LXAA 4W9CA 2MBEA 3EHVA 3OAWA 3TJPA 1VCBA 1WJNA 4HCNB 4IM2A 1Z2MA 2K1FA 4HDOA 4EZKA 1SIFA 3RD2A 1Y8RC 1ZGUB 5DPRA 3NZUA 3SU8X 4EFOA 4IC7B 2BGFA 2G4SA 2DYOA 2D07B 4MJSA 2AYOB 4RM9A 3EFUA 3WA0A 5KHOA 1WXMA 2A5UA 2EMSA 2MRPA 3AU5A 2G4DB 3T8MA 2MQJA 3AXCA 4MSQB 1V81A 2GOWA 5AZGA 3ZDMC 3ML8A 4G0NB 1E7VA 2LVOA 2L3ZA 4HCPB 3WALA 4AJYB 2K6QA 3UF8A 4GDKB 4I6NB 1Q5WB 3L13A 4N9F4 1V86A 2M1MA 4OVVA 2JF5A 3V6EB 3DVGX 4WJNA 2BWFA 1U4AA 4GSWA 2LD9A 2M8SA 3M3JA 2BYFA 3ZNGC 5J18A 5C1ZA 2XK5A 4GN1A 4ICUA 3A1QB 3WAMA 1E8WA 2J0MA 1WMHB 4HJKA 2L0TA 1YIWA 4WJPA 5E6PA 2LGDA 4DDGD 5JHBA 4FJYA 2GBNA 1OTRB 2J0KA 2LVQA 3PPAA 3QQ8B 5JH5C 2KDFB 4E71A 2GBRA 2FCMA 2L7RA 3DCGA 3N3KB 2PJHA 4I6PA 2NS5A 3QCAA 5DPTA 2M4NA 4DHJD 4LCDE 4MELA 3JSVA 5D6JB 4BBNC 4K7UA 2VRRB 3APDA 5BO4B 2L05A 2IO0B 5CX3A 4BKSA 2ZVOA 5KHQA 2FAZA 2EMTA 2JWZA 2ZNVC 1H4RA 1RAXA 2QHOA 3ZNHB 4GU2A 2C9WB 3CMMB 4NQKE 4KZ0A 2RGFA 3RCZA 4XC2A 2MA9B 4JL9A 4BOSC 2KLGA 3ZW3A 2KDEB 2K8BA 2PE6B 3UQBA 2GBKA 3JVZX 5FR6A 1KLVA 4IW0A 1WGHA 2IO3B 4MGYE 3LDZE 2AL3A 4DBGA 1F9JA 3A4SC 2O2VA 5DPWA 1WF9A 1WR1A 1XQQA 2K39A 1WJ6A 2MW5A 2R2QA 4RMAA 2N4FA 3QK0A 4IWOA 2IO2B 2N1WA 3L17A 4ZRIA 4ZRJA 1UD7A 5DCNA 2C5LC 3UQAA 3V61A 3W1YA 5D94A 1GC7A 3RYTA 3VUYA 3R7RA 3B08A 5D7GA 1Z5SB 4JQWC 3ALBA 3X23A 4X57B 3A9KA 4ASWC 3KW5B 1WRDB 2N9PC 3U30A 2UYZB 2KTFA 3P2BA 3QAQA 4M8NA 5AZHA 2LUEA 2Z0DB 5IAAC 1SE9A 4ANXA 2LASA 1EUVB 1WXAA 1WZ3A 2D11A 2KKCA 3ZLZA 2KANA 3H9DA 4EZJA 1C1YB 2NPTB 4IUMB 2DX5B 2KC1A 2C7NB 2D10A 3H7PB 1XD3B 3A33B 2KWCA 3PLUA 4E74A 3WAPA 4KDLB 1V80A 2KN5A 2MCNB 4DHJB 4ANWA 2GMIC 2KWVB 2LJ5A 1S1QB 1EF1A 2DZJA 2IO1B 4MGZE 1GG3A 2ASQA 4HWIB 3VH3B 2J7QB 4FLHA 3JSVB 3ONSA 1E90A 2NBUA 4GIVA 3ZRFA 2KHWB 4DXAB 1J19A 1WY8A 1WGDA 3MJWA 3VTVA 1XT9B 4FADA 3L10B 1JRUA 2CU1A 2Z0EB 3ZRCA 2V1YA 3A9KB 2L00B 4G3XB 1P98A 3DPDA 4AJWA 3ZDTA 2KC2A 2NR2A 2KFKB 2JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX9 A;  4URK A;  1X1M A;  3A1Q A;  3HIZ A;  4NQL B;  1VD2 A;  3S2A A;  4BFR A;  1GC6 A;  2NVU I;  4MGI E;  4PS7 A;  1NI2 A;  4B6W A;  4GOC A;  4NY0 A;  1UEL A;  2KK8 A;  2WYQ A;  2FID A;  4KIK B;  1OEY A;  2OJR A;  2M0X A;  3QC8 B;  5CHF A;  1I42 A;  4FHK A;  1V5T A;  4NJ7 A;  4YL8 A;  2BKF A;  2CKH B;  2LRW A;  2KOX A;  3QA8 A;  4G50 A;  3SHQ A;  1E5W A;  4TUU A;  2K6D B;  2WX1 A;  3Q3J A;  4MEM A;  1WJU A;  4WWN A;  4TV3 A;  4LJP B;  4W9D A;  4FHJ A;  2G45 B;  2XK5 B;  2ZPY A;  4B9K A;  2IY1 B;  1IYF A;  4M0W B;  2JZ3 B;  2KJH B;  3KYD D;  2JT4 B;  4KDI C;  1LQB A;  3NZS A;  1WX7 A;  2KFJ A;  1L7Y A;  2KNB A;  2V3S A;  4A3P A;  5CHV C;  1UH6 A;  2KFK A;  2WWZ A;  2WDT B;  2KQ7 A;  4TQ1 A;  5JZE B;  3OLM D;  3ZO5 B;  3PVL A;  1NDD A;  1GNU A;  2CHX A;  1YQB A;  3RZF A;  4BKS D;  1YX6 B;  4WJO A;  3X0W A;  1G6J A;  1LXD A;  3QAR A;  3ENE A;  1OQY A;  1WI0 A;  3PHW B;  2HTH A;  4J6I A;  4WJQ A;  1Q0W B;  5E6N A;  4MGK E;  3CF6 E;  3BY4 B;  3ZIM A;  3WAO A;  3N32 A;  4EZL A;  3ZKJ C;  2L0F A;  1M94 A;  4K7W A;  1V6E A;  1ZW7 A;  2JUO A;  4ZRK A;  5LLI A;  4AWJ A;  5HKH A;  3APC A;  2FCS A;  3DQV A;  2CR5 A;  2MBH A;  2DAJ A;  2IBI B;  1PQS A;  2LGX A;  1ISN A;  1WM2 A;  2I1K A;  1WX8 A;  4F8C B;  3RT3 B;  4AUQ C;  4HPL B;  1V2Y A;  3IBE A;  1OGW A;  1GUA B;  4RM8 A;  3VQI A;  4W9H A;  2FUH B;  5JHA A;  4W9F A;  1WYW B;  1YJ1 A;  3ECI A;  2UWQ A;  2D3G A;  1TGZ B;  3SD5 A;  3M62 B;  2D2Q A;  2Z59 B;  2KO3 A;  2BWE S;  4KZC A;  2O6V A;  1WIA A;  3KVF B;  2GBJ A;  3AUL A;  4WWP A;  3D32 A;  2I1J A;  2MX2 A;  3UGB B;  5LXH A;  5GMV A;  4IM3 A;  2MWS B;  4LJO B;  1I35 A;  4ZDV A;  2NBW B;  3ZNI D;  4E3C A;  4MSM B;  3HHM A;  3K9O B;  2JRH A;  3IHP C;  3H1U A;  3O65 B;  3ZUN A;  4B95 A;  4PS8 A;  4IG7 B;  4BKG A;  1A5R A;  2K25 A;  2LZ6 A;  4DHZ E;  2KMC A;  2M17 A;  1TZ1 A;  2HD5 B;  3BIN A;  2YLM A;  5TR5 A;  2FIF A;  2KTR A;  3V6C B;  2A4Z A;  3V62 A;  4OVU A;  1P0R A;  4TQ0 A;  1IPG A;  1WGG A;  3PHX B;  4CHK A;  3T9L A;  4FBJ B;  2MSE D;  1UBI A;  2Y5B B;  3KUD B;  1WH3 A;  2C60 A;  2ZEQ A;  3IVF A;  1EF5 A;  1ZKH A;  3RUL A;  3OJ3 A;  5E6O A;  3L54 A;  4BVU C;  2FNJ B;  4GGQ A;  1V49 A;  1RFA A;  2ZPN A;  3TMP B;  4K7S A;  4FA6 A;  4AOF A;  4GDK A;  2KTR B;  1C3T A;  2BYV E;  3H7P A;  2KQS A;  3HM3 A;  3ZTD A;  3QX1 A;  4G11 A;  4AP4 C;  2EKE C;  4HVB A;  1KJT A;  2DZM A;  3I3T B;  3VUX A;  3VUW A;  1YX5 B;  1WXS A;  4KSK C;  4NPN A;  1WE6 A;  2KX0 A;  2LVP A;  2KX3 A;  3DVN V;  3KUC B;  1H8C A;  2FCN A;  3ZNZ B;  1WXV A;  3DBL I;  4MJS B;  3W1S C;  3UIO B;  2LGY A;  3PRM B;  2RR9 A;  5C23 A;  3IFW B;  4HLE A;  3VTU A;  4PYU A;  5G55 A;  2N9X A;  4K1R B;  2O6V D;  3PV1 A;  3K9P B;  5G2N A;  4ANU A;  1P1A A;  3H7S A;  2JXX A;  4EEW A;  4JGH B;  2BKR B;  2MLB A;  4II2 B;  4FJZ A;  4I6L B;  3CST A;  2N7D A;  2KD0 A;  4HXD A;  4IWQ A;  4II3 B;  3PTF C;  2LRU A;  4P7I A;  5LXI B;  1R4N I;  1TTN A;  4GB9 A;  2K8C A;  4M8M A;  1QZE A;  2BF8 B;  2LXC A;  3LJ3 A;  4W9E A;  1UBQ A;  2IYD B;  2KWU B;  4HDQ A;  3DBR I;  1KM7 A;  4GDL A;  3IG3 A;  2GBM A;  2YVC A;  3C0R B;  3DVN U;  4KIK A;  4CO7 A;  3ZTC A;  2IY0 B;  3DBS A;  3HM6 X;  3DDC B;  2AWT A;  3JW0 X;  3M95 A;  3PRE A;  3VVW B;  5L95 C;  3TIX A;  3DVG Y;  2IZV B;  3L08 A;  2OOB B;  3PRP B;  3PGE A;  2ZCB A;  4FN2 A;  4GMV A;  3RZW C;  5D2M B;  2O2V B;  3UIP B;  1NBF C;  4WWO A;  1V9J A;  1WZ0 A;  2REX A;  4TKN A;  5EDS A;  4CYE A;  3EEC A;  1TBE A;  4EOY A;  3PRZ A;  1WR6 E;  2DZI A;  3WIM A;  3HK0 A;  3VH4 B;  3RUI B;  5AEK B;  3B0A A;  4HK2 A;  2DZK A;  4W9G A;  1J0G A;  1WGY A;  2CHZ A;  2V4L A;  3MTN B;  3EC8 A;  4WQO B;  4DHZ B;  2KVR A;  1UGM A;  4XX5 A;  3PZD A;  2NCN A;  4IWP A;  2CHW A;  2ZVN A;  2BYE A;  3GOE A;  1WE7 A;  1KOT A;  4F1S A;  2JY6 A;  4NAW A;  3VTW A;  5DPS A;  4JLC A;  3PLV A;  2NBV B;  4NAW B;  3OJ4 B;  3VDZ A;  2MBB B;  3NS8 A;  3VAW A;  2N9E B;  3PS6 A;  3TCA A;  1Q1O A;  1UZX B;  4JIO U;  2CS4 A;  2BPS A;  4FUL A;  2DHZ A;  4KV2 A;  1HE8 A;  4MH0 E;  4ZYN A;  2LI5 A;  2ZJD A;  1E7U A;  2MBO A;  4FJV B;  2L76 A;  1T0Y A;  4KVG B;  1EO6 A;  1E8Y A;  1LM8 B;  2MP2 A;  3A9J B;  3NOB A;  1WM3 A;  4WAA A;  2DYM A;  3N30 A;  1BT0 A;  3QHT A;  3R3M A;  3JYU A;  1E8X A;  2J0J A;  5AZF A;  3R66 C;  1CMX B;  1WGR A;  1IP9 A;  1LFD A;  3L16 A;  3APF A;  2B3A A;  2JPH A;  2AL6 A;  3L0W B;  2XBB C;  3KUZ A;  3B1L X;  2N1V A;  2PPH A;  2PE9 A;  3Q3F A;  4IM0 A;  3W1S A;  1D3Z A;  4PYZ A;  2ZNV B;  1GJZ A;  3PT2 B;  3ZVV A;  4A20 A;  1K8R B;  2ZZP B;  4XZ4 A;  4DDI D;  4HPM B;  1J8C A;  1OEY J;  2KLC A;  2DEN B;  2K8H A;  2JRI B;  1RRB A;  3DBH I;  2C7H A;  5L83 A;  4DK5 A;  3UIN B;  2HE7 A;  2HJ8 A;  3AU4 A;  2R2O A;  2WX0 A;  3CSF A;  3VXW A;  1S3S G;  2MP2 B;  3A9J A;  4A3O A;  4PS3 A;  4W9J A;  2JZZ A;  3R7Q A;  4GDL B;  3NY5 A;  3V60 A;  2KMA A;  4KSL C;  4NJ6 A;  2ZCC A;  4MDK E;  2KXJ A;  3QJZ A;  2N7E A;  3NHE B;  2KZR A;  3VHT C;  2NPT A;  2AEH A;  4ANV A;  1RLF A;  2RD0 A;  4BBN F;  3VFK A;  5J17 A;  1WMH A;  2KJR A;  2KDB A;  2XEW A;  5CHW A;  5J2R A;  3TBL D;  1L2N A;  2DYB A;  1P3Q U;  4W9I A;  3KYC D;  4MM3 A;  4BKT A;  1R4M I;  2G3Q B;  2KDI A;  4BOZ B;  3A4R A;  4EKU A;  1E8Z A;  2W9N A;  2RSU A;  3H6N A;  5CTR C;  2L8J A;  4F7Z A;  2KJ6 A;  1WFY A;  3SDL C;  3WAN A;  4LDT D;  1SGH A;  3MHS D;  2LWP A;  2RPQ A;  4EUT A;  4NNJ B;  2MBQ A;  3KH0 A;  4K81 A;  3QIJ A;  2DAF A;  3PSE B;  1AAR A;  1V5O A;  4DWF A;  2O6V B;  4W9K A;  3DOW A;  4LDT B;  2C7M B;  3AI5 A;  3GZN I;  3TL5 A;  5IA7 A;  4GXB A;  3M63 B;  4W9L A;  4ICV A;  2FCQ A;  1MG8 A;  1P9D U;  3ML9 A;  1YD8 U;  3QWZ B;  2PEA A;  3U8Z A;  1FXT B;  1WJ4 A;  3U7D A;  2LXA A;  4W9C A;  2MBE A;  3EHV A;  3OAW A;  3TJP A;  1VCB A;  1WJN A;  4HCN B;  4IM2 A;  1Z2M A;  2K1F A;  4HDO A;  4EZK A;  1SIF A;  3RD2 A;  1Y8R C;  1ZGU B;  5DPR A;  3NZU A;  3SU8 X;  4EFO A;  4IC7 B;  2BGF A;  2G4S A;  2DYO A;  2D07 B;  4MJS A;  2AYO B;  4RM9 A;  3EFU A;  3WA0 A;  5KHO A;  1WXM A;  2A5U A;  2EMS A;  2MRP A;  3AU5 A;  2G4D B;  3T8M A;  2MQJ A;  3AXC A;  4MSQ B;  1V81 A;  2GOW A;  5AZG A;  3ZDM C;  3ML8 A;  4G0N B;  1E7V A;  2LVO A;  2L3Z A;  4HCP B;  3WAL A;  4AJY B;  2K6Q A;  3UF8 A;  4GDK B;  4I6N B;  1Q5W B;  3L13 A;  4N9F 4;  1V86 A;  2M1M A;  4OVV A;  2JF5 A;  3V6E B;  3DVG X;  4WJN A;  2BWF A;  1U4A A;  4GSW A;  2LD9 A;  2M8S A;  3M3J A;  2BYF A;  3ZNG C;  5J18 A;  5C1Z A;  2XK5 A;  4GN1 A;  4ICU A;  3A1Q B;  3WAM A;  1E8W A;  2J0M A;  1WMH B;  4HJK A;  2L0T A;  1YIW A;  4WJP A;  5E6P A;  2LGD A;  4DDG D;  5JHB A;  4FJY A;  2GBN A;  1OTR B;  2J0K A;  2LVQ A;  3PPA A;  3QQ8 B;  5JH5 C;  2KDF B;  4E71 A;  2GBR A;  2FCM A;  2L7R A;  3DCG A;  3N3K B;  2PJH A;  4I6P A;  2NS5 A;  3QCA A;  5DPT A;  2M4N A;  4DHJ D;  4LCD E;  4MEL A;  3JSV A;  5D6J B;  4BBN C;  4K7U A;  2VRR B;  3APD A;  5BO4 B;  2L05 A;  2IO0 B;  5CX3 A;  4BKS A;  2ZVO A;  5KHQ A;  2FAZ A;  2EMT A;  2JWZ A;  2ZNV C;  1H4R A;  1RAX A;  2QHO A;  3ZNH B;  4GU2 A;  2C9W B;  3CMM B;  4NQK E;  4KZ0 A;  2RGF A;  3RCZ A;  4XC2 A;  2MA9 B;  4JL9 A;  4BOS C;  2KLG A;  3ZW3 A;  2KDE B;  2K8B A;  2PE6 B;  3UQB A;  2GBK A;  3JVZ X;  5FR6 A;  1KLV A;  4IW0 A;  1WGH A;  2IO3 B;  4MGY E;  3LDZ E;  2AL3 A;  4DBG A;  1F9J A;  3A4S C;  2O2V A;  5DPW A;  1WF9 A;  1WR1 A;  1XQQ A;  2K39 A;  1WJ6 A;  2MW5 A;  2R2Q A;  4RMA A;  2N4F A;  3QK0 A;  4IWO A;  2IO2 B;  2N1W A;  3L17 A;  4ZRI A;  4ZRJ A;  1UD7 A;  5DCN A;  2C5L C;  3UQA A;  3V61 A;  3W1Y A;  5D94 A;  1GC7 A;  3RYT A;  3VUY A;  3R7R A;  3B08 A;  5D7G A;  1Z5S B;  4JQW C;  3ALB A;  3X23 A;  4X57 B;  3A9K A;  4ASW C;  3KW5 B;  1WRD B;  2N9P C;  3U30 A;  2UYZ B;  2KTF A;  3P2B A;  3QAQ A;  4M8N A;  5AZH A;  2LUE A;  2Z0D B;  5IAA C;  1SE9 A;  4ANX A;  2LAS A;  1EUV B;  1WXA A;  1WZ3 A;  2D11 A;  2KKC A;  3ZLZ A;  2KAN A;  3H9D A;  4EZJ A;  1C1Y B;  2NPT B;  4IUM B;  2DX5 B;  2KC1 A;  2C7N B;  2D10 A;  3H7P B;  1XD3 B;  3A33 B;  2KWC A;  3PLU A;  4E74 A;  3WAP A;  4KDL B;  1V80 A;  2KN5 A;  2MCN B;  4DHJ B;  4ANW A;  2GMI C;  2KWV B;  2LJ5 A;  1S1Q B;  1EF1 A;  2DZJ A;  2IO1 B;  4MGZ E;  1GG3 A;  2ASQ A;  4HWI B;  3VH3 B;  2J7Q B;  4FLH A;  3JSV B;  3ONS A;  1E90 A;  2NBU A;  4GIV A;  3ZRF A;  2KHW B;  4DXA B;  1J19 A;  1WY8 A;  1WGD A;  3MJW A;  3VTV A;  1XT9 B;  4FAD A;  3L10 B;  1JRU A;  2CU1 A;  2Z0E B;  3ZRC A;  2V1Y A;  3A9K B;  2L00 B;  4G3X B;  1P98 A;  3DPD A;  4AJW A;  3ZDT A;  2KC2 A;  2NR2 A;  2KFK B;  2JVC A; 
#chains in the Genus database with same CATH topology
 3P1M A;  2GLS A;  3GZN B;  3V05 A;  1TS2 A;  1HXY D;  1JCK B;  4JWU C;  2KK8 A;  1OEY A;  2OJR A;  3Q69 A;  3AE8 B;  3SFE B;  4NJ7 A;  4YL8 A;  3GB1 A;  2WXO A;  3RNE C;  3NJT A;  2E3T A;  4IDI A;  4MEM A;  1WJU A;  1KLU D;  2K9X A;  3VRA B;  2ZPY A;  1QT9 A;  2PIA A;  1IYF A;  4M0W B;  2KJH B;  3KYD D;  2BBC A;  4KDI C;  1L7Y A;  1EWY C;  2KFK A;  1IGD A;  2LGI A;  5JZE B;  5TSS A;  3PVL A;  4JWS C;  2CHX A;  5BYR A;  3MC8 A;  4FXC A;  1YX6 B;  4JE3 B;  4WJO A;  1G6J A;  1PGA A;  2AQ2 B;  2HTH A;  1YN3 A;  5E6N A;  3BWU D;  4RNA A;  3VR9 B;  1YOV B;  1QF6 A;  1JML A;  4EZL A;  4KGT A;  2WXL A;  2FCS A;  3KWV A;  2LGX A;  2I1K A;  3DBL B;  4XE0 A;  3IBE A;  1V1P A;  4RM8 A;  3VQI A;  4W9F A;  1YJ1 A;  3RNG C;  3SD5 A;  1JRP A;  2O6V A;  2GBJ A;  3D32 A;  3Q8B A;  2MX2 A;  3AN1 A;  3UGB B;  1XCQ L;  2BW2 A;  5LXH A;  4KKJ A;  5GMV A;  4EE2 A;  4IM3 A;  4R3D A;  4GLS C;  1C76 A;  2BB6 A;  2KMC A;  3BIN A;  2YLM A;  1KTK A;  3V6C B;  3V62 A;  1I4G A;  1IPG A;  4CHK A;  4FBJ B;  1XLN A;  1P7E A;  1QOF A;  1I4X A;  4M00 A;  2JXT A;  3N1X C;  3OJ3 A;  3I57 A;  4BVU C;  2FNJ B;  4GGQ A;  3P4P B;  3TMP B;  4K7S A;  1I4H A;  4GDK A;  2KTR B;  1C3T A;  1CJE A;  1QKZ A;  3H7P A;  3ZTD A;  4G11 A;  1TIF A;  4HVB A;  3I3T B;  1V8C A;  1YX5 B;  3MC0 B;  3ZJT A;  2LGY A;  5C23 A;  1TYG B;  3IFW B;  1HQR D;  4ANU A;  3AV8 A;  4MAC A;  4II2 B;  1C4C A;  4FJZ A;  4I6L B;  2KD0 A;  4ZRQ A;  4WAF A;  1E0Z A;  3PTF C;  1UUP A;  2LRU A;  4P7I A;  4YSY B;  4B0E A;  2K8C A;  3LJ3 A;  2JSV X;  2EEL A;  1N5W A;  2GBM A;  3CWI A;  2IY0 B;  3DDC B;  3JW0 X;  2OOB B;  4FN2 A;  1I4Q A;  1V9J A;  4NAM A;  3EEC A;  1PFD A;  1TBE A;  3IT6 B;  3PRZ A;  3WIM A;  4KGS A;  4N58 A;  2DZK A;  4W9G A;  1WGY A;  2V4L A;  3MTN B;  3EC8 A;  4USA A;  2KVR A;  4XX5 A;  2IDY A;  3PZD A;  1JRO A;  2ZVN A;  2VZK D;  3GOE A;  1WE7 A;  3FIL B;  4NAW A;  4OZB A;  4TMA B;  1VZ7 A;  2NBV B;  2X8X X;  3NS8 A;  1F2R C;  1BML C;  3NZ3 A;  3B2F A;  2WXJ A;  4A9A A;  4JIO U;  2BPS A;  1HE8 A;  4ZYN A;  5BYS A;  3Q8E A;  2JYT A;  1FRR A;  3NOB A;  4YXD B;  2WLB A;  2PTL A;  3R3M A;  3R66 C;  2Y5P A;  1B9R A;  2AL6 A;  1DOI A;  1QIL A;  3AEF B;  1L4D B;  2PPH A;  1L0X B;  5EE0 A;  1HEZ E;  3W5U B;  3Q3F A;  4IM0 A;  3W1S A;  1YN4 A;  2WXP A;  4PYZ A;  4ZHO A;  2D5G A;  4L23 A;  1ACC A;  2OJW A;  3FAH A;  4XZ4 A;  1FRD A;  2L83 A;  2K8H A;  2HE7 A;  1MG4 A;  3GE3 C;  4YTP B;  2MP2 B;  3EFC A;  4A3O A;  1GAQ B;  3V60 A;  2ZCC A;  4LNF A;  2W3S A;  3QJZ A;  2KZR A;  2KN4 A;  1WXQ A;  2NPT A;  3VHT C;  2AEH A;  4ANV A;  5HFY A;  2KDB A;  5J2R A;  1YQ4 B;  3TBL D;  3FIL A;  4MM3 A;  4BOZ B;  2RSU A;  2QCZ A;  4F7Z A;  4RCO A;  3WAN A;  3MHS D;  1CZP A;  4EUT A;  2MBQ A;  3KH0 A;  3QIJ A;  4DWF A;  3DOW A;  5H8Y E;  2I38 A;  3TL5 A;  5IA7 A;  1K53 A;  2FCQ A;  2IND C;  2I2Y A;  3Q3N C;  2LXA A;  3TJP A;  1VCB A;  2K1F A;  4HDO A;  1SIF A;  3RD2 A;  1Y8R C;  1ZGU B;  1J7C A;  1RWS A;  3CIR B;  2G4S A;  2AQ1 B;  3B9J A;  1HZ5 A;  5H92 C;  2YEP F;  3WA0 A;  1WXM A;  3E9S A;  2GI9 A;  3T8M A;  4RGN A;  3TEW A;  5AZG A;  3ZDM C;  2K5P A;  3ML8 A;  1E7V A;  3LXF A;  4HCP B;  4AJY B;  4I6N B;  1CQV A;  1NYR A;  3L13 A;  4N9F 4;  2M1M A;  2JF5 A;  4YT0 B;  3V6E B;  3DVG X;  3NUH B;  2KT7 A;  1E8W A;  1OTR B;  1NVI D;  3EUB 2;  3Q3O C;  4MM3 B;  1AN8 A;  4E71 A;  4K3C A;  3DCG A;  3N20 C;  4A6Q A;  1J7A A;  1EM7 A;  2NS5 A;  1JW9 D;  5DPT A;  2M4N A;  5AUI A;  4JPS A;  3U4E G;  4BBN C;  3MC9 A;  4C00 A;  2V0G A;  1TKE A;  2VRR B;  5CX3 A;  2IO0 B;  5KHQ A;  2EMT A;  4GU2 A;  2C9W B;  3RCZ A;  1DYQ A;  3LB8 C;  1UWM A;  1F77 A;  2MA9 B;  4JL9 A;  4BOS C;  3U52 E;  4ZHP A;  2K8B A;  3HVZ A;  5FR6 A;  1ZUD 2;  2IGH A;  2AL3 A;  2KDM A;  1F9J A;  4MGY E;  2O2V A;  3AH7 A;  1WF9 A;  2PLP A;  2K39 A;  1IBX A;  2JU6 X;  3R8B A;  4ZRJ A;  3RNF C;  2C5L C;  3W1Y A;  3RYT A;  4D2K A;  5HI1 A;  5D7G A;  4X57 B;  3KW5 B;  3L4P A;  3RNB C;  3U30 A;  3P2B A;  5IAA C;  3PO0 A;  2LUE A;  1EUV B;  2LAS A;  2M56 B;  2W55 A;  3ZLZ A;  2KAN A;  3AEA B;  1XD3 B;  3A33 B;  2KWC A;  3PLU A;  4MT5 A;  4WQM A;  1V80 A;  5IKC M;  3IAS 1;  2GMI C;  2V3N A;  3U2S C;  4MGZ E;  2IO1 B;  5I4D A;  2ASQ A;  4HWI B;  4LK0 M;  4GIV A;  1E90 A;  2D3C A;  5FK9 C;  4UDU C;  1XT9 B;  4FAD A;  1JRU A;  3ZRC A;  1I7H A;  3A9K B;  2KC2 A;  2BB5 A;  1WYG A;  2QSD A;  4URK A;  1R4M B;  1I4P A;  2RDH A;  4MGI E;  3N1Y C;  3Q8C A;  4PS7 A;  1UEL A;  4XGA B;  4DXG A;  1TKY A;  2FID A;  4KIK B;  3QC8 B;  4HPP A;  5CHF A;  4FHK A;  4WWM A;  4C7Y A;  2CKH B;  4HKQ A;  1ZXI A;  4G50 A;  3SHQ A;  1AWD A;  2V3P A;  2GRI A;  3BVM A;  2K6D B;  2WX1 A;  2G45 B;  3AE9 B;  5BMG A;  2JZ3 B;  1UWX A;  2N9L A;  1WX7 A;  5CHV C;  2WDT B;  4LNO A;  3RZF A;  4BKS D;  3X0W A;  3QAR A;  1WI0 A;  1Q0W B;  4MGK E;  3CF6 E;  3BY4 B;  3ZKJ C;  2L0F A;  1F1H A;  3DHH C;  1ZW7 A;  4AWJ A;  3APC A;  2DAJ A;  2IBI B;  1WM2 A;  4AUQ C;  4HPL B;  1OGW A;  4W9H A;  1WYW B;  4B0M A;  3BII D;  1TGZ B;  2D2Q A;  1V1P B;  4KZC A;  1WIA A;  4OZA A;  2ON8 A;  2MWS B;  5BMI A;  3ZYY X;  4DXF A;  2WU2 B;  2NBW B;  1HTO A;  4E3C A;  4MSM B;  3HHM A;  2HJ1 A;  2JRH A;  3ZUN A;  3H1U A;  1R7S A;  2RDB C;  4IG7 B;  2K25 A;  2LZ6 A;  4C4V B;  1ROE A;  4RH6 A;  1TZ1 A;  2FIF A;  1KLG D;  2KTR A;  2IPK D;  1FFU A;  3RI7 C;  3T9L A;  1SJH D;  2ZEQ A;  3IVF A;  1N61 A;  1WWT A;  5E6O A;  3L54 A;  2ZPN A;  4AOF A;  5BMH A;  2BYV E;  3FKY A;  3QX1 A;  3AB5 A;  3VUX A;  2FBW B;  1WXS A;  2LVP A;  2KX3 A;  2WXN A;  3DVN V;  2MHJ A;  5EE3 A;  1WXV A;  3DBL I;  1ZE3 D;  2N9X A;  3W5V B;  4EEW A;  2JXX A;  2BKR B;  2MLB A;  4PT5 A;  1NEK B;  3CST A;  4HXD A;  2QIL A;  4XWT A;  3SEB A;  1TTN A;  4GB9 A;  4M8M A;  1QZE A;  1UBQ A;  2WXM A;  1KM7 A;  3IG3 A;  3C0R B;  1VJK A;  1XCT L;  2AWT A;  4A55 A;  1KH0 A;  2WP9 B;  3M95 A;  3PRE A;  5E6J A;  3VVW B;  2IZV B;  2EKI A;  3PGE A;  4GMV A;  1EWC A;  4J3O D;  5D2M B;  2WDR B;  1NBF C;  4YTN B;  4CYE A;  1WR6 E;  3B0A A;  2SAK A;  4DHZ B;  4IWP A;  1FIQ A;  2CHW A;  3I5J C;  2JY6 A;  3VTW A;  4JLC A;  3PLV A;  1QQR A;  3OJ4 B;  1A70 A;  2KVZ A;  2N9E B;  1D4B A;  1Q1O A;  4Q2J A;  3AE1 B;  2DHZ A;  2ZJD A;  1E7U A;  2MBO A;  4FJV B;  1K50 A;  2MP2 A;  1WM3 A;  2J42 A;  4LNI A;  1JAL A;  2DYM A;  1HTQ A;  1E8X A;  5AZF A;  1WGR A;  2Y3A A;  3L16 A;  3APF A;  1XLP A;  2OED A;  3KUZ A;  2N7J A;  1DOY A;  3GE8 C;  4ZYS A;  1M4V A;  2KQ4 X;  4IKG A;  2XN9 C;  2ZNV B;  4A20 A;  2AX5 A;  4C80 A;  4ITK A;  2LHD A;  2C7H A;  2WDV B;  4DK5 A;  2GB1 A;  2R2O A;  2WX0 A;  3CSF A;  1KRH A;  4KSL C;  2ONQ A;  4MDK E;  2KXJ A;  2VH2 A;  3P63 A;  3RPF C;  4C7Z A;  1SEB D;  1BUI C;  1XLO A;  2RD0 A;  5J17 A;  1SBB B;  2HTM E;  5CHW A;  4IOI E;  1P3Q U;  4BKT A;  3AED B;  3A4R A;  2FE8 A;  4EKU A;  2W9N A;  3H6N A;  5CTR C;  4KGR A;  2RPQ A;  2JYE A;  2DAF A;  4P6V F;  4LLG M;  4W9K A;  4LDT B;  2D3A A;  1ET6 A;  2C7M B;  3AI5 A;  3M63 B;  4ICV A;  2BVC A;  1N62 A;  3DWM A;  4OVZ A;  1WJ4 A;  1TS3 A;  3EHV A;  1WJN A;  1E10 A;  1K51 A;  4IM2 A;  1T0R C;  3SU8 X;  4IC7 B;  3B2G A;  2DYO A;  4ACF A;  5IO9 A;  2D07 B;  4MJS A;  4RM9 A;  3EFU A;  1CK1 A;  5KHO A;  2EMS A;  1YJI A;  2MQJ A;  3AXC A;  1MPE A;  1V81 A;  1ESF A;  2GOW A;  4YWG G;  4G0N B;  2L3Z A;  4GDK B;  4WJN A;  3PZ8 A;  5D3I B;  3N1Z C;  5GXG B;  4GSW A;  1ZDX A;  1YMH E;  1JWS D;  2JQR B;  2BYF A;  1SXT A;  1N63 A;  4GN1 A;  4ICU A;  4N59 A;  2J0M A;  2JX5 A;  1FM0 D;  1RFK A;  2WDQ B;  3Q8A A;  5E6P A;  4FJY A;  2GBN A;  3QQ8 B;  3ZXR A;  2FCM A;  3N3K B;  2PJH A;  1C9F A;  2QIE B;  2W82 A;  4MEL A;  3JSV A;  5D6J B;  1SF0 A;  3APD A;  5BO4 B;  1N6Z A;  1AW7 A;  2JWZ A;  2ZNV C;  1I4R A;  1H4R A;  1XO3 A;  2KLG A;  3ZW3 A;  2PE6 B;  2ZW0 A;  1KFY B;  4IW0 A;  4DBG A;  3A4S C;  4CQN A;  2VH1 A;  3QK0 A;  2N1W A;  4RF0 A;  4HRS A;  1TZO A;  2LJI A;  1Z5S B;  4JQW C;  3ALB A;  3X23 A;  1WRD B;  2N9P C;  2WXR A;  2WXG A;  2K22 A;  5AZH A;  3DHG C;  1WXA A;  1V97 A;  2INP E;  1WZ3 A;  1UNS A;  2PMV A;  4EZJ A;  2DX5 B;  1NEN B;  2D10 A;  4E74 A;  2KN5 A;  3ABV B;  2KWV B;  3VH3 B;  1PGX A;  2Z8L A;  3GS2 A;  4HJG E;  1WGK A;  2NBU A;  3IXS A;  2KHW B;  1WY8 A;  2BYT A;  1WGD A;  3VTV A;  2QMT A;  2V1Y A;  5G5H A;  5IP4 D;  2L00 B;  4G3X B;  3DPD A;  4P1C C;  3ZDT A;  2KFK B;  4ASW C;  2ZW1 A;  1X1M A;  3A1Q A;  3HIZ A;  4NQL B;  4TSS A;  1FMA D;  1GC6 A;  4A8X C;  1E6E B;  4B6W A;  2MJE A;  2NMQ A;  3RMK C;  2MEK A;  4ARC A;  2M0X A;  1I42 A;  1V5T A;  2PVO D;  2BKF A;  2K0P A;  3AM9 A;  2KOX A;  4AS1 A;  4TUU A;  3Q3J A;  1D6E C;  4WWN A;  5C3J B;  4FHJ A;  2XK5 B;  1ZOY B;  2WNM A;  1FCC C;  1LQB A;  3NZS A;  2KNB A;  2V3S A;  1UH6 A;  2WWZ A;  2KQ7 A;  4TQ1 A;  4XYC A;  3ZO5 B;  1GNU A;  2WU5 B;  1YQB A;  1LXD A;  3ENE A;  1OQY A;  2R61 A;  3WAO A;  1VLB A;  1ZPS A;  3N32 A;  2FUG 1;  1M94 A;  2ICI A;  4K7W A;  1V6E A;  1QOA A;  1NYQ A;  1QOG A;  5LLI A;  4K3B A;  3AE4 B;  3DQV A;  3E56 A;  1L0V B;  1JWA D;  1WX8 A;  4M0W A;  2G9H D;  3RT3 B;  3I9V 1;  4RF1 A;  3AMZ A;  1FXA A;  2FUH B;  1QLB B;  4OW0 A;  3ECI A;  2UWQ A;  1YN5 A;  2Z59 B;  1C77 A;  2KO3 A;  3KVF B;  3AUL A;  4WWP A;  1JQ4 A;  2I1J A;  2CU3 A;  2L52 A;  4HRO A;  4LJO B;  2JWU A;  4ZDV A;  2WHI A;  3ZNI D;  1AYF A;  3O65 B;  3IHP C;  4B95 A;  4PS8 A;  1A5R A;  4BKG A;  3Q6B A;  2HD5 B;  5TR5 A;  3P4S B;  1C79 A;  2A4Z A;  1P0R A;  3KLS X;  4TQ0 A;  2MSE D;  3AEB B;  1OQQ A;  3Q8F A;  1SSN A;  3MP9 A;  4AP4 C;  2EKE C;  2KAJ A;  4C4V A;  2Q5W D;  4KSK C;  1WE6 A;  3BYY B;  3KUC B;  2FCN A;  1HZ6 A;  2NTS A;  2PKO A;  4MJS B;  3W1S C;  3UIO B;  2RR9 A;  3IAM 1;  4HLE A;  3VTU A;  4PYU A;  4K1R B;  2O6V D;  3PV1 A;  5G2N A;  4AQ7 A;  2M0A A;  2N7D A;  4IWQ A;  3RNA C;  5LXI B;  1R4N I;  3NS1 A;  2LXC A;  2IYD B;  4HDQ A;  3DBR I;  4GDL A;  5EE1 A;  4KIK A;  3ZTC A;  3HM6 X;  3TIX A;  3DVG Y;  2ZCB A;  4WWO A;  2REX A;  4TKN A;  5EDS A;  4L1B A;  2DZI A;  3HK0 A;  4HK2 A;  1J0G A;  2WGS A;  2CHZ A;  3V3X A;  1UGM A;  3GP7 A;  2NCN A;  1L6V A;  5IOI A;  4F1S A;  1KOT A;  1D5X C;  5DPS A;  1PUT A;  1IUE A;  3AE3 B;  3P42 A;  3VAW A;  3TCA A;  4KKI A;  4FUL A;  4KV2 A;  4DQO C;  1T0Y A;  1EO6 A;  1TT5 B;  1FPY A;  3N30 A;  3QHT A;  3JYU A;  1CMX B;  1IP9 A;  1LFD A;  1JWM D;  2L32 A;  3W9C B;  3L0W B;  3B1L X;  2HDE A;  2PE9 A;  1E7P B;  2M19 A;  2IGG A;  4NZL B;  1HA5 A;  2QJL A;  4NJC A;  4C56 C;  1GJZ A;  1T5X D;  3ZVV A;  1D5Z C;  4DDI D;  4HPM B;  3KQ4 A;  1OEY J;  2DEN B;  3NRZ A;  1T0Q C;  2W3R A;  3NVV A;  5L83 A;  1VDV A;  1WSP A;  3AU4 A;  1FNW A;  3A9J A;  2JZZ A;  3R7Q A;  4GDL B;  2KMA A;  2LUM A;  1FO4 A;  2H88 B;  1TY2 A;  3SR6 A;  3VFK A;  1WMH A;  2KJR A;  2XEW A;  4QAY A;  1SB3 C;  2QEJ C;  3HUI A;  1L2N A;  4P1B C;  5HHD G;  4W9I A;  2KDI A;  1E8Z A;  1MJD A;  2RPV A;  1SIJ A;  2L8J A;  3ZXV A;  3SDL C;  4LDT D;  1SGH A;  4NNJ B;  3MFG A;  3PSE B;  1IGC A;  2W54 A;  2O6V B;  4BZA A;  2BT6 A;  3GZN I;  4GXB A;  3VR8 B;  1P9D U;  3FC4 A;  1YD8 U;  3QWZ B;  3U8Z A;  1FXT B;  4OHJ A;  3U7D A;  4LNN A;  1Z2M A;  4EZK A;  1N60 A;  5DPR A;  3MHZ A;  4EFO A;  1IBX B;  1D5M C;  2AYO B;  3ETR A;  1EU4 A;  1R4N B;  1SE4 A;  2G4D B;  4N6E B;  1FNV A;  1RYJ A;  1F0Z A;  2LVO A;  3WAL A;  5AUK A;  2K6Q A;  3UF8 A;  1QOB A;  1Q5W B;  1V86 A;  1SE3 A;  3HRD D;  1U4A A;  2K3U A;  3TSS A;  3VRB B;  2LD9 A;  2M8S A;  3M3J A;  2PVG C;  3ZNG C;  5J18 A;  3BK2 A;  2XK5 A;  1WMH B;  4HJK A;  2L0T A;  1YIW A;  4WJP A;  2LGD A;  4DDG D;  3PPA A;  5JH5 C;  2KDF B;  1FFV A;  2GBR A;  4I6P A;  3QCA A;  4DHJ D;  4LCD E;  1PGB A;  3BZD B;  1PYW D;  5T8I A;  2ZVO A;  1OQR A;  2FAZ A;  3ZNH B;  2KMM A;  4REZ A;  3BVG A;  4XDC A;  2GBK A;  3JVZ X;  1SJE D;  1TKG A;  1SE2 A;  1WGH A;  1C78 A;  3LDZ E;  5DPW A;  1JWB D;  1TS5 A;  1WR1 A;  1XQQ A;  1VZ8 A;  1L0Y B;  1WJ6 A;  2MW5 A;  4US8 A;  2R2Q A;  4RGO S;  4RMA A;  2N4F A;  3RNC C;  2IO2 B;  3L17 A;  3DWG C;  3SFD B;  4ZRI A;  1UD7 A;  5DCN A;  3UQA A;  1BXT A;  1PDX A;  5D94 A;  4BAX A;  2BTE A;  3VUY A;  3A9K A;  1LGR A;  3I63 C;  2UYZ B;  2KTF A;  4ANX A;  1SE9 A;  3KWL A;  2KKC A;  1ET9 A;  2QC8 A;  1C1Y B;  4IUM B;  3H7P B;  3NVW A;  4DHJ B;  1MI0 A;  4ANW A;  2BS2 B;  3LYY A;  2DZJ A;  2J7Q B;  1TY0 A;  3ONS A;  3ZRF A;  1J19 A;  1MHH E;  3MJW A;  2KYW A;  3R2T A;  2Z0E B;  2G1E A;  3PZ7 A;  1P98 A;  2OHF A;  2NR2 A;  2JVC A;  4A90 A;  1WX9 A;  5HG2 A;  1VD2 A;  3S2A A;  4BFR A;  2NVU I;  2XNA C;  2WXF A;  1NI2 A;  4ZRP A;  4GOC A;  4NY0 A;  2WQY B;  2WYQ A;  2IGD A;  3OG5 A;  3Q2A C;  3IT4 B;  1TJE A;  3AE7 B;  1C4A A;  2LRW A;  3QA8 A;  1MFW A;  1E5W A;  5BYQ A;  3J9C A;  4TV3 A;  4LJP B;  4W9D A;  4B9K A;  2IY1 B;  4RFB A;  2JT4 B;  3MJ5 A;  2KFJ A;  4A3P A;  2KWD A;  3NG0 A;  3OLM D;  1NDD A;  2BS3 B;  2VZK B;  1B1Z A;  2WS3 B;  2QDF A;  3PHW B;  2L1A A;  1FEH A;  4J6I A;  4WJQ A;  3U7Z A;  3ZJV A;  2YEP B;  3ZIM A;  4RGT A;  5HKH A;  2JUO A;  4ZRK A;  2CR5 A;  2MBH A;  1PQS A;  1ISN A;  2AQ3 B;  2N9K A;  4F8C B;  2N0S B;  1V2Y A;  2J53 A;  3O13 A;  1GUA B;  5JHA A;  3EA6 A;  2WXQ A;  2D3G A;  3M62 B;  2BWE S;  4WIP A;  5FKA C;  1FCL A;  1GPX A;  5EE9 A;  1I35 A;  1E9M A;  1DGJ A;  3K9O B;  2WXK A;  4DHZ E;  2M17 A;  2TSS A;  1ZDV A;  1GB4 A;  2V4I B;  1T6B X;  1Y56 A;  3AEC B;  4OVU A;  1WGG A;  3PHX B;  1UBI A;  2Y5B B;  3KUD B;  1WH3 A;  2C60 A;  1EU3 A;  1ZXH A;  1EF5 A;  1FXI A;  1ZKH A;  3RUL A;  2DNF A;  1YNT E;  2DLB A;  1V49 A;  1RFA A;  4FA6 A;  3ZJU A;  2KQS A;  3HM3 A;  1KJT A;  2B76 B;  1UF0 A;  2DZM A;  2LFI A;  4MH8 A;  3VUW A;  4NPN A;  3TEZ A;  2KX0 A;  1LO5 D;  1H8C A;  3ZNZ B;  5IN7 A;  2Y5C A;  3PRM B;  5C2T B;  2MH7 A;  3HVD A;  1FNU A;  5G55 A;  3K9P B;  1P1A A;  3H7S A;  2UU7 A;  4JGH B;  2RDG A;  4O1N A;  2J4X A;  2LHE A;  4M02 A;  4II3 B;  1MHX A;  3TUO A;  1UGJ A;  2BF8 B;  4W9E A;  2KWU B;  3RFZ B;  4H2A A;  2YVC A;  3DVN U;  4CO7 A;  3DBS A;  1GB1 A;  1VZ6 A;  4M01 A;  5L95 C;  2BQQ A;  2DWQ A;  3L08 A;  3PRP B;  3RZW C;  2O2V B;  5D3D A;  3UIP B;  1RM6 C;  1WZ0 A;  3DHI C;  1YQ3 B;  4L2Y A;  4EOY A;  3AE5 B;  1P7F A;  3VH4 B;  3RUI B;  5AEK B;  3BVZ A;  4WH4 A;  4WQO B;  1MVK A;  2BYE A;  1GOZ A;  3T3O A;  4JX1 C;  2CJO A;  4HEA 1;  4NAW B;  3VDZ A;  3EGR A;  2ACZ B;  2MBB B;  3PS6 A;  5JXV A;  1V1O A;  1WRI A;  1UZX B;  2CS4 A;  4MH0 E;  2LI5 A;  1ENF A;  5MPO A;  2L76 A;  4KVG B;  1E8Y A;  1LM8 B;  3A9J B;  1VRA B;  4WAA A;  4YTM B;  1BT0 A;  4OZC A;  2INC C;  2J0J A;  1T0S C;  2B3A A;  3P4Q B;  2JPH A;  3C19 A;  2XBB C;  2LGS A;  3R2I A;  2N1V A;  5LNK 1;  5G5G A;  3Q14 C;  3W2D A;  2D3B A;  1D3Z A;  2MJ3 A;  3PT2 B;  1Q10 A;  1K8R B;  2ZZP B;  2IJ0 A;  1J8C A;  2KLC A;  2JRI B;  1RRB A;  3DBH I;  3UIN B;  2HJ8 A;  3VXW A;  1S3S G;  4PS3 A;  3URY A;  4W9J A;  3NY5 A;  4NJ6 A;  2E6X A;  2N7E A;  3NHE B;  2WXH A;  1XLQ A;  1RLF A;  4BBN F;  4S17 A;  2DYB A;  3KYC D;  1R4M I;  2G3Q B;  1FD6 A;  1L4Z B;  4XWW A;  1K52 A;  2LMC A;  2KJ6 A;  1WFY A;  2DBY A;  2LWP A;  4K81 A;  1AAR A;  1V5O A;  3TEX A;  1T3Q A;  2KAC A;  3OWE B;  4W9L A;  1MG8 A;  3ML9 A;  1J7B A;  2PEA A;  1L5P A;  4W9C A;  2MBE A;  3OAW A;  4HCN B;  3UI3 A;  1NI3 A;  3AE6 B;  3NZU A;  2BGF A;  1STE A;  4S0R A;  3N9Y C;  2NTT A;  1F2R I;  1JWU D;  2A5U A;  2MRP A;  1C4P A;  3AU5 A;  4MSQ B;  5FR3 A;  3TEY A;  3P4R B;  2CJN A;  4US9 A;  3WCQ A;  2H89 B;  4OVV A;  1DOX A;  2BWF A;  1YJJ A;  3BYT B;  5C1Z A;  1VR9 A;  3A1Q B;  3WAM A;  4ARI A;  2BS4 B;  4LNK A;  5JHB A;  2LVQ A;  2J0K A;  3AEG B;  4P16 A;  4YSX B;  3H8H A;  1N5X A;  4ZOH C;  2L7R A;  3Q3M C;  2LEK A;  2INN E;  4K7U A;  2L05 A;  4BKS A;  1OFF A;  2QHO A;  1RAX A;  3CMM B;  4KX6 B;  2JZP A;  4KZ0 A;  4NQK E;  2RGF A;  4WUR A;  4XC2 A;  3AE2 B;  3DBR B;  2KDE B;  3UQB A;  1TS4 A;  4YSZ B;  1KLV A;  2IO3 B;  4HKZ E;  4IWO A;  3ZGZ A;  3V61 A;  1GC7 A;  1XF5 L;  3R7R A;  2WXI A;  3B08 A;  2X38 A;  3DBH B;  3AEE B;  4PK1 A;  3QAQ A;  4M8N A;  2Z0D B;  1L6U A;  3NVZ A;  1F52 A;  2D11 A;  3T3N A;  3H9D A;  2SEB D;  2NPT B;  2RMM A;  2KC1 A;  2C7N B;  2V9H A;  3WAP A;  4KDL B;  2PW9 A;  2MCN B;  2LJ5 A;  1S1Q B;  1EF1 A;  3ZQ4 A;  2J52 A;  1GG3 A;  1XXG A;  1KF6 B;  3C8Y A;  1ZP0 B;  1XEE A;  4FLH A;  3JSV B;  3NVY A;  4DXA B;  3BK1 A;  4LTU A;  3L10 B;  4XDD A;  4RGM A;  2CU1 A;  2MJD A;  4AJW A;  3RN9 C; 
#chains in the Genus database with same CATH homology
 1WX9 A;  4URK A;  1X1M A;  3A1Q A;  3HIZ A;  4NQL B;  1VD2 A;  3S2A A;  4BFR A;  1GC6 A;  2NVU I;  4MGI E;  4PS7 A;  1NI2 A;  4B6W A;  4GOC A;  4NY0 A;  1UEL A;  2KK8 A;  2WYQ A;  2FID A;  4KIK B;  1OEY A;  2OJR A;  2M0X A;  3QC8 B;  5CHF A;  1I42 A;  4FHK A;  1V5T A;  4NJ7 A;  4YL8 A;  2BKF A;  2CKH B;  2LRW A;  2KOX A;  3QA8 A;  4G50 A;  3SHQ A;  1E5W A;  4TUU A;  2K6D B;  2WX1 A;  3Q3J A;  4MEM A;  1WJU A;  4WWN A;  4TV3 A;  4LJP B;  4W9D A;  4FHJ A;  2G45 B;  2XK5 B;  2ZPY A;  4B9K A;  2IY1 B;  1IYF A;  4M0W B;  2JZ3 B;  2KJH B;  3KYD D;  2JT4 B;  4KDI C;  1LQB A;  3NZS A;  1WX7 A;  2KFJ A;  1L7Y A;  2KNB A;  2V3S A;  4A3P A;  5CHV C;  1UH6 A;  2KFK A;  2WWZ A;  2WDT B;  2KQ7 A;  4TQ1 A;  5JZE B;  3OLM D;  3ZO5 B;  3PVL A;  1NDD A;  1GNU A;  2CHX A;  1YQB A;  3RZF A;  4BKS D;  1YX6 B;  4WJO A;  3X0W A;  1G6J A;  1LXD A;  3QAR A;  3ENE A;  1OQY A;  1WI0 A;  3PHW B;  2HTH A;  4J6I A;  4WJQ A;  1Q0W B;  5E6N A;  4MGK E;  3CF6 E;  3BY4 B;  3ZIM A;  3WAO A;  3N32 A;  4EZL A;  3ZKJ C;  2L0F A;  1M94 A;  4K7W A;  1V6E A;  1ZW7 A;  2JUO A;  4ZRK A;  5LLI A;  4AWJ A;  5HKH A;  3APC A;  2FCS A;  3DQV A;  2CR5 A;  2MBH A;  2DAJ A;  2IBI B;  1PQS A;  2LGX A;  1ISN A;  1WM2 A;  2I1K A;  1WX8 A;  4F8C B;  3RT3 B;  4AUQ C;  4HPL B;  1V2Y A;  3IBE A;  1OGW A;  1GUA B;  4RM8 A;  3VQI A;  4W9H A;  2FUH B;  5JHA A;  4W9F A;  1WYW B;  1YJ1 A;  3ECI A;  2UWQ A;  2D3G A;  1TGZ B;  3SD5 A;  3M62 B;  2D2Q A;  2Z59 B;  2KO3 A;  2BWE S;  4KZC A;  2O6V A;  1WIA A;  3KVF B;  2GBJ A;  3AUL A;  4WWP A;  3D32 A;  2I1J A;  2MX2 A;  3UGB B;  5LXH A;  5GMV A;  4IM3 A;  2MWS B;  4LJO B;  1I35 A;  4ZDV A;  2NBW B;  3ZNI D;  4E3C A;  4MSM B;  3HHM A;  3K9O B;  2JRH A;  3IHP C;  3H1U A;  3O65 B;  3ZUN A;  4B95 A;  4PS8 A;  4IG7 B;  4BKG A;  1A5R A;  2K25 A;  2LZ6 A;  4DHZ E;  2KMC A;  2M17 A;  1TZ1 A;  2HD5 B;  3BIN A;  2YLM A;  5TR5 A;  2FIF A;  2KTR A;  3V6C B;  2A4Z A;  3V62 A;  4OVU A;  1P0R A;  4TQ0 A;  1IPG A;  1WGG A;  3PHX B;  4CHK A;  3T9L A;  4FBJ B;  2MSE D;  1UBI A;  2Y5B B;  3KUD B;  1WH3 A;  2C60 A;  2ZEQ A;  3IVF A;  1EF5 A;  1ZKH A;  3RUL A;  3OJ3 A;  5E6O A;  3L54 A;  4BVU C;  2FNJ B;  4GGQ A;  1V49 A;  1RFA A;  2ZPN A;  3TMP B;  4K7S A;  4FA6 A;  4AOF A;  4GDK A;  2KTR B;  1C3T A;  2BYV E;  3H7P A;  2KQS A;  3HM3 A;  3ZTD A;  3QX1 A;  4G11 A;  4AP4 C;  2EKE C;  4HVB A;  1KJT A;  2DZM A;  3I3T B;  3VUX A;  3VUW A;  1YX5 B;  1WXS A;  4KSK C;  4NPN A;  1WE6 A;  2KX0 A;  2LVP A;  2KX3 A;  3DVN V;  3KUC B;  1H8C A;  2FCN A;  3ZNZ B;  1WXV A;  3DBL I;  4MJS B;  3W1S C;  3UIO B;  2LGY A;  3PRM B;  2RR9 A;  5C23 A;  3IFW B;  4HLE A;  3VTU A;  4PYU A;  5G55 A;  2N9X A;  4K1R B;  2O6V D;  3PV1 A;  3K9P B;  5G2N A;  4ANU A;  1P1A A;  3H7S A;  2JXX A;  4EEW A;  4JGH B;  2BKR B;  2MLB A;  4II2 B;  4FJZ A;  4I6L B;  3CST A;  2N7D A;  2KD0 A;  4HXD A;  4IWQ A;  4II3 B;  3PTF C;  2LRU A;  4P7I A;  5LXI B;  1R4N I;  1TTN A;  4GB9 A;  2K8C A;  4M8M A;  1QZE A;  2BF8 B;  2LXC A;  3LJ3 A;  4W9E A;  1UBQ A;  2IYD B;  2KWU B;  4HDQ A;  3DBR I;  1KM7 A;  4GDL A;  3IG3 A;  2GBM A;  2YVC A;  3C0R B;  3DVN U;  4KIK A;  4CO7 A;  3ZTC A;  2IY0 B;  3DBS A;  3HM6 X;  3DDC B;  2AWT A;  3JW0 X;  3M95 A;  3PRE A;  3VVW B;  5L95 C;  3TIX A;  3DVG Y;  2IZV B;  3L08 A;  2OOB B;  3PRP B;  3PGE A;  2ZCB A;  4FN2 A;  4GMV A;  3RZW C;  5D2M B;  2O2V B;  3UIP B;  1NBF C;  4WWO A;  1V9J A;  1WZ0 A;  2REX A;  4TKN A;  5EDS A;  4CYE A;  3EEC A;  1TBE A;  4EOY A;  3PRZ A;  1WR6 E;  2DZI A;  3WIM A;  3HK0 A;  3VH4 B;  3RUI B;  5AEK B;  3B0A A;  4HK2 A;  2DZK A;  4W9G A;  1J0G A;  1WGY A;  2CHZ A;  2V4L A;  3MTN B;  3EC8 A;  4WQO B;  4DHZ B;  2KVR A;  1UGM A;  4XX5 A;  3PZD A;  2NCN A;  4IWP A;  2CHW A;  2ZVN A;  2BYE A;  3GOE A;  1WE7 A;  1KOT A;  4F1S A;  2JY6 A;  4NAW A;  3VTW A;  5DPS A;  4JLC A;  3PLV A;  2NBV B;  4NAW B;  3OJ4 B;  3VDZ A;  2MBB B;  3NS8 A;  3VAW A;  2N9E B;  3PS6 A;  3TCA A;  1Q1O A;  1UZX B;  4JIO U;  2CS4 A;  2BPS A;  4FUL A;  2DHZ A;  4KV2 A;  1HE8 A;  4MH0 E;  4ZYN A;  2LI5 A;  2ZJD A;  1E7U A;  2MBO A;  4FJV B;  2L76 A;  1T0Y A;  4KVG B;  1EO6 A;  1E8Y A;  1LM8 B;  2MP2 A;  3A9J B;  3NOB A;  1WM3 A;  4WAA A;  2DYM A;  3N30 A;  1BT0 A;  3QHT A;  3R3M A;  3JYU A;  1E8X A;  2J0J A;  5AZF A;  3R66 C;  1CMX B;  1WGR A;  1IP9 A;  1LFD A;  3L16 A;  3APF A;  2B3A A;  2JPH A;  2AL6 A;  3L0W B;  2XBB C;  3KUZ A;  3B1L X;  2N1V A;  2PPH A;  2PE9 A;  3Q3F A;  4IM0 A;  3W1S A;  1D3Z A;  4PYZ A;  2ZNV B;  1GJZ A;  3PT2 B;  3ZVV A;  4A20 A;  1K8R B;  2ZZP B;  4XZ4 A;  4DDI D;  4HPM B;  1J8C A;  1OEY J;  2KLC A;  2DEN B;  2K8H A;  2JRI B;  1RRB A;  3DBH I;  2C7H A;  5L83 A;  4DK5 A;  3UIN B;  2HE7 A;  2HJ8 A;  3AU4 A;  2R2O A;  2WX0 A;  3CSF A;  3VXW A;  1S3S G;  2MP2 B;  3A9J A;  4A3O A;  4PS3 A;  4W9J A;  2JZZ A;  3R7Q A;  4GDL B;  3NY5 A;  3V60 A;  2KMA A;  4KSL C;  4NJ6 A;  2ZCC A;  4MDK E;  2KXJ A;  3QJZ A;  2N7E A;  3NHE B;  2KZR A;  3VHT C;  2NPT A;  2AEH A;  4ANV A;  1RLF A;  2RD0 A;  4BBN F;  3VFK A;  5J17 A;  1WMH A;  2KJR A;  2KDB A;  2XEW A;  5CHW A;  5J2R A;  3TBL D;  1L2N A;  2DYB A;  1P3Q U;  4W9I A;  3KYC D;  4MM3 A;  4BKT A;  1R4M I;  2G3Q B;  2KDI A;  4BOZ B;  3A4R A;  4EKU A;  1E8Z A;  2W9N A;  2RSU A;  3H6N A;  5CTR C;  2L8J A;  4F7Z A;  2KJ6 A;  1WFY A;  3SDL C;  3WAN A;  4LDT D;  1SGH A;  3MHS D;  2LWP A;  2RPQ A;  4EUT A;  4NNJ B;  2MBQ A;  3KH0 A;  4K81 A;  3QIJ A;  2DAF A;  3PSE B;  1AAR A;  1V5O A;  4DWF A;  2O6V B;  4W9K A;  3DOW A;  4LDT B;  2C7M B;  3AI5 A;  3GZN I;  3TL5 A;  5IA7 A;  4GXB A;  3M63 B;  4W9L A;  4ICV A;  2FCQ A;  1MG8 A;  1P9D U;  3ML9 A;  1YD8 U;  3QWZ B;  2PEA A;  3U8Z A;  1FXT B;  1WJ4 A;  3U7D A;  2LXA A;  4W9C A;  2MBE A;  3EHV A;  3OAW A;  3TJP A;  1VCB A;  1WJN A;  4HCN B;  4IM2 A;  1Z2M A;  2K1F A;  4HDO A;  4EZK A;  1SIF A;  3RD2 A;  1Y8R C;  1ZGU B;  5DPR A;  3NZU A;  3SU8 X;  4EFO A;  4IC7 B;  2BGF A;  2G4S A;  2DYO A;  2D07 B;  4MJS A;  2AYO B;  4RM9 A;  3EFU A;  3WA0 A;  5KHO A;  1WXM A;  2A5U A;  2EMS A;  2MRP A;  3AU5 A;  2G4D B;  3T8M A;  2MQJ A;  3AXC A;  4MSQ B;  1V81 A;  2GOW A;  5AZG A;  3ZDM C;  3ML8 A;  4G0N B;  1E7V A;  2LVO A;  2L3Z A;  4HCP B;  3WAL A;  4AJY B;  2K6Q A;  3UF8 A;  4GDK B;  4I6N B;  1Q5W B;  3L13 A;  4N9F 4;  1V86 A;  2M1M A;  4OVV A;  2JF5 A;  3V6E B;  3DVG X;  4WJN A;  2BWF A;  1U4A A;  4GSW A;  2LD9 A;  2M8S A;  3M3J A;  2BYF A;  3ZNG C;  5J18 A;  5C1Z A;  2XK5 A;  4GN1 A;  4ICU A;  3A1Q B;  3WAM A;  1E8W A;  2J0M A;  1WMH B;  4HJK A;  2L0T A;  1YIW A;  4WJP A;  5E6P A;  2LGD A;  4DDG D;  5JHB A;  4FJY A;  2GBN A;  1OTR B;  2J0K A;  2LVQ A;  3PPA A;  3QQ8 B;  5JH5 C;  2KDF B;  4E71 A;  2GBR A;  2FCM A;  2L7R A;  3DCG A;  3N3K B;  2PJH A;  4I6P A;  2NS5 A;  3QCA A;  5DPT A;  2M4N A;  4DHJ D;  4LCD E;  4MEL A;  3JSV A;  5D6J B;  4BBN C;  4K7U A;  2VRR B;  3APD A;  5BO4 B;  2L05 A;  2IO0 B;  5CX3 A;  4BKS A;  2ZVO A;  5KHQ A;  2FAZ A;  2EMT A;  2JWZ A;  2ZNV C;  1H4R A;  1RAX A;  2QHO A;  3ZNH B;  4GU2 A;  2C9W B;  3CMM B;  4NQK E;  4KZ0 A;  2RGF A;  3RCZ A;  4XC2 A;  2MA9 B;  4JL9 A;  4BOS C;  2KLG A;  3ZW3 A;  2KDE B;  2K8B A;  2PE6 B;  3UQB A;  2GBK A;  3JVZ X;  5FR6 A;  1KLV A;  4IW0 A;  1WGH A;  2IO3 B;  4MGY E;  3LDZ E;  2AL3 A;  4DBG A;  1F9J A;  3A4S C;  2O2V A;  5DPW A;  1WF9 A;  1WR1 A;  1XQQ A;  2K39 A;  1WJ6 A;  2MW5 A;  2R2Q A;  4RMA A;  2N4F A;  3QK0 A;  4IWO A;  2IO2 B;  2N1W A;  3L17 A;  4ZRI A;  4ZRJ A;  1UD7 A;  5DCN A;  2C5L C;  3UQA A;  3V61 A;  3W1Y A;  5D94 A;  1GC7 A;  3RYT A;  3VUY A;  3R7R A;  3B08 A;  5D7G A;  1Z5S B;  4JQW C;  3ALB A;  3X23 A;  4X57 B;  3A9K A;  4ASW C;  3KW5 B;  1WRD B;  2N9P C;  3U30 A;  2UYZ B;  2KTF A;  3P2B A;  3QAQ A;  4M8N A;  5AZH A;  2LUE A;  2Z0D B;  5IAA C;  1SE9 A;  4ANX A;  2LAS A;  1EUV B;  1WXA A;  1WZ3 A;  2D11 A;  2KKC A;  3ZLZ A;  2KAN A;  3H9D A;  4EZJ A;  1C1Y B;  2NPT B;  4IUM B;  2DX5 B;  2KC1 A;  2C7N B;  2D10 A;  3H7P B;  1XD3 B;  3A33 B;  2KWC A;  3PLU A;  4E74 A;  3WAP A;  4KDL B;  1V80 A;  2KN5 A;  2MCN B;  4DHJ B;  4ANW A;  2GMI C;  2KWV B;  2LJ5 A;  1S1Q B;  1EF1 A;  2DZJ A;  2IO1 B;  4MGZ E;  1GG3 A;  2ASQ A;  4HWI B;  3VH3 B;  2J7Q B;  4FLH A;  3JSV B;  3ONS A;  1E90 A;  2NBU A;  4GIV A;  3ZRF A;  2KHW B;  4DXA B;  1J19 A;  1WY8 A;  1WGD A;  3MJW A;  3VTV A;  1XT9 B;  4FAD A;  3L10 B;  1JRU A;  2CU1 A;  2Z0E B;  3ZRC A;  2V1Y A;  3A9K B;  2L00 B;  4G3X B;  1P98 A;  3DPD A;  4AJW A;  3ZDT A;  2KC2 A;  2NR2 A;  2KFK B;  2JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...