1XT9B

Crystal structure of den1 in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 8
publication title Structure of a Complex between Nedd8 and the Ulp/Senp Protease Family Member Den1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1xt9B00
2OOBB 3VH3B 1RAXA 1V80A 3DDCB 3SHQA 3ZTCA 1OGWA 4MEMA 1R4NI 3PGEA 3PRPB 3SU8X 4PYUA 1GJZA 2KTRA 4II3B 1WM3A 2KLGA 4AWJA 4JIOU 4GB9A 2PPHA 2RGFA 2UWQA 4I6PA 4ZRIA 2IYDB 3H7PA 2O2VA 3N32A 1E90A 3PSEB 4AUQC 5J18A 1WYWB 4EEWA 3MTNB 3DQVA 4YL8A 1E7UA 1P1AA 3H7SA 4TQ0A 4X57B 4FHKA 2JF5A 3X23A 2WYQA 5DCNA 4F1SA 1AARA 2C7NB 1WJNA 3LJ3A 4W9HA 3W1SC 4AJYB 4GXBA 4I6NB 4BOZB 4E71A 4MGIE 1U4AA 4ASWC 3AU5A 3CSFA 2KO3A 4IM0A 3APFA 3DBRI 4W9CA 3CSTA 3PHXB 4GSWA 3A9JB 2MP2A 4PYZA 2BGFA 4B95A 4ICVA 3V60A 3VXWA 3X0WA 4K1RB 3DOWA 5J17A 3DVNV 1WF9A 2A4ZA 3B0AA 2D10A 4HLEA 1UGMA 4DDID 4W9KA 4IWPA 2AL6A 2KMAA 3PLUA 4IM3A 4KIKB 1WR1A 2KX3A 1YIWA 2ZVNA 5G2NA 5AZFA 2L7RA 4HPMB 1WX9A 2O6VA 4ICUA 2KFKB 4ZRJA 4A20A 5JZEB 2KD0A 3L0WB 4KDIC 5BO4B 1WY8A 2DENB 2LUEA 3KYCD 5AEKB 4GU2A 3L16A 2NR2A 2JRIB 1GG3A 1V81A 2MCNB 3W1YA 3M95A 2LASA 3IBEA 4N9F4 2NBWB 1I35A 2GMIC 2ZZPB 1IPGA 2JY6A 2KMCA 4GN1A 4IWQA 4WQOB 3H7PB 2O2VB 5C23A 5E6NA 1ZGUB 4WJPA 2O6VD 5D7GA 4K7WA 4HXDA 2DHZA 2AEHA 4ANXA 4TUUA 3KUDB 4MELA 2IBIB 3PRZA 4M8MA 2G4DB 5CX3A 3RCZA 1OQYA 2CHZA 4FJZA 2M1MA 2V4LA 4WJNA 1WZ0A 3KUZA 5C1ZA 2D2QA 2I1KA 1FXTB 5EDSA 3DCGA 4HK2A 4CYEA 1WJ6A 4EKUA 3R7QA 1Y8RC 3RZWC 2JUOA 3TBLD 1V49A 4ZRKA 1QZEA 4BFRA 2MP2B 3U7DA 2RSUA 3DVGY 4JGHB 1Z2MA 2CKHB 2C60A 1P9DU 2VRRB 3MJWA 3VQIA 3S2AA 1WRDB 3A9KA 4BBNF 1OEYA 1M94A 3ZUNA 1UD7A 1RFAA 1WI0A 1LFDA 1TGZB 2BYVE 2KQ7A 3NOBA 2J0KA 1WGHA 3AXCA 2J0MA 4MDKE 5D94A 4JL9A 3B08A 4LJPB 1R4MI 2Z0DB 4NNJB 3VTWA 3KW5B 3VHTC 1C1YB 2O6VB 2N7DA 3A9JA 3ZRCA 3APCA 2IO1B 2D07B 4HCPB 4K81A 3N3KB 4BVUC 2W9NA 2GBJA 3KVFB 4HPLB 4DHZB 3PTFC 4HVBA 4GGQA 2YVCA 2JPHA 1IYFA 1L7YA 1WXMA 4DWFA 5LXIB 2CS4A 3T8MA 1GUAB 3IHPC 1WMHB 4MH0E 2L8JA 2XEWA 3PLVA 3TJPA 3LDZE 4GDKB 4TV3A 3WALA 2IY0B 2UYZB 2G3QB 2KFKA 2KZRA 5FR6A 1WJUA 2K6QA 2B3AA 3ZLZA 1WGRA 5DPRA 3UIOB 3ZTDA 3PZDA 2N7EA 2JT4B 3O65B 2NS5A 4FLHA 3VFKA 4AP4C 2KDFB 1Q5WB 1SIFA 1V86A 3ZDMC 4EFOA 2IY1B 3MHSD 1E5WA 1LXDA 3JYUA 4F7ZA 3GZNI 3L17A 4GMVA 2EMTA 2L05A 2LRUA 2ZCCA 2ZPYA 2FCQA 1J8CA 2MRPA 2DZJA 1WX8A 1KLVA 3SD5A 3TMPB 4WWPA 2BWES 3DBSA 5CHWA 1WH3A 2KJHB 3A9KB 1I42A 1WE6A 2JWZA 1P0RA 3BINA 2DAFA 1EUVB 4HDOA 5L83A 3H9DA 4W9DA 3ZW3A 3ML8A 2RD0A 2MX2A 3IG3A 4JQWC 4BKGA 3NY5A 3WAMA 1ZW7A 2I1JA 2KX0A 2KWVB 3QAQA 2DAJA 3I3TB 2LGDA 1VCBA 2WWZA 2LGYA 1SGHA 2GBNA 3VUWA 2PJHA 3P2BA 2ASQA 5L95C 3HM6X 4EOYA 2JZ3B 2KKCA 4JLCA 1WX7A 3WAPA 2K8CA 1YQBA 2M17A 2KWUB 5CHVC 1TBEA 3V62A 3ONSA 2RR9A 2KFJA 5G55A 2JRHA 3QCAA 4XZ4A 2FNJB 1S1QB 3PPAA 3OJ3A 4CHKA 5AZHA 3QJZA 4IG7B 2EMSA 4A3OA 2BYEA 1E7VA 3QX1A 2BKRB 1XQQA 2K25A 3A33B 3ZNID 4IM2A 2N9XA 4CO7A 1WMHA 2JXXA 3V6CB 2D11A 1F9JA 4NPNA 3VH4B 4GDKA 1T0YA 2KVRA 4BBNC 4RM9A 3RZFA 2JVCA 2CR5A 4II2B 4KSKC 1P3QU 4MGZE 3VVWB 2HD5B 2KOXA 4FULA 4HWIB 4PS8A 4OVUA 4TQ1A 3RD2A 2Y5BB 4W9GA 2CHXA 3WA0A 4W9IA 4FJYA 4HDQA 1E8WA 3KUCB 4K7UA 2KXJA 4IC7B 3TL5A 2MWSB 2FIFA 3DPDA 4HJKA 4XC2A 4NQKE 2GBKA 2D3GA 2FCSA 3VUXA 1ZKHA 2J0JA 3ZO5B 5JH5C 3HK0A 2PEAA 4LDTD 5CTRC 4FHJA 3GOEA 3QIJA 4W9FA 4E3CA 1NBFC 3NZSA 1NI2A 3PVLA 2C5LC 5DPSA 2PE9A 3ZNGC 3ML9A 2NCNA 4ANWA 2LVOA 2MQJA 2KDEB 4KV2A 2KHWB 2REXA 5D2MB 1V5TA 3SDLC 2BWFA 2M4NA 3ZNHB 2KWCA 4F8CB 2V1YA 4TKNA 1EF5A 2MBEA 3UGBB 3AU4A 3APDA 3H1UA 4GOCA 1OEYJ 2Z0EB 2JZZA 2R2OA 2NPTB 1GNUA 1V9JA 1UBIA 2LVQA 1L2NA 4PS3A 2GOWA 2L00B 2WX0A 1WZ3A 3DBLI 4LDTB 3CMMB 2KNBA 3H6NA 4B6WA 2MBOA 2IO2B 2ZNVC 5E6OA 3DVGX 3UIPB 1ISNA 2A5UA 2KTFA 3NZUA 4IUMB 1G6JA 4OVVA 5D6JB 3JSVB 3VUYA 2LXCA 4G3XB 2LXAA 2NBUA 1C3TA 2HJ8A 1TZ1A 2WDTB 4EUTA 1P98A 2FUHB 3T9LA 4GDLB 4EZKA 4W9EA 2Z59B 3VTUA 1YX6B 2J7QB 3HIZA 3PV1A 4GIVA 3CF6E 1EO6A 4ANUA 2PE6B 1V6EA 3EECA 2KJRA 4DK5A 1NDDA 4M0WB 4EZLA 3C0RB 2K8HA 4WAAA 2FAZA 3A1QB 1MG8A 3K9OB 4BKSD 3EHVA 4DXAB 2KJ6A 2ZNVB 2K6DB 3OLMD 2IZVB 2QHOA 2WX1A 4NQLB 2HE7A 2CU1A 4HCNB 2NBVB 2MBHA 4LCDE 4NAWA 1UELA 3V61A 3L54A 1HE8A 3Q3JA 1WGDA 2YLMA 3QWZB 3VAWA 3V6EB 2XBBC 3L10B 3UQAA 1GC6A 3VDZA 2C9WB 2N1WA 2N1VA 1EF1A 2C7MB 2MLBA 5JHBA 5LLIA 2KANA 3M62B 5CHFA 3QA8A 3UF8A 2LVPA 4MJSA 1D3ZA 1E8ZA 4WWOA 2DYOA 2LRWA 1YD8U 3JVZX 4KZCA 3R7RA 1WFYA 2L3ZA 2XK5A 3OJ4B 4AOFA 5DPWA 3L13A 1XD3B 1RRBA 1UZXB 2AL3A 3M63B 4FADA 2L0FA 4KVGB 4B9KA 1WGGA 1S3SG 3IVFA 4BKTA 1SE9A 4W9LA 4URKA 3U30A 2M8SA 3K9PB 4KZ0A 2ZJDA 4WJQA 1J0GA 1V5OA 4G11A 1WXAA 2IO0B 2GBMA 2KK8A 3HM3A 4PS7A 2KN5A 2IO3B 2K39A 3QARA 2NPTA 3PREA 5GMVA 1WGYA 2BYFA 2N9EB 3PRMB 4A3PA 2BKFA 3D32A 3AI5A 3ALBA 3DBHI 3PT2B 2ZVOA 2AWTA 3QK0A 2ZEQA 3ZKJC 1PQSA 2DYMA 3QC8B 1H4RA 5AZGA 1BT0A 4P7IA 1WE7A 3WANA 3JSVA 1E8YA 4W9JA 2KQSA 4DDGD 3UQBA 2KC1A 2KDBA 3A4SC 4BOSC 4G50A 1WJ4A 3AULA 3OAWA 4NJ6A 2BPSA 1XT9B 3WIMA 3ECIA 2MSED 2G4SA 3QQ8B 3IFWB 4MSMB 2C7HA 4GDLA 3DVNU 2K8BA 3JW0X 3M3JA 2GBRA 3WAOA 3Q3FA 1IP9A 4KSLC 4ANVA 3KH0A 4NAWB 2ZCBA 2L76A 4NJ7A 2KTRB 4MSQB 1Q1OA 2CHWA 3ENEA 2DX5B 3PS6A 1JRUA 1E8XA 1WXVA 3A4RA 3R3MA 3TCAA 1A5RA 2DZMA 5JHAA 2EKEC 3A1QA 1KOTA 4KDLB 4DHZE 2HTHA 1RLFA 1WXSA 3U8ZA 1K8RB 1H8CA 3ZVVA 1YX5B 1GC7A 4MJSB 2FIDA 2MW5A 2L0TA 5J2RA 2XK5B 4RMAA 5LXHA 3L08A 1TTNA 3R66C 4DBGA 4IW0A 1LM8B 4NY0A 4WWNA 2N4FA 2FCMA 1YJ1A 3ZRFA 2ZPNA 4G0NB 4WJOA 5IAAC 3VTVA 2N9PC 2KC2A 1Q0WB 2NVUI 3ZNZB 4RM8A 3HHMA 1VD2A 2LGXA 2DZIA 4DHJD 4FN2A 2RPQA 2M0XA 4AJWA 3EC8A 5HKHA 4MM3A 3ZIMA 1J19A 2LD9A 2MBQA 4EZJA 1V2YA 5TR5A 2KDIA 3EFUA 2BF8B 2MA9B 3RUIB 4BKSA 3TIXA 4J6IA 3N30A 3RYTA 2FCNA 4FJVB 1X1MA 3UINB 4FA6A 1UH6A 5E6PA 3KYDD 2G45B 2K1FA 5KHQA 4E74A 1Z5SB 2AYOB 4MGKE 4FBJB 4XX5A 3RT3B 4ZYNA 2OJRA 2V3SA 3NHEB 2LI5A 2DYBA 2LJ5A 1LQBA 2LZ6A 3PHWB 3QHTA 3ZDTA 1KJTA 1CMXB 4IWOA 4ZDVA 1OTRB 4KIKA 4M8NA 5DPTA 2KLCA 1WM2A 1WR6E 3NS8A 3BY4B 4K7SA 2DZKA 5KHOA 4DHJB 1KM7A 4I6LB 1UBQA 4MGYE 2MBBB 2LWPA 3W1SA 1WIAA 3B1LX 2R2QA 4LJOB 3RULA 5IA7A
chains in the Genus database with same CATH superfamily
4S0RA 1RAXA 3NUHB 3HUIA 3HVZA 4YT0B 4PYUA 4II3B 2UWQA 2RGFA 1STEA 1WRIA 4AUQC 2IYDB 1E90A 4IDIA 1WYWB 1OQQA 3FILA 4O1NA 3DQVA 1P1AA 1CJEA 2DBYA 3AB5A 2C7NB 2AQ2B 4GXBA 4I6NB 4BOZB 4LNIA 4MGIE 3AU5A 3CSFA 2OJWA 4REZA 3DBRI 1HQRD 3PHXB 2H89B 3X0WA 3AEBB 3GP7A 3DVNV 2AL6A 3PLUA 4KIKB 2KX3A 2ZVNA 2VH1A 1DOXA 2L7RA 1WX9A 3PZ8A 1T6BX 2WU2B 3L0WB 4KDIC 2DENB 2BQQA 1XF5L 1HXYD 1V8CA 4GU2A 1Y56A 3L16A 1IGCA 2NR2A 2JRIB 2W3RA 1F2RI 1V81A 1T5XD 3BWUD 3M95A 2LASA 3ABVB 2NBWB 1I35A 5HHDG 1FM0D 2DHZA 3I9V1 4ANXA 2IBIB 4FJZA 2M1MA 4WJNA 5C1ZA 1FPYA 4CYEA 4EKUA 1WJ6A 3Q8CA 1FFVA 1QZEA 3AE2B 4L23A 2VRRB 4N59A 3MJWA 2JSVX 3ZUNA 1WI0A 3TEZA 1CQVA 2KQ7A 4EE2A 3BIID 3VTWA 4JL9A 4NNJB 3AE4B 2O6VB 3A9JA 3HVDA 2IO1B 5EE3A 1QT9A 4DHZB 1GPXA 4GGQA 1WXMA 4DWFA 5LXIB 3T8MA 2IGHA 2L8JA 1D5XC 1PUTA 4XDDA 3TJPA 3GE8C 2UYZB 2G3QB 3ZGZA 3L4PA 3ZLZA 4RGTA 3ZTDA 5DPRA 3UIOB 3PZDA 2N7EA 2NS5A 1JWSD 2MJEA 2KDFB 3ZDMC 1IGDA 3MHSD 1RWSA 2EMTA 3P4RB 2BWES 5G5HA 1ROEA 5I4DA 1PYWD 3GB1A 2DAFA 4W9DA 4WQMA 5LNK1 4LLGM 2MX2A 3WAMA 2KX0A 3QAQA 2DAJA 1ZOYB 2V9HA 3P2BA 2AQ1B 3AE7B 2KKCA 1WX7A 2MJ3A 2K8CA 5AUIA 2PW9A 3V62A 4WURA 2RR9A 3BK2A 2KFJA 3QCAA 4LNNA 2UU7A 2FNJB 1S1QB 3PPAA 4CHKA 5AZHA 2NMQA 4QAYA 5HG2A 4A3OA 1E7VA 2K25A 3A33B 2J52A 3HRDD 1F9JA 4XWTA 4BBNC 4RM9A 3RZFA 2LMCA 2KOXA 2QIEB 4FULA 4LNKA 4TQ1A 1I4QA 3RD2A 3CWIA 3LXFA 1ZXIA 1E8WA 4K7UA 3DPDA 4XC2A 1B1ZA 2E3TA 1IBXB 3V05A 2PLPA 5CTRC 3Q8FA 2BW2A 4W9FA 1FNUA 2C5LC 4ANWA 4N58A 3P42A 1TKYA 1M4VA 3SR6A 4XYCA 3BYYB 1R4MB 3APDA 2Z0EB 1ET6A 2LVQA 4C4VA 4PS3A 2GOWA 2OHFA 1JRPA 1WWTA 4LDTB 2KNBA 4LNFA 2MBOA 4K3CA 3UIPB 3DVGX 3AE5B 1G6JA 3NZUA 5HI1A 4OVZA 1QF6A 3JSVB 4OZCA 3Q2AC 2WXKA 1C3TA 1TZ1A 2FUHB 4GDLB 2AX5A 3W9CB 2Z59B 2N7JA 3PV1A 3CF6E 1EO6A 1BMLC 4HEA1 2IJ0A 3EECA 2R61A 1NDDA 4RNAA 3A1QB 4BZAA 4MT5A 2K6DB 1PGXA 2HE7A 2CU1A 4HCNB 2NBVB 3NVYA 1HE8A 3VAWA 5EE9A 2XN9C 1GC6A 2C9WB 2C7MB 3PO0A 2KANA 3M62B 4P1BC 4WWOA 1YD8U 2LRWA 3OJ4B 4FADA 2L0FA 4B9KA 4KZ0A 3PZ7A 2ZJDA 4C80A 4A90A 2INPE 2IO0B 2GBMA 1P7EA 3HM3A 2D3CA 4L2YA 2K39A 2NPTA 5GMVA 2BYFA 2N9EB 4RH6A 3N9YC 4ZOHC 1T3QA 3BZDB 2AWTA 3QK0A 1JWUD 1MFWA 2BYTA 1BT0A 1RFKA 2D5GA 4W9JA 2NTSA 3UQBA 3ECIA 2MSED 3QQ8B 4BAXA 3IFWB 1C77A 2GBRA 1FO4A 3NS1A 4ANVA 1JRUA 1A5RA 4M0WA 1WXSA 1C4CA 3ZVVA 4MJSB 2L0TA 5LXHA 3R66C 1AW7A 3AECB 1R7SA 1QILA 4G0NB 4WJOA 3NVWA 2NVUI 1A70A 2X38A 3HHMA 1VD2A 2LGXA 4AJWA 5HKHA 3RN9C 2WXJA 3ZIMA 4EZJA 4WAFA 2BF8B 2MA9B 4BKSA 2DWQA 3KYDD 2K1FA 1TIFA 4E74A 4MGKE 2W3SA 1YJJA 2OJRA 3NHEB 3QHTA 2LZ6A 1LQBA 3PHWB 1KJTA 2WNMA 1CMXB 4IWOA 4ZHPA 4KIKA 3AEGB 1ZXHA 2JYEA 3O13A 2KLCA 4YSZB 1WM2A 1WR6E 2DZKA 5KHOA 4DHJB 4MGYE 1NVID 1WIAA 3Q14C 2R2QA 4LJOB 3RULA 2BS2B 4D2KA 1V80A 3SHQA 3ZTCA 1OGWA 4MEMA 1R4NI 2LEKA 3PGEA 1JW9D 3SU8X 1GJZA 2SEBD 2KTRA 2WXIA 1WM3A 4AWJA 4JIOU 2WXQA 4I6PA 4ZRIA 3PSEB 2I2YA 1UF0A 3H7SA 1HA5A 4X57B 2WYQA 2YEPB 3E56A 5DCNA 4C7ZA 1K51A 4E71A 3B9JA 1MPEA 3W5UB 2KO3A 2L32A 1N60A 4W9CA 2AQ3B 4GSWA 3AV8A 1F0ZA 2QEJC 3V60A 3NRZA 3DOWA 1UUPA 2D10A 4W9KA 5T8IA 4B0EA 2EELA 4JWSC 3BVMA 1JALA 2WXHA 2O6VA 2KFKB 3MC9A 2KD0A 1MI0A 5H92C 5BO4B 3ZJTA 1WY8A 4YSYB 5D3IB 3KYCD 3MP9A 5AEKB 1IUEA 1WYGA 1GG3A 2MJDA 2WXOA 4ZRQA 1P7FA 2MCNB 1YMHE 2GMIC 1IPGA 4WQOB 3H7PB 5IOIA 1ZGUB 4WJPA 1QLBB 4NZLB 4K7WA 4MELA 4M8MA 4DXGA 1L6VA 1OQYA 3Q8EA 3KUZA 1XLPA 1D4BA 3R7QA 4ZRKA 4BFRA 3U7DA 4BBNF 1M94A 1UD7A 3ZJVA 1RFAA 1LFDA 2BYVE 2J0KA 1WGHA 3AXCA 3B08A 2Z0DB 4FXCA 3VHTC 2RDBC 4HCPB 4BVUC 2W9NA 2GBJA 3KVFB 3CIRB 2YVCA 2JPHA 1YN5A 5IO9A 1GUAB 3B2FA 3DHIC 4MH0E 3WALA 2Q5WD 2IY0B 2CU3A 4FLHA 1E10A 4AP4C 3EGRA 2BS3B 4EFOA 1E0ZA 4F7ZA 3GZNI 3L17A 2L05A 1NEKB 2LRUA 2FCQA 1J8CA 2ONQA 1C4PA 3TMPB 4WWPA 4WIPA 4K3BA 2RDGA 1WH3A 2WGSA 3A9KB 1I42A 5AUKA 3FKYA 2JWZA 1NENB 3ZW3A 3ML8A 3NY5A 2MH7A 5IKCM 2EKIA 3I3TB 1VCBA 2WWZA 2GBNA 5L95C 1F1HA 2ASQA 5TSSA 3WAPA 2OEDA 1QKZA 2PTLA 1QOFA 2FUG1 1Q10A 1XQQA 4IM2A 4CO7A 1WMHA 3MC8A 2WQYB 3V6CB 2D11A 1FNVA 4GDKA 2WLBA 2L1AA 2CR5A 2HD5B 2VZKD 1VRAB 2CHXA 3KUCB 2FIFA 1DOIA 4KKJA 3NVVA 3ZO5B 2J0JA 2D3AA 3RPFC 5JH5C 1VLBA 4NJCA 2DNFA 3QIJA 5D3DA 3NZSA 1NI2A 5DPSA 2PE9A 1C78A 2ACZB 2NCNA 1N5WA 4XWWA 2REXA 3NZ3A 3SDLC 2M4NA 1XEEA 2KMMA 2WXFA 2KWCA 3AE1B 3AU4A 4GOCA 3URYA 2L52A 1GNUA 2HJ1A 1WZ3A 4KKIA 1EWYC 3H6NA 4B6WA 2IO2B 2A5UA 5D6JB 2LXCA 4G3XB 3VR8B 3AMZA 2NBUA 2Y3AA 3SFDB 3OWEB 4HKZE 1JCKB 3I57A 2KAJA 2J7QB 3HIZA 3TEYA 2WDRB 2HDEA 3IT6B 4ANUA 1PGBA 1L0YB 2FAZA 4BKSD 5IP4D 3EHVA 5C3JB 2GRIA 2ZNVB 4DXAB 2QHOA 4NQLB 1PFDA 3L54A 3Q3MC 1QOAA 3H8HA 1EF1A 2MLBA 5JHBA 1AWDA 2GI9A 1TKEA 2LVPA 4MJSA 1E8ZA 2DYOA 2INNE 4AOFA 1WFYA 2L3ZA 3RMKC 2XNAC 1I4PA 3SEBA 2ON8A 4KVGB 4DQOC 4BKTA 1T0QC 1SE9A 3U30A 4WWMA 1J0GA 4G11A 4PS7A 2KN5A 2IO3B 3QARA 5H8YE 1WGYA 3GS2A 1PGAA 1QOGA 3AI5A 3IXSA 3ALBA 2PIAA 2ZVOA 2BVCA 2Y5CA 2DYMA 2K22A 1KFYB 1SBBB 5BMIA 3WIMA 1XT9B 1D5ZC 3JW0X 3WAOA 1QOBA 3Q3FA 2L76A 3ENEA 1CK1A 3TCAA 1YJIA 2DZMA 2EKEC 3AN1A 4DHZE 3Q8BA 3U8ZA 1K8RB 4R3DA 1FRRA 3DHGC 2FIDA 2MW5A 1TS5A 2XK5B 4C7YA 2WU5B 1JROA 2QJLA 4US8A 2KC2A 3ZNZB 2M19A 2RPQA 3ZXVA 3R8BA 1SJED 2LJIA 5TR5A 3RUIB 2K5PA 1BUIC 3RNBC 1D6EC 1ZE3D 2FCNA 1X1MA 1ESFA 1UH6A 5KHQA 1JWAD 4HROA 3ZQ4A 4RFBA 1MJDA 4ZYNA 1KLGD 3ZDTA 4CQNA 1UNSA 2WXMA 3R2TA 4K7SA 3BY4B 1J7BA 1KM7A 1XO3A 2MBBB 2QC8A 3W1SA 3B1LX 1EWCA 1D5MC 5IA7A 3KWVA 3V3XA 2OOBB 3DDCB 2KLGA 4GB9A 1YOVB 5J18A 3H7PA 2KDMA 3N32A 4P1CC 1VDVA 2KQ4X 4EEWA 3MTNB 3W2DA 4YL8A 1E7UA 3IAS1 4TQ0A 2JWUA 2JF5A 3X23A 3AEFB 2WHIA 3R2IA 1ACCA 1AARA 4LNOA 1WJNA 3LJ3A 4KGTA 4W9HA 3W1SC 4AJYB 4AQ7A 4ASWC 2VH2A 4IM0A 3NVZA 3CSTA 3A9JB 1NYQA 3MJ5A 2BGFA 4B95A 4K1RB 5J17A 4JWUC 1L6UA 1UGMA 2WXRA 4DDID 4IWPA 2LFIA 2CJOA 2KMAA 4IM3A 2JXTA 1WR1A 1YIWA 4HPMB 2QSDA 4ICUA 4KGRA 4ZRJA 4HRSA 3VR9B 1TZOA 3C19A 4B0MA 3RI7C 1GB1A 3RFZB 1RYJA 2PVGC 3LYYA 3RNAC 3IBEA 2LHDA 4N9F4 3ZYYX 2ZZPB 2BTEA 2JY6A 4GN1A 2O2VB 5C23A 5E6NA 1E9MA 2K3UA 3AE8B 2I38A 4HXDA 1HTOA 3SFEB 4HPPA 2AEHA 1N6ZA 3TUOA 3KUDB 2CHZA 4LTUA 2D2QA 1EU3A 2I1KA 1FXTB 5EDSA 3DCGA 1YQ3B 1Y8RC 3E9SA 2JUOA 1V49A 1JQ4A 1GB4A 2MP2B 2RSUA 3DWGC 3DVGY 4XGAB 1Z2MA 2C60A 3VQIA 2JU6X 3GE3C 3S2AA 3A9KA 1HEZE 2BS4B 1TGZB 3NOBA 1YNTE 2WXGA 3DBLB 4MDKE 3AEDB 4LJPB 3KW5B 3ZRCA 3APCA 1ENFA 3N3KB 4HPLB 4C56C 4HVBA 2N9LA 4HKQA 4WH4A 3U7ZA 1SSNA 2XEWA 3P63A 3PLVA 1JWMD 4TV3A 1DOYA 1FNWA 2KZRA 2K9XA 5FR6A 5FK9C 2G1EA 2JT4B 3O65B 3VFKA 1K52A 1V1OA 1Q5WB 1V86A 1E5WA 1C76A 1R4NB 4N6EB 1LXDA 1HTQA 2IGDA 2FE8A 2ZW1A 3EFCA 3FC4A 2ZCCA 3T3OA 1KLVA 3SD5A 2MEKA 3WCQA 1WE6A 4A6QA 4H2AA 1P0RA 3BINA 4HDOA 5L83A 3H9DA 4JQWC 1SE2A 4BKGA 1ZW7A 2KWVB 4M02A 2LGDA 4USAA 2LGYA 4C4VB 2PJHA 3DBHB 2L83A 4JLCA 3Q69A 2M17A 2KWUB 5CHVC 3TEXA 4XZ4A 4IG7B 1KH0A 1J7CA 2EMSA 3QX1A 2GLSA 2KWDA 3ZNID 4A9AA 5G5GA 2KVRA 5EE0A 2V3PA 5IN7A 2JVCA 3I63C 1EM7A 4KSKC 4MGZE 4ZHOA 4HWIB 3WA0A 4FJYA 2FBWB 3U52E 2H88B 3TL5A 2MWSB 1LO5D 4HJKA 2CJNA 3VUXA 1ZKHA 3MFGA 1J7AA 1V1PB 4FHJA 1NBFC 3IAM1 3PVLA 3ZNGC 3ML9A 1I4XA 2LVOA 2MQJA 2KDEB 2JZPA 2BWFA 3ZNHB 2V1YA 1EF5A 2MBEA 3N20C 2VZKB 2WS3B 3UGBB 1F77A 1OEYJ 2QILA 2JZZA 2R2OA 2NPTB 1V9JA 2KVZA 2L00B 2WX0A 2QDFA 3EA6A 2ZNVC 4JE3B 4OVVA 4ARIA 2LXAA 1FRDA 2WXLA 2WDTB 1PDXA 1XLOA 3Q8AA 4P6VF 1TY2A 3VTUA 1XXGA 3GZNB 1LGRA 1V6EA 2KJRA 4DK5A 4YTPB 4M0WB 3C0RB 1TS4A 4WAAA 1VZ7A 3K9OB 1I4GA 2KJ6A 3OLMD 4XDCA 3N1YC 4PK1A 2WX1A 3WANA 4LCDE 2MBHA 1IBXA 3Q3JA 3L10B 4MH8A 3UQAA 3VDZA 2N1VA 2M56B 5CHFA 3DBRB 5GXGB 4JX1C 1D3ZA 1ZP0B 3JVZX 2YEPF 2XK5A 1XD3B 1RRBA 1UZXB 2AL3A 2V4IB 1WGGA 4W9LA 2W55A 2M8SA 3K9PB 4WJQA 1V5OA 4YWGG 3RNFC 4NAMA 3KQ4A 3PREA 3PRMB 2BKFA 3MHZA 1XLNA 1SEBD 3ZKJC 2ZEQA 2KT7A 1PQSA 3AE9B 2X8XX 3QC8B 5AZGA 3ZXRA 2Y5PA 4OZAA 1WE7A 3IT4B 3JSVA 2KQSA 1XLQA 4DDGD 3AEEB 2KDBA 3A4SC 3AULA 2BPSA 4RGMA 2G4SA 2D3BA 1VZ8A 4MSMB 1TY0A 3NG0A 2LGIA 4GDLA 5HFYA 3DVNU 3U4EG 1MVKA 3M3JA 4M00A 3W5VB 1IP9A 4KSLC 3KH0A 4NAWB 1SXTA 2ZCBA 4NJ7A 2KTRB 4MSQB 2CHWA 2DX5B 3RNEC 4YTMB 1WXVA 1E8XA 1ZDXA 3A4RA 4US9A 3A1QA 2JQRB 1XCQL 4KDLB 2HTHA 1RLFA 2NTTA 4HJGE 1YX5B 1GC7A 3VRAB 5J2RA 2JYTA 3L08A 1TTNA 4DBGA 1LM8B 1TYGB 2KYWA 2N4FA 1FCLA 1YJ1A 3ZRFA 2Z8LA 2ZPNA 4RGOS 2N9PC 1Q0WB 4RM8A 1F52A 1L4ZB 2DZIA 4FN2A 2M0XA 1V97A 1N62A 1J19A 1V2YA 5FR3A 2BBCA 2KDIA 3EFUA 3UI3A 4RF1A 1N5XA 3TIXA 1B9RA 3N30A 3RYTA 2ZW0A 5BMGA 1KF6B 2RMMA 4FA6A 5E6PA 2G45B 1Z5SB 2J53A 1E6EB 1C4AA 2WXNA 2DYBA 1I4RA 2LJ5A 4DXFA 4ZDVA 1OTRB 4M8NA 2SAKA 1VJKA 4I6LB 1UBQA 3BVGA 1FEHA 2V3NA 3VH3B 2K0PA 3PRPB 1SJHD 4ACFA 2WDQB 1SF0A 2PPHA 5BMHA 2O2VA 1L0XB 2LUMA 3TEWA 2J4XA 4FHKA 4F1SA 4MM3B 3NJTA 4C00A 1QQRA 1U4AA 3APFA 1N61A 4UDUC 3VRBB 2MP2A 4PYZA 4ICVA 3VXWA 1DYQA 1CZPA 1WF9A 2A4ZA 3B0AA 4HLEA 1DGJA 1BXTA 3EUB2 5BYRA 4GLSC 4A55A 3AH7A 4KGSA 5G2NA 5AZFA 1EU4A 3Q3OC 4A20A 5JZEB 4ARCA 1OFFA 2LUEA 3BVZA 1UWXA 2ICIA 3ZJUA 2BT6A 2BB5A 3AE3B 3W1YA 4OW0A 2KMCA 4IWQA 1T0SC 1ZDVA 1K50A 3FILB 2O6VD 5D7GA 4JPSA 1OQRA 4TUUA 3Q3NC 3PRZA 5CX3A 2G4DB 3RCZA 1TS2A 1E7PB 2V4LA 1GOZA 1WZ0A 3P4SB 5BYSA 4HK2A 1JMLA 3RZWC 3TBLD 5JXVA 3AEAB 1XCTL 4JGHB 2CKHB 1P9DU 1WRDB 1OEYA 4A8XC 5D94A 2J0MA 1C9FA 1R4MI 1N63A 1AYFA 1C1YB 1KRHA 2N7DA 4K81A 2D07B 3N1ZC 1MHHE 3PTFC 4YTNB 1IYFA 1L7YA 4OZBA 2HTME 2CS4A 3IHPC 1WMHB 1SE4A 1L4DB 3LDZE 4GDKB 2KFKA 3P4PB 5FKAC 1FMAD 1WJUA 2K6QA 2B3AA 1FXAA 1WGRA 2LGSA 4IOIE 4J3OD 1SIFA 3DHHC 2IY1B 3AM9A 3JYUA 2TSSA 4GMVA 2ZPYA 2MRPA 2DZJA 1WX8A 4TMAB 3I5JC 5EE1A 1SB3C 3N1XC 4MACA 5BYQA 3DBSA 5CHWA 1MG4A 1I7HA 2KJHB 4AS1A 3KWLA 4PT5A 1EUVB 1K53A 2RD0A 3IG3A 1V1PA 2E6XA 2N9KA 1UWMA 1NYRA 1JWBD 2I1JA 3ETRA 4RGNA 2IDYA 3FAHA 1SGHA 3VUWA 3HM6X 4EOYA 2JZ3B 4M01A 1SE3A 1YQBA 2KN4A 1TBEA 2W54A 3ONSA 5G55A 2JRHA 4RCOA 3OJ3A 3QJZA 3Q6BA 2BYEA 2BKRB 2IPKD 2N9XA 2JXXA 4NPNA 3VH4B 1T0YA 3BYTB 2INCC 4II2B 1P3QU 3VVWB 4OVUA 4PS8A 2Y5BB 4W9GA 4W9IA 1RM6C 4HDQA 2KXJA 4IC7B 1L0VB 4NQKE 2GBKA 1FFUA 2D3GA 2FCSA 1WGKA 4RF0A 3HK0A 2PEAA 4LDTD 3GOEA 4E3CA 4XE0A 3T3NA 2WP9B 4KV2A 2KHWB 5D2MB 1V5TA 5MPOA 2JX5A 3AE6B 4F8CB 1YN3A 4TKNA 3J9CA 3H1UA 1KLUD 1NI3A 1MHXA 1UBIA 1T0RC 1L2NA 1FXIA 1VZ6A 3DBLI 4LK0M 3CMMB 5E6OA 1ISNA 2KTFA 4IUMB 4L1BA 3VUYA 4Q2JA 2HJ8A 1ZPSA 1TJEA 1YN4A 2INDC 3C8YA 4EUTA 4P16A 5C2TB 1P98A 3T9LA 1TT5B 4EZKA 4W9EA 1FD6A 1YX6B 4GIVA 2J42A 1ET9A 2PE6B 2RPVA 2QCZA 2B76B 4EZLA 2K8HA 1HZ5A 1MG8A 4OHJA 1L5PA 4TSSA 2IZVB 3V61A 4NAWA 1UELA 3QWZB 1WGDA 2YLMA 3V6EB 2XBBC 3P4QB 2G9HD 2KACA 2DLBA 2N1WA 1HZ6A 2MHJA 5LLIA 3QA8A 3UF8A 1F2RC 3R7RA 4KZCA 5DPWA 3L13A 3M63B 3IVFA 1S3SG 4URKA 3P1MA 1WXAA 2KK8A 4YXDB 4A3PA 3LB8C 3D32A 2V0GA 1FCCC 3DBHI 3PT2B 3OG5A 3U2SC 1H4RA 4ITKA 4P7IA 2WXPA 1E8YA 2KC1A 4BOSC 4G50A 1WJ4A 3OAWA 4NJ6A 5E6JA 2RDHA 2C7HA 2K8BA 3KLSX 3B2GA 1FIQA 2QMTA 1Q1OA 2BB6A 2PKOA 3PS6A 3R3MA 1WSPA 5JHAA 1KOTA 1UGJA 1TS3A 1WXQA 3RNGC 1H8CA 2LHEA 3RNCC 1I4HA 4RMAA 4IW0A 2IGGA 4NY0A 4WWNA 2FCMA 1YQ4B 2W82A 1KTKA 3TSSA 5IAAC 3VTVA 1ZUD2 1TKGA 4S17A 4YSXB 2PVOD 2PMVA 1VR9A 4DHJD 3EC8A 4MM3A 3BK1A 1AN8A 2LD9A 2MBQA 2N0SB 2GB1A 1GAQB 4J6IA 4KX6B 3DWMA 4FJVB 4ZYSA 3UINB 2AYOB 4FBJB 4XX5A 3RT3B 2V3SA 2LI5A 1SIJA 2M0AA 5DPTA 2WDVB 4ZRPA 3NS8A 2LWPA 4IKGA 3MC0B 1C79A
chains in the Genus database with same CATH topology
2OOBB 3VH3B 1RAXA 1V80A 3DDCB 3SHQA 3ZTCA 1OGWA 4MEMA 1R4NI 3PGEA 3PRPB 3SU8X 4PYUA 1GJZA 2KTRA 4II3B 1WM3A 2KLGA 4AWJA 4JIOU 4GB9A 2PPHA 2RGFA 2UWQA 4I6PA 4ZRIA 2IYDB 3H7PA 2O2VA 3N32A 1E90A 3PSEB 4AUQC 5J18A 1WYWB 4EEWA 3MTNB 3DQVA 4YL8A 1E7UA 1P1AA 3H7SA 4TQ0A 4X57B 4FHKA 2JF5A 3X23A 2WYQA 5DCNA 4F1SA 1AARA 2C7NB 1WJNA 3LJ3A 4W9HA 3W1SC 4AJYB 4GXBA 4I6NB 4BOZB 4E71A 4MGIE 1U4AA 4ASWC 3AU5A 3CSFA 2KO3A 4IM0A 3APFA 3DBRI 4W9CA 3CSTA 3PHXB 4GSWA 3A9JB 2MP2A 4PYZA 2BGFA 4B95A 4ICVA 3V60A 3VXWA 3X0WA 4K1RB 3DOWA 5J17A 3DVNV 1WF9A 2A4ZA 3B0AA 2D10A 4HLEA 1UGMA 4DDID 4W9KA 4IWPA 2AL6A 2KMAA 3PLUA 4IM3A 4KIKB 1WR1A 2KX3A 1YIWA 2ZVNA 5G2NA 5AZFA 2L7RA 4HPMB 1WX9A 2O6VA 4ICUA 2KFKB 4ZRJA 4A20A 5JZEB 2KD0A 3L0WB 4KDIC 5BO4B 1WY8A 2DENB 2LUEA 3KYCD 5AEKB 4GU2A 3L16A 2NR2A 2JRIB 1GG3A 1V81A 2MCNB 3W1YA 3M95A 2LASA 3IBEA 4N9F4 2NBWB 1I35A 2GMIC 2ZZPB 1IPGA 2JY6A 2KMCA 4GN1A 4IWQA 4WQOB 3H7PB 2O2VB 5C23A 5E6NA 1ZGUB 4WJPA 2O6VD 5D7GA 4K7WA 4HXDA 2DHZA 2AEHA 4ANXA 4TUUA 3KUDB 4MELA 2IBIB 3PRZA 4M8MA 2G4DB 5CX3A 3RCZA 1OQYA 2CHZA 4FJZA 2M1MA 2V4LA 4WJNA 1WZ0A 3KUZA 5C1ZA 2D2QA 2I1KA 1FXTB 5EDSA 3DCGA 4HK2A 4CYEA 1WJ6A 4EKUA 3R7QA 1Y8RC 3RZWC 2JUOA 3TBLD 1V49A 4ZRKA 1QZEA 4BFRA 2MP2B 3U7DA 2RSUA 3DVGY 4JGHB 1Z2MA 2CKHB 2C60A 1P9DU 2VRRB 3MJWA 3VQIA 3S2AA 1WRDB 3A9KA 4BBNF 1OEYA 1M94A 3ZUNA 1UD7A 1RFAA 1WI0A 1LFDA 1TGZB 2BYVE 2KQ7A 3NOBA 2J0KA 1WGHA 3AXCA 2J0MA 4MDKE 5D94A 4JL9A 3B08A 4LJPB 1R4MI 2Z0DB 4NNJB 3VTWA 3KW5B 3VHTC 1C1YB 2O6VB 2N7DA 3A9JA 3ZRCA 3APCA 2IO1B 2D07B 4HCPB 4K81A 3N3KB 4BVUC 2W9NA 2GBJA 3KVFB 4HPLB 4DHZB 3PTFC 4HVBA 4GGQA 2YVCA 2JPHA 1IYFA 1L7YA 1WXMA 4DWFA 5LXIB 2CS4A 3T8MA 1GUAB 3IHPC 1WMHB 4MH0E 2L8JA 2XEWA 3PLVA 3TJPA 3LDZE 4GDKB 4TV3A 3WALA 2IY0B 2UYZB 2G3QB 2KFKA 2KZRA 5FR6A 1WJUA 2K6QA 2B3AA 3ZLZA 1WGRA 5DPRA 3UIOB 3ZTDA 3PZDA 2N7EA 2JT4B 3O65B 2NS5A 4FLHA 3VFKA 4AP4C 2KDFB 1Q5WB 1SIFA 1V86A 3ZDMC 4EFOA 2IY1B 3MHSD 1E5WA 1LXDA 3JYUA 4F7ZA 3GZNI 3L17A 4GMVA 2EMTA 2L05A 2LRUA 2ZCCA 2ZPYA 2FCQA 1J8CA 2MRPA 2DZJA 1WX8A 1KLVA 3SD5A 3TMPB 4WWPA 2BWES 3DBSA 5CHWA 1WH3A 2KJHB 3A9KB 1I42A 1WE6A 2JWZA 1P0RA 3BINA 2DAFA 1EUVB 4HDOA 5L83A 3H9DA 4W9DA 3ZW3A 3ML8A 2RD0A 2MX2A 3IG3A 4JQWC 4BKGA 3NY5A 3WAMA 1ZW7A 2I1JA 2KX0A 2KWVB 3QAQA 2DAJA 3I3TB 2LGDA 1VCBA 2WWZA 2LGYA 1SGHA 2GBNA 3VUWA 2PJHA 3P2BA 2ASQA 5L95C 3HM6X 4EOYA 2JZ3B 2KKCA 4JLCA 1WX7A 3WAPA 2K8CA 1YQBA 2M17A 2KWUB 5CHVC 1TBEA 3V62A 3ONSA 2RR9A 2KFJA 5G55A 2JRHA 3QCAA 4XZ4A 2FNJB 1S1QB 3PPAA 3OJ3A 4CHKA 5AZHA 3QJZA 4IG7B 2EMSA 4A3OA 2BYEA 1E7VA 3QX1A 2BKRB 1XQQA 2K25A 3A33B 3ZNID 4IM2A 2N9XA 4CO7A 1WMHA 2JXXA 3V6CB 2D11A 1F9JA 4NPNA 3VH4B 4GDKA 1T0YA 2KVRA 4BBNC 4RM9A 3RZFA 2JVCA 2CR5A 4II2B 4KSKC 1P3QU 4MGZE 3VVWB 2HD5B 2KOXA 4FULA 4HWIB 4PS8A 4OVUA 4TQ1A 3RD2A 2Y5BB 4W9GA 2CHXA 3WA0A 4W9IA 4FJYA 4HDQA 1E8WA 3KUCB 4K7UA 2KXJA 4IC7B 3TL5A 2MWSB 2FIFA 3DPDA 4HJKA 4XC2A 4NQKE 2GBKA 2D3GA 2FCSA 3VUXA 1ZKHA 2J0JA 3ZO5B 5JH5C 3HK0A 2PEAA 4LDTD 5CTRC 4FHJA 3GOEA 3QIJA 4W9FA 4E3CA 1NBFC 3NZSA 1NI2A 3PVLA 2C5LC 5DPSA 2PE9A 3ZNGC 3ML9A 2NCNA 4ANWA 2LVOA 2MQJA 2KDEB 4KV2A 2KHWB 2REXA 5D2MB 1V5TA 3SDLC 2BWFA 2M4NA 3ZNHB 2KWCA 4F8CB 2V1YA 4TKNA 1EF5A 2MBEA 3UGBB 3AU4A 3APDA 3H1UA 4GOCA 1OEYJ 2Z0EB 2JZZA 2R2OA 2NPTB 1GNUA 1V9JA 1UBIA 2LVQA 1L2NA 4PS3A 2GOWA 2L00B 2WX0A 1WZ3A 3DBLI 4LDTB 3CMMB 2KNBA 3H6NA 4B6WA 2MBOA 2IO2B 2ZNVC 5E6OA 3DVGX 3UIPB 1ISNA 2A5UA 2KTFA 3NZUA 4IUMB 1G6JA 4OVVA 5D6JB 3JSVB 3VUYA 2LXCA 4G3XB 2LXAA 2NBUA 1C3TA 2HJ8A 1TZ1A 2WDTB 4EUTA 1P98A 2FUHB 3T9LA 4GDLB 4EZKA 4W9EA 2Z59B 3VTUA 1YX6B 2J7QB 3HIZA 3PV1A 4GIVA 3CF6E 1EO6A 4ANUA 2PE6B 1V6EA 3EECA 2KJRA 4DK5A 1NDDA 4M0WB 4EZLA 3C0RB 2K8HA 4WAAA 2FAZA 3A1QB 1MG8A 3K9OB 4BKSD 3EHVA 4DXAB 2KJ6A 2ZNVB 2K6DB 3OLMD 2IZVB 2QHOA 2WX1A 4NQLB 2HE7A 2CU1A 4HCNB 2NBVB 2MBHA 4LCDE 4NAWA 1UELA 3V61A 3L54A 1HE8A 3Q3JA 1WGDA 2YLMA 3QWZB 3VAWA 3V6EB 2XBBC 3L10B 3UQAA 1GC6A 3VDZA 2C9WB 2N1WA 2N1VA 1EF1A 2C7MB 2MLBA 5JHBA 5LLIA 2KANA 3M62B 5CHFA 3QA8A 3UF8A 2LVPA 4MJSA 1D3ZA 1E8ZA 4WWOA 2DYOA 2LRWA 1YD8U 3JVZX 4KZCA 3R7RA 1WFYA 2L3ZA 2XK5A 3OJ4B 4AOFA 5DPWA 3L13A 1XD3B 1RRBA 1UZXB 2AL3A 3M63B 4FADA 2L0FA 4KVGB 4B9KA 1WGGA 1S3SG 3IVFA 4BKTA 1SE9A 4W9LA 4URKA 3U30A 2M8SA 3K9PB 4KZ0A 2ZJDA 4WJQA 1J0GA 1V5OA 4G11A 1WXAA 2IO0B 2GBMA 2KK8A 3HM3A 4PS7A 2KN5A 2IO3B 2K39A 3QARA 2NPTA 3PREA 5GMVA 1WGYA 2BYFA 2N9EB 3PRMB 4A3PA 2BKFA 3D32A 3AI5A 3ALBA 3DBHI 3PT2B 2ZVOA 2AWTA 3QK0A 2ZEQA 3ZKJC 1PQSA 2DYMA 3QC8B 1H4RA 5AZGA 1BT0A 4P7IA 1WE7A 3WANA 3JSVA 1E8YA 4W9JA 2KQSA 4DDGD 3UQBA 2KC1A 2KDBA 3A4SC 4BOSC 4G50A 1WJ4A 3AULA 3OAWA 4NJ6A 2BPSA 1XT9B 3WIMA 3ECIA 2MSED 2G4SA 3QQ8B 3IFWB 4MSMB 2C7HA 4GDLA 3DVNU 2K8BA 3JW0X 3M3JA 2GBRA 3WAOA 3Q3FA 1IP9A 4KSLC 4ANVA 3KH0A 4NAWB 2ZCBA 2L76A 4NJ7A 2KTRB 4MSQB 1Q1OA 2CHWA 3ENEA 2DX5B 3PS6A 1JRUA 1E8XA 1WXVA 3A4RA 3R3MA 3TCAA 1A5RA 2DZMA 5JHAA 2EKEC 3A1QA 1KOTA 4KDLB 4DHZE 2HTHA 1RLFA 1WXSA 3U8ZA 1K8RB 1H8CA 3ZVVA 1YX5B 1GC7A 4MJSB 2FIDA 2MW5A 2L0TA 5J2RA 2XK5B 4RMAA 5LXHA 3L08A 1TTNA 3R66C 4DBGA 4IW0A 1LM8B 4NY0A 4WWNA 2N4FA 2FCMA 1YJ1A 3ZRFA 2ZPNA 4G0NB 4WJOA 5IAAC 3VTVA 2N9PC 2KC2A 1Q0WB 2NVUI 3ZNZB 4RM8A 3HHMA 1VD2A 2LGXA 2DZIA 4DHJD 4FN2A 2RPQA 2M0XA 4AJWA 3EC8A 5HKHA 4MM3A 3ZIMA 1J19A 2LD9A 2MBQA 4EZJA 1V2YA 5TR5A 2KDIA 3EFUA 2BF8B 2MA9B 3RUIB 4BKSA 3TIXA 4J6IA 3N30A 3RYTA 2FCNA 4FJVB 1X1MA 3UINB 4FA6A 1UH6A 5E6PA 3KYDD 2G45B 2K1FA 5KHQA 4E74A 1Z5SB 2AYOB 4MGKE 4FBJB 4XX5A 3RT3B 4ZYNA 2OJRA 2V3SA 3NHEB 2LI5A 2DYBA 2LJ5A 1LQBA 2LZ6A 3PHWB 3QHTA 3ZDTA 1KJTA 1CMXB 4IWOA 4ZDVA 1OTRB 4KIKA 4M8NA 5DPTA 2KLCA 1WM2A 1WR6E 3NS8A 3BY4B 4K7SA 2DZKA 5KHOA 4DHJB 1KM7A 4I6LB 1UBQA 4MGYE 2MBBB 2LWPA 3W1SA 1WIAA 3B1LX 2R2QA 4LJOB 3RULA 5IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOB B;  3VH3 B;  1RAX A;  1V80 A;  3DDC B;  3SHQ A;  3ZTC A;  1OGW A;  4MEM A;  1R4N I;  3PGE A;  3PRP B;  3SU8 X;  4PYU A;  1GJZ A;  2KTR A;  4II3 B;  1WM3 A;  2KLG A;  4AWJ A;  4JIO U;  4GB9 A;  2PPH A;  2RGF A;  2UWQ A;  4I6P A;  4ZRI A;  2IYD B;  3H7P A;  2O2V A;  3N32 A;  1E90 A;  3PSE B;  4AUQ C;  5J18 A;  1WYW B;  4EEW A;  3MTN B;  3DQV A;  4YL8 A;  1E7U A;  1P1A A;  3H7S A;  4TQ0 A;  4X57 B;  4FHK A;  2JF5 A;  3X23 A;  2WYQ A;  5DCN A;  4F1S A;  1AAR A;  2C7N B;  1WJN A;  3LJ3 A;  4W9H A;  3W1S C;  4AJY B;  4GXB A;  4I6N B;  4BOZ B;  4E71 A;  4MGI E;  1U4A A;  4ASW C;  3AU5 A;  3CSF A;  2KO3 A;  4IM0 A;  3APF A;  3DBR I;  4W9C A;  3CST A;  3PHX B;  4GSW A;  3A9J B;  2MP2 A;  4PYZ A;  2BGF A;  4B95 A;  4ICV A;  3V60 A;  3VXW A;  3X0W A;  4K1R B;  3DOW A;  5J17 A;  3DVN V;  1WF9 A;  2A4Z A;  3B0A A;  2D10 A;  4HLE A;  1UGM A;  4DDI D;  4W9K A;  4IWP A;  2AL6 A;  2KMA A;  3PLU A;  4IM3 A;  4KIK B;  1WR1 A;  2KX3 A;  1YIW A;  2ZVN A;  5G2N A;  5AZF A;  2L7R A;  4HPM B;  1WX9 A;  2O6V A;  4ICU A;  2KFK B;  4ZRJ A;  4A20 A;  5JZE B;  2KD0 A;  3L0W B;  4KDI C;  5BO4 B;  1WY8 A;  2DEN B;  2LUE A;  3KYC D;  5AEK B;  4GU2 A;  3L16 A;  2NR2 A;  2JRI B;  1GG3 A;  1V81 A;  2MCN B;  3W1Y A;  3M95 A;  2LAS A;  3IBE A;  4N9F 4;  2NBW B;  1I35 A;  2GMI C;  2ZZP B;  1IPG A;  2JY6 A;  2KMC A;  4GN1 A;  4IWQ A;  4WQO B;  3H7P B;  2O2V B;  5C23 A;  5E6N A;  1ZGU B;  4WJP A;  2O6V D;  5D7G A;  4K7W A;  4HXD A;  2DHZ A;  2AEH A;  4ANX A;  4TUU A;  3KUD B;  4MEL A;  2IBI B;  3PRZ A;  4M8M A;  2G4D B;  5CX3 A;  3RCZ A;  1OQY A;  2CHZ A;  4FJZ A;  2M1M A;  2V4L A;  4WJN A;  1WZ0 A;  3KUZ A;  5C1Z A;  2D2Q A;  2I1K A;  1FXT B;  5EDS A;  3DCG A;  4HK2 A;  4CYE A;  1WJ6 A;  4EKU A;  3R7Q A;  1Y8R C;  3RZW C;  2JUO A;  3TBL D;  1V49 A;  4ZRK A;  1QZE A;  4BFR A;  2MP2 B;  3U7D A;  2RSU A;  3DVG Y;  4JGH B;  1Z2M A;  2CKH B;  2C60 A;  1P9D U;  2VRR B;  3MJW A;  3VQI A;  3S2A A;  1WRD B;  3A9K A;  4BBN F;  1OEY A;  1M94 A;  3ZUN A;  1UD7 A;  1RFA A;  1WI0 A;  1LFD A;  1TGZ B;  2BYV E;  2KQ7 A;  3NOB A;  2J0K A;  1WGH A;  3AXC A;  2J0M A;  4MDK E;  5D94 A;  4JL9 A;  3B08 A;  4LJP B;  1R4M I;  2Z0D B;  4NNJ B;  3VTW A;  3KW5 B;  3VHT C;  1C1Y B;  2O6V B;  2N7D A;  3A9J A;  3ZRC A;  3APC A;  2IO1 B;  2D07 B;  4HCP B;  4K81 A;  3N3K B;  4BVU C;  2W9N A;  2GBJ A;  3KVF B;  4HPL B;  4DHZ B;  3PTF C;  4HVB A;  4GGQ A;  2YVC A;  2JPH A;  1IYF A;  1L7Y A;  1WXM A;  4DWF A;  5LXI B;  2CS4 A;  3T8M A;  1GUA B;  3IHP C;  1WMH B;  4MH0 E;  2L8J A;  2XEW A;  3PLV A;  3TJP A;  3LDZ E;  4GDK B;  4TV3 A;  3WAL A;  2IY0 B;  2UYZ B;  2G3Q B;  2KFK A;  2KZR A;  5FR6 A;  1WJU A;  2K6Q A;  2B3A A;  3ZLZ A;  1WGR A;  5DPR A;  3UIO B;  3ZTD A;  3PZD A;  2N7E A;  2JT4 B;  3O65 B;  2NS5 A;  4FLH A;  3VFK A;  4AP4 C;  2KDF B;  1Q5W B;  1SIF A;  1V86 A;  3ZDM C;  4EFO A;  2IY1 B;  3MHS D;  1E5W A;  1LXD A;  3JYU A;  4F7Z A;  3GZN I;  3L17 A;  4GMV A;  2EMT A;  2L05 A;  2LRU A;  2ZCC A;  2ZPY A;  2FCQ A;  1J8C A;  2MRP A;  2DZJ A;  1WX8 A;  1KLV A;  3SD5 A;  3TMP B;  4WWP A;  2BWE S;  3DBS A;  5CHW A;  1WH3 A;  2KJH B;  3A9K B;  1I42 A;  1WE6 A;  2JWZ A;  1P0R A;  3BIN A;  2DAF A;  1EUV B;  4HDO A;  5L83 A;  3H9D A;  4W9D A;  3ZW3 A;  3ML8 A;  2RD0 A;  2MX2 A;  3IG3 A;  4JQW C;  4BKG A;  3NY5 A;  3WAM A;  1ZW7 A;  2I1J A;  2KX0 A;  2KWV B;  3QAQ A;  2DAJ A;  3I3T B;  2LGD A;  1VCB A;  2WWZ A;  2LGY A;  1SGH A;  2GBN A;  3VUW A;  2PJH A;  3P2B A;  2ASQ A;  5L95 C;  3HM6 X;  4EOY A;  2JZ3 B;  2KKC A;  4JLC A;  1WX7 A;  3WAP A;  2K8C A;  1YQB A;  2M17 A;  2KWU B;  5CHV C;  1TBE A;  3V62 A;  3ONS A;  2RR9 A;  2KFJ A;  5G55 A;  2JRH A;  3QCA A;  4XZ4 A;  2FNJ B;  1S1Q B;  3PPA A;  3OJ3 A;  4CHK A;  5AZH A;  3QJZ A;  4IG7 B;  2EMS A;  4A3O A;  2BYE A;  1E7V A;  3QX1 A;  2BKR B;  1XQQ A;  2K25 A;  3A33 B;  3ZNI D;  4IM2 A;  2N9X A;  4CO7 A;  1WMH A;  2JXX A;  3V6C B;  2D11 A;  1F9J A;  4NPN A;  3VH4 B;  4GDK A;  1T0Y A;  2KVR A;  4BBN C;  4RM9 A;  3RZF A;  2JVC A;  2CR5 A;  4II2 B;  4KSK C;  1P3Q U;  4MGZ E;  3VVW B;  2HD5 B;  2KOX A;  4FUL A;  4HWI B;  4PS8 A;  4OVU A;  4TQ1 A;  3RD2 A;  2Y5B B;  4W9G A;  2CHX A;  3WA0 A;  4W9I A;  4FJY A;  4HDQ A;  1E8W A;  3KUC B;  4K7U A;  2KXJ A;  4IC7 B;  3TL5 A;  2MWS B;  2FIF A;  3DPD A;  4HJK A;  4XC2 A;  4NQK E;  2GBK A;  2D3G A;  2FCS A;  3VUX A;  1ZKH A;  2J0J A;  3ZO5 B;  5JH5 C;  3HK0 A;  2PEA A;  4LDT D;  5CTR C;  4FHJ A;  3GOE A;  3QIJ A;  4W9F A;  4E3C A;  1NBF C;  3NZS A;  1NI2 A;  3PVL A;  2C5L C;  5DPS A;  2PE9 A;  3ZNG C;  3ML9 A;  2NCN A;  4ANW A;  2LVO A;  2MQJ A;  2KDE B;  4KV2 A;  2KHW B;  2REX A;  5D2M B;  1V5T A;  3SDL C;  2BWF A;  2M4N A;  3ZNH B;  2KWC A;  4F8C B;  2V1Y A;  4TKN A;  1EF5 A;  2MBE A;  3UGB B;  3AU4 A;  3APD A;  3H1U A;  4GOC A;  1OEY J;  2Z0E B;  2JZZ A;  2R2O A;  2NPT B;  1GNU A;  1V9J A;  1UBI A;  2LVQ A;  1L2N A;  4PS3 A;  2GOW A;  2L00 B;  2WX0 A;  1WZ3 A;  3DBL I;  4LDT B;  3CMM B;  2KNB A;  3H6N A;  4B6W A;  2MBO A;  2IO2 B;  2ZNV C;  5E6O A;  3DVG X;  3UIP B;  1ISN A;  2A5U A;  2KTF A;  3NZU A;  4IUM B;  1G6J A;  4OVV A;  5D6J B;  3JSV B;  3VUY A;  2LXC A;  4G3X B;  2LXA A;  2NBU A;  1C3T A;  2HJ8 A;  1TZ1 A;  2WDT B;  4EUT A;  1P98 A;  2FUH B;  3T9L A;  4GDL B;  4EZK A;  4W9E A;  2Z59 B;  3VTU A;  1YX6 B;  2J7Q B;  3HIZ A;  3PV1 A;  4GIV A;  3CF6 E;  1EO6 A;  4ANU A;  2PE6 B;  1V6E A;  3EEC A;  2KJR A;  4DK5 A;  1NDD A;  4M0W B;  4EZL A;  3C0R B;  2K8H A;  4WAA A;  2FAZ A;  3A1Q B;  1MG8 A;  3K9O B;  4BKS D;  3EHV A;  4DXA B;  2KJ6 A;  2ZNV B;  2K6D B;  3OLM D;  2IZV B;  2QHO A;  2WX1 A;  4NQL B;  2HE7 A;  2CU1 A;  4HCN B;  2NBV B;  2MBH A;  4LCD E;  4NAW A;  1UEL A;  3V61 A;  3L54 A;  1HE8 A;  3Q3J A;  1WGD A;  2YLM A;  3QWZ B;  3VAW A;  3V6E B;  2XBB C;  3L10 B;  3UQA A;  1GC6 A;  3VDZ A;  2C9W B;  2N1W A;  2N1V A;  1EF1 A;  2C7M B;  2MLB A;  5JHB A;  5LLI A;  2KAN A;  3M62 B;  5CHF A;  3QA8 A;  3UF8 A;  2LVP A;  4MJS A;  1D3Z A;  1E8Z A;  4WWO A;  2DYO A;  2LRW A;  1YD8 U;  3JVZ X;  4KZC A;  3R7R A;  1WFY A;  2L3Z A;  2XK5 A;  3OJ4 B;  4AOF A;  5DPW A;  3L13 A;  1XD3 B;  1RRB A;  1UZX B;  2AL3 A;  3M63 B;  4FAD A;  2L0F A;  4KVG B;  4B9K A;  1WGG A;  1S3S G;  3IVF A;  4BKT A;  1SE9 A;  4W9L A;  4URK A;  3U30 A;  2M8S A;  3K9P B;  4KZ0 A;  2ZJD A;  4WJQ A;  1J0G A;  1V5O A;  4G11 A;  1WXA A;  2IO0 B;  2GBM A;  2KK8 A;  3HM3 A;  4PS7 A;  2KN5 A;  2IO3 B;  2K39 A;  3QAR A;  2NPT A;  3PRE A;  5GMV A;  1WGY A;  2BYF A;  2N9E B;  3PRM B;  4A3P A;  2BKF A;  3D32 A;  3AI5 A;  3ALB A;  3DBH I;  3PT2 B;  2ZVO A;  2AWT A;  3QK0 A;  2ZEQ A;  3ZKJ C;  1PQS A;  2DYM A;  3QC8 B;  1H4R A;  5AZG A;  1BT0 A;  4P7I A;  1WE7 A;  3WAN A;  3JSV A;  1E8Y A;  4W9J A;  2KQS A;  4DDG D;  3UQB A;  2KC1 A;  2KDB A;  3A4S C;  4BOS C;  4G50 A;  1WJ4 A;  3AUL A;  3OAW A;  4NJ6 A;  2BPS A;  1XT9 B;  3WIM A;  3ECI A;  2MSE D;  2G4S A;  3QQ8 B;  3IFW B;  4MSM B;  2C7H A;  4GDL A;  3DVN U;  2K8B A;  3JW0 X;  3M3J A;  2GBR A;  3WAO A;  3Q3F A;  1IP9 A;  4KSL C;  4ANV A;  3KH0 A;  4NAW B;  2ZCB A;  2L76 A;  4NJ7 A;  2KTR B;  4MSQ B;  1Q1O A;  2CHW A;  3ENE A;  2DX5 B;  3PS6 A;  1JRU A;  1E8X A;  1WXV A;  3A4R A;  3R3M A;  3TCA A;  1A5R A;  2DZM A;  5JHA A;  2EKE C;  3A1Q A;  1KOT A;  4KDL B;  4DHZ E;  2HTH A;  1RLF A;  1WXS A;  3U8Z A;  1K8R B;  1H8C A;  3ZVV A;  1YX5 B;  1GC7 A;  4MJS B;  2FID A;  2MW5 A;  2L0T A;  5J2R A;  2XK5 B;  4RMA A;  5LXH A;  3L08 A;  1TTN A;  3R66 C;  4DBG A;  4IW0 A;  1LM8 B;  4NY0 A;  4WWN A;  2N4F A;  2FCM A;  1YJ1 A;  3ZRF A;  2ZPN A;  4G0N B;  4WJO A;  5IAA C;  3VTV A;  2N9P C;  2KC2 A;  1Q0W B;  2NVU I;  3ZNZ B;  4RM8 A;  3HHM A;  1VD2 A;  2LGX A;  2DZI A;  4DHJ D;  4FN2 A;  2RPQ A;  2M0X A;  4AJW A;  3EC8 A;  5HKH A;  4MM3 A;  3ZIM A;  1J19 A;  2LD9 A;  2MBQ A;  4EZJ A;  1V2Y A;  5TR5 A;  2KDI A;  3EFU A;  2BF8 B;  2MA9 B;  3RUI B;  4BKS A;  3TIX A;  4J6I A;  3N30 A;  3RYT A;  2FCN A;  4FJV B;  1X1M A;  3UIN B;  4FA6 A;  1UH6 A;  5E6P A;  3KYD D;  2G45 B;  2K1F A;  5KHQ A;  4E74 A;  1Z5S B;  2AYO B;  4MGK E;  4FBJ B;  4XX5 A;  3RT3 B;  4ZYN A;  2OJR A;  2V3S A;  3NHE B;  2LI5 A;  2DYB A;  2LJ5 A;  1LQB A;  2LZ6 A;  3PHW B;  3QHT A;  3ZDT A;  1KJT A;  1CMX B;  4IWO A;  4ZDV A;  1OTR B;  4KIK A;  4M8N A;  5DPT A;  2KLC A;  1WM2 A;  1WR6 E;  3NS8 A;  3BY4 B;  4K7S A;  2DZK A;  5KHO A;  4DHJ B;  1KM7 A;  4I6L B;  1UBQ A;  4MGY E;  2MBB B;  2LWP A;  3W1S A;  1WIA A;  3B1L X;  2R2Q A;  4LJO B;  3RUL A;  5IA7 A; 
#chains in the Genus database with same CATH topology
 4S0R A;  1RAX A;  3NUH B;  3HUI A;  3HVZ A;  4YT0 B;  4PYU A;  4II3 B;  2UWQ A;  2RGF A;  1STE A;  1WRI A;  4AUQ C;  2IYD B;  1E90 A;  4IDI A;  1WYW B;  1OQQ A;  3FIL A;  4O1N A;  3DQV A;  1P1A A;  1CJE A;  2DBY A;  3AB5 A;  2C7N B;  2AQ2 B;  4GXB A;  4I6N B;  4BOZ B;  4LNI A;  4MGI E;  3AU5 A;  3CSF A;  2OJW A;  4REZ A;  3DBR I;  1HQR D;  3PHX B;  2H89 B;  3X0W A;  3AEB B;  3GP7 A;  3DVN V;  2AL6 A;  3PLU A;  4KIK B;  2KX3 A;  2ZVN A;  2VH1 A;  1DOX A;  2L7R A;  1WX9 A;  3PZ8 A;  1T6B X;  2WU2 B;  3L0W B;  4KDI C;  2DEN B;  2BQQ A;  1XF5 L;  1HXY D;  1V8C A;  4GU2 A;  1Y56 A;  3L16 A;  1IGC A;  2NR2 A;  2JRI B;  2W3R A;  1F2R I;  1V81 A;  1T5X D;  3BWU D;  3M95 A;  2LAS A;  3ABV B;  2NBW B;  1I35 A;  5HHD G;  1FM0 D;  2DHZ A;  3I9V 1;  4ANX A;  2IBI B;  4FJZ A;  2M1M A;  4WJN A;  5C1Z A;  1FPY A;  4CYE A;  4EKU A;  1WJ6 A;  3Q8C A;  1FFV A;  1QZE A;  3AE2 B;  4L23 A;  2VRR B;  4N59 A;  3MJW A;  2JSV X;  3ZUN A;  1WI0 A;  3TEZ A;  1CQV A;  2KQ7 A;  4EE2 A;  3BII D;  3VTW A;  4JL9 A;  4NNJ B;  3AE4 B;  2O6V B;  3A9J A;  3HVD A;  2IO1 B;  5EE3 A;  1QT9 A;  4DHZ B;  1GPX A;  4GGQ A;  1WXM A;  4DWF A;  5LXI B;  3T8M A;  2IGH A;  2L8J A;  1D5X C;  1PUT A;  4XDD A;  3TJP A;  3GE8 C;  2UYZ B;  2G3Q B;  3ZGZ A;  3L4P A;  3ZLZ A;  4RGT A;  3ZTD A;  5DPR A;  3UIO B;  3PZD A;  2N7E A;  2NS5 A;  1JWS D;  2MJE A;  2KDF B;  3ZDM C;  1IGD A;  3MHS D;  1RWS A;  2EMT A;  3P4R B;  2BWE S;  5G5H A;  1ROE A;  5I4D A;  1PYW D;  3GB1 A;  2DAF A;  4W9D A;  4WQM A;  5LNK 1;  4LLG M;  2MX2 A;  3WAM A;  2KX0 A;  3QAQ A;  2DAJ A;  1ZOY B;  2V9H A;  3P2B A;  2AQ1 B;  3AE7 B;  2KKC A;  1WX7 A;  2MJ3 A;  2K8C A;  5AUI A;  2PW9 A;  3V62 A;  4WUR A;  2RR9 A;  3BK2 A;  2KFJ A;  3QCA A;  4LNN A;  2UU7 A;  2FNJ B;  1S1Q B;  3PPA A;  4CHK A;  5AZH A;  2NMQ A;  4QAY A;  5HG2 A;  4A3O A;  1E7V A;  2K25 A;  3A33 B;  2J52 A;  3HRD D;  1F9J A;  4XWT A;  4BBN C;  4RM9 A;  3RZF A;  2LMC A;  2KOX A;  2QIE B;  4FUL A;  4LNK A;  4TQ1 A;  1I4Q A;  3RD2 A;  3CWI A;  3LXF A;  1ZXI A;  1E8W A;  4K7U A;  3DPD A;  4XC2 A;  1B1Z A;  2E3T A;  1IBX B;  3V05 A;  2PLP A;  5CTR C;  3Q8F A;  2BW2 A;  4W9F A;  1FNU A;  2C5L C;  4ANW A;  4N58 A;  3P42 A;  1TKY A;  1M4V A;  3SR6 A;  4XYC A;  3BYY B;  1R4M B;  3APD A;  2Z0E B;  1ET6 A;  2LVQ A;  4C4V A;  4PS3 A;  2GOW A;  2OHF A;  1JRP A;  1WWT A;  4LDT B;  2KNB A;  4LNF A;  2MBO A;  4K3C A;  3UIP B;  3DVG X;  3AE5 B;  1G6J A;  3NZU A;  5HI1 A;  4OVZ A;  1QF6 A;  3JSV B;  4OZC A;  3Q2A C;  2WXK A;  1C3T A;  1TZ1 A;  2FUH B;  4GDL B;  2AX5 A;  3W9C B;  2Z59 B;  2N7J A;  3PV1 A;  3CF6 E;  1EO6 A;  1BML C;  4HEA 1;  2IJ0 A;  3EEC A;  2R61 A;  1NDD A;  4RNA A;  3A1Q B;  4BZA A;  4MT5 A;  2K6D B;  1PGX A;  2HE7 A;  2CU1 A;  4HCN B;  2NBV B;  3NVY A;  1HE8 A;  3VAW A;  5EE9 A;  2XN9 C;  1GC6 A;  2C9W B;  2C7M B;  3PO0 A;  2KAN A;  3M62 B;  4P1B C;  4WWO A;  1YD8 U;  2LRW A;  3OJ4 B;  4FAD A;  2L0F A;  4B9K A;  4KZ0 A;  3PZ7 A;  2ZJD A;  4C80 A;  4A90 A;  2INP E;  2IO0 B;  2GBM A;  1P7E A;  3HM3 A;  2D3C A;  4L2Y A;  2K39 A;  2NPT A;  5GMV A;  2BYF A;  2N9E B;  4RH6 A;  3N9Y C;  4ZOH C;  1T3Q A;  3BZD B;  2AWT A;  3QK0 A;  1JWU D;  1MFW A;  2BYT A;  1BT0 A;  1RFK A;  2D5G A;  4W9J A;  2NTS A;  3UQB A;  3ECI A;  2MSE D;  3QQ8 B;  4BAX A;  3IFW B;  1C77 A;  2GBR A;  1FO4 A;  3NS1 A;  4ANV A;  1JRU A;  1A5R A;  4M0W A;  1WXS A;  1C4C A;  3ZVV A;  4MJS B;  2L0T A;  5LXH A;  3R66 C;  1AW7 A;  3AEC B;  1R7S A;  1QIL A;  4G0N B;  4WJO A;  3NVW A;  2NVU I;  1A70 A;  2X38 A;  3HHM A;  1VD2 A;  2LGX A;  4AJW A;  5HKH A;  3RN9 C;  2WXJ A;  3ZIM A;  4EZJ A;  4WAF A;  2BF8 B;  2MA9 B;  4BKS A;  2DWQ A;  3KYD D;  2K1F A;  1TIF A;  4E74 A;  4MGK E;  2W3S A;  1YJJ A;  2OJR A;  3NHE B;  3QHT A;  2LZ6 A;  1LQB A;  3PHW B;  1KJT A;  2WNM A;  1CMX B;  4IWO A;  4ZHP A;  4KIK A;  3AEG B;  1ZXH A;  2JYE A;  3O13 A;  2KLC A;  4YSZ B;  1WM2 A;  1WR6 E;  2DZK A;  5KHO A;  4DHJ B;  4MGY E;  1NVI D;  1WIA A;  3Q14 C;  2R2Q A;  4LJO B;  3RUL A;  2BS2 B;  4D2K A;  1V80 A;  3SHQ A;  3ZTC A;  1OGW A;  4MEM A;  1R4N I;  2LEK A;  3PGE A;  1JW9 D;  3SU8 X;  1GJZ A;  2SEB D;  2KTR A;  2WXI A;  1WM3 A;  4AWJ A;  4JIO U;  2WXQ A;  4I6P A;  4ZRI A;  3PSE B;  2I2Y A;  1UF0 A;  3H7S A;  1HA5 A;  4X57 B;  2WYQ A;  2YEP B;  3E56 A;  5DCN A;  4C7Z A;  1K51 A;  4E71 A;  3B9J A;  1MPE A;  3W5U B;  2KO3 A;  2L32 A;  1N60 A;  4W9C A;  2AQ3 B;  4GSW A;  3AV8 A;  1F0Z A;  2QEJ C;  3V60 A;  3NRZ A;  3DOW A;  1UUP A;  2D10 A;  4W9K A;  5T8I A;  4B0E A;  2EEL A;  4JWS C;  3BVM A;  1JAL A;  2WXH A;  2O6V A;  2KFK B;  3MC9 A;  2KD0 A;  1MI0 A;  5H92 C;  5BO4 B;  3ZJT A;  1WY8 A;  4YSY B;  5D3I B;  3KYC D;  3MP9 A;  5AEK B;  1IUE A;  1WYG A;  1GG3 A;  2MJD A;  2WXO A;  4ZRQ A;  1P7F A;  2MCN B;  1YMH E;  2GMI C;  1IPG A;  4WQO B;  3H7P B;  5IOI A;  1ZGU B;  4WJP A;  1QLB B;  4NZL B;  4K7W A;  4MEL A;  4M8M A;  4DXG A;  1L6V A;  1OQY A;  3Q8E A;  3KUZ A;  1XLP A;  1D4B A;  3R7Q A;  4ZRK A;  4BFR A;  3U7D A;  4BBN F;  1M94 A;  1UD7 A;  3ZJV A;  1RFA A;  1LFD A;  2BYV E;  2J0K A;  1WGH A;  3AXC A;  3B08 A;  2Z0D B;  4FXC A;  3VHT C;  2RDB C;  4HCP B;  4BVU C;  2W9N A;  2GBJ A;  3KVF B;  3CIR B;  2YVC A;  2JPH A;  1YN5 A;  5IO9 A;  1GUA B;  3B2F A;  3DHI C;  4MH0 E;  3WAL A;  2Q5W D;  2IY0 B;  2CU3 A;  4FLH A;  1E10 A;  4AP4 C;  3EGR A;  2BS3 B;  4EFO A;  1E0Z A;  4F7Z A;  3GZN I;  3L17 A;  2L05 A;  1NEK B;  2LRU A;  2FCQ A;  1J8C A;  2ONQ A;  1C4P A;  3TMP B;  4WWP A;  4WIP A;  4K3B A;  2RDG A;  1WH3 A;  2WGS A;  3A9K B;  1I42 A;  5AUK A;  3FKY A;  2JWZ A;  1NEN B;  3ZW3 A;  3ML8 A;  3NY5 A;  2MH7 A;  5IKC M;  2EKI A;  3I3T B;  1VCB A;  2WWZ A;  2GBN A;  5L95 C;  1F1H A;  2ASQ A;  5TSS A;  3WAP A;  2OED A;  1QKZ A;  2PTL A;  1QOF A;  2FUG 1;  1Q10 A;  1XQQ A;  4IM2 A;  4CO7 A;  1WMH A;  3MC8 A;  2WQY B;  3V6C B;  2D11 A;  1FNV A;  4GDK A;  2WLB A;  2L1A A;  2CR5 A;  2HD5 B;  2VZK D;  1VRA B;  2CHX A;  3KUC B;  2FIF A;  1DOI A;  4KKJ A;  3NVV A;  3ZO5 B;  2J0J A;  2D3A A;  3RPF C;  5JH5 C;  1VLB A;  4NJC A;  2DNF A;  3QIJ A;  5D3D A;  3NZS A;  1NI2 A;  5DPS A;  2PE9 A;  1C78 A;  2ACZ B;  2NCN A;  1N5W A;  4XWW A;  2REX A;  3NZ3 A;  3SDL C;  2M4N A;  1XEE A;  2KMM A;  2WXF A;  2KWC A;  3AE1 B;  3AU4 A;  4GOC A;  3URY A;  2L52 A;  1GNU A;  2HJ1 A;  1WZ3 A;  4KKI A;  1EWY C;  3H6N A;  4B6W A;  2IO2 B;  2A5U A;  5D6J B;  2LXC A;  4G3X B;  3VR8 B;  3AMZ A;  2NBU A;  2Y3A A;  3SFD B;  3OWE B;  4HKZ E;  1JCK B;  3I57 A;  2KAJ A;  2J7Q B;  3HIZ A;  3TEY A;  2WDR B;  2HDE A;  3IT6 B;  4ANU A;  1PGB A;  1L0Y B;  2FAZ A;  4BKS D;  5IP4 D;  3EHV A;  5C3J B;  2GRI A;  2ZNV B;  4DXA B;  2QHO A;  4NQL B;  1PFD A;  3L54 A;  3Q3M C;  1QOA A;  3H8H A;  1EF1 A;  2MLB A;  5JHB A;  1AWD A;  2GI9 A;  1TKE A;  2LVP A;  4MJS A;  1E8Z A;  2DYO A;  2INN E;  4AOF A;  1WFY A;  2L3Z A;  3RMK C;  2XNA C;  1I4P A;  3SEB A;  2ON8 A;  4KVG B;  4DQO C;  4BKT A;  1T0Q C;  1SE9 A;  3U30 A;  4WWM A;  1J0G A;  4G11 A;  4PS7 A;  2KN5 A;  2IO3 B;  3QAR A;  5H8Y E;  1WGY A;  3GS2 A;  1PGA A;  1QOG A;  3AI5 A;  3IXS A;  3ALB A;  2PIA A;  2ZVO A;  2BVC A;  2Y5C A;  2DYM A;  2K22 A;  1KFY B;  1SBB B;  5BMI A;  3WIM A;  1XT9 B;  1D5Z C;  3JW0 X;  3WAO A;  1QOB A;  3Q3F A;  2L76 A;  3ENE A;  1CK1 A;  3TCA A;  1YJI A;  2DZM A;  2EKE C;  3AN1 A;  4DHZ E;  3Q8B A;  3U8Z A;  1K8R B;  4R3D A;  1FRR A;  3DHG C;  2FID A;  2MW5 A;  1TS5 A;  2XK5 B;  4C7Y A;  2WU5 B;  1JRO A;  2QJL A;  4US8 A;  2KC2 A;  3ZNZ B;  2M19 A;  2RPQ A;  3ZXV A;  3R8B A;  1SJE D;  2LJI A;  5TR5 A;  3RUI B;  2K5P A;  1BUI C;  3RNB C;  1D6E C;  1ZE3 D;  2FCN A;  1X1M A;  1ESF A;  1UH6 A;  5KHQ A;  1JWA D;  4HRO A;  3ZQ4 A;  4RFB A;  1MJD A;  4ZYN A;  1KLG D;  3ZDT A;  4CQN A;  1UNS A;  2WXM A;  3R2T A;  4K7S A;  3BY4 B;  1J7B A;  1KM7 A;  1XO3 A;  2MBB B;  2QC8 A;  3W1S A;  3B1L X;  1EWC A;  1D5M C;  5IA7 A;  3KWV A;  3V3X A;  2OOB B;  3DDC B;  2KLG A;  4GB9 A;  1YOV B;  5J18 A;  3H7P A;  2KDM A;  3N32 A;  4P1C C;  1VDV A;  2KQ4 X;  4EEW A;  3MTN B;  3W2D A;  4YL8 A;  1E7U A;  3IAS 1;  4TQ0 A;  2JWU A;  2JF5 A;  3X23 A;  3AEF B;  2WHI A;  3R2I A;  1ACC A;  1AAR A;  4LNO A;  1WJN A;  3LJ3 A;  4KGT A;  4W9H A;  3W1S C;  4AJY B;  4AQ7 A;  4ASW C;  2VH2 A;  4IM0 A;  3NVZ A;  3CST A;  3A9J B;  1NYQ A;  3MJ5 A;  2BGF A;  4B95 A;  4K1R B;  5J17 A;  4JWU C;  1L6U A;  1UGM A;  2WXR A;  4DDI D;  4IWP A;  2LFI A;  2CJO A;  2KMA A;  4IM3 A;  2JXT A;  1WR1 A;  1YIW A;  4HPM B;  2QSD A;  4ICU A;  4KGR A;  4ZRJ A;  4HRS A;  3VR9 B;  1TZO A;  3C19 A;  4B0M A;  3RI7 C;  1GB1 A;  3RFZ B;  1RYJ A;  2PVG C;  3LYY A;  3RNA C;  3IBE A;  2LHD A;  4N9F 4;  3ZYY X;  2ZZP B;  2BTE A;  2JY6 A;  4GN1 A;  2O2V B;  5C23 A;  5E6N A;  1E9M A;  2K3U A;  3AE8 B;  2I38 A;  4HXD A;  1HTO A;  3SFE B;  4HPP A;  2AEH A;  1N6Z A;  3TUO A;  3KUD B;  2CHZ A;  4LTU A;  2D2Q A;  1EU3 A;  2I1K A;  1FXT B;  5EDS A;  3DCG A;  1YQ3 B;  1Y8R C;  3E9S A;  2JUO A;  1V49 A;  1JQ4 A;  1GB4 A;  2MP2 B;  2RSU A;  3DWG C;  3DVG Y;  4XGA B;  1Z2M A;  2C60 A;  3VQI A;  2JU6 X;  3GE3 C;  3S2A A;  3A9K A;  1HEZ E;  2BS4 B;  1TGZ B;  3NOB A;  1YNT E;  2WXG A;  3DBL B;  4MDK E;  3AED B;  4LJP B;  3KW5 B;  3ZRC A;  3APC A;  1ENF A;  3N3K B;  4HPL B;  4C56 C;  4HVB A;  2N9L A;  4HKQ A;  4WH4 A;  3U7Z A;  1SSN A;  2XEW A;  3P63 A;  3PLV A;  1JWM D;  4TV3 A;  1DOY A;  1FNW A;  2KZR A;  2K9X A;  5FR6 A;  5FK9 C;  2G1E A;  2JT4 B;  3O65 B;  3VFK A;  1K52 A;  1V1O A;  1Q5W B;  1V86 A;  1E5W A;  1C76 A;  1R4N B;  4N6E B;  1LXD A;  1HTQ A;  2IGD A;  2FE8 A;  2ZW1 A;  3EFC A;  3FC4 A;  2ZCC A;  3T3O A;  1KLV A;  3SD5 A;  2MEK A;  3WCQ A;  1WE6 A;  4A6Q A;  4H2A A;  1P0R A;  3BIN A;  4HDO A;  5L83 A;  3H9D A;  4JQW C;  1SE2 A;  4BKG A;  1ZW7 A;  2KWV B;  4M02 A;  2LGD A;  4USA A;  2LGY A;  4C4V B;  2PJH A;  3DBH B;  2L83 A;  4JLC A;  3Q69 A;  2M17 A;  2KWU B;  5CHV C;  3TEX A;  4XZ4 A;  4IG7 B;  1KH0 A;  1J7C A;  2EMS A;  3QX1 A;  2GLS A;  2KWD A;  3ZNI D;  4A9A A;  5G5G A;  2KVR A;  5EE0 A;  2V3P A;  5IN7 A;  2JVC A;  3I63 C;  1EM7 A;  4KSK C;  4MGZ E;  4ZHO A;  4HWI B;  3WA0 A;  4FJY A;  2FBW B;  3U52 E;  2H88 B;  3TL5 A;  2MWS B;  1LO5 D;  4HJK A;  2CJN A;  3VUX A;  1ZKH A;  3MFG A;  1J7A A;  1V1P B;  4FHJ A;  1NBF C;  3IAM 1;  3PVL A;  3ZNG C;  3ML9 A;  1I4X A;  2LVO A;  2MQJ A;  2KDE B;  2JZP A;  2BWF A;  3ZNH B;  2V1Y A;  1EF5 A;  2MBE A;  3N20 C;  2VZK B;  2WS3 B;  3UGB B;  1F77 A;  1OEY J;  2QIL A;  2JZZ A;  2R2O A;  2NPT B;  1V9J A;  2KVZ A;  2L00 B;  2WX0 A;  2QDF A;  3EA6 A;  2ZNV C;  4JE3 B;  4OVV A;  4ARI A;  2LXA A;  1FRD A;  2WXL A;  2WDT B;  1PDX A;  1XLO A;  3Q8A A;  4P6V F;  1TY2 A;  3VTU A;  1XXG A;  3GZN B;  1LGR A;  1V6E A;  2KJR A;  4DK5 A;  4YTP B;  4M0W B;  3C0R B;  1TS4 A;  4WAA A;  1VZ7 A;  3K9O B;  1I4G A;  2KJ6 A;  3OLM D;  4XDC A;  3N1Y C;  4PK1 A;  2WX1 A;  3WAN A;  4LCD E;  2MBH A;  1IBX A;  3Q3J A;  3L10 B;  4MH8 A;  3UQA A;  3VDZ A;  2N1V A;  2M56 B;  5CHF A;  3DBR B;  5GXG B;  4JX1 C;  1D3Z A;  1ZP0 B;  3JVZ X;  2YEP F;  2XK5 A;  1XD3 B;  1RRB A;  1UZX B;  2AL3 A;  2V4I B;  1WGG A;  4W9L A;  2W55 A;  2M8S A;  3K9P B;  4WJQ A;  1V5O A;  4YWG G;  3RNF C;  4NAM A;  3KQ4 A;  3PRE A;  3PRM B;  2BKF A;  3MHZ A;  1XLN A;  1SEB D;  3ZKJ C;  2ZEQ A;  2KT7 A;  1PQS A;  3AE9 B;  2X8X X;  3QC8 B;  5AZG A;  3ZXR A;  2Y5P A;  4OZA A;  1WE7 A;  3IT4 B;  3JSV A;  2KQS A;  1XLQ A;  4DDG D;  3AEE B;  2KDB A;  3A4S C;  3AUL A;  2BPS A;  4RGM A;  2G4S A;  2D3B A;  1VZ8 A;  4MSM B;  1TY0 A;  3NG0 A;  2LGI A;  4GDL A;  5HFY A;  3DVN U;  3U4E G;  1MVK A;  3M3J A;  4M00 A;  3W5V B;  1IP9 A;  4KSL C;  3KH0 A;  4NAW B;  1SXT A;  2ZCB A;  4NJ7 A;  2KTR B;  4MSQ B;  2CHW A;  2DX5 B;  3RNE C;  4YTM B;  1WXV A;  1E8X A;  1ZDX A;  3A4R A;  4US9 A;  3A1Q A;  2JQR B;  1XCQ L;  4KDL B;  2HTH A;  1RLF A;  2NTT A;  4HJG E;  1YX5 B;  1GC7 A;  3VRA B;  5J2R A;  2JYT A;  3L08 A;  1TTN A;  4DBG A;  1LM8 B;  1TYG B;  2KYW A;  2N4F A;  1FCL A;  1YJ1 A;  3ZRF A;  2Z8L A;  2ZPN A;  4RGO S;  2N9P C;  1Q0W B;  4RM8 A;  1F52 A;  1L4Z B;  2DZI A;  4FN2 A;  2M0X A;  1V97 A;  1N62 A;  1J19 A;  1V2Y A;  5FR3 A;  2BBC A;  2KDI A;  3EFU A;  3UI3 A;  4RF1 A;  1N5X A;  3TIX A;  1B9R A;  3N30 A;  3RYT A;  2ZW0 A;  5BMG A;  1KF6 B;  2RMM A;  4FA6 A;  5E6P A;  2G45 B;  1Z5S B;  2J53 A;  1E6E B;  1C4A A;  2WXN A;  2DYB A;  1I4R A;  2LJ5 A;  4DXF A;  4ZDV A;  1OTR B;  4M8N A;  2SAK A;  1VJK A;  4I6L B;  1UBQ A;  3BVG A;  1FEH A;  2V3N A;  3VH3 B;  2K0P A;  3PRP B;  1SJH D;  4ACF A;  2WDQ B;  1SF0 A;  2PPH A;  5BMH A;  2O2V A;  1L0X B;  2LUM A;  3TEW A;  2J4X A;  4FHK A;  4F1S A;  4MM3 B;  3NJT A;  4C00 A;  1QQR A;  1U4A A;  3APF A;  1N61 A;  4UDU C;  3VRB B;  2MP2 A;  4PYZ A;  4ICV A;  3VXW A;  1DYQ A;  1CZP A;  1WF9 A;  2A4Z A;  3B0A A;  4HLE A;  1DGJ A;  1BXT A;  3EUB 2;  5BYR A;  4GLS C;  4A55 A;  3AH7 A;  4KGS A;  5G2N A;  5AZF A;  1EU4 A;  3Q3O C;  4A20 A;  5JZE B;  4ARC A;  1OFF A;  2LUE A;  3BVZ A;  1UWX A;  2ICI A;  3ZJU A;  2BT6 A;  2BB5 A;  3AE3 B;  3W1Y A;  4OW0 A;  2KMC A;  4IWQ A;  1T0S C;  1ZDV A;  1K50 A;  3FIL B;  2O6V D;  5D7G A;  4JPS A;  1OQR A;  4TUU A;  3Q3N C;  3PRZ A;  5CX3 A;  2G4D B;  3RCZ A;  1TS2 A;  1E7P B;  2V4L A;  1GOZ A;  1WZ0 A;  3P4S B;  5BYS A;  4HK2 A;  1JML A;  3RZW C;  3TBL D;  5JXV A;  3AEA B;  1XCT L;  4JGH B;  2CKH B;  1P9D U;  1WRD B;  1OEY A;  4A8X C;  5D94 A;  2J0M A;  1C9F A;  1R4M I;  1N63 A;  1AYF A;  1C1Y B;  1KRH A;  2N7D A;  4K81 A;  2D07 B;  3N1Z C;  1MHH E;  3PTF C;  4YTN B;  1IYF A;  1L7Y A;  4OZB A;  2HTM E;  2CS4 A;  3IHP C;  1WMH B;  1SE4 A;  1L4D B;  3LDZ E;  4GDK B;  2KFK A;  3P4P B;  5FKA C;  1FMA D;  1WJU A;  2K6Q A;  2B3A A;  1FXA A;  1WGR A;  2LGS A;  4IOI E;  4J3O D;  1SIF A;  3DHH C;  2IY1 B;  3AM9 A;  3JYU A;  2TSS A;  4GMV A;  2ZPY A;  2MRP A;  2DZJ A;  1WX8 A;  4TMA B;  3I5J C;  5EE1 A;  1SB3 C;  3N1X C;  4MAC A;  5BYQ A;  3DBS A;  5CHW A;  1MG4 A;  1I7H A;  2KJH B;  4AS1 A;  3KWL A;  4PT5 A;  1EUV B;  1K53 A;  2RD0 A;  3IG3 A;  1V1P A;  2E6X A;  2N9K A;  1UWM A;  1NYR A;  1JWB D;  2I1J A;  3ETR A;  4RGN A;  2IDY A;  3FAH A;  1SGH A;  3VUW A;  3HM6 X;  4EOY A;  2JZ3 B;  4M01 A;  1SE3 A;  1YQB A;  2KN4 A;  1TBE A;  2W54 A;  3ONS A;  5G55 A;  2JRH A;  4RCO A;  3OJ3 A;  3QJZ A;  3Q6B A;  2BYE A;  2BKR B;  2IPK D;  2N9X A;  2JXX A;  4NPN A;  3VH4 B;  1T0Y A;  3BYT B;  2INC C;  4II2 B;  1P3Q U;  3VVW B;  4OVU A;  4PS8 A;  2Y5B B;  4W9G A;  4W9I A;  1RM6 C;  4HDQ A;  2KXJ A;  4IC7 B;  1L0V B;  4NQK E;  2GBK A;  1FFU A;  2D3G A;  2FCS A;  1WGK A;  4RF0 A;  3HK0 A;  2PEA A;  4LDT D;  3GOE A;  4E3C A;  4XE0 A;  3T3N A;  2WP9 B;  4KV2 A;  2KHW B;  5D2M B;  1V5T A;  5MPO A;  2JX5 A;  3AE6 B;  4F8C B;  1YN3 A;  4TKN A;  3J9C A;  3H1U A;  1KLU D;  1NI3 A;  1MHX A;  1UBI A;  1T0R C;  1L2N A;  1FXI A;  1VZ6 A;  3DBL I;  4LK0 M;  3CMM B;  5E6O A;  1ISN A;  2KTF A;  4IUM B;  4L1B A;  3VUY A;  4Q2J A;  2HJ8 A;  1ZPS A;  1TJE A;  1YN4 A;  2IND C;  3C8Y A;  4EUT A;  4P16 A;  5C2T B;  1P98 A;  3T9L A;  1TT5 B;  4EZK A;  4W9E A;  1FD6 A;  1YX6 B;  4GIV A;  2J42 A;  1ET9 A;  2PE6 B;  2RPV A;  2QCZ A;  2B76 B;  4EZL A;  2K8H A;  1HZ5 A;  1MG8 A;  4OHJ A;  1L5P A;  4TSS A;  2IZV B;  3V61 A;  4NAW A;  1UEL A;  3QWZ B;  1WGD A;  2YLM A;  3V6E B;  2XBB C;  3P4Q B;  2G9H D;  2KAC A;  2DLB A;  2N1W A;  1HZ6 A;  2MHJ A;  5LLI A;  3QA8 A;  3UF8 A;  1F2R C;  3R7R A;  4KZC A;  5DPW A;  3L13 A;  3M63 B;  3IVF A;  1S3S G;  4URK A;  3P1M A;  1WXA A;  2KK8 A;  4YXD B;  4A3P A;  3LB8 C;  3D32 A;  2V0G A;  1FCC C;  3DBH I;  3PT2 B;  3OG5 A;  3U2S C;  1H4R A;  4ITK A;  4P7I A;  2WXP A;  1E8Y A;  2KC1 A;  4BOS C;  4G50 A;  1WJ4 A;  3OAW A;  4NJ6 A;  5E6J A;  2RDH A;  2C7H A;  2K8B A;  3KLS X;  3B2G A;  1FIQ A;  2QMT A;  1Q1O A;  2BB6 A;  2PKO A;  3PS6 A;  3R3M A;  1WSP A;  5JHA A;  1KOT A;  1UGJ A;  1TS3 A;  1WXQ A;  3RNG C;  1H8C A;  2LHE A;  3RNC C;  1I4H A;  4RMA A;  4IW0 A;  2IGG A;  4NY0 A;  4WWN A;  2FCM A;  1YQ4 B;  2W82 A;  1KTK A;  3TSS A;  5IAA C;  3VTV A;  1ZUD 2;  1TKG A;  4S17 A;  4YSX B;  2PVO D;  2PMV A;  1VR9 A;  4DHJ D;  3EC8 A;  4MM3 A;  3BK1 A;  1AN8 A;  2LD9 A;  2MBQ A;  2N0S B;  2GB1 A;  1GAQ B;  4J6I A;  4KX6 B;  3DWM A;  4FJV B;  4ZYS A;  3UIN B;  2AYO B;  4FBJ B;  4XX5 A;  3RT3 B;  2V3S A;  2LI5 A;  1SIJ A;  2M0A A;  5DPT A;  2WDV B;  4ZRP A;  3NS8 A;  2LWP A;  4IKG A;  3MC0 B;  1C79 A; 
#chains in the Genus database with same CATH homology
 2OOB B;  3VH3 B;  1RAX A;  1V80 A;  3DDC B;  3SHQ A;  3ZTC A;  1OGW A;  4MEM A;  1R4N I;  3PGE A;  3PRP B;  3SU8 X;  4PYU A;  1GJZ A;  2KTR A;  4II3 B;  1WM3 A;  2KLG A;  4AWJ A;  4JIO U;  4GB9 A;  2PPH A;  2RGF A;  2UWQ A;  4I6P A;  4ZRI A;  2IYD B;  3H7P A;  2O2V A;  3N32 A;  1E90 A;  3PSE B;  4AUQ C;  5J18 A;  1WYW B;  4EEW A;  3MTN B;  3DQV A;  4YL8 A;  1E7U A;  1P1A A;  3H7S A;  4TQ0 A;  4X57 B;  4FHK A;  2JF5 A;  3X23 A;  2WYQ A;  5DCN A;  4F1S A;  1AAR A;  2C7N B;  1WJN A;  3LJ3 A;  4W9H A;  3W1S C;  4AJY B;  4GXB A;  4I6N B;  4BOZ B;  4E71 A;  4MGI E;  1U4A A;  4ASW C;  3AU5 A;  3CSF A;  2KO3 A;  4IM0 A;  3APF A;  3DBR I;  4W9C A;  3CST A;  3PHX B;  4GSW A;  3A9J B;  2MP2 A;  4PYZ A;  2BGF A;  4B95 A;  4ICV A;  3V60 A;  3VXW A;  3X0W A;  4K1R B;  3DOW A;  5J17 A;  3DVN V;  1WF9 A;  2A4Z A;  3B0A A;  2D10 A;  4HLE A;  1UGM A;  4DDI D;  4W9K A;  4IWP A;  2AL6 A;  2KMA A;  3PLU A;  4IM3 A;  4KIK B;  1WR1 A;  2KX3 A;  1YIW A;  2ZVN A;  5G2N A;  5AZF A;  2L7R A;  4HPM B;  1WX9 A;  2O6V A;  4ICU A;  2KFK B;  4ZRJ A;  4A20 A;  5JZE B;  2KD0 A;  3L0W B;  4KDI C;  5BO4 B;  1WY8 A;  2DEN B;  2LUE A;  3KYC D;  5AEK B;  4GU2 A;  3L16 A;  2NR2 A;  2JRI B;  1GG3 A;  1V81 A;  2MCN B;  3W1Y A;  3M95 A;  2LAS A;  3IBE A;  4N9F 4;  2NBW B;  1I35 A;  2GMI C;  2ZZP B;  1IPG A;  2JY6 A;  2KMC A;  4GN1 A;  4IWQ A;  4WQO B;  3H7P B;  2O2V B;  5C23 A;  5E6N A;  1ZGU B;  4WJP A;  2O6V D;  5D7G A;  4K7W A;  4HXD A;  2DHZ A;  2AEH A;  4ANX A;  4TUU A;  3KUD B;  4MEL A;  2IBI B;  3PRZ A;  4M8M A;  2G4D B;  5CX3 A;  3RCZ A;  1OQY A;  2CHZ A;  4FJZ A;  2M1M A;  2V4L A;  4WJN A;  1WZ0 A;  3KUZ A;  5C1Z A;  2D2Q A;  2I1K A;  1FXT B;  5EDS A;  3DCG A;  4HK2 A;  4CYE A;  1WJ6 A;  4EKU A;  3R7Q A;  1Y8R C;  3RZW C;  2JUO A;  3TBL D;  1V49 A;  4ZRK A;  1QZE A;  4BFR A;  2MP2 B;  3U7D A;  2RSU A;  3DVG Y;  4JGH B;  1Z2M A;  2CKH B;  2C60 A;  1P9D U;  2VRR B;  3MJW A;  3VQI A;  3S2A A;  1WRD B;  3A9K A;  4BBN F;  1OEY A;  1M94 A;  3ZUN A;  1UD7 A;  1RFA A;  1WI0 A;  1LFD A;  1TGZ B;  2BYV E;  2KQ7 A;  3NOB A;  2J0K A;  1WGH A;  3AXC A;  2J0M A;  4MDK E;  5D94 A;  4JL9 A;  3B08 A;  4LJP B;  1R4M I;  2Z0D B;  4NNJ B;  3VTW A;  3KW5 B;  3VHT C;  1C1Y B;  2O6V B;  2N7D A;  3A9J A;  3ZRC A;  3APC A;  2IO1 B;  2D07 B;  4HCP B;  4K81 A;  3N3K B;  4BVU C;  2W9N A;  2GBJ A;  3KVF B;  4HPL B;  4DHZ B;  3PTF C;  4HVB A;  4GGQ A;  2YVC A;  2JPH A;  1IYF A;  1L7Y A;  1WXM A;  4DWF A;  5LXI B;  2CS4 A;  3T8M A;  1GUA B;  3IHP C;  1WMH B;  4MH0 E;  2L8J A;  2XEW A;  3PLV A;  3TJP A;  3LDZ E;  4GDK B;  4TV3 A;  3WAL A;  2IY0 B;  2UYZ B;  2G3Q B;  2KFK A;  2KZR A;  5FR6 A;  1WJU A;  2K6Q A;  2B3A A;  3ZLZ A;  1WGR A;  5DPR A;  3UIO B;  3ZTD A;  3PZD A;  2N7E A;  2JT4 B;  3O65 B;  2NS5 A;  4FLH A;  3VFK A;  4AP4 C;  2KDF B;  1Q5W B;  1SIF A;  1V86 A;  3ZDM C;  4EFO A;  2IY1 B;  3MHS D;  1E5W A;  1LXD A;  3JYU A;  4F7Z A;  3GZN I;  3L17 A;  4GMV A;  2EMT A;  2L05 A;  2LRU A;  2ZCC A;  2ZPY A;  2FCQ A;  1J8C A;  2MRP A;  2DZJ A;  1WX8 A;  1KLV A;  3SD5 A;  3TMP B;  4WWP A;  2BWE S;  3DBS A;  5CHW A;  1WH3 A;  2KJH B;  3A9K B;  1I42 A;  1WE6 A;  2JWZ A;  1P0R A;  3BIN A;  2DAF A;  1EUV B;  4HDO A;  5L83 A;  3H9D A;  4W9D A;  3ZW3 A;  3ML8 A;  2RD0 A;  2MX2 A;  3IG3 A;  4JQW C;  4BKG A;  3NY5 A;  3WAM A;  1ZW7 A;  2I1J A;  2KX0 A;  2KWV B;  3QAQ A;  2DAJ A;  3I3T B;  2LGD A;  1VCB A;  2WWZ A;  2LGY A;  1SGH A;  2GBN A;  3VUW A;  2PJH A;  3P2B A;  2ASQ A;  5L95 C;  3HM6 X;  4EOY A;  2JZ3 B;  2KKC A;  4JLC A;  1WX7 A;  3WAP A;  2K8C A;  1YQB A;  2M17 A;  2KWU B;  5CHV C;  1TBE A;  3V62 A;  3ONS A;  2RR9 A;  2KFJ A;  5G55 A;  2JRH A;  3QCA A;  4XZ4 A;  2FNJ B;  1S1Q B;  3PPA A;  3OJ3 A;  4CHK A;  5AZH A;  3QJZ A;  4IG7 B;  2EMS A;  4A3O A;  2BYE A;  1E7V A;  3QX1 A;  2BKR B;  1XQQ A;  2K25 A;  3A33 B;  3ZNI D;  4IM2 A;  2N9X A;  4CO7 A;  1WMH A;  2JXX A;  3V6C B;  2D11 A;  1F9J A;  4NPN A;  3VH4 B;  4GDK A;  1T0Y A;  2KVR A;  4BBN C;  4RM9 A;  3RZF A;  2JVC A;  2CR5 A;  4II2 B;  4KSK C;  1P3Q U;  4MGZ E;  3VVW B;  2HD5 B;  2KOX A;  4FUL A;  4HWI B;  4PS8 A;  4OVU A;  4TQ1 A;  3RD2 A;  2Y5B B;  4W9G A;  2CHX A;  3WA0 A;  4W9I A;  4FJY A;  4HDQ A;  1E8W A;  3KUC B;  4K7U A;  2KXJ A;  4IC7 B;  3TL5 A;  2MWS B;  2FIF A;  3DPD A;  4HJK A;  4XC2 A;  4NQK E;  2GBK A;  2D3G A;  2FCS A;  3VUX A;  1ZKH A;  2J0J A;  3ZO5 B;  5JH5 C;  3HK0 A;  2PEA A;  4LDT D;  5CTR C;  4FHJ A;  3GOE A;  3QIJ A;  4W9F A;  4E3C A;  1NBF C;  3NZS A;  1NI2 A;  3PVL A;  2C5L C;  5DPS A;  2PE9 A;  3ZNG C;  3ML9 A;  2NCN A;  4ANW A;  2LVO A;  2MQJ A;  2KDE B;  4KV2 A;  2KHW B;  2REX A;  5D2M B;  1V5T A;  3SDL C;  2BWF A;  2M4N A;  3ZNH B;  2KWC A;  4F8C B;  2V1Y A;  4TKN A;  1EF5 A;  2MBE A;  3UGB B;  3AU4 A;  3APD A;  3H1U A;  4GOC A;  1OEY J;  2Z0E B;  2JZZ A;  2R2O A;  2NPT B;  1GNU A;  1V9J A;  1UBI A;  2LVQ A;  1L2N A;  4PS3 A;  2GOW A;  2L00 B;  2WX0 A;  1WZ3 A;  3DBL I;  4LDT B;  3CMM B;  2KNB A;  3H6N A;  4B6W A;  2MBO A;  2IO2 B;  2ZNV C;  5E6O A;  3DVG X;  3UIP B;  1ISN A;  2A5U A;  2KTF A;  3NZU A;  4IUM B;  1G6J A;  4OVV A;  5D6J B;  3JSV B;  3VUY A;  2LXC A;  4G3X B;  2LXA A;  2NBU A;  1C3T A;  2HJ8 A;  1TZ1 A;  2WDT B;  4EUT A;  1P98 A;  2FUH B;  3T9L A;  4GDL B;  4EZK A;  4W9E A;  2Z59 B;  3VTU A;  1YX6 B;  2J7Q B;  3HIZ A;  3PV1 A;  4GIV A;  3CF6 E;  1EO6 A;  4ANU A;  2PE6 B;  1V6E A;  3EEC A;  2KJR A;  4DK5 A;  1NDD A;  4M0W B;  4EZL A;  3C0R B;  2K8H A;  4WAA A;  2FAZ A;  3A1Q B;  1MG8 A;  3K9O B;  4BKS D;  3EHV A;  4DXA B;  2KJ6 A;  2ZNV B;  2K6D B;  3OLM D;  2IZV B;  2QHO A;  2WX1 A;  4NQL B;  2HE7 A;  2CU1 A;  4HCN B;  2NBV B;  2MBH A;  4LCD E;  4NAW A;  1UEL A;  3V61 A;  3L54 A;  1HE8 A;  3Q3J A;  1WGD A;  2YLM A;  3QWZ B;  3VAW A;  3V6E B;  2XBB C;  3L10 B;  3UQA A;  1GC6 A;  3VDZ A;  2C9W B;  2N1W A;  2N1V A;  1EF1 A;  2C7M B;  2MLB A;  5JHB A;  5LLI A;  2KAN A;  3M62 B;  5CHF A;  3QA8 A;  3UF8 A;  2LVP A;  4MJS A;  1D3Z A;  1E8Z A;  4WWO A;  2DYO A;  2LRW A;  1YD8 U;  3JVZ X;  4KZC A;  3R7R A;  1WFY A;  2L3Z A;  2XK5 A;  3OJ4 B;  4AOF A;  5DPW A;  3L13 A;  1XD3 B;  1RRB A;  1UZX B;  2AL3 A;  3M63 B;  4FAD A;  2L0F A;  4KVG B;  4B9K A;  1WGG A;  1S3S G;  3IVF A;  4BKT A;  1SE9 A;  4W9L A;  4URK A;  3U30 A;  2M8S A;  3K9P B;  4KZ0 A;  2ZJD A;  4WJQ A;  1J0G A;  1V5O A;  4G11 A;  1WXA A;  2IO0 B;  2GBM A;  2KK8 A;  3HM3 A;  4PS7 A;  2KN5 A;  2IO3 B;  2K39 A;  3QAR A;  2NPT A;  3PRE A;  5GMV A;  1WGY A;  2BYF A;  2N9E B;  3PRM B;  4A3P A;  2BKF A;  3D32 A;  3AI5 A;  3ALB A;  3DBH I;  3PT2 B;  2ZVO A;  2AWT A;  3QK0 A;  2ZEQ A;  3ZKJ C;  1PQS A;  2DYM A;  3QC8 B;  1H4R A;  5AZG A;  1BT0 A;  4P7I A;  1WE7 A;  3WAN A;  3JSV A;  1E8Y A;  4W9J A;  2KQS A;  4DDG D;  3UQB A;  2KC1 A;  2KDB A;  3A4S C;  4BOS C;  4G50 A;  1WJ4 A;  3AUL A;  3OAW A;  4NJ6 A;  2BPS A;  1XT9 B;  3WIM A;  3ECI A;  2MSE D;  2G4S A;  3QQ8 B;  3IFW B;  4MSM B;  2C7H A;  4GDL A;  3DVN U;  2K8B A;  3JW0 X;  3M3J A;  2GBR A;  3WAO A;  3Q3F A;  1IP9 A;  4KSL C;  4ANV A;  3KH0 A;  4NAW B;  2ZCB A;  2L76 A;  4NJ7 A;  2KTR B;  4MSQ B;  1Q1O A;  2CHW A;  3ENE A;  2DX5 B;  3PS6 A;  1JRU A;  1E8X A;  1WXV A;  3A4R A;  3R3M A;  3TCA A;  1A5R A;  2DZM A;  5JHA A;  2EKE C;  3A1Q A;  1KOT A;  4KDL B;  4DHZ E;  2HTH A;  1RLF A;  1WXS A;  3U8Z A;  1K8R B;  1H8C A;  3ZVV A;  1YX5 B;  1GC7 A;  4MJS B;  2FID A;  2MW5 A;  2L0T A;  5J2R A;  2XK5 B;  4RMA A;  5LXH A;  3L08 A;  1TTN A;  3R66 C;  4DBG A;  4IW0 A;  1LM8 B;  4NY0 A;  4WWN A;  2N4F A;  2FCM A;  1YJ1 A;  3ZRF A;  2ZPN A;  4G0N B;  4WJO A;  5IAA C;  3VTV A;  2N9P C;  2KC2 A;  1Q0W B;  2NVU I;  3ZNZ B;  4RM8 A;  3HHM A;  1VD2 A;  2LGX A;  2DZI A;  4DHJ D;  4FN2 A;  2RPQ A;  2M0X A;  4AJW A;  3EC8 A;  5HKH A;  4MM3 A;  3ZIM A;  1J19 A;  2LD9 A;  2MBQ A;  4EZJ A;  1V2Y A;  5TR5 A;  2KDI A;  3EFU A;  2BF8 B;  2MA9 B;  3RUI B;  4BKS A;  3TIX A;  4J6I A;  3N30 A;  3RYT A;  2FCN A;  4FJV B;  1X1M A;  3UIN B;  4FA6 A;  1UH6 A;  5E6P A;  3KYD D;  2G45 B;  2K1F A;  5KHQ A;  4E74 A;  1Z5S B;  2AYO B;  4MGK E;  4FBJ B;  4XX5 A;  3RT3 B;  4ZYN A;  2OJR A;  2V3S A;  3NHE B;  2LI5 A;  2DYB A;  2LJ5 A;  1LQB A;  2LZ6 A;  3PHW B;  3QHT A;  3ZDT A;  1KJT A;  1CMX B;  4IWO A;  4ZDV A;  1OTR B;  4KIK A;  4M8N A;  5DPT A;  2KLC A;  1WM2 A;  1WR6 E;  3NS8 A;  3BY4 B;  4K7S A;  2DZK A;  5KHO A;  4DHJ B;  1KM7 A;  4I6L B;  1UBQ A;  4MGY E;  2MBB B;  2LWP A;  3W1S A;  1WIA A;  3B1L X;  2R2Q A;  4LJO B;  3RUL A;  5IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...