1XT9B

Crystal structure of den1 in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complex between Nedd8 and the Ulp/Senp Protease Family Member Den1.
pubmed doi rcsb
molecule keywords Sentrin-specific protease 8
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1xt9B00
2ZVOA 4FA6A 4WWOA 2N9EB 3SU8X 3UIPB 2BWES 5AZHA 2YVCA 4GN1A 3VQIA 3ZNGC 2QHOA 3I3TB 2LI5A 3PGEA 2PE9A 2KC1A 3RUIB 1UD7A 2D2QA 2N1WA 2O2VA 1NBFC 1J19A 2ZNVC 3QX1A 4G3XB 2VRRB 3AI5A 3QQ8B 2CKHB 3KH0A 2AWTA 2LVOA 3H7PA 3ENEA 4IM3A 1ZKHA 3QJZA 4PS3A 4WJQA 3VUWA 4DDGD 4MELA 4JIOU 5C1ZA 1AARA 3L0WB 4RMAA 1E5WA 3RULA 5BO4B 2AL3A 3PZDA 1TTNA 1VCBA 3RCZA 1VD2A 3ZVVA 3EC8A 1ZGUB 4ZRIA 2GBNA 4I6PA 4GDKB 3CSTA 1WZ3A 3VFKA 3N32A 3ZDMC 2N7EA 1LXDA 2NBVB 4WJOA 3WAOA 4IUMB 2UWQA 4OVVA 1YX5B 4AJYB 2CHZA 3RZWC 2M0XA 3AULA 3M3JA 4W9GA 2FCMA 2L05A 4GDLB 5D6JB 4KZCA 3RD2A 3BY4B 4XC2A 2DYOA 3HM3A 4MSMB 4LCDE 3TBLD 2C7MB 3MJWA 1M94A 4GOCA 3EECA 5DPRA 2JWZA 2XEWA 1UH6A 5L83A 2B3AA 2LRWA 4NJ7A 2C7HA 4W9EA 3CF6E 1MG8A 1XT9B 2HTHA 4IG7B 3ZNID 4EZKA 3JSVB 3PHWB 4HK2A 1WMHA 4JLCA 5KHQA 3QCAA 1TZ1A 3DDCB 1WRDB 2OOBB 2M8SA 4NQKE 3V61A 1D3ZA 4II3B 4LDTD 4JGHB 2KJ6A 4AUQC 2BPSA 3DBSA 1I35A 4BKSD 1WIAA 2Z0EB 5C23A 4A20A 3ZLZA 1L7YA 4KIKA 3A9JB 4M8MA 4FHKA 3GZNI 1E8ZA 3SHQA 4TKNA 1S1QB 2JZZA 1V6EA 1IYFA 1IP9A 3HM6X 3U7DA 2CS4A 2MCNB 2ZCCA 1WXMA 3PSEB 2KLGA 5CHFA 4W9LA 4HLEA 4NJ6A 3QAQA 3A1QB 2GOWA 2JUOA 5AZGA 4IWOA 5FR6A 3UF8A 3VDZA 3PT2B 4ZRJA 3VAWA 1PQSA 2JVCA 1FXTB 2ZCBA 4W9JA 3EFUA 2R2OA 2NVUI 4PYZA 4PYUA 1EF5A 4E3CA 1WX9A 1KM7A 3DVGX 5D2MB 3PHXB 4WJNA 3PV1A 3QA8A 2C60A 3APFA 2FIFA 2PPHA 5AEKB 2HJ8A 2JXXA 2OJRA 3OJ4B 3UQAA 3DCGA 1WGYA 2L7RA 2AEHA 5D94A 4A3PA 5IA7A 4MSQB 2N1VA 4BVUC 1WX8A 4DHJD 2PE6B 2N4FA 2LGDA 4K7WA 2K25A 2XK5B 2DZMA 3JVZX 2D07B 2JPHA 1JRUA 2DAFA 2KMAA 3OJ3A 2NPTB 4WAAA 4P7IA 3BINA 2LRUA 4KSKC 3NS8A 2MBOA 3O65B 4DHZB 4CHKA 4TQ0A 4M0WB 1P1AA 4K7UA 1V9JA 4EZJA 2KDBA 2O6VD 1H4RA 2KKCA 1LQBA 1Q0WB 3UINB 2KFJA 2PJHA 3H7SA 3RT3B 2GBJA 1J8CA 1I42A 4MDKE 4EUTA 4XZ4A 2LD9A 4WJPA 1P3QU 3EHVA 4MJSA 2C9WB 1WR6E 2FNJB 2KDIA 2W9NA 4W9HA 3PPAA 3S2AA 2J0MA 2KQSA 3L54A 3ZNZB 4EZLA 4HDQA 2Z0DB 2K6QA 3H6NA 2MBBB 3KUZA 4NNJB 4HVBA 3B0AA 1WFYA 4HPMB 3UQBA 5G2NA 2LVPA 1UELA 3KUDB 1EO6A 4AP4C 3IFWB 1WM2A 1E7UA 1E90A 2CR5A 2KJRA 3A9KB 4NY0A 2DX5B 2HE7A 2KC2A 3PLVA 5CHWA 2CHWA 2NBUA 3AU4A 3ALBA 4MH0E 3DOWA 2JY6A 1NDDA 1WE7A 1GC7A 1YQBA 2KOXA 3DVNV 4ICVA 4M8NA 4HCPB 4EOYA 4GDKA 4N9F4 4PS7A 1E8WA 2KDEB 3X0WA 4EEWA 5HKHA 1GJZA 2O2VB 4FJYA 3SDLC 4GSWA 4RM8A 2DZJA 4OVUA 1T0YA 2N9PC 3VUXA 2M17A 2LXCA 2MLBA 1TBEA 4W9DA 1WGGA 4URKA 4I6LB 3WALA 4KDIC 2KWCA 1P98A 4GDLA 3UGBB 4GMVA 3ZO5B 4BKTA 4X57B 2KK8A 2MP2B 3W1YA 3WAPA 3ZNHB 4ZYNA 5AZFA 2ZJDA 5J2RA 2GBKA 3VTUA 2ZVNA 3DVNU 3CSFA 4BKGA 2NCNA 3JSVA 2EKEC 2O6VA 2DZKA 2MRPA 3L16A 5TR5A 2MX2A 2RR9A 1YX6B 3NY5A 3V60A 3VTWA 4JL9A 4B95A 1OTRB 2WYQA 3ZUNA 1GC6A 4FULA 2MBEA 2K6DB 4AOFA 3C0RB 3KVFB 3QIJA 4GB9A 3ZKJC 4HCNB 2NS5A 2I1KA 2KFKA 2KX0A 3M63B 1V2YA 4HDOA 4K81A 4CYEA 1WY8A 1RFAA 2IO2B 2G4DB 1XD3B 3L13A 1WMHB 3R66C 2V1YA 4IW0A 4MGYE 2KVRA 3DPDA 4DK5A 4MGZE 3PRPB 4GIVA 3M95A 2MA9B 4KZ0A 3D32A 4GXBA 4F8CB 3R3MA 2L0FA 4XX5A 1SGHA 4EFOA 3HHMA 4LJOB 4G0NB 1RRBA 1G6JA 4FN2A 1OGWA 1V5OA 1F9JA 5L95C 1ISNA 2R2QA 4HJKA 4ANVA 2KWUB 2DZIA 4G50A 4NAWB 5J17A 2PEAA 3A4SC 1RLFA 4B9KA 2RD0A 2ZZPB 2K8CA 1IPGA 2LXAA 1WI0A 1Q1OA 2RPQA 2WX1A 3NOBA 2KN5A 4HWIB 2KO3A 2LGXA 5LXIB 2ZNVB 1GNUA 1WE6A 2LJ5A 2WX0A 1GG3A 2ASQA 5DCNA 4J6IA 3TIXA 3VH3B 5CTRC 2LGYA 4E74A 2NBWB 2RGFA 4JQWC 3TL5A 2GMIC 3ML9A 5DPSA 2WWZA 1R4MI 1KJTA 3KYDD 4TUUA 2EMTA 3M62B 4LJPB 5D7GA 4II2B 2MSED 2KTRB 2J0JA 2MWSB 1LM8B 1SE9A 1V81A 3U30A 5G55A 3IG3A 1WXAA 4W9KA 1H8CA 1WGRA 3U8ZA 1A5RA 1YD8U 3L10B 4TQ1A 3IHPC 2REXA 4F7ZA 3OLMD 1LFDA 1R4NI 2MQJA 4BBNF 4DWFA 5JHAA 2HD5B 4IM0A 1EF1A 1WXVA 2MBQA 5JZEB 2D10A 1E8YA 1WJNA 3IVFA 5DPTA 2J0KA 2GBRA 5E6OA 2Z59B 2AL6A 2JF5A 2L3ZA 3B08A 4LDTB 2Y5BB 2V4LA 5JHBA 2M1MA 3KW5B 4K1RB 3A9KA 4EKUA 4FADA 3PTFC 2JZ3B 2FCSA 3R7QA 1YIWA 2KMCA 4MJSB 1WR1A 3ZTDA 1Z5SB 4GGQA 4AWJA 1UBQA 3DBLI 1WJ6A 1SIFA 2FUHB 4DDID 2KHWB 2DENB 3APCA 2L00B 1P9DU 2C5LC 3DBRI 4F1SA 2EMSA 1UGMA 2LVQA 4HXDA 3H7PB 2WDTB 4YL8A 1V49A 4CO7A 3N30A 1V86A 3WA0A 1UZXB 2UYZB 2J7QB 3WAMA 2BKFA 2L76A 1E8XA 2KTFA 1J0GA 2D3GA 2V3SA 2GBMA 4TV3A 2FCNA 3A33B 5DPWA 4BFRA 2MP2A 4FJVB 4B6WA 3QARA 4ICUA 3MTNB 4W9FA 3P2BA 4NQLB 2K8HA 2D11A 3PS6A 1TGZB 2G4SA 2KXJA 2YLMA 3JYUA 1CMXB 4MGIE 4BOSC 2CHXA 2CU1A 4W9IA 1C1YB 4K7SA 4BBNC 3AU5A 1L2NA 2A5UA 3N3KB 3NZSA 1OEYA 1WJUA 2M4NA 2N9XA 3T9LA 2LASA 1BT0A 3AXCA 2C7NB 2K39A 4DBGA 4DHJB 3DBHI 2NR2A 3QC8B 1WXSA 1QZEA 2G3QB 2ZPYA 4WQOB 2MW5A 5E6PA 3VUYA 4MGKE 3K9OB 4HPLB 4FBJB 2DHZA 3QHTA 4E71A 2JT4B 3W1SA 1RAXA 3A9JA 4W9CA 2KLCA 3SD5A 4DXAB 3PREA 1V80A 3JW0X 5CHVC 3RYTA 1UBIA 1XQQA 1Y8RC 2IO3B 2O6VB 4A3OA 4MM3A 1WF9A 3KYCD 4G11A 1U4AA 2BF8B 1NI2A 2DYBA 1Z2MA 3H9DA 2BYEA 3PLUA 2BGFA 5GMVA 2IZVB 3A1QA 3X23A 3UIOB 2KWVB 2DAJA 4RM9A 3NHEB 3VHTC 4KIKB 3ZIMA 3QK0A 3KUCB 5LXHA 2KFKB 3OAWA 3Q3FA 4NAWA 4WWNA 3V62A 2IBIB 4ANWA 3NZUA 1GUAB 1WX7A 3TCAA 3WIMA 2I1JA 4ANXA 1V5TA 2IYDB 3IBEA 3VXWA 2KZRA 3K9PB 2LZ6A 3QWZB 2L0TA 3TJPA 3H1UA 3ZRCA 2JRIB 4ZRKA 2IY0B 3RZFA 2AYOB 3VVWB 3WANA 4BOZB 1WGDA 1WZ0A 4KSLC 1HE8A 1X1MA 1EUVB 4FLHA 2K8BA 5J18A 4IWQA 1KLVA 3PRMB 2FAZA 2MBHA 2ZEQA 4FJZA 3TMPB 1WGHA 4AJWA 2XK5A 3CMMB 3ZRFA 4DHZE 3Q3JA 2BYFA 2ZPNA 2NPTA 3VH4B 3A4RA 5JH5C 4I6NB 5EDSA 3L17A 2KQ7A 3ZDTA 3ZTCA 4IC7B 3V6CB 2G45B 5IAAC 2FCQA 2KANA 3ZW3A 3GOEA 3T8MA 4KDLB 4ANUA 2KTRA 5CX3A 3PVLA 1YJ1A 1OEYJ 3R7RA 3B1LX 4WWPA 1WYWB 2BYVE 4MEMA 3V6EB 2IO1B 5E6NA 3L08A 3HK0A 3W1SC 2KDFB 3ONSA 1E7VA 4FHJA 4NPNA 2LWPA 2L8JA 2KJHB 1OQYA 3DQVA 2BWFA 3ML8A 1WM3A 1C3TA 5KHOA 2K1FA 1P0RA 4KV2A 4IM2A 3DVGY 2KX3A 3MHSD 2JRHA 4KVGB 4GU2A 3LDZE 2IY1B 1KOTA 3HIZA 1K8RB 3PRZA 1ZW7A 1WJ4A 4PS8A 1WH3A 2XBBC 3ECIA 5LLIA 2LUEA 3LJ3A 2N7DA 3VTVA 2BKRB 4BKSA 2KD0A 2FIDA 1S3SG 2A4ZA 4IWPA 4ASWC 2DYMA 1Q5WB 3APDA 2RSUA 2IO0B 2KNBA 4ZDVA
chains in the Genus database with same CATH superfamily
3EUB2 2ZW1A 3UIPB 3P4QB 5AZHA 4GN1A 3VQIA 1XCQL 2QIEB 2RMMA 2W54A 2D2QA 4G3XB 3IT6B 3TEXA 2AWTA 2LVOA 1ZKHA 3N1ZC 5C1ZA 1AARA 1TZOA 2MHJA 3RULA 3PZDA 1TTNA 1VD2A 3N9YC 1ZGUB 3Q6BA 1PGAA 1WZ3A 4MT5A 3ZDMC 4ZOHC 2JU6X 2WDVB 4IUMB 1EWYC 2UWQA 3O13A 3MP9A 3VR8B 2CHZA 2INCC 1FFUA 3M3JA 5EE3A 1P7FA 3Q3MC 2L05A 4GDLB 5D6JB 3RD2A 3BY4B 3TBLD 1V8CA 1ET6A 1M94A 1N63A 3EECA 5DPRA 1BUIC 2JWZA 4KKIA 1ROEA 4W9EA 2C7HA 2J4XA 1T0SC 1MVKA 3JSVB 1N6ZA 4HK2A 1WMHA 5KHQA 1TZ1A 1UNSA 1V97A 1TS3A 4NQKE 4II3B 4YT0B 4JGHB 2BPSA 5C23A 3ZLZA 4REZA 4KIKA 3P42A 5BYRA 1QOFA 3IT4B 1V6EA 1IYFA 1C77A 1PGBA 3U4EG 3ZJUA 3KWVA 4L23A 2AX5A 1HQRD 3QAQA 1B9RA 2JUOA 4LK0M 1XLQA 3PT2B 3VAWA 2IDYA 4CQNA 1EF5A 3RI7C 2WXJA 3AE3B 3P4PB 3BVZA 3PHXB 3APFA 1L6UA 1DGJA 1TS4A 2BQQA 1DOYA 2J53A 1WGYA 2L7RA 4KX6B 4HJGE 2JWUA 2BW2A 1PDXA 3JVZX 3OJ3A 2JPHA 2DAFA 2NPTB 4P6VF 4NAMA 1LO5D 3NS8A 2MBOA 3MHZA 4DHZB 4TQ0A 1P1AA 2KDBA 3UINB 3H7SA 1J8CA 4M01A 5IN7A 3KQ4A 1P3QU 2C9WB 2FNJB 2KDIA 3PPAA 3L54A 3ZNZB 2CJNA 3H6NA 1EWCA 1K52A 3ZJTA 4RF0A 5G2NA 1SEBD 1MPEA 3NS1A 4S17A 4NY0A 2KC2A 5G5HA 2CHWA 1YQ4B 3DOWA 1YQBA 2KOXA 3ZXRA 1E7PB 4HCPB 2WS3B 4ZHOA 2DBYA 4GDKA 1JROA 4FJYA 2DZJA 1B1ZA 3BYTB 2INPE 4URKA 4I6LB 1YQ3B 1KH0A 1JALA 1P98A 3UGBB 1HZ5A 1GPXA 5AUKA 4BKTA 2KK8A 2MP2B 3WAPA 3DVNU 4BKGA 1K50A 2DZKA 2MRPA 3L16A 2BB6A 4JWUC 3NY5A 4B95A 1FPYA 4JL9A 1C78A 1GC6A 3FILB 5AUIA 1GB1A 2MBEA 2IPKD 2H88B 3KVFB 2N7JA 4GB9A 5E6JA 4HDOA 1WY8A 5BYQA 3ZGZA 1XD3B 3L13A 4IW0A 2KVRA 4GIVA 4KZ0A 2IGGA 1ACCA 2Y3AA 1AWDA 1SGHA 1K51A 1RRBA 3R8BA 2FBWB 1PYWD 3BVGA 4G50A 3AN1A 4B9KA 1JWSD 2Y5PA 1WI0A 1Q1OA 2LGXA 5LXIB 1GNUA 1SE4A 1WE6A 1GG3A 2NBWB 2RGFA 2KMMA 3DWGC 5DPSA 1R4MI 1KJTA 3KYDD 4OZAA 3W9CB 5D7GA 2KTRB 1V81A 2CU3A 3GS2A 1WXAA 3U8ZA 3SEBA 3Q14C 1YD8U 3IHPC 4F7ZA 3OLMD 3Q69A 4BBNF 1JWUD 2Z59B 2IJ0A 2AL6A 4LDTB 2Y5BB 5JHBA 3KW5B 4K1RB 1V1PB 3IXSA 2JZ3B 3T3OA 2BS3B 4MJSB 4AWJA 1CQVA 2VH2A 2X8XX 1FCCC 2L00B 2FUG1 2C5LC 1UUPA 2EMSA 2LVQA 4HXDA 3Q2AC 1UZXB 2J7QB 2KTFA 1J0GA 2BS4B 3V05A 3A33B 5DPWA 4B6WA 4ICUA 1IGCA 4ITKA 3W5VB 3AE4B 3PS6A 1VR9A 2KACA 1TGZB 1M4VA 4BOSC 4MGIE 4W9IA 4JWSC 1L2NA 1L6VA 1JWMD 3NZSA 1OEYA 3T9LA 2LASA 3AXCA 4DBGA 2WXMA 3RNEC 1RFKA 4TMAB 2G3QB 4WQOB 3VUYA 4N58A 4FBJB 3SFDB 2DHZA 2RDBC 1SB3C 3QHTA 4E71A 2NMQA 3RNBC 4W9CA 1YMHE 3PREA 1V80A 2QILA 3JW0X 3RYTA 1XQQA 1Y8RC 1RWSA 1WF9A 3KYCD 3GB1A 1C79A 1F1HA 3MC8A 3PLUA 4XDCA 3LB8C 2BGFA 5GMVA 3Q8EA 3X23A 3BYYB 3VHTC 4KIKB 3NVYA 3KUCB 5LXHA 1SF0A 3NZUA 4FXCA 3WIMA 2BB5A 2EELA 4ANXA 2IYDB 2ICIA 3AV8A 2BBCA 2L0TA 3AE5B 5T8IA 3TJPA 3H1UA 4ZRKA 2IY0B 2WXKA 3RZFA 4RH6A 1WGDA 1UGJA 4KSLC 2HJ1A 2BVCA 5J18A 1KLVA 4FJZA 2BYFA 2NPTA 1QOAA 1IGDA 5EDSA 2KQ7A 3ZDTA 2GI9A 2FCQA 4KDLB 1YJ1A 3B1LX 5BMHA 2LGIA 3RNGC 1BMLC 3HK0A 2LGSA 2KDFB 3ONSA 2D5GA 3W1SC 4NPNA 2WGSA 4LTUA 2LHEA 3ML8A 1C3TA 1P0RA 4KV2A 4AS1A 2KX3A 2JRHA 4C00A 2IY1B 1K8RB 1WJ4A 3ECIA 2FIDA 4ASWC 2DYMA 2RSUA 2KNBA 1I4RA 4FA6A 3SU8X 1XF5L 2KYWA 1L0YB 2LI5A 1J7AA 2KC1A 3QX1A 1NBFC 2VRRB 3AI5A 3MC0B 3H7PA 4PS3A 4YWGG 4DDGD 3VR9B 2AQ2B 4JIOU 2I38A 3CIRB 4RMAA 1NI3A 1J7BA 3ZVVA 4A9AA 4ZRIA 2GBNA 4I6PA 4GDKB 4YTMB 3N32A 1QLBB 2N7EA 1LXDA 3ZXVA 2NBVB 2GB1A 3WAOA 1XXGA 4AJYB 3OG5A 1UWXA 2M0XA 2FCMA 1MG4A 1J7CA 1Q10A 3FILA 4KZCA 4XC2A 4MSMB 3HM3A 4GOCA 3IAS1 2B3AA 2M56B 2LEKA 4ZYSA 1MG8A 4EZKA 2LUMA 4UDUC 3QCAA 3DDCB 1WRDB 3AE8B 2WHIA 3V61A 2QDFA 2Z0EB 3DBLB 4OZCA 2W3RA 3HVDA 1L7YA 3DBRB 3NJTA 3GZNI 1E8ZA 4WH4A 4TKNA 1IP9A 3HM6X 3U7DA 2CS4A 2D3AA 2KLGA 1CZPA 4W9LA 3AEFB 2GOWA 3LXFA 3UF8A 3TEZA 1PQSA 1FXTB 1FRRA 1FXIA 3AEEB 3EFUA 4PYUA 1YOVB 3Q8CA 3DVGX 4WJNA 2C60A 2PPHA 2OJRA 4LLGM 2BS2B 3DBHB 3OWEB 2AEHA 1WXQA 4JE3B 1TIFA 4DHJD 2PE6B 2N4FA 2K25A 2DZMA 2KMAA 4P1BC 3AM9A 4WURA 4CHKA 1L0XB 1V9JA 4EZJA 2O6VD 1H4RA 1I4QA 1LQBA 2H89B 3WCQA 1NENB 2K0PA 2VZKD 2GBJA 2LD9A 4WJPA 4AQ7A 4MJSA 1FNWA 1WR6E 2N0SB 3GE3C 2Z0DB 4BAXA 2MBBB 1RYJA 4NNJB 3PO0A 4HPMB 3EGRA 1JW9D 1EO6A 2CR5A 4L1BA 4ZHPA 2N9KA 5D3DA 4MH0E 1GC7A 3AE9B 1E6EB 2WU2B 2KDEB 1T0QC 3X0WA 4EEWA 4RM8A 2N9PC 2M17A 2MLBA 4DQOC 1FEHA 3WALA 2KWCA 3UI3A 3ZO5B 4X57B 1PUTA 4HKQA 2GBKA 1YN4A 1UWMA 2WQYB 2NCNA 4ZRPA 2EKEC 1N5XA 1ZDXA 2MX2A 4RGOS 2RR9A 5EE9A 3ZUNA 3C0RB 4MACA 2WXFA 2I1KA 3PZ8A 1V2YA 4K81A 4CYEA 3AE1B 2MA9B 4GXBA 4F8CB 2OEDA 5HHDG 4XX5A 1GOZA 3RN9C 1G6JA 4FN2A 1VRAB 1F9JA 5L95C 2R2QA 4ANVA 2KWUB 1L4ZB 2PEAA 1RLFA 1YN3A 2ZZPB 1FM0D 2K8CA 4RFBA 1PGXA 3Q8BA 2KN5A 2PVGC 2KO3A 2ZNVB 4WAFA 3VH3B 2LFIA 3FC4A 2E3TA 4J6IA 3R2TA 3HVZA 4E74A 2EKIA 2L32A 1F0ZA 4JQWC 3HRDD 3ML9A 1TT5B 3U2SC 3MJ5A 2WWZA 2EMTA 3M62B 2VH1A 4M0WA 2J0JA 3MFGA 3B9JA 2I2YA 2DNFA 1SE9A 5G55A 1OQQA 3IG3A 1H8CA 2NTTA 3MC9A 4O1NA 1A5RA 1R4NI 1XEEA 2MQJA 5JHAA 1EF1A 1WXVA 5JZEB 1EU4A 4P1CC 2J42A 2PMVA 4OVZA 1TY0A 2JYTA 3PTFC 2KMCA 1WR1A 5BMIA 2RDGA 3ZTDA 4XGAB 4GGQA 1MHHE 5FK9C 4DDID 2DENB 3ZQ4A 3APCA 4OZBA 4F1SA 3AE7B 3H7PB 4K3BA 2WXIA 3GP7A 3N30A 1V86A 2KQ4X 4XYCA 5BMGA 4RF1A 3WAMA 2BKFA 4N6EB 2GBMA 2D3BA 2FCNA 4TV3A 2BT6A 3GE8C 3MTNB 4W9FA 3P2BA 2D11A 2HDEA 2AQ1B 2KXJA 1ZPSA 4LNIA 3BK1A 1C76A 3VRAB 2A5UA 3HUIA 2N9XA 1BT0A 2K39A 1TS2A 2MW5A 3NUHB 4HPLB 3ZYYX 1RAXA 2KLCA 4LNOA 2IO3B 4A3OA 2QJLA 1SIJA 1NI2A 3H9DA 1Z2MA 3UIOB 2KWVB 2LHDA 4RM9A 3OAWA 4WWNA 3V62A 2IBIB 1WX7A 1ET9A 3TCAA 1FIQA 3IBEA 3Q3OC 3QWZB 4DXFA 1QT9A 2MH7A 3ZRCA 3VVWB 1EUVB 2K5PA 2INDC 2MBHA 3Q3JA 2ZPNA 5JH5C 3Q3NC 1YNTE 3L17A 3ZTCA 2MJ3A 4IC7B 3V6CB 5IAAC 3ABVB 3ZW3A 4OW0A 3U7ZA 3AMZA 1WYWB 2BYVE 3L08A 4FHJA 1E7VA 2L8JA 3EA6A 4XWTA 1I4PA 1WM3A 1K53A 3AH7A 4IM2A 2MEKA 4WIPA 3HIZA 1ZW7A 4PS8A 2XBBC 1S3SG 2A4ZA 1D4BA 3APDA 2K3UA 2IO0B 2ON8A 4ZDVA 2ZVOA 4WWOA 1L4DB 2PVOD 2BWES 3I3TB 2W55A 1TYGB 1UD7A 1KFYB 4C4VB 1FO4A 1XLOA 2QEJC 1I4GA 3QQ8B 4K3CA 3KH0A 4WJQA 3QJZA 3VUWA 4MELA 1JWBD 2WLBA 1E5WA 2AL3A 1R4MB 3RCZA 3PZ7A 2W82A 3L4PA 3W5UB 2GRIA 4XE0A 3VFKA 4NZLB 2OHFA 2V0GA 3AULA 4W9GA 2DYOA 4LCDE 2PIAA 3MJWA 2QCZA 4EE2A 1UH6A 5L83A 4IG7B 3ZNID 4JLCA 1I4HA 1D3ZA 4AUQC 2KJ6A 3DBSA 1WIAA 4A20A 1MHXA 3A9JB 1ZDVA 1Y56A 4M8MA 1IBXA 3I5JC 2KVZA 2MCNB 4MM3B 1DYQA 1T3QA 4TSSA 3PSEB 3AE6B 4NJ6A 5FR6A 3SR6A 3VDZA 2ZCBA 2R2OA 4YXDB 1FFVA 1KM7A 1VLBA 3QA8A 2FIFA 5AEKB 2HJ8A 3UQAA 2WXGA 1VZ6A 2WXHA 2XNAC 4A3PA 1WYGA 1D6EC 2N1VA 4BVUC 1WX8A 2LGDA 2XK5B 5HG2A 4WAAA 3NRZA 2PLPA 2JQRB 3P4SB 4P7IA 3BINA 4KGRA 4KSKC 3O65B 1ZUD2 4M0WB 4K7UA 1L0VB 3EFCA 1Q0WB 2KFJA 2QC8A 4KGTA 2PJHA 4XZ4A 1KRHA 3NVWA 3EHVA 1N60A 4RGNA 4W9HA 2KQSA 4EZLA 2KAJA 1NYRA 1KTKA 4HVBA 2V3NA 3NZ3A 4AP4C 2WP9B 1FRDA 1E90A 2DX5B 2HE7A 2BTEA 2NBUA 1A70A 3AU4A 3ALBA 1NDDA 1WE7A 3DVNV 4ICVA 4M8NA 1NEKB 4EOYA 5HKHA 1GJZA 2O2VB 3SDLC 4GSWA 2LXCA 4D2KA 4KDIC 1JQ4A 4GMVA 1QOBA 5IOIA 4B0EA 3TEWA 3W1YA 3ZNHB 4R3DA 5FKAC 4ZYNA 3RPFC 5J2RA 3VTUA 1RM6C 3CSFA 1ZP0B 4S0RA 5IO9A 1YX6B 4PK1A 3V60A 1OTRB 1VJKA 3ZJVA 2B76B 4Q2JA 4HEA1 4LNKA 3AE2B 2V3PA 3QIJA 3ZKJC 4HCNB 4QAYA 2G4DB 3R66C 4MGYE 1VZ8A 2L0FA 3R3MA 4LJOB 1OGWA 1V5OA 1EM7A 1ISNA 4HJKA 1E9MA 5HFYA 2XN9C 1IPGA 2LXAA 1KLGD 3BZDB 2LJ5A 5DCNA 5CTRC 3DHIC 1MFWA 1STEA 2GMIC 1SBBB 2W3SA 4LJPB 1SJHD 2JX5A 1ENFA 2AQ3B 4W9KA 3V3XA 3GZNB 4ARCA 3SFEB 2RDHA 2HD5B 1HEZE 1N62A 4GLSC 2D10A 5E6OA 3IVFA 5DPTA 2J0KA 2GBRA 4C4VA 4LNFA 4RGTA 1FMAD 2JF5A 3B08A 2L3ZA 1SE2A 2G9HD 1YJIA 2V4LA 1AYFA 1ZE3D 3A9KA 4EKUA 3FAHA 3N1YC 1YIWA 1Z5SB 1UBQA 1WJ6A 1P9DU 3LYYA 1UGMA 3Q8AA 3P1MA 1HXYD 4M00A 4CO7A 1T5XD 4N59A 3E56A 1E8XA 2V3SA 1VZ7A 1FXAA 4NQLB 3JYUA 4JPSA 2UU7A 2QSDA 4K7SA 5MPOA 3AU5A 3N3KB 1WJUA 4J3OD 4DHJB 3C19A 3QC8B 1WXSA 4BZAA 1QZEA 2ZPYA 1WWTA 1XLPA 1HA5A 4MGKE 3NG0A 4C7ZA 3KWLA 1C4CA 3W1SA 3A9JA 3SD5A 1GB4A 4DXAB 1WSPA 2INNE 3P63A 2O6VB 3W2DA 1MI0A 4MM3A 3DHHC 1EU3A 5G5GA 2BF8B 2VZKB 2BYEA 3BVMA 2R61A 2FE8A 1C4AA 1PFDA 2WXLA 3QK0A 1IBXB 2KFKB 3Q3FA 4NAWA 2E6XA 2J52A 1GUAB 3RNAC 1V5TA 1WGKA 3VXWA 5C3JB 4E3CA 3WANA 1WZ0A 1HE8A 1QKZA 4ZRQA 5FR3A 4IWQA 4ACFA 2ZEQA 1WGHA 1MJDA 2XK5A 1BXTA 4DHZE 2N9LA 4I6NB 2CJOA 1F2RC 5I4DA 2YEPF 2KANA 3GOEA 3T8MA 3ETRA 4ANUA 5CX3A 1OEYJ 1WRIA 1ZXIA 3AEBB 5JXVA 3V6EB 3VRBB 2IO1B 4HPPA 1KLUD 3FKYA 5E6NA 2K9XA 2KJHB 3DQVA 1N61A 2K1FA 2M19A 4KVGB 5BYSA 3LDZE 4HKZE 1KOTA 1FNUA 2WDRB 1T0RC 3N1XC 2LUEA 5LLIA 2N7DA 3VTVA 3E9SA 3Q8FA 5C2TB 1N5WA 2WXOA 1XLNA 2N9EB 4OHJA 1DOXA 2YVCA 3ZNGC 2QHOA 3PGEA 4YTPB 2PE9A 3RUIB 2JZPA 2N1WA 2O2VA 2WDQB 2ZNVC 1J19A 2CKHB 4IM3A 3ENEA 3L0WB 3NVVA 5BO4B 1VCBA 3RNFC 3EC8A 4JX1C 1NVID 3CSTA 4RGMA 4WJOA 1I4XA 4OVVA 1YX5B 1GAQB 3RZWC 2IGDA 3RNCC 1R4NB 2D3CA 2C7MB 2XEWA 3I57A 2LRWA 4NJ7A 3CF6E 1XT9B 2HTHA 3PHWB 2Y5CA 2NTSA 2OOBB 2M8SA 1I7HA 4LDTD 3RMKC 1JRPA 1I35A 3AEDB 4BKSD 4KGSA 1L5PA 1SSNA 4B0MA 1NYQA 2MJEA 4H2AA 4FHKA 4IKGA 3SHQA 1S1QB 2JZZA 3AB5A 2ZCCA 1WXMA 5CHFA 4HLEA 4YTNB 1DOIA 3A1QB 5AZGA 4IWOA 2WXQA 5IA7A 4ZRJA 2JVCA 4W9JA 4PYZA 2NVUI 2Z8LA 3B2GA 3NVZA 1WX9A 5D2MB 3PV1A 4A8XC 1SXTA 1OQRA 4YSYB 2BYTA 2JXXA 3I63C 3OJ4B 5HI1A 3DCGA 4NJCA 4PT5A 2L52A 1TKGA 5D94A 4MSQB 2SEBD 4US9A 2YEPB 4K7WA 2D07B 1JRUA 3IAM1 1T6BX 2LRUA 1JMLA 1D5MC 2KKCA 3BWUD 4M02A 4US8A 3RT3B 1I42A 4MDKE 4EUTA 1D5ZC 2PKOA 2W9NA 3DWMA 3S2AA 2J0MA 1CK1A 4HDQA 3P4RB 2K6QA 3KUZA 3B0AA 1ZXHA 1WFYA 3UQBA 2LVPA 1UELA 3AEGB 3KUDB 2KDMA 1E0ZA 3IFWB 1WM2A 1TS5A 1E7UA 2KJRA 3A9KB 3PLVA 5CHWA 5GXGB 3J9CA 1P7EA 2JY6A 1FCLA 4DXGA 2KN4A 1JCKB 1AW7A 4PS7A 4N9F4 1E8WA 4OVUA 3VUXA 1T0YA 5LNK1 1TBEA 2WXNA 4W9DA 2KT7A 1WGGA 2LMCA 4GDLA 5H8YE 4MH8A 1TKEA 5AZFA 2ZJDA 2ZVNA 4C56C 1FNVA 3JSVA 2O6VA 5EE0A 5TR5A 2DLBA 3VTWA 3R2IA 2WYQA 4FULA 2DWQA 2K6DB 4AOFA 1HTQA 1CJEA 3AEAB 2NS5A 2KFKA 2KX0A 3M63B 4YSXB 1ESFA 1RFAA 2IO2B 4A55A 1UF0A 2M0AA 1WMHB 2V1YA 3DPDA 4DK5A 4MGZE 3PRPB 2WXPA 3M95A 3D32A 3H8HA 4A6QA 4EFOA 3BK2A 3HHMA 4G0NB 2WU5B 4IOIE 4HRSA 2DZIA 4NAWB 5J17A 3A4SC 2L83A 4WQMA 4RNAA 2RD0A 4P16A 4RCOA 2RPQA 2WX1A 5D3IB 3NOBA 4HWIB 5TSSA 2IGHA 2LJIA 2WX0A 3TIXA 2ASQA 2ACZB 2LGYA 1ZOYB 4ARIA 2PW9A 3TL5A 1OFFA 1TY2A 2JSVX 2TSSA 4TUUA 4HROA 3B2FA 4IDIA 4II2B 2MSED 1R7SA 2MWSB 3C8YA 1LM8B 4YSZB 3U30A 1LGRA 4C80A 1WGRA 2ONQA 5H92C 3TUOA 3L10B 4TQ1A 2REXA 1LFDA 4DWFA 1YJJA 5IKCM 4IM0A 2MBQA 1E8YA 1WJNA 2SAKA 2M1MA 1QQRA 4FADA 3N20C 1F52A 2FCSA 3R7QA 2KWDA 1TKYA 3DBLI 1SIFA 2FUHB 1SE3A 2KHWB 2MJDA 3TEYA 3DBRI 4YL8A 2OJWA 2WDTB 1V49A 2G1EA 3WA0A 5IP4D 2UYZB 3AECB 1IUEA 2L76A 2D3GA 4BFRA 2MP2A 4FJVB 3QARA 2K8HA 2G4SA 2RPVA 2YLMA 1CMXB 1V1OA 2CHXA 3BIID 2CU1A 1C1YB 4BBNC 3CWIA 2M4NA 2C7NB 1HTOA 4USAA 2K22A 3DBHI 2NR2A 4L2YA 3RFZB 3KLSX 5E6PA 3K9OB 2JT4B 2JXTA 2PTLA 1C4PA 1XCTL 5CHVC 1YN5A 1UBIA 1QILA 1D5XC 4A90A 4G11A 1U4AA 1VDVA 2DYBA 2IZVB 1E10A 3A1QA 2ZW0A 2DAJA 1AN8A 3NHEB 3ZIMA 4C7YA 1QOGA 2WNMA 2WXRA 4ANWA 3TSSA 1F77A 2I1JA 2X38A 4WWMA 2KZRA 2V9HA 3K9PB 2LZ6A 3T3NA 2L1AA 2JRIB 2AYOB 4BOZB 1X1MA 3I9V1 2K8BA 4FLHA 3PRMB 2FAZA 3TMPB 4AJWA 3CMMB 3ZRFA 3VH4B 3A4RA 2JYEA 4KKJA 3U52E 1JWAD 2G45B 3URYA 1TJEA 2KTRA 1HZ6A 3PVLA 3R7RA 4WWPA 4MEMA 2V4IB 1XO3A 1QF6A 2LWPA 2HTME 2QMTA 1OQYA 2BWFA 5KHOA 1SJED 3DVGY 3MHSD 4LNNA 1C9FA 4GU2A 2GLSA 1KF6B 3PRZA 1FD6A 1WH3A 5EE1A 3LJ3A 4XDDA 1F2RI 2BKRB 2KD0A 4BKSA 3DHGC 4IWPA 1V1PA 1Q5WB 4XWWA 2Q5WD
chains in the Genus database with same CATH topology
2ZVOA 4FA6A 4WWOA 2N9EB 3SU8X 3UIPB 2BWES 5AZHA 2YVCA 4GN1A 3VQIA 3ZNGC 2QHOA 3I3TB 2LI5A 3PGEA 2PE9A 2KC1A 3RUIB 1UD7A 2D2QA 2N1WA 2O2VA 1NBFC 1J19A 2ZNVC 3QX1A 4G3XB 2VRRB 3AI5A 3QQ8B 2CKHB 3KH0A 2AWTA 2LVOA 3H7PA 3ENEA 4IM3A 1ZKHA 3QJZA 4PS3A 4WJQA 3VUWA 4DDGD 4MELA 4JIOU 5C1ZA 1AARA 3L0WB 4RMAA 1E5WA 3RULA 5BO4B 2AL3A 3PZDA 1TTNA 1VCBA 3RCZA 1VD2A 3ZVVA 3EC8A 1ZGUB 4ZRIA 2GBNA 4I6PA 4GDKB 3CSTA 1WZ3A 3VFKA 3N32A 3ZDMC 2N7EA 1LXDA 2NBVB 4WJOA 3WAOA 4IUMB 2UWQA 4OVVA 1YX5B 4AJYB 2CHZA 3RZWC 2M0XA 3AULA 3M3JA 4W9GA 2FCMA 2L05A 4GDLB 5D6JB 4KZCA 3RD2A 3BY4B 4XC2A 2DYOA 3HM3A 4MSMB 4LCDE 3TBLD 2C7MB 3MJWA 1M94A 4GOCA 3EECA 5DPRA 2JWZA 2XEWA 1UH6A 5L83A 2B3AA 2LRWA 4NJ7A 2C7HA 4W9EA 3CF6E 1MG8A 1XT9B 2HTHA 4IG7B 3ZNID 4EZKA 3JSVB 3PHWB 4HK2A 1WMHA 4JLCA 5KHQA 3QCAA 1TZ1A 3DDCB 1WRDB 2OOBB 2M8SA 4NQKE 3V61A 1D3ZA 4II3B 4LDTD 4JGHB 2KJ6A 4AUQC 2BPSA 3DBSA 1I35A 4BKSD 1WIAA 2Z0EB 5C23A 4A20A 3ZLZA 1L7YA 4KIKA 3A9JB 4M8MA 4FHKA 3GZNI 1E8ZA 3SHQA 4TKNA 1S1QB 2JZZA 1V6EA 1IYFA 1IP9A 3HM6X 3U7DA 2CS4A 2MCNB 2ZCCA 1WXMA 3PSEB 2KLGA 5CHFA 4W9LA 4HLEA 4NJ6A 3QAQA 3A1QB 2GOWA 2JUOA 5AZGA 4IWOA 5FR6A 3UF8A 3VDZA 3PT2B 4ZRJA 3VAWA 1PQSA 2JVCA 1FXTB 2ZCBA 4W9JA 3EFUA 2R2OA 2NVUI 4PYZA 4PYUA 1EF5A 4E3CA 1WX9A 1KM7A 3DVGX 5D2MB 3PHXB 4WJNA 3PV1A 3QA8A 2C60A 3APFA 2FIFA 2PPHA 5AEKB 2HJ8A 2JXXA 2OJRA 3OJ4B 3UQAA 3DCGA 1WGYA 2L7RA 2AEHA 5D94A 4A3PA 5IA7A 4MSQB 2N1VA 4BVUC 1WX8A 4DHJD 2PE6B 2N4FA 2LGDA 4K7WA 2K25A 2XK5B 2DZMA 3JVZX 2D07B 2JPHA 1JRUA 2DAFA 2KMAA 3OJ3A 2NPTB 4WAAA 4P7IA 3BINA 2LRUA 4KSKC 3NS8A 2MBOA 3O65B 4DHZB 4CHKA 4TQ0A 4M0WB 1P1AA 4K7UA 1V9JA 4EZJA 2KDBA 2O6VD 1H4RA 2KKCA 1LQBA 1Q0WB 3UINB 2KFJA 2PJHA 3H7SA 3RT3B 2GBJA 1J8CA 1I42A 4MDKE 4EUTA 4XZ4A 2LD9A 4WJPA 1P3QU 3EHVA 4MJSA 2C9WB 1WR6E 2FNJB 2KDIA 2W9NA 4W9HA 3PPAA 3S2AA 2J0MA 2KQSA 3L54A 3ZNZB 4EZLA 4HDQA 2Z0DB 2K6QA 3H6NA 2MBBB 3KUZA 4NNJB 4HVBA 3B0AA 1WFYA 4HPMB 3UQBA 5G2NA 2LVPA 1UELA 3KUDB 1EO6A 4AP4C 3IFWB 1WM2A 1E7UA 1E90A 2CR5A 2KJRA 3A9KB 4NY0A 2DX5B 2HE7A 2KC2A 3PLVA 5CHWA 2CHWA 2NBUA 3AU4A 3ALBA 4MH0E 3DOWA 2JY6A 1NDDA 1WE7A 1GC7A 1YQBA 2KOXA 3DVNV 4ICVA 4M8NA 4HCPB 4EOYA 4GDKA 4N9F4 4PS7A 1E8WA 2KDEB 3X0WA 4EEWA 5HKHA 1GJZA 2O2VB 4FJYA 3SDLC 4GSWA 4RM8A 2DZJA 4OVUA 1T0YA 2N9PC 3VUXA 2M17A 2LXCA 2MLBA 1TBEA 4W9DA 1WGGA 4URKA 4I6LB 3WALA 4KDIC 2KWCA 1P98A 4GDLA 3UGBB 4GMVA 3ZO5B 4BKTA 4X57B 2KK8A 2MP2B 3W1YA 3WAPA 3ZNHB 4ZYNA 5AZFA 2ZJDA 5J2RA 2GBKA 3VTUA 2ZVNA 3DVNU 3CSFA 4BKGA 2NCNA 3JSVA 2EKEC 2O6VA 2DZKA 2MRPA 3L16A 5TR5A 2MX2A 2RR9A 1YX6B 3NY5A 3V60A 3VTWA 4JL9A 4B95A 1OTRB 2WYQA 3ZUNA 1GC6A 4FULA 2MBEA 2K6DB 4AOFA 3C0RB 3KVFB 3QIJA 4GB9A 3ZKJC 4HCNB 2NS5A 2I1KA 2KFKA 2KX0A 3M63B 1V2YA 4HDOA 4K81A 4CYEA 1WY8A 1RFAA 2IO2B 2G4DB 1XD3B 3L13A 1WMHB 3R66C 2V1YA 4IW0A 4MGYE 2KVRA 3DPDA 4DK5A 4MGZE 3PRPB 4GIVA 3M95A 2MA9B 4KZ0A 3D32A 4GXBA 4F8CB 3R3MA 2L0FA 4XX5A 1SGHA 4EFOA 3HHMA 4LJOB 4G0NB 1RRBA 1G6JA 4FN2A 1OGWA 1V5OA 1F9JA 5L95C 1ISNA 2R2QA 4HJKA 4ANVA 2KWUB 2DZIA 4G50A 4NAWB 5J17A 2PEAA 3A4SC 1RLFA 4B9KA 2RD0A 2ZZPB 2K8CA 1IPGA 2LXAA 1WI0A 1Q1OA 2RPQA 2WX1A 3NOBA 2KN5A 4HWIB 2KO3A 2LGXA 5LXIB 2ZNVB 1GNUA 1WE6A 2LJ5A 2WX0A 1GG3A 2ASQA 5DCNA 4J6IA 3TIXA 3VH3B 5CTRC 2LGYA 4E74A 2NBWB 2RGFA 4JQWC 3TL5A 2GMIC 3ML9A 5DPSA 2WWZA 1R4MI 1KJTA 3KYDD 4TUUA 2EMTA 3M62B 4LJPB 5D7GA 4II2B 2MSED 2KTRB 2J0JA 2MWSB 1LM8B 1SE9A 1V81A 3U30A 5G55A 3IG3A 1WXAA 4W9KA 1H8CA 1WGRA 3U8ZA 1A5RA 1YD8U 3L10B 4TQ1A 3IHPC 2REXA 4F7ZA 3OLMD 1LFDA 1R4NI 2MQJA 4BBNF 4DWFA 5JHAA 2HD5B 4IM0A 1EF1A 1WXVA 2MBQA 5JZEB 2D10A 1E8YA 1WJNA 3IVFA 5DPTA 2J0KA 2GBRA 5E6OA 2Z59B 2AL6A 2JF5A 2L3ZA 3B08A 4LDTB 2Y5BB 2V4LA 5JHBA 2M1MA 3KW5B 4K1RB 3A9KA 4EKUA 4FADA 3PTFC 2JZ3B 2FCSA 3R7QA 1YIWA 2KMCA 4MJSB 1WR1A 3ZTDA 1Z5SB 4GGQA 4AWJA 1UBQA 3DBLI 1WJ6A 1SIFA 2FUHB 4DDID 2KHWB 2DENB 3APCA 2L00B 1P9DU 2C5LC 3DBRI 4F1SA 2EMSA 1UGMA 2LVQA 4HXDA 3H7PB 2WDTB 4YL8A 1V49A 4CO7A 3N30A 1V86A 3WA0A 1UZXB 2UYZB 2J7QB 3WAMA 2BKFA 2L76A 1E8XA 2KTFA 1J0GA 2D3GA 2V3SA 2GBMA 4TV3A 2FCNA 3A33B 5DPWA 4BFRA 2MP2A 4FJVB 4B6WA 3QARA 4ICUA 3MTNB 4W9FA 3P2BA 4NQLB 2K8HA 2D11A 3PS6A 1TGZB 2G4SA 2KXJA 2YLMA 3JYUA 1CMXB 4MGIE 4BOSC 2CHXA 2CU1A 4W9IA 1C1YB 4K7SA 4BBNC 3AU5A 1L2NA 2A5UA 3N3KB 3NZSA 1OEYA 1WJUA 2M4NA 2N9XA 3T9LA 2LASA 1BT0A 3AXCA 2C7NB 2K39A 4DBGA 4DHJB 3DBHI 2NR2A 3QC8B 1WXSA 1QZEA 2G3QB 2ZPYA 4WQOB 2MW5A 5E6PA 3VUYA 4MGKE 3K9OB 4HPLB 4FBJB 2DHZA 3QHTA 4E71A 2JT4B 3W1SA 1RAXA 3A9JA 4W9CA 2KLCA 3SD5A 4DXAB 3PREA 1V80A 3JW0X 5CHVC 3RYTA 1UBIA 1XQQA 1Y8RC 2IO3B 2O6VB 4A3OA 4MM3A 1WF9A 3KYCD 4G11A 1U4AA 2BF8B 1NI2A 2DYBA 1Z2MA 3H9DA 2BYEA 3PLUA 2BGFA 5GMVA 2IZVB 3A1QA 3X23A 3UIOB 2KWVB 2DAJA 4RM9A 3NHEB 3VHTC 4KIKB 3ZIMA 3QK0A 3KUCB 5LXHA 2KFKB 3OAWA 3Q3FA 4NAWA 4WWNA 3V62A 2IBIB 4ANWA 3NZUA 1GUAB 1WX7A 3TCAA 3WIMA 2I1JA 4ANXA 1V5TA 2IYDB 3IBEA 3VXWA 2KZRA 3K9PB 2LZ6A 3QWZB 2L0TA 3TJPA 3H1UA 3ZRCA 2JRIB 4ZRKA 2IY0B 3RZFA 2AYOB 3VVWB 3WANA 4BOZB 1WGDA 1WZ0A 4KSLC 1HE8A 1X1MA 1EUVB 4FLHA 2K8BA 5J18A 4IWQA 1KLVA 3PRMB 2FAZA 2MBHA 2ZEQA 4FJZA 3TMPB 1WGHA 4AJWA 2XK5A 3CMMB 3ZRFA 4DHZE 3Q3JA 2BYFA 2ZPNA 2NPTA 3VH4B 3A4RA 5JH5C 4I6NB 5EDSA 3L17A 2KQ7A 3ZDTA 3ZTCA 4IC7B 3V6CB 2G45B 5IAAC 2FCQA 2KANA 3ZW3A 3GOEA 3T8MA 4KDLB 4ANUA 2KTRA 5CX3A 3PVLA 1YJ1A 1OEYJ 3R7RA 3B1LX 4WWPA 1WYWB 2BYVE 4MEMA 3V6EB 2IO1B 5E6NA 3L08A 3HK0A 3W1SC 2KDFB 3ONSA 1E7VA 4FHJA 4NPNA 2LWPA 2L8JA 2KJHB 1OQYA 3DQVA 2BWFA 3ML8A 1WM3A 1C3TA 5KHOA 2K1FA 1P0RA 4KV2A 4IM2A 3DVGY 2KX3A 3MHSD 2JRHA 4KVGB 4GU2A 3LDZE 2IY1B 1KOTA 3HIZA 1K8RB 3PRZA 1ZW7A 1WJ4A 4PS8A 1WH3A 2XBBC 3ECIA 5LLIA 2LUEA 3LJ3A 2N7DA 3VTVA 2BKRB 4BKSA 2KD0A 2FIDA 1S3SG 2A4ZA 4IWPA 4ASWC 2DYMA 1Q5WB 3APDA 2RSUA 2IO0B 2KNBA 4ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO A;  4FA6 A;  4WWO A;  2N9E B;  3SU8 X;  3UIP B;  2BWE S;  5AZH A;  2YVC A;  4GN1 A;  3VQI A;  3ZNG C;  2QHO A;  3I3T B;  2LI5 A;  3PGE A;  2PE9 A;  2KC1 A;  3RUI B;  1UD7 A;  2D2Q A;  2N1W A;  2O2V A;  1NBF C;  1J19 A;  2ZNV C;  3QX1 A;  4G3X B;  2VRR B;  3AI5 A;  3QQ8 B;  2CKH B;  3KH0 A;  2AWT A;  2LVO A;  3H7P A;  3ENE A;  4IM3 A;  1ZKH A;  3QJZ A;  4PS3 A;  4WJQ A;  3VUW A;  4DDG D;  4MEL A;  4JIO U;  5C1Z A;  1AAR A;  3L0W B;  4RMA A;  1E5W A;  3RUL A;  5BO4 B;  2AL3 A;  3PZD A;  1TTN A;  1VCB A;  3RCZ A;  1VD2 A;  3ZVV A;  3EC8 A;  1ZGU B;  4ZRI A;  2GBN A;  4I6P A;  4GDK B;  3CST A;  1WZ3 A;  3VFK A;  3N32 A;  3ZDM C;  2N7E A;  1LXD A;  2NBV B;  4WJO A;  3WAO A;  4IUM B;  2UWQ A;  4OVV A;  1YX5 B;  4AJY B;  2CHZ A;  3RZW C;  2M0X A;  3AUL A;  3M3J A;  4W9G A;  2FCM A;  2L05 A;  4GDL B;  5D6J B;  4KZC A;  3RD2 A;  3BY4 B;  4XC2 A;  2DYO A;  3HM3 A;  4MSM B;  4LCD E;  3TBL D;  2C7M B;  3MJW A;  1M94 A;  4GOC A;  3EEC A;  5DPR A;  2JWZ A;  2XEW A;  1UH6 A;  5L83 A;  2B3A A;  2LRW A;  4NJ7 A;  2C7H A;  4W9E A;  3CF6 E;  1MG8 A;  1XT9 B;  2HTH A;  4IG7 B;  3ZNI D;  4EZK A;  3JSV B;  3PHW B;  4HK2 A;  1WMH A;  4JLC A;  5KHQ A;  3QCA A;  1TZ1 A;  3DDC B;  1WRD B;  2OOB B;  2M8S A;  4NQK E;  3V61 A;  1D3Z A;  4II3 B;  4LDT D;  4JGH B;  2KJ6 A;  4AUQ C;  2BPS A;  3DBS A;  1I35 A;  4BKS D;  1WIA A;  2Z0E B;  5C23 A;  4A20 A;  3ZLZ A;  1L7Y A;  4KIK A;  3A9J B;  4M8M A;  4FHK A;  3GZN I;  1E8Z A;  3SHQ A;  4TKN A;  1S1Q B;  2JZZ A;  1V6E A;  1IYF A;  1IP9 A;  3HM6 X;  3U7D A;  2CS4 A;  2MCN B;  2ZCC A;  1WXM A;  3PSE B;  2KLG A;  5CHF A;  4W9L A;  4HLE A;  4NJ6 A;  3QAQ A;  3A1Q B;  2GOW A;  2JUO A;  5AZG A;  4IWO A;  5FR6 A;  3UF8 A;  3VDZ A;  3PT2 B;  4ZRJ A;  3VAW A;  1PQS A;  2JVC A;  1FXT B;  2ZCB A;  4W9J A;  3EFU A;  2R2O A;  2NVU I;  4PYZ A;  4PYU A;  1EF5 A;  4E3C A;  1WX9 A;  1KM7 A;  3DVG X;  5D2M B;  3PHX B;  4WJN A;  3PV1 A;  3QA8 A;  2C60 A;  3APF A;  2FIF A;  2PPH A;  5AEK B;  2HJ8 A;  2JXX A;  2OJR A;  3OJ4 B;  3UQA A;  3DCG A;  1WGY A;  2L7R A;  2AEH A;  5D94 A;  4A3P A;  5IA7 A;  4MSQ B;  2N1V A;  4BVU C;  1WX8 A;  4DHJ D;  2PE6 B;  2N4F A;  2LGD A;  4K7W A;  2K25 A;  2XK5 B;  2DZM A;  3JVZ X;  2D07 B;  2JPH A;  1JRU A;  2DAF A;  2KMA A;  3OJ3 A;  2NPT B;  4WAA A;  4P7I A;  3BIN A;  2LRU A;  4KSK C;  3NS8 A;  2MBO A;  3O65 B;  4DHZ B;  4CHK A;  4TQ0 A;  4M0W B;  1P1A A;  4K7U A;  1V9J A;  4EZJ A;  2KDB A;  2O6V D;  1H4R A;  2KKC A;  1LQB A;  1Q0W B;  3UIN B;  2KFJ A;  2PJH A;  3H7S A;  3RT3 B;  2GBJ A;  1J8C A;  1I42 A;  4MDK E;  4EUT A;  4XZ4 A;  2LD9 A;  4WJP A;  1P3Q U;  3EHV A;  4MJS A;  2C9W B;  1WR6 E;  2FNJ B;  2KDI A;  2W9N A;  4W9H A;  3PPA A;  3S2A A;  2J0M A;  2KQS A;  3L54 A;  3ZNZ B;  4EZL A;  4HDQ A;  2Z0D B;  2K6Q A;  3H6N A;  2MBB B;  3KUZ A;  4NNJ B;  4HVB A;  3B0A A;  1WFY A;  4HPM B;  3UQB A;  5G2N A;  2LVP A;  1UEL A;  3KUD B;  1EO6 A;  4AP4 C;  3IFW B;  1WM2 A;  1E7U A;  1E90 A;  2CR5 A;  2KJR A;  3A9K B;  4NY0 A;  2DX5 B;  2HE7 A;  2KC2 A;  3PLV A;  5CHW A;  2CHW A;  2NBU A;  3AU4 A;  3ALB A;  4MH0 E;  3DOW A;  2JY6 A;  1NDD A;  1WE7 A;  1GC7 A;  1YQB A;  2KOX A;  3DVN V;  4ICV A;  4M8N A;  4HCP B;  4EOY A;  4GDK A;  4N9F 4;  4PS7 A;  1E8W A;  2KDE B;  3X0W A;  4EEW A;  5HKH A;  1GJZ A;  2O2V B;  4FJY A;  3SDL C;  4GSW A;  4RM8 A;  2DZJ A;  4OVU A;  1T0Y A;  2N9P C;  3VUX A;  2M17 A;  2LXC A;  2MLB A;  1TBE A;  4W9D A;  1WGG A;  4URK A;  4I6L B;  3WAL A;  4KDI C;  2KWC A;  1P98 A;  4GDL A;  3UGB B;  4GMV A;  3ZO5 B;  4BKT A;  4X57 B;  2KK8 A;  2MP2 B;  3W1Y A;  3WAP A;  3ZNH B;  4ZYN A;  5AZF A;  2ZJD A;  5J2R A;  2GBK A;  3VTU A;  2ZVN A;  3DVN U;  3CSF A;  4BKG A;  2NCN A;  3JSV A;  2EKE C;  2O6V A;  2DZK A;  2MRP A;  3L16 A;  5TR5 A;  2MX2 A;  2RR9 A;  1YX6 B;  3NY5 A;  3V60 A;  3VTW A;  4JL9 A;  4B95 A;  1OTR B;  2WYQ A;  3ZUN A;  1GC6 A;  4FUL A;  2MBE A;  2K6D B;  4AOF A;  3C0R B;  3KVF B;  3QIJ A;  4GB9 A;  3ZKJ C;  4HCN B;  2NS5 A;  2I1K A;  2KFK A;  2KX0 A;  3M63 B;  1V2Y A;  4HDO A;  4K81 A;  4CYE A;  1WY8 A;  1RFA A;  2IO2 B;  2G4D B;  1XD3 B;  3L13 A;  1WMH B;  3R66 C;  2V1Y A;  4IW0 A;  4MGY E;  2KVR A;  3DPD A;  4DK5 A;  4MGZ E;  3PRP B;  4GIV A;  3M95 A;  2MA9 B;  4KZ0 A;  3D32 A;  4GXB A;  4F8C B;  3R3M A;  2L0F A;  4XX5 A;  1SGH A;  4EFO A;  3HHM A;  4LJO B;  4G0N B;  1RRB A;  1G6J A;  4FN2 A;  1OGW A;  1V5O A;  1F9J A;  5L95 C;  1ISN A;  2R2Q A;  4HJK A;  4ANV A;  2KWU B;  2DZI A;  4G50 A;  4NAW B;  5J17 A;  2PEA A;  3A4S C;  1RLF A;  4B9K A;  2RD0 A;  2ZZP B;  2K8C A;  1IPG A;  2LXA A;  1WI0 A;  1Q1O A;  2RPQ A;  2WX1 A;  3NOB A;  2KN5 A;  4HWI B;  2KO3 A;  2LGX A;  5LXI B;  2ZNV B;  1GNU A;  1WE6 A;  2LJ5 A;  2WX0 A;  1GG3 A;  2ASQ A;  5DCN A;  4J6I A;  3TIX A;  3VH3 B;  5CTR C;  2LGY A;  4E74 A;  2NBW B;  2RGF A;  4JQW C;  3TL5 A;  2GMI C;  3ML9 A;  5DPS A;  2WWZ A;  1R4M I;  1KJT A;  3KYD D;  4TUU A;  2EMT A;  3M62 B;  4LJP B;  5D7G A;  4II2 B;  2MSE D;  2KTR B;  2J0J A;  2MWS B;  1LM8 B;  1SE9 A;  1V81 A;  3U30 A;  5G55 A;  3IG3 A;  1WXA A;  4W9K A;  1H8C A;  1WGR A;  3U8Z A;  1A5R A;  1YD8 U;  3L10 B;  4TQ1 A;  3IHP C;  2REX A;  4F7Z A;  3OLM D;  1LFD A;  1R4N I;  2MQJ A;  4BBN F;  4DWF A;  5JHA A;  2HD5 B;  4IM0 A;  1EF1 A;  1WXV A;  2MBQ A;  5JZE B;  2D10 A;  1E8Y A;  1WJN A;  3IVF A;  5DPT A;  2J0K A;  2GBR A;  5E6O A;  2Z59 B;  2AL6 A;  2JF5 A;  2L3Z A;  3B08 A;  4LDT B;  2Y5B B;  2V4L A;  5JHB A;  2M1M A;  3KW5 B;  4K1R B;  3A9K A;  4EKU A;  4FAD A;  3PTF C;  2JZ3 B;  2FCS A;  3R7Q A;  1YIW A;  2KMC A;  4MJS B;  1WR1 A;  3ZTD A;  1Z5S B;  4GGQ A;  4AWJ A;  1UBQ A;  3DBL I;  1WJ6 A;  1SIF A;  2FUH B;  4DDI D;  2KHW B;  2DEN B;  3APC A;  2L00 B;  1P9D U;  2C5L C;  3DBR I;  4F1S A;  2EMS A;  1UGM A;  2LVQ A;  4HXD A;  3H7P B;  2WDT B;  4YL8 A;  1V49 A;  4CO7 A;  3N30 A;  1V86 A;  3WA0 A;  1UZX B;  2UYZ B;  2J7Q B;  3WAM A;  2BKF A;  2L76 A;  1E8X A;  2KTF A;  1J0G A;  2D3G A;  2V3S A;  2GBM A;  4TV3 A;  2FCN A;  3A33 B;  5DPW A;  4BFR A;  2MP2 A;  4FJV B;  4B6W A;  3QAR A;  4ICU A;  3MTN B;  4W9F A;  3P2B A;  4NQL B;  2K8H A;  2D11 A;  3PS6 A;  1TGZ B;  2G4S A;  2KXJ A;  2YLM A;  3JYU A;  1CMX B;  4MGI E;  4BOS C;  2CHX A;  2CU1 A;  4W9I A;  1C1Y B;  4K7S A;  4BBN C;  3AU5 A;  1L2N A;  2A5U A;  3N3K B;  3NZS A;  1OEY A;  1WJU A;  2M4N A;  2N9X A;  3T9L A;  2LAS A;  1BT0 A;  3AXC A;  2C7N B;  2K39 A;  4DBG A;  4DHJ B;  3DBH I;  2NR2 A;  3QC8 B;  1WXS A;  1QZE A;  2G3Q B;  2ZPY A;  4WQO B;  2MW5 A;  5E6P A;  3VUY A;  4MGK E;  3K9O B;  4HPL B;  4FBJ B;  2DHZ A;  3QHT A;  4E71 A;  2JT4 B;  3W1S A;  1RAX A;  3A9J A;  4W9C A;  2KLC A;  3SD5 A;  4DXA B;  3PRE A;  1V80 A;  3JW0 X;  5CHV C;  3RYT A;  1UBI A;  1XQQ A;  1Y8R C;  2IO3 B;  2O6V B;  4A3O A;  4MM3 A;  1WF9 A;  3KYC D;  4G11 A;  1U4A A;  2BF8 B;  1NI2 A;  2DYB A;  1Z2M A;  3H9D A;  2BYE A;  3PLU A;  2BGF A;  5GMV A;  2IZV B;  3A1Q A;  3X23 A;  3UIO B;  2KWV B;  2DAJ A;  4RM9 A;  3NHE B;  3VHT C;  4KIK B;  3ZIM A;  3QK0 A;  3KUC B;  5LXH A;  2KFK B;  3OAW A;  3Q3F A;  4NAW A;  4WWN A;  3V62 A;  2IBI B;  4ANW A;  3NZU A;  1GUA B;  1WX7 A;  3TCA A;  3WIM A;  2I1J A;  4ANX A;  1V5T A;  2IYD B;  3IBE A;  3VXW A;  2KZR A;  3K9P B;  2LZ6 A;  3QWZ B;  2L0T A;  3TJP A;  3H1U A;  3ZRC A;  2JRI B;  4ZRK A;  2IY0 B;  3RZF A;  2AYO B;  3VVW B;  3WAN A;  4BOZ B;  1WGD A;  1WZ0 A;  4KSL C;  1HE8 A;  1X1M A;  1EUV B;  4FLH A;  2K8B A;  5J18 A;  4IWQ A;  1KLV A;  3PRM B;  2FAZ A;  2MBH A;  2ZEQ A;  4FJZ A;  3TMP B;  1WGH A;  4AJW A;  2XK5 A;  3CMM B;  3ZRF A;  4DHZ E;  3Q3J A;  2BYF A;  2ZPN A;  2NPT A;  3VH4 B;  3A4R A;  5JH5 C;  4I6N B;  5EDS A;  3L17 A;  2KQ7 A;  3ZDT A;  3ZTC A;  4IC7 B;  3V6C B;  2G45 B;  5IAA C;  2FCQ A;  2KAN A;  3ZW3 A;  3GOE A;  3T8M A;  4KDL B;  4ANU A;  2KTR A;  5CX3 A;  3PVL A;  1YJ1 A;  1OEY J;  3R7R A;  3B1L X;  4WWP A;  1WYW B;  2BYV E;  4MEM A;  3V6E B;  2IO1 B;  5E6N A;  3L08 A;  3HK0 A;  3W1S C;  2KDF B;  3ONS A;  1E7V A;  4FHJ A;  4NPN A;  2LWP A;  2L8J A;  2KJH B;  1OQY A;  3DQV A;  2BWF A;  3ML8 A;  1WM3 A;  1C3T A;  5KHO A;  2K1F A;  1P0R A;  4KV2 A;  4IM2 A;  3DVG Y;  2KX3 A;  3MHS D;  2JRH A;  4KVG B;  4GU2 A;  3LDZ E;  2IY1 B;  1KOT A;  3HIZ A;  1K8R B;  3PRZ A;  1ZW7 A;  1WJ4 A;  4PS8 A;  1WH3 A;  2XBB C;  3ECI A;  5LLI A;  2LUE A;  3LJ3 A;  2N7D A;  3VTV A;  2BKR B;  4BKS A;  2KD0 A;  2FID A;  1S3S G;  2A4Z A;  4IWP A;  4ASW C;  2DYM A;  1Q5W B;  3APD A;  2RSU A;  2IO0 B;  2KNB A;  4ZDV A; 
#chains in the Genus database with same CATH topology
 3EUB 2;  2ZW1 A;  3UIP B;  3P4Q B;  5AZH A;  4GN1 A;  3VQI A;  1XCQ L;  2QIE B;  2RMM A;  2W54 A;  2D2Q A;  4G3X B;  3IT6 B;  3TEX A;  2AWT A;  2LVO A;  1ZKH A;  3N1Z C;  5C1Z A;  1AAR A;  1TZO A;  2MHJ A;  3RUL A;  3PZD A;  1TTN A;  1VD2 A;  3N9Y C;  1ZGU B;  3Q6B A;  1PGA A;  1WZ3 A;  4MT5 A;  3ZDM C;  4ZOH C;  2JU6 X;  2WDV B;  4IUM B;  1EWY C;  2UWQ A;  3O13 A;  3MP9 A;  3VR8 B;  2CHZ A;  2INC C;  1FFU A;  3M3J A;  5EE3 A;  1P7F A;  3Q3M C;  2L05 A;  4GDL B;  5D6J B;  3RD2 A;  3BY4 B;  3TBL D;  1V8C A;  1ET6 A;  1M94 A;  1N63 A;  3EEC A;  5DPR A;  1BUI C;  2JWZ A;  4KKI A;  1ROE A;  4W9E A;  2C7H A;  2J4X A;  1T0S C;  1MVK A;  3JSV B;  1N6Z A;  4HK2 A;  1WMH A;  5KHQ A;  1TZ1 A;  1UNS A;  1V97 A;  1TS3 A;  4NQK E;  4II3 B;  4YT0 B;  4JGH B;  2BPS A;  5C23 A;  3ZLZ A;  4REZ A;  4KIK A;  3P42 A;  5BYR A;  1QOF A;  3IT4 B;  1V6E A;  1IYF A;  1C77 A;  1PGB A;  3U4E G;  3ZJU A;  3KWV A;  4L23 A;  2AX5 A;  1HQR D;  3QAQ A;  1B9R A;  2JUO A;  4LK0 M;  1XLQ A;  3PT2 B;  3VAW A;  2IDY A;  4CQN A;  1EF5 A;  3RI7 C;  2WXJ A;  3AE3 B;  3P4P B;  3BVZ A;  3PHX B;  3APF A;  1L6U A;  1DGJ A;  1TS4 A;  2BQQ A;  1DOY A;  2J53 A;  1WGY A;  2L7R A;  4KX6 B;  4HJG E;  2JWU A;  2BW2 A;  1PDX A;  3JVZ X;  3OJ3 A;  2JPH A;  2DAF A;  2NPT B;  4P6V F;  4NAM A;  1LO5 D;  3NS8 A;  2MBO A;  3MHZ A;  4DHZ B;  4TQ0 A;  1P1A A;  2KDB A;  3UIN B;  3H7S A;  1J8C A;  4M01 A;  5IN7 A;  3KQ4 A;  1P3Q U;  2C9W B;  2FNJ B;  2KDI A;  3PPA A;  3L54 A;  3ZNZ B;  2CJN A;  3H6N A;  1EWC A;  1K52 A;  3ZJT A;  4RF0 A;  5G2N A;  1SEB D;  1MPE A;  3NS1 A;  4S17 A;  4NY0 A;  2KC2 A;  5G5H A;  2CHW A;  1YQ4 B;  3DOW A;  1YQB A;  2KOX A;  3ZXR A;  1E7P B;  4HCP B;  2WS3 B;  4ZHO A;  2DBY A;  4GDK A;  1JRO A;  4FJY A;  2DZJ A;  1B1Z A;  3BYT B;  2INP E;  4URK A;  4I6L B;  1YQ3 B;  1KH0 A;  1JAL A;  1P98 A;  3UGB B;  1HZ5 A;  1GPX A;  5AUK A;  4BKT A;  2KK8 A;  2MP2 B;  3WAP A;  3DVN U;  4BKG A;  1K50 A;  2DZK A;  2MRP A;  3L16 A;  2BB6 A;  4JWU C;  3NY5 A;  4B95 A;  1FPY A;  4JL9 A;  1C78 A;  1GC6 A;  3FIL B;  5AUI A;  1GB1 A;  2MBE A;  2IPK D;  2H88 B;  3KVF B;  2N7J A;  4GB9 A;  5E6J A;  4HDO A;  1WY8 A;  5BYQ A;  3ZGZ A;  1XD3 B;  3L13 A;  4IW0 A;  2KVR A;  4GIV A;  4KZ0 A;  2IGG A;  1ACC A;  2Y3A A;  1AWD A;  1SGH A;  1K51 A;  1RRB A;  3R8B A;  2FBW B;  1PYW D;  3BVG A;  4G50 A;  3AN1 A;  4B9K A;  1JWS D;  2Y5P A;  1WI0 A;  1Q1O A;  2LGX A;  5LXI B;  1GNU A;  1SE4 A;  1WE6 A;  1GG3 A;  2NBW B;  2RGF A;  2KMM A;  3DWG C;  5DPS A;  1R4M I;  1KJT A;  3KYD D;  4OZA A;  3W9C B;  5D7G A;  2KTR B;  1V81 A;  2CU3 A;  3GS2 A;  1WXA A;  3U8Z A;  3SEB A;  3Q14 C;  1YD8 U;  3IHP C;  4F7Z A;  3OLM D;  3Q69 A;  4BBN F;  1JWU D;  2Z59 B;  2IJ0 A;  2AL6 A;  4LDT B;  2Y5B B;  5JHB A;  3KW5 B;  4K1R B;  1V1P B;  3IXS A;  2JZ3 B;  3T3O A;  2BS3 B;  4MJS B;  4AWJ A;  1CQV A;  2VH2 A;  2X8X X;  1FCC C;  2L00 B;  2FUG 1;  2C5L C;  1UUP A;  2EMS A;  2LVQ A;  4HXD A;  3Q2A C;  1UZX B;  2J7Q B;  2KTF A;  1J0G A;  2BS4 B;  3V05 A;  3A33 B;  5DPW A;  4B6W A;  4ICU A;  1IGC A;  4ITK A;  3W5V B;  3AE4 B;  3PS6 A;  1VR9 A;  2KAC A;  1TGZ B;  1M4V A;  4BOS C;  4MGI E;  4W9I A;  4JWS C;  1L2N A;  1L6V A;  1JWM D;  3NZS A;  1OEY A;  3T9L A;  2LAS A;  3AXC A;  4DBG A;  2WXM A;  3RNE C;  1RFK A;  4TMA B;  2G3Q B;  4WQO B;  3VUY A;  4N58 A;  4FBJ B;  3SFD B;  2DHZ A;  2RDB C;  1SB3 C;  3QHT A;  4E71 A;  2NMQ A;  3RNB C;  4W9C A;  1YMH E;  3PRE A;  1V80 A;  2QIL A;  3JW0 X;  3RYT A;  1XQQ A;  1Y8R C;  1RWS A;  1WF9 A;  3KYC D;  3GB1 A;  1C79 A;  1F1H A;  3MC8 A;  3PLU A;  4XDC A;  3LB8 C;  2BGF A;  5GMV A;  3Q8E A;  3X23 A;  3BYY B;  3VHT C;  4KIK B;  3NVY A;  3KUC B;  5LXH A;  1SF0 A;  3NZU A;  4FXC A;  3WIM A;  2BB5 A;  2EEL A;  4ANX A;  2IYD B;  2ICI A;  3AV8 A;  2BBC A;  2L0T A;  3AE5 B;  5T8I A;  3TJP A;  3H1U A;  4ZRK A;  2IY0 B;  2WXK A;  3RZF A;  4RH6 A;  1WGD A;  1UGJ A;  4KSL C;  2HJ1 A;  2BVC A;  5J18 A;  1KLV A;  4FJZ A;  2BYF A;  2NPT A;  1QOA A;  1IGD A;  5EDS A;  2KQ7 A;  3ZDT A;  2GI9 A;  2FCQ A;  4KDL B;  1YJ1 A;  3B1L X;  5BMH A;  2LGI A;  3RNG C;  1BML C;  3HK0 A;  2LGS A;  2KDF B;  3ONS A;  2D5G A;  3W1S C;  4NPN A;  2WGS A;  4LTU A;  2LHE A;  3ML8 A;  1C3T A;  1P0R A;  4KV2 A;  4AS1 A;  2KX3 A;  2JRH A;  4C00 A;  2IY1 B;  1K8R B;  1WJ4 A;  3ECI A;  2FID A;  4ASW C;  2DYM A;  2RSU A;  2KNB A;  1I4R A;  4FA6 A;  3SU8 X;  1XF5 L;  2KYW A;  1L0Y B;  2LI5 A;  1J7A A;  2KC1 A;  3QX1 A;  1NBF C;  2VRR B;  3AI5 A;  3MC0 B;  3H7P A;  4PS3 A;  4YWG G;  4DDG D;  3VR9 B;  2AQ2 B;  4JIO U;  2I38 A;  3CIR B;  4RMA A;  1NI3 A;  1J7B A;  3ZVV A;  4A9A A;  4ZRI A;  2GBN A;  4I6P A;  4GDK B;  4YTM B;  3N32 A;  1QLB B;  2N7E A;  1LXD A;  3ZXV A;  2NBV B;  2GB1 A;  3WAO A;  1XXG A;  4AJY B;  3OG5 A;  1UWX A;  2M0X A;  2FCM A;  1MG4 A;  1J7C A;  1Q10 A;  3FIL A;  4KZC A;  4XC2 A;  4MSM B;  3HM3 A;  4GOC A;  3IAS 1;  2B3A A;  2M56 B;  2LEK A;  4ZYS A;  1MG8 A;  4EZK A;  2LUM A;  4UDU C;  3QCA A;  3DDC B;  1WRD B;  3AE8 B;  2WHI A;  3V61 A;  2QDF A;  2Z0E B;  3DBL B;  4OZC A;  2W3R A;  3HVD A;  1L7Y A;  3DBR B;  3NJT A;  3GZN I;  1E8Z A;  4WH4 A;  4TKN A;  1IP9 A;  3HM6 X;  3U7D A;  2CS4 A;  2D3A A;  2KLG A;  1CZP A;  4W9L A;  3AEF B;  2GOW A;  3LXF A;  3UF8 A;  3TEZ A;  1PQS A;  1FXT B;  1FRR A;  1FXI A;  3AEE B;  3EFU A;  4PYU A;  1YOV B;  3Q8C A;  3DVG X;  4WJN A;  2C60 A;  2PPH A;  2OJR A;  4LLG M;  2BS2 B;  3DBH B;  3OWE B;  2AEH A;  1WXQ A;  4JE3 B;  1TIF A;  4DHJ D;  2PE6 B;  2N4F A;  2K25 A;  2DZM A;  2KMA A;  4P1B C;  3AM9 A;  4WUR A;  4CHK A;  1L0X B;  1V9J A;  4EZJ A;  2O6V D;  1H4R A;  1I4Q A;  1LQB A;  2H89 B;  3WCQ A;  1NEN B;  2K0P A;  2VZK D;  2GBJ A;  2LD9 A;  4WJP A;  4AQ7 A;  4MJS A;  1FNW A;  1WR6 E;  2N0S B;  3GE3 C;  2Z0D B;  4BAX A;  2MBB B;  1RYJ A;  4NNJ B;  3PO0 A;  4HPM B;  3EGR A;  1JW9 D;  1EO6 A;  2CR5 A;  4L1B A;  4ZHP A;  2N9K A;  5D3D A;  4MH0 E;  1GC7 A;  3AE9 B;  1E6E B;  2WU2 B;  2KDE B;  1T0Q C;  3X0W A;  4EEW A;  4RM8 A;  2N9P C;  2M17 A;  2MLB A;  4DQO C;  1FEH A;  3WAL A;  2KWC A;  3UI3 A;  3ZO5 B;  4X57 B;  1PUT A;  4HKQ A;  2GBK A;  1YN4 A;  1UWM A;  2WQY B;  2NCN A;  4ZRP A;  2EKE C;  1N5X A;  1ZDX A;  2MX2 A;  4RGO S;  2RR9 A;  5EE9 A;  3ZUN A;  3C0R B;  4MAC A;  2WXF A;  2I1K A;  3PZ8 A;  1V2Y A;  4K81 A;  4CYE A;  3AE1 B;  2MA9 B;  4GXB A;  4F8C B;  2OED A;  5HHD G;  4XX5 A;  1GOZ A;  3RN9 C;  1G6J A;  4FN2 A;  1VRA B;  1F9J A;  5L95 C;  2R2Q A;  4ANV A;  2KWU B;  1L4Z B;  2PEA A;  1RLF A;  1YN3 A;  2ZZP B;  1FM0 D;  2K8C A;  4RFB A;  1PGX A;  3Q8B A;  2KN5 A;  2PVG C;  2KO3 A;  2ZNV B;  4WAF A;  3VH3 B;  2LFI A;  3FC4 A;  2E3T A;  4J6I A;  3R2T A;  3HVZ A;  4E74 A;  2EKI A;  2L32 A;  1F0Z A;  4JQW C;  3HRD D;  3ML9 A;  1TT5 B;  3U2S C;  3MJ5 A;  2WWZ A;  2EMT A;  3M62 B;  2VH1 A;  4M0W A;  2J0J A;  3MFG A;  3B9J A;  2I2Y A;  2DNF A;  1SE9 A;  5G55 A;  1OQQ A;  3IG3 A;  1H8C A;  2NTT A;  3MC9 A;  4O1N A;  1A5R A;  1R4N I;  1XEE A;  2MQJ A;  5JHA A;  1EF1 A;  1WXV A;  5JZE B;  1EU4 A;  4P1C C;  2J42 A;  2PMV A;  4OVZ A;  1TY0 A;  2JYT A;  3PTF C;  2KMC A;  1WR1 A;  5BMI A;  2RDG A;  3ZTD A;  4XGA B;  4GGQ A;  1MHH E;  5FK9 C;  4DDI D;  2DEN B;  3ZQ4 A;  3APC A;  4OZB A;  4F1S A;  3AE7 B;  3H7P B;  4K3B A;  2WXI A;  3GP7 A;  3N30 A;  1V86 A;  2KQ4 X;  4XYC A;  5BMG A;  4RF1 A;  3WAM A;  2BKF A;  4N6E B;  2GBM A;  2D3B A;  2FCN A;  4TV3 A;  2BT6 A;  3GE8 C;  3MTN B;  4W9F A;  3P2B A;  2D11 A;  2HDE A;  2AQ1 B;  2KXJ A;  1ZPS A;  4LNI A;  3BK1 A;  1C76 A;  3VRA B;  2A5U A;  3HUI A;  2N9X A;  1BT0 A;  2K39 A;  1TS2 A;  2MW5 A;  3NUH B;  4HPL B;  3ZYY X;  1RAX A;  2KLC A;  4LNO A;  2IO3 B;  4A3O A;  2QJL A;  1SIJ A;  1NI2 A;  3H9D A;  1Z2M A;  3UIO B;  2KWV B;  2LHD A;  4RM9 A;  3OAW A;  4WWN A;  3V62 A;  2IBI B;  1WX7 A;  1ET9 A;  3TCA A;  1FIQ A;  3IBE A;  3Q3O C;  3QWZ B;  4DXF A;  1QT9 A;  2MH7 A;  3ZRC A;  3VVW B;  1EUV B;  2K5P A;  2IND C;  2MBH A;  3Q3J A;  2ZPN A;  5JH5 C;  3Q3N C;  1YNT E;  3L17 A;  3ZTC A;  2MJ3 A;  4IC7 B;  3V6C B;  5IAA C;  3ABV B;  3ZW3 A;  4OW0 A;  3U7Z A;  3AMZ A;  1WYW B;  2BYV E;  3L08 A;  4FHJ A;  1E7V A;  2L8J A;  3EA6 A;  4XWT A;  1I4P A;  1WM3 A;  1K53 A;  3AH7 A;  4IM2 A;  2MEK A;  4WIP A;  3HIZ A;  1ZW7 A;  4PS8 A;  2XBB C;  1S3S G;  2A4Z A;  1D4B A;  3APD A;  2K3U A;  2IO0 B;  2ON8 A;  4ZDV A;  2ZVO A;  4WWO A;  1L4D B;  2PVO D;  2BWE S;  3I3T B;  2W55 A;  1TYG B;  1UD7 A;  1KFY B;  4C4V B;  1FO4 A;  1XLO A;  2QEJ C;  1I4G A;  3QQ8 B;  4K3C A;  3KH0 A;  4WJQ A;  3QJZ A;  3VUW A;  4MEL A;  1JWB D;  2WLB A;  1E5W A;  2AL3 A;  1R4M B;  3RCZ A;  3PZ7 A;  2W82 A;  3L4P A;  3W5U B;  2GRI A;  4XE0 A;  3VFK A;  4NZL B;  2OHF A;  2V0G A;  3AUL A;  4W9G A;  2DYO A;  4LCD E;  2PIA A;  3MJW A;  2QCZ A;  4EE2 A;  1UH6 A;  5L83 A;  4IG7 B;  3ZNI D;  4JLC A;  1I4H A;  1D3Z A;  4AUQ C;  2KJ6 A;  3DBS A;  1WIA A;  4A20 A;  1MHX A;  3A9J B;  1ZDV A;  1Y56 A;  4M8M A;  1IBX A;  3I5J C;  2KVZ A;  2MCN B;  4MM3 B;  1DYQ A;  1T3Q A;  4TSS A;  3PSE B;  3AE6 B;  4NJ6 A;  5FR6 A;  3SR6 A;  3VDZ A;  2ZCB A;  2R2O A;  4YXD B;  1FFV A;  1KM7 A;  1VLB A;  3QA8 A;  2FIF A;  5AEK B;  2HJ8 A;  3UQA A;  2WXG A;  1VZ6 A;  2WXH A;  2XNA C;  4A3P A;  1WYG A;  1D6E C;  2N1V A;  4BVU C;  1WX8 A;  2LGD A;  2XK5 B;  5HG2 A;  4WAA A;  3NRZ A;  2PLP A;  2JQR B;  3P4S B;  4P7I A;  3BIN A;  4KGR A;  4KSK C;  3O65 B;  1ZUD 2;  4M0W B;  4K7U A;  1L0V B;  3EFC A;  1Q0W B;  2KFJ A;  2QC8 A;  4KGT A;  2PJH A;  4XZ4 A;  1KRH A;  3NVW A;  3EHV A;  1N60 A;  4RGN A;  4W9H A;  2KQS A;  4EZL A;  2KAJ A;  1NYR A;  1KTK A;  4HVB A;  2V3N A;  3NZ3 A;  4AP4 C;  2WP9 B;  1FRD A;  1E90 A;  2DX5 B;  2HE7 A;  2BTE A;  2NBU A;  1A70 A;  3AU4 A;  3ALB A;  1NDD A;  1WE7 A;  3DVN V;  4ICV A;  4M8N A;  1NEK B;  4EOY A;  5HKH A;  1GJZ A;  2O2V B;  3SDL C;  4GSW A;  2LXC A;  4D2K A;  4KDI C;  1JQ4 A;  4GMV A;  1QOB A;  5IOI A;  4B0E A;  3TEW A;  3W1Y A;  3ZNH B;  4R3D A;  5FKA C;  4ZYN A;  3RPF C;  5J2R A;  3VTU A;  1RM6 C;  3CSF A;  1ZP0 B;  4S0R A;  5IO9 A;  1YX6 B;  4PK1 A;  3V60 A;  1OTR B;  1VJK A;  3ZJV A;  2B76 B;  4Q2J A;  4HEA 1;  4LNK A;  3AE2 B;  2V3P A;  3QIJ A;  3ZKJ C;  4HCN B;  4QAY A;  2G4D B;  3R66 C;  4MGY E;  1VZ8 A;  2L0F A;  3R3M A;  4LJO B;  1OGW A;  1V5O A;  1EM7 A;  1ISN A;  4HJK A;  1E9M A;  5HFY A;  2XN9 C;  1IPG A;  2LXA A;  1KLG D;  3BZD B;  2LJ5 A;  5DCN A;  5CTR C;  3DHI C;  1MFW A;  1STE A;  2GMI C;  1SBB B;  2W3S A;  4LJP B;  1SJH D;  2JX5 A;  1ENF A;  2AQ3 B;  4W9K A;  3V3X A;  3GZN B;  4ARC A;  3SFE B;  2RDH A;  2HD5 B;  1HEZ E;  1N62 A;  4GLS C;  2D10 A;  5E6O A;  3IVF A;  5DPT A;  2J0K A;  2GBR A;  4C4V A;  4LNF A;  4RGT A;  1FMA D;  2JF5 A;  3B08 A;  2L3Z A;  1SE2 A;  2G9H D;  1YJI A;  2V4L A;  1AYF A;  1ZE3 D;  3A9K A;  4EKU A;  3FAH A;  3N1Y C;  1YIW A;  1Z5S B;  1UBQ A;  1WJ6 A;  1P9D U;  3LYY A;  1UGM A;  3Q8A A;  3P1M A;  1HXY D;  4M00 A;  4CO7 A;  1T5X D;  4N59 A;  3E56 A;  1E8X A;  2V3S A;  1VZ7 A;  1FXA A;  4NQL B;  3JYU A;  4JPS A;  2UU7 A;  2QSD A;  4K7S A;  5MPO A;  3AU5 A;  3N3K B;  1WJU A;  4J3O D;  4DHJ B;  3C19 A;  3QC8 B;  1WXS A;  4BZA A;  1QZE A;  2ZPY A;  1WWT A;  1XLP A;  1HA5 A;  4MGK E;  3NG0 A;  4C7Z A;  3KWL A;  1C4C A;  3W1S A;  3A9J A;  3SD5 A;  1GB4 A;  4DXA B;  1WSP A;  2INN E;  3P63 A;  2O6V B;  3W2D A;  1MI0 A;  4MM3 A;  3DHH C;  1EU3 A;  5G5G A;  2BF8 B;  2VZK B;  2BYE A;  3BVM A;  2R61 A;  2FE8 A;  1C4A A;  1PFD A;  2WXL A;  3QK0 A;  1IBX B;  2KFK B;  3Q3F A;  4NAW A;  2E6X A;  2J52 A;  1GUA B;  3RNA C;  1V5T A;  1WGK A;  3VXW A;  5C3J B;  4E3C A;  3WAN A;  1WZ0 A;  1HE8 A;  1QKZ A;  4ZRQ A;  5FR3 A;  4IWQ A;  4ACF A;  2ZEQ A;  1WGH A;  1MJD A;  2XK5 A;  1BXT A;  4DHZ E;  2N9L A;  4I6N B;  2CJO A;  1F2R C;  5I4D A;  2YEP F;  2KAN A;  3GOE A;  3T8M A;  3ETR A;  4ANU A;  5CX3 A;  1OEY J;  1WRI A;  1ZXI A;  3AEB B;  5JXV A;  3V6E B;  3VRB B;  2IO1 B;  4HPP A;  1KLU D;  3FKY A;  5E6N A;  2K9X A;  2KJH B;  3DQV A;  1N61 A;  2K1F A;  2M19 A;  4KVG B;  5BYS A;  3LDZ E;  4HKZ E;  1KOT A;  1FNU A;  2WDR B;  1T0R C;  3N1X C;  2LUE A;  5LLI A;  2N7D A;  3VTV A;  3E9S A;  3Q8F A;  5C2T B;  1N5W A;  2WXO A;  1XLN A;  2N9E B;  4OHJ A;  1DOX A;  2YVC A;  3ZNG C;  2QHO A;  3PGE A;  4YTP B;  2PE9 A;  3RUI B;  2JZP A;  2N1W A;  2O2V A;  2WDQ B;  2ZNV C;  1J19 A;  2CKH B;  4IM3 A;  3ENE A;  3L0W B;  3NVV A;  5BO4 B;  1VCB A;  3RNF C;  3EC8 A;  4JX1 C;  1NVI D;  3CST A;  4RGM A;  4WJO A;  1I4X A;  4OVV A;  1YX5 B;  1GAQ B;  3RZW C;  2IGD A;  3RNC C;  1R4N B;  2D3C A;  2C7M B;  2XEW A;  3I57 A;  2LRW A;  4NJ7 A;  3CF6 E;  1XT9 B;  2HTH A;  3PHW B;  2Y5C A;  2NTS A;  2OOB B;  2M8S A;  1I7H A;  4LDT D;  3RMK C;  1JRP A;  1I35 A;  3AED B;  4BKS D;  4KGS A;  1L5P A;  1SSN A;  4B0M A;  1NYQ A;  2MJE A;  4H2A A;  4FHK A;  4IKG A;  3SHQ A;  1S1Q B;  2JZZ A;  3AB5 A;  2ZCC A;  1WXM A;  5CHF A;  4HLE A;  4YTN B;  1DOI A;  3A1Q B;  5AZG A;  4IWO A;  2WXQ A;  5IA7 A;  4ZRJ A;  2JVC A;  4W9J A;  4PYZ A;  2NVU I;  2Z8L A;  3B2G A;  3NVZ A;  1WX9 A;  5D2M B;  3PV1 A;  4A8X C;  1SXT A;  1OQR A;  4YSY B;  2BYT A;  2JXX A;  3I63 C;  3OJ4 B;  5HI1 A;  3DCG A;  4NJC A;  4PT5 A;  2L52 A;  1TKG A;  5D94 A;  4MSQ B;  2SEB D;  4US9 A;  2YEP B;  4K7W A;  2D07 B;  1JRU A;  3IAM 1;  1T6B X;  2LRU A;  1JML A;  1D5M C;  2KKC A;  3BWU D;  4M02 A;  4US8 A;  3RT3 B;  1I42 A;  4MDK E;  4EUT A;  1D5Z C;  2PKO A;  2W9N A;  3DWM A;  3S2A A;  2J0M A;  1CK1 A;  4HDQ A;  3P4R B;  2K6Q A;  3KUZ A;  3B0A A;  1ZXH A;  1WFY A;  3UQB A;  2LVP A;  1UEL A;  3AEG B;  3KUD B;  2KDM A;  1E0Z A;  3IFW B;  1WM2 A;  1TS5 A;  1E7U A;  2KJR A;  3A9K B;  3PLV A;  5CHW A;  5GXG B;  3J9C A;  1P7E A;  2JY6 A;  1FCL A;  4DXG A;  2KN4 A;  1JCK B;  1AW7 A;  4PS7 A;  4N9F 4;  1E8W A;  4OVU A;  3VUX A;  1T0Y A;  5LNK 1;  1TBE A;  2WXN A;  4W9D A;  2KT7 A;  1WGG A;  2LMC A;  4GDL A;  5H8Y E;  4MH8 A;  1TKE A;  5AZF A;  2ZJD A;  2ZVN A;  4C56 C;  1FNV A;  3JSV A;  2O6V A;  5EE0 A;  5TR5 A;  2DLB A;  3VTW A;  3R2I A;  2WYQ A;  4FUL A;  2DWQ A;  2K6D B;  4AOF A;  1HTQ A;  1CJE A;  3AEA B;  2NS5 A;  2KFK A;  2KX0 A;  3M63 B;  4YSX B;  1ESF A;  1RFA A;  2IO2 B;  4A55 A;  1UF0 A;  2M0A A;  1WMH B;  2V1Y A;  3DPD A;  4DK5 A;  4MGZ E;  3PRP B;  2WXP A;  3M95 A;  3D32 A;  3H8H A;  4A6Q A;  4EFO A;  3BK2 A;  3HHM A;  4G0N B;  2WU5 B;  4IOI E;  4HRS A;  2DZI A;  4NAW B;  5J17 A;  3A4S C;  2L83 A;  4WQM A;  4RNA A;  2RD0 A;  4P16 A;  4RCO A;  2RPQ A;  2WX1 A;  5D3I B;  3NOB A;  4HWI B;  5TSS A;  2IGH A;  2LJI A;  2WX0 A;  3TIX A;  2ASQ A;  2ACZ B;  2LGY A;  1ZOY B;  4ARI A;  2PW9 A;  3TL5 A;  1OFF A;  1TY2 A;  2JSV X;  2TSS A;  4TUU A;  4HRO A;  3B2F A;  4IDI A;  4II2 B;  2MSE D;  1R7S A;  2MWS B;  3C8Y A;  1LM8 B;  4YSZ B;  3U30 A;  1LGR A;  4C80 A;  1WGR A;  2ONQ A;  5H92 C;  3TUO A;  3L10 B;  4TQ1 A;  2REX A;  1LFD A;  4DWF A;  1YJJ A;  5IKC M;  4IM0 A;  2MBQ A;  1E8Y A;  1WJN A;  2SAK A;  2M1M A;  1QQR A;  4FAD A;  3N20 C;  1F52 A;  2FCS A;  3R7Q A;  2KWD A;  1TKY A;  3DBL I;  1SIF A;  2FUH B;  1SE3 A;  2KHW B;  2MJD A;  3TEY A;  3DBR I;  4YL8 A;  2OJW A;  2WDT B;  1V49 A;  2G1E A;  3WA0 A;  5IP4 D;  2UYZ B;  3AEC B;  1IUE A;  2L76 A;  2D3G A;  4BFR A;  2MP2 A;  4FJV B;  3QAR A;  2K8H A;  2G4S A;  2RPV A;  2YLM A;  1CMX B;  1V1O A;  2CHX A;  3BII D;  2CU1 A;  1C1Y B;  4BBN C;  3CWI A;  2M4N A;  2C7N B;  1HTO A;  4USA A;  2K22 A;  3DBH I;  2NR2 A;  4L2Y A;  3RFZ B;  3KLS X;  5E6P A;  3K9O B;  2JT4 B;  2JXT A;  2PTL A;  1C4P A;  1XCT L;  5CHV C;  1YN5 A;  1UBI A;  1QIL A;  1D5X C;  4A90 A;  4G11 A;  1U4A A;  1VDV A;  2DYB A;  2IZV B;  1E10 A;  3A1Q A;  2ZW0 A;  2DAJ A;  1AN8 A;  3NHE B;  3ZIM A;  4C7Y A;  1QOG A;  2WNM A;  2WXR A;  4ANW A;  3TSS A;  1F77 A;  2I1J A;  2X38 A;  4WWM A;  2KZR A;  2V9H A;  3K9P B;  2LZ6 A;  3T3N A;  2L1A A;  2JRI B;  2AYO B;  4BOZ B;  1X1M A;  3I9V 1;  2K8B A;  4FLH A;  3PRM B;  2FAZ A;  3TMP B;  4AJW A;  3CMM B;  3ZRF A;  3VH4 B;  3A4R A;  2JYE A;  4KKJ A;  3U52 E;  1JWA D;  2G45 B;  3URY A;  1TJE A;  2KTR A;  1HZ6 A;  3PVL A;  3R7R A;  4WWP A;  4MEM A;  2V4I B;  1XO3 A;  1QF6 A;  2LWP A;  2HTM E;  2QMT A;  1OQY A;  2BWF A;  5KHO A;  1SJE D;  3DVG Y;  3MHS D;  4LNN A;  1C9F A;  4GU2 A;  2GLS A;  1KF6 B;  3PRZ A;  1FD6 A;  1WH3 A;  5EE1 A;  3LJ3 A;  4XDD A;  1F2R I;  2BKR B;  2KD0 A;  4BKS A;  3DHG C;  4IWP A;  1V1P A;  1Q5W B;  4XWW A;  2Q5W D; 
#chains in the Genus database with same CATH homology
 2ZVO A;  4FA6 A;  4WWO A;  2N9E B;  3SU8 X;  3UIP B;  2BWE S;  5AZH A;  2YVC A;  4GN1 A;  3VQI A;  3ZNG C;  2QHO A;  3I3T B;  2LI5 A;  3PGE A;  2PE9 A;  2KC1 A;  3RUI B;  1UD7 A;  2D2Q A;  2N1W A;  2O2V A;  1NBF C;  1J19 A;  2ZNV C;  3QX1 A;  4G3X B;  2VRR B;  3AI5 A;  3QQ8 B;  2CKH B;  3KH0 A;  2AWT A;  2LVO A;  3H7P A;  3ENE A;  4IM3 A;  1ZKH A;  3QJZ A;  4PS3 A;  4WJQ A;  3VUW A;  4DDG D;  4MEL A;  4JIO U;  5C1Z A;  1AAR A;  3L0W B;  4RMA A;  1E5W A;  3RUL A;  5BO4 B;  2AL3 A;  3PZD A;  1TTN A;  1VCB A;  3RCZ A;  1VD2 A;  3ZVV A;  3EC8 A;  1ZGU B;  4ZRI A;  2GBN A;  4I6P A;  4GDK B;  3CST A;  1WZ3 A;  3VFK A;  3N32 A;  3ZDM C;  2N7E A;  1LXD A;  2NBV B;  4WJO A;  3WAO A;  4IUM B;  2UWQ A;  4OVV A;  1YX5 B;  4AJY B;  2CHZ A;  3RZW C;  2M0X A;  3AUL A;  3M3J A;  4W9G A;  2FCM A;  2L05 A;  4GDL B;  5D6J B;  4KZC A;  3RD2 A;  3BY4 B;  4XC2 A;  2DYO A;  3HM3 A;  4MSM B;  4LCD E;  3TBL D;  2C7M B;  3MJW A;  1M94 A;  4GOC A;  3EEC A;  5DPR A;  2JWZ A;  2XEW A;  1UH6 A;  5L83 A;  2B3A A;  2LRW A;  4NJ7 A;  2C7H A;  4W9E A;  3CF6 E;  1MG8 A;  1XT9 B;  2HTH A;  4IG7 B;  3ZNI D;  4EZK A;  3JSV B;  3PHW B;  4HK2 A;  1WMH A;  4JLC A;  5KHQ A;  3QCA A;  1TZ1 A;  3DDC B;  1WRD B;  2OOB B;  2M8S A;  4NQK E;  3V61 A;  1D3Z A;  4II3 B;  4LDT D;  4JGH B;  2KJ6 A;  4AUQ C;  2BPS A;  3DBS A;  1I35 A;  4BKS D;  1WIA A;  2Z0E B;  5C23 A;  4A20 A;  3ZLZ A;  1L7Y A;  4KIK A;  3A9J B;  4M8M A;  4FHK A;  3GZN I;  1E8Z A;  3SHQ A;  4TKN A;  1S1Q B;  2JZZ A;  1V6E A;  1IYF A;  1IP9 A;  3HM6 X;  3U7D A;  2CS4 A;  2MCN B;  2ZCC A;  1WXM A;  3PSE B;  2KLG A;  5CHF A;  4W9L A;  4HLE A;  4NJ6 A;  3QAQ A;  3A1Q B;  2GOW A;  2JUO A;  5AZG A;  4IWO A;  5FR6 A;  3UF8 A;  3VDZ A;  3PT2 B;  4ZRJ A;  3VAW A;  1PQS A;  2JVC A;  1FXT B;  2ZCB A;  4W9J A;  3EFU A;  2R2O A;  2NVU I;  4PYZ A;  4PYU A;  1EF5 A;  4E3C A;  1WX9 A;  1KM7 A;  3DVG X;  5D2M B;  3PHX B;  4WJN A;  3PV1 A;  3QA8 A;  2C60 A;  3APF A;  2FIF A;  2PPH A;  5AEK B;  2HJ8 A;  2JXX A;  2OJR A;  3OJ4 B;  3UQA A;  3DCG A;  1WGY A;  2L7R A;  2AEH A;  5D94 A;  4A3P A;  5IA7 A;  4MSQ B;  2N1V A;  4BVU C;  1WX8 A;  4DHJ D;  2PE6 B;  2N4F A;  2LGD A;  4K7W A;  2K25 A;  2XK5 B;  2DZM A;  3JVZ X;  2D07 B;  2JPH A;  1JRU A;  2DAF A;  2KMA A;  3OJ3 A;  2NPT B;  4WAA A;  4P7I A;  3BIN A;  2LRU A;  4KSK C;  3NS8 A;  2MBO A;  3O65 B;  4DHZ B;  4CHK A;  4TQ0 A;  4M0W B;  1P1A A;  4K7U A;  1V9J A;  4EZJ A;  2KDB A;  2O6V D;  1H4R A;  2KKC A;  1LQB A;  1Q0W B;  3UIN B;  2KFJ A;  2PJH A;  3H7S A;  3RT3 B;  2GBJ A;  1J8C A;  1I42 A;  4MDK E;  4EUT A;  4XZ4 A;  2LD9 A;  4WJP A;  1P3Q U;  3EHV A;  4MJS A;  2C9W B;  1WR6 E;  2FNJ B;  2KDI A;  2W9N A;  4W9H A;  3PPA A;  3S2A A;  2J0M A;  2KQS A;  3L54 A;  3ZNZ B;  4EZL A;  4HDQ A;  2Z0D B;  2K6Q A;  3H6N A;  2MBB B;  3KUZ A;  4NNJ B;  4HVB A;  3B0A A;  1WFY A;  4HPM B;  3UQB A;  5G2N A;  2LVP A;  1UEL A;  3KUD B;  1EO6 A;  4AP4 C;  3IFW B;  1WM2 A;  1E7U A;  1E90 A;  2CR5 A;  2KJR A;  3A9K B;  4NY0 A;  2DX5 B;  2HE7 A;  2KC2 A;  3PLV A;  5CHW A;  2CHW A;  2NBU A;  3AU4 A;  3ALB A;  4MH0 E;  3DOW A;  2JY6 A;  1NDD A;  1WE7 A;  1GC7 A;  1YQB A;  2KOX A;  3DVN V;  4ICV A;  4M8N A;  4HCP B;  4EOY A;  4GDK A;  4N9F 4;  4PS7 A;  1E8W A;  2KDE B;  3X0W A;  4EEW A;  5HKH A;  1GJZ A;  2O2V B;  4FJY A;  3SDL C;  4GSW A;  4RM8 A;  2DZJ A;  4OVU A;  1T0Y A;  2N9P C;  3VUX A;  2M17 A;  2LXC A;  2MLB A;  1TBE A;  4W9D A;  1WGG A;  4URK A;  4I6L B;  3WAL A;  4KDI C;  2KWC A;  1P98 A;  4GDL A;  3UGB B;  4GMV A;  3ZO5 B;  4BKT A;  4X57 B;  2KK8 A;  2MP2 B;  3W1Y A;  3WAP A;  3ZNH B;  4ZYN A;  5AZF A;  2ZJD A;  5J2R A;  2GBK A;  3VTU A;  2ZVN A;  3DVN U;  3CSF A;  4BKG A;  2NCN A;  3JSV A;  2EKE C;  2O6V A;  2DZK A;  2MRP A;  3L16 A;  5TR5 A;  2MX2 A;  2RR9 A;  1YX6 B;  3NY5 A;  3V60 A;  3VTW A;  4JL9 A;  4B95 A;  1OTR B;  2WYQ A;  3ZUN A;  1GC6 A;  4FUL A;  2MBE A;  2K6D B;  4AOF A;  3C0R B;  3KVF B;  3QIJ A;  4GB9 A;  3ZKJ C;  4HCN B;  2NS5 A;  2I1K A;  2KFK A;  2KX0 A;  3M63 B;  1V2Y A;  4HDO A;  4K81 A;  4CYE A;  1WY8 A;  1RFA A;  2IO2 B;  2G4D B;  1XD3 B;  3L13 A;  1WMH B;  3R66 C;  2V1Y A;  4IW0 A;  4MGY E;  2KVR A;  3DPD A;  4DK5 A;  4MGZ E;  3PRP B;  4GIV A;  3M95 A;  2MA9 B;  4KZ0 A;  3D32 A;  4GXB A;  4F8C B;  3R3M A;  2L0F A;  4XX5 A;  1SGH A;  4EFO A;  3HHM A;  4LJO B;  4G0N B;  1RRB A;  1G6J A;  4FN2 A;  1OGW A;  1V5O A;  1F9J A;  5L95 C;  1ISN A;  2R2Q A;  4HJK A;  4ANV A;  2KWU B;  2DZI A;  4G50 A;  4NAW B;  5J17 A;  2PEA A;  3A4S C;  1RLF A;  4B9K A;  2RD0 A;  2ZZP B;  2K8C A;  1IPG A;  2LXA A;  1WI0 A;  1Q1O A;  2RPQ A;  2WX1 A;  3NOB A;  2KN5 A;  4HWI B;  2KO3 A;  2LGX A;  5LXI B;  2ZNV B;  1GNU A;  1WE6 A;  2LJ5 A;  2WX0 A;  1GG3 A;  2ASQ A;  5DCN A;  4J6I A;  3TIX A;  3VH3 B;  5CTR C;  2LGY A;  4E74 A;  2NBW B;  2RGF A;  4JQW C;  3TL5 A;  2GMI C;  3ML9 A;  5DPS A;  2WWZ A;  1R4M I;  1KJT A;  3KYD D;  4TUU A;  2EMT A;  3M62 B;  4LJP B;  5D7G A;  4II2 B;  2MSE D;  2KTR B;  2J0J A;  2MWS B;  1LM8 B;  1SE9 A;  1V81 A;  3U30 A;  5G55 A;  3IG3 A;  1WXA A;  4W9K A;  1H8C A;  1WGR A;  3U8Z A;  1A5R A;  1YD8 U;  3L10 B;  4TQ1 A;  3IHP C;  2REX A;  4F7Z A;  3OLM D;  1LFD A;  1R4N I;  2MQJ A;  4BBN F;  4DWF A;  5JHA A;  2HD5 B;  4IM0 A;  1EF1 A;  1WXV A;  2MBQ A;  5JZE B;  2D10 A;  1E8Y A;  1WJN A;  3IVF A;  5DPT A;  2J0K A;  2GBR A;  5E6O A;  2Z59 B;  2AL6 A;  2JF5 A;  2L3Z A;  3B08 A;  4LDT B;  2Y5B B;  2V4L A;  5JHB A;  2M1M A;  3KW5 B;  4K1R B;  3A9K A;  4EKU A;  4FAD A;  3PTF C;  2JZ3 B;  2FCS A;  3R7Q A;  1YIW A;  2KMC A;  4MJS B;  1WR1 A;  3ZTD A;  1Z5S B;  4GGQ A;  4AWJ A;  1UBQ A;  3DBL I;  1WJ6 A;  1SIF A;  2FUH B;  4DDI D;  2KHW B;  2DEN B;  3APC A;  2L00 B;  1P9D U;  2C5L C;  3DBR I;  4F1S A;  2EMS A;  1UGM A;  2LVQ A;  4HXD A;  3H7P B;  2WDT B;  4YL8 A;  1V49 A;  4CO7 A;  3N30 A;  1V86 A;  3WA0 A;  1UZX B;  2UYZ B;  2J7Q B;  3WAM A;  2BKF A;  2L76 A;  1E8X A;  2KTF A;  1J0G A;  2D3G A;  2V3S A;  2GBM A;  4TV3 A;  2FCN A;  3A33 B;  5DPW A;  4BFR A;  2MP2 A;  4FJV B;  4B6W A;  3QAR A;  4ICU A;  3MTN B;  4W9F A;  3P2B A;  4NQL B;  2K8H A;  2D11 A;  3PS6 A;  1TGZ B;  2G4S A;  2KXJ A;  2YLM A;  3JYU A;  1CMX B;  4MGI E;  4BOS C;  2CHX A;  2CU1 A;  4W9I A;  1C1Y B;  4K7S A;  4BBN C;  3AU5 A;  1L2N A;  2A5U A;  3N3K B;  3NZS A;  1OEY A;  1WJU A;  2M4N A;  2N9X A;  3T9L A;  2LAS A;  1BT0 A;  3AXC A;  2C7N B;  2K39 A;  4DBG A;  4DHJ B;  3DBH I;  2NR2 A;  3QC8 B;  1WXS A;  1QZE A;  2G3Q B;  2ZPY A;  4WQO B;  2MW5 A;  5E6P A;  3VUY A;  4MGK E;  3K9O B;  4HPL B;  4FBJ B;  2DHZ A;  3QHT A;  4E71 A;  2JT4 B;  3W1S A;  1RAX A;  3A9J A;  4W9C A;  2KLC A;  3SD5 A;  4DXA B;  3PRE A;  1V80 A;  3JW0 X;  5CHV C;  3RYT A;  1UBI A;  1XQQ A;  1Y8R C;  2IO3 B;  2O6V B;  4A3O A;  4MM3 A;  1WF9 A;  3KYC D;  4G11 A;  1U4A A;  2BF8 B;  1NI2 A;  2DYB A;  1Z2M A;  3H9D A;  2BYE A;  3PLU A;  2BGF A;  5GMV A;  2IZV B;  3A1Q A;  3X23 A;  3UIO B;  2KWV B;  2DAJ A;  4RM9 A;  3NHE B;  3VHT C;  4KIK B;  3ZIM A;  3QK0 A;  3KUC B;  5LXH A;  2KFK B;  3OAW A;  3Q3F A;  4NAW A;  4WWN A;  3V62 A;  2IBI B;  4ANW A;  3NZU A;  1GUA B;  1WX7 A;  3TCA A;  3WIM A;  2I1J A;  4ANX A;  1V5T A;  2IYD B;  3IBE A;  3VXW A;  2KZR A;  3K9P B;  2LZ6 A;  3QWZ B;  2L0T A;  3TJP A;  3H1U A;  3ZRC A;  2JRI B;  4ZRK A;  2IY0 B;  3RZF A;  2AYO B;  3VVW B;  3WAN A;  4BOZ B;  1WGD A;  1WZ0 A;  4KSL C;  1HE8 A;  1X1M A;  1EUV B;  4FLH A;  2K8B A;  5J18 A;  4IWQ A;  1KLV A;  3PRM B;  2FAZ A;  2MBH A;  2ZEQ A;  4FJZ A;  3TMP B;  1WGH A;  4AJW A;  2XK5 A;  3CMM B;  3ZRF A;  4DHZ E;  3Q3J A;  2BYF A;  2ZPN A;  2NPT A;  3VH4 B;  3A4R A;  5JH5 C;  4I6N B;  5EDS A;  3L17 A;  2KQ7 A;  3ZDT A;  3ZTC A;  4IC7 B;  3V6C B;  2G45 B;  5IAA C;  2FCQ A;  2KAN A;  3ZW3 A;  3GOE A;  3T8M A;  4KDL B;  4ANU A;  2KTR A;  5CX3 A;  3PVL A;  1YJ1 A;  1OEY J;  3R7R A;  3B1L X;  4WWP A;  1WYW B;  2BYV E;  4MEM A;  3V6E B;  2IO1 B;  5E6N A;  3L08 A;  3HK0 A;  3W1S C;  2KDF B;  3ONS A;  1E7V A;  4FHJ A;  4NPN A;  2LWP A;  2L8J A;  2KJH B;  1OQY A;  3DQV A;  2BWF A;  3ML8 A;  1WM3 A;  1C3T A;  5KHO A;  2K1F A;  1P0R A;  4KV2 A;  4IM2 A;  3DVG Y;  2KX3 A;  3MHS D;  2JRH A;  4KVG B;  4GU2 A;  3LDZ E;  2IY1 B;  1KOT A;  3HIZ A;  1K8R B;  3PRZ A;  1ZW7 A;  1WJ4 A;  4PS8 A;  1WH3 A;  2XBB C;  3ECI A;  5LLI A;  2LUE A;  3LJ3 A;  2N7D A;  3VTV A;  2BKR B;  4BKS A;  2KD0 A;  2FID A;  1S3S G;  2A4Z A;  4IWP A;  4ASW C;  2DYM A;  1Q5W B;  3APD A;  2RSU A;  2IO0 B;  2KNB A;  4ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...