1XT9B

Crystal structure of den1 in complex with nedd8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 8
publication title Structure of a Complex between Nedd8 and the Ulp/Senp Protease Family Member Den1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1xt9B00
3RYTA 1NDDA 3JSVB 2G45B 1WGGA 3PV1A 4BFRA 3H7SA 2FCQA 4E74A 2AYOB 4FA6A 1UZXB 2NPTB 3DBRI 2NS5A 4W9GA 4EFOA 3RT3B 4IWPA 1V80A 3AULA 2FNJB 1WJ6A 1A5RA 4XZ4A 2C7HA 3RCZA 2JY6A 2Y5BB 4ASWC 5DPSA 2KFKA 2IO3B 3A4SC 3VQIA 4A3PA 2OOBB 2PPHA 2K6QA 3ZNHB 2ZCBA 3Q3FA 5CHWA 3MHSD 2IY0B 3H7PA 1JRUA 1RFAA 4GXBA 4ICUA 5IA7A 1SGHA 5JH5C 2N7DA 4JQWC 3H6NA 2R2OA 2HD5B 4GGQA 3KUZA 3UF8A 4GN1A 1Q1OA 1S3SG 1YX5B 2MA9B 2ZJDA 3A9JA 1NI2A 1I35A 2A5UA 2MBHA 4IG7B 3ZDMC 3DBHI 1K8RB 1SE9A 1WGHA 2QHOA 3L16A 4DDID 3MJWA 2M8SA 1E8XA 3NS8A 3UGBB 2LVPA 3KH0A 1IYFA 3I3TB 1GG3A 4X57B 1J0GA 1XQQA 2BYFA 2MX2A 4NY0A 5LXIB 5L95C 1GJZA 4B9KA 4M8NA 5CX3A 4FLHA 4KDLB 3UQBA 5HKHA 3DVGX 3OAWA 5DPTA 4GIVA 2DAFA 2CR5A 2G4SA 2KANA 5G55A 2EMSA 2LXAA 1E8ZA 1EO6A 2Z59B 2M17A 3V6EB 4BKGA 2KTRB 4W9HA 1VCBA 4FHKA 3AU4A 2DZKA 3MTNB 2KMAA 2NVUI 4MDKE 4WWNA 2UWQA 2KMCA 3CF6E 4IUMB 3KVFB 2DX5B 4OVVA 1E8WA 2O6VD 1LM8B 3DVNV 2KNBA 2JZZA 5C23A 4HPLB 3U7DA 1NBFC 4ANXA 4EZLA 2JWZA 3PRPB 4PS3A 4W9JA 4F8CB 2MBQA 3RD2A 3APCA 3HM3A 4NAWA 3OLMD 3X23A 1E7VA 1WZ3A 2LRUA 2Z0EB 3R7RA 2G4DB 2NR2A 4E71A 1U4AA 2K8HA 4JIOU 2D10A 3ZNZB 1ISNA 4W9FA 2MBOA 3GOEA 3X0WA 4MGIE 4URKA 4B95A 2LGYA 2LUEA 4BKSD 4ZDVA 3PGEA 1KLVA 3OJ4B 2DYMA 3VFKA 2KQSA 1IPGA 5J2RA 2BKFA 4II2B 3AU5A 3ECIA 3DVNU 4CO7A 2J7QB 2NBVB 1HE8A 3HHMA 2KX0A 1T0YA 1WGYA 4DHJB 1MG8A 2BPSA 4K81A 2HJ8A 3QA8A 4NJ6A 1FXTB 2MP2B 1J8CA 4I6NB 1UBQA 3IBEA 4MJSB 3DBLI 2KJHB 3W1SA 2IYDB 4DBGA 3O65B 4NQLB 2C7MB 1WE7A 2JRHA 3KUDB 2MLBA 1TGZB 2BF8B 2FCSA 4PS8A 1V2YA 2G3QB 3IHPC 2JUOA 3JSVA 2BWFA 4K7WA 2N1WA 2KD0A 2KZRA 5LLIA 5J17A 4HDOA 2N7EA 2C7NB 1P0RA 4HXDA 1YJ1A 2NPTA 1V81A 2LJ5A 4K1RB 2D2QA 2KFJA 4GB9A 1GC7A 2A4ZA 2LGXA 4LCDE 1P98A 3C0RB 3R3MA 1KOTA 3UINB 4W9CA 3N3KB 3VUYA 1UD7A 2ASQA 3QAQA 1E8YA 2FAZA 4HPMB 1WM3A 3HK0A 1ZGUB 2L76A 1V86A 4DHJD 2MBBB 2O6VA 1G6JA 3PHWB 3IG3A 3APFA 3A33B 2KVRA 2IO2B 1OTRB 3A1QB 1WX8A 3L17A 4ANUA 3L0WB 1WMHB 1EUVB 3OJ3A 3TMPB 2IO0B 3A9KB 2WDTB 4PYZA 4ANVA 1YQBA 1E7UA 2D07B 3IVFA 3KW5B 4XC2A 2CHXA 2MRPA 4KIKB 2WX1A 4EUTA 4FULA 1WX9A 1L7YA 1WX7A 2MWSB 3T8MA 3V61A 4BKSA 4I6PA 1V5OA 2ZEQA 1C1YB 4IWQA 4FHJA 2KJ6A 1R4NI 5KHOA 2XK5B 2I1JA 2MQJA 4DWFA 4G50A 3M62B 1WXSA 2EMTA 1GUAB 5AEKB 1WF9A 2IZVB 4BKTA 1WXMA 2FIFA 4W9DA 5FR6A 3QIJA 2K39A 3VH3B 4OVUA 2KDFB 3BY4B 1LFDA 3ML8A 2KQ7A 1RRBA 5CHFA 4GSWA 2KOXA 3M3JA 3UIPB 5AZFA 4LDTB 5D2MB 2GBKA 2N9EB 3QHTA 4WWOA 4HCNB 4DK5A 3PRZA 2D3GA 3WAOA 4A3OA 4AWJA 4DHZE 3DDCB 4CHKA 4IWOA 3PRMB 1J19A 2NBUA 4AOFA 2VRRB 4KV2A 2KKCA 2KWVB 3NY5A 4YL8A 3VTUA 2REXA 1S1QB 2ZZPB 3VAWA 1WFYA 2LRWA 3VUXA 2KXJA 2MBEA 4BOZB 3K9PB 1F9JA 2KX3A 3TL5A 3ZKJC 2HTHA 1WJNA 3PVLA 2LVQA 1UH6A 3VXWA 4HWIB 2CU1A 2RPQA 2MSED 2YVCA 1OEYJ 2LWPA 2JT4B 3QWZB 1LQBA 4MELA 1V5TA 2WYQA 4KSLC 2J0KA 4WQOB 3WAPA 2M1MA 1P3QU 2JXXA 3PTFC 3PLVA 5TR5A 4F7ZA 3ALBA 4ICVA 2KC2A 3N30A 5IAAC 3B0AA 3CSFA 3SU8X 3N32A 2L8JA 4ZYNA 3QJZA 3HM6X 2N4FA 4GDLB 1V9JA 4JLCA 3M63B 2Z0DB 4W9EA 2KDIA 2MW5A 2K1FA 1WZ0A 2KWUB 2LGDA 3L08A 5AZHA 3ZO5B 3V6CB 5JHBA 3LDZE 5KHQA 3QARA 3ZDTA 5D7GA 1TTNA 3WANA 3ZUNA 2J0JA 4TQ0A 4PYUA 3PZDA 3CSTA 5E6PA 3QX1A 4HK2A 3RULA 1SIFA 3V62A 3NZUA 3VVWB 1VD2A 2KN5A 2W9NA 2LVOA 3TJPA 4EZKA 2XBBC 4ZRJA 1WXVA 4WJOA 4FN2A 1XT9B 4HLEA 4II3B 2GBNA 4BOSC 3S2AA 4CYEA 1L2NA 3NOBA 5J18A 2AWTA 3UQAA 2KWCA 4G0NB 2CS4A 5DPWA 1WMHA 3H1UA 4GU2A 2L00B 3AXCA 4HJKA 5GMVA 3A9KA 3DQVA 3PSEB 3VDZA 4GDKB 4NJ7A 4WWPA 2C9WB 2O2VB 2CHZA 4HDQA 1Z2MA 2V4LA 4I6LB 4KSKC 1H8CA 3ZTCA 1YD8U 5AZGA 3APDA 4A20A 1WRDB 1Z5SB 2C60A 3ZLZA 5D94A 4AP4C 4K7SA 2OJRA 1Q5WB 2L7RA 3GZNI 3WALA 1EF1A 3U30A 2KTFA 3QCAA 4FJYA 2XK5A 4BVUC 1UBIA 3KYDD 3QC8B 2RSUA 3VTVA 3W1YA 3EHVA 2AL6A 3DOWA 1YX6B 1PQSA 3H9DA 2FCNA 2KC1A 3QQ8B 3TBLD 4EOYA 1RAXA 2DYBA 4K7UA 3PPAA 4KVGB 3PHXB 1M94A 2D11A 4WJQA 2RR9A 3EC8A 4MSQB 1QZEA 3Q3JA 2J0MA 3SD5A 2DZJA 2GOWA 2WX0A 4WJPA 1WIAA 1V49A 3A4RA 2IBIB 1WJ4A 4M0WB 1E90A 3WAMA 2ZVNA 3PREA 4MGZE 3RUIB 5EDSA 1WR1A 1XD3B 1IP9A 5CTRC 2FCMA 1WJUA 3NZSA 4NNJB 4KZCA 5E6OA 4W9LA 5DPRA 3WIMA 2KTRA 5E6NA 1EF5A 3UIOB 5DCNA 4DXAB 1C3TA 1OGWA 2GBRA 2ZPNA 3CMMB 2DZIA 3JYUA 3ZTDA 5L83A 3U8ZA 4GMVA 1LXDA 3ZW3A 2DAJA 2BYEA 3VUWA 4E3CA 2LI5A 4W9IA 3KUCB 3T9LA 1TBEA 1WGRA 4MEMA 5JZEB 3AI5A 3EFUA 2ZCCA 2I1KA 4N9F4 3SHQA 2O6VB 3DVGY 4WAAA 3DCGA 1OEYA 2K8BA 3JVZX 4RM9A 3DPDA 1WY8A 1UELA 1WE6A 3R7QA 2LD9A 1WGDA 2KHWB 3DBSA 4PS7A 2LZ6A 1GC6A 1Y8RC 4EKUA 1V6EA 4TV3A 4AUQC 4AJYB 2WWZA 4MGYE 2NBWB 1WXAA 4LJOB 1WH3A 2CHWA 4GDLA 2MCNB 1CMXB 3VHTC 2K25A 4IM2A 2KFKB 4TUUA 1WYWB 3L54A 2ZNVC 1BT0A 3ZRFA 2LXCA 4G11A 2N9XA 2RGFA 1Q0WB 1KM7A 3TIXA 3ML9A 2JF5A 4LJPB 2N1VA 3H7PB 2FIDA 4NQKE 1X1MA 2B3AA 2MP2A 3RZFA 4TKNA 3W1SC 2GMIC 4NPNA 2KO3A 4GOCA 4MJSA 3JW0X 2NCNA 3B1LX 4LDTD 1P1AA 4AJWA 3A9JB 3V60A 4HVBA 4FJVB 2ZPYA 4P7IA 1YIWA 4G3XB 1H4RA 4W9KA 1I42A 2AL3A 3PS6A 2L0FA 3TCAA 3P2BA 1GNUA 3ZVVA 4XX5A 4DDGD 1D3ZA 4B6WA 3B08A 2C5LC 1OQYA 2L05A 3KYCD 5JHAA 4WJNA 2RD0A 4GDKA 2FUHB 2O2VA 1UGMA 3RZWC 1WI0A 4MGKE 3PLUA 2AEHA 5D6JB 2BKRB 2IY1B 3SDLC 4FADA 4IW0A 1AARA 3D32A 4J6IA 4EZJA 4HCPB 4RM8A 3VH4B 3WA0A 3M95A 2PJHA 3IFWB 4ZRIA 2BYVE 2M0XA 4M8MA 3A1QA 2JPHA 2EKEC 2KJRA 4FBJB 2DZMA 2GBJA 3LJ3A 3ENEA 5C1ZA 1ZW7A 2LASA 2XEWA 1KJTA 4IM3A 2BGFA 4F1SA 3L10B 1E5WA 4NAWB 2KDEB 4KDIC 4BBNC 2V3SA 4KIKA 4MM3A 4ZRKA 3ONSA 2JRIB 2KLCA 1P9DU 3QK0A 3ZRCA 2K6DB 2DYOA 2R2QA 3L13A 4ANWA 2ZVOA 1RLFA 2IO1B 2V1YA 3BINA 3PT2B 3ZIMA 4KZ0A 5G2NA 2PE6B 4JL9A 2KDBA 3HIZA 2UYZB 4JGHB 4MSMB 2PEAA 4EEWA 2KK8A 2PE9A 1R4MI 5CHVC 3NHEB 3VTWA 1WR6E 2JZ3B 2N9PC 2ZNVB 5LXHA 3EECA 2CKHB 2GBMA 2YLMA 1ZKHA 3K9OB 2L3ZA 4FJZA 4IM0A 4MH0E 3R66C 1TZ1A 2DENB 2K8CA 2BWES 2L0TA 3ZNID 3ZNGC 4BBNF 5BO4B 2DHZA 2JVCA 4RMAA 4DHZB 2HE7A 1WM2A 2KLGA 4IC7B 4TQ1A 2M4NA
chains in the Genus database with same CATH superfamily
1R4NB 1WGGA 4BFRA 2FCQA 1N61A 3R2TA 1AWDA 3DBRI 1B1ZA 3AULA 1A5RA 4WURA 2Y5BB 5DPSA 5E6JA 1F77A 3VQIA 4LNOA 2OOBB 2PPHA 1ZXHA 3ZNHB 3LB8C 2V3NA 4ITKA 3MHSD 5FKAC 1JWMD 5IA7A 1SGHA 4JQWC 2HD5B 4GGQA 3KUZA 1S3SG 1YX5B 1NI2A 2W3SA 3ZDMC 2V9HA 2M8SA 1ET9A 2LEKA 3KH0A 1N6ZA 1XQQA 4NY0A 3NZ3A 2H88B 3OAWA 2CR5A 2G4SA 1E8ZA 2M17A 1YNTE 3HVZA 1VCBA 5IP4D 2CJNA 1MG4A 1RM6C 3AU4A 4HRSA 4WWNA 3U4EG 2WDQB 2KMCA 3CF6E 3KVFB 2DX5B 4KGTA 2L52A 1E8WA 5C23A 3RMKC 3H8HA 1E7VA 1WZ3A 2LRUA 2G4DB 4E71A 2QIEB 1SE3A 3GOEA 4H2AA 2WXHA 3AEFB 3OJ4B 2DYMA 2KQSA 2J7QB 2PTLA 1HE8A 1N60A 3HHMA 1OQQA 4P16A 2WGSA 3Q14C 1C77A 1TT5B 2INNE 3DBLI 2KJHB 2G9HD 4NQLB 2C7MB 3KUDB 4PS8A 1DOIA 1V2YA 4MACA 4OZBA 4K7WA 2KD0A 2RDGA 5LLIA 2KVZA 3PZ8A 4JWSC 4HXDA 1YJ1A 4GB9A 1YQ4B 2DBYA 2LGXA 1FEHA 2WLBA 1JCKB 3VUYA 3AE1B 2WU2B 2L76A 4L2YA 3BIID 1G6JA 4OHJA 2D3CA 3A33B 3A1QB 4ANUA 3DBRB 3N1XC 3W5VB 2FE8A 3URYA 3IVFA 2CHXA 3HVDA 2WX1A 4CQNA 4BKSA 1V5OA 1SB3C 4A90A 4USAA 4DWFA 1WXSA 1YJJA 5T8IA 1WXMA 3R8BA 4W9DA 2BVCA 1KTKA 3VH3B 3IXSA 3M3JA 5IN7A 2GBKA 1ESFA 4WWOA 2WDVB 1PFDA 2Y5CA 2MHJA 3PRMB 1J19A 4KV2A 1C78A 4KKJA 1K53A 5BYRA 1WFYA 2KXJA 4BOZB 2KX3A 5HI1A 3ZKJC 1WJNA 1V8CA 3Q8CA 2CU1A 2HDEA 2LWPA 4LNFA 4WQOB 3WAPA 2KC2A 4M00A 1YN5A 3SU8X 1CK1A 4ZYNA 2FUG1 1PUTA 1D5ZC 2Z0DB 5AZHA 3QARA 3ZDTA 3WANA 3RNFC 3BZDB 1VLBA 4LK0M 1ET6A 3CSTA 1TYGB 3DBLB 1VD2A 3NVVA 4BOSC 2VH1A 4CYEA 3NOBA 2ONQA 1WMHA 3H1UA 3AXCA 5GMVA 3A9KA 3PSEB 3VDZA 4GDKB 2C9WB 2CHZA 4HDQA 1Z2MA 3APDA 4AP4C 3T3OA 5D94A 1MJDA 4ZRPA 2L7RA 1KLUD 4B0EA 3U7ZA 3C19A 2E3TA 3ETRA 3W1YA 1QKZA 1PQSA 3H9DA 3TBLD 4K7UA 4KX6B 3O13A 4MSQB 3RFZB 1VRAB 3Q3JA 2J0MA 2DZJA 1V49A 3A4RA 2IBIB 4M0WB 2VH2A 1E90A 5G5GA 4MGZE 1B9RA 3NS1A 5EDSA 1TS3A 5CTRC 3RN9C 1WJUA 4KZCA 4W9LA 5DPRA 3WIMA 1QT9A 5E6NA 1MHHE 4N6EB 1XLPA 3JYUA 3NVWA 3DBHB 2LGSA 3U8ZA 2MEKA 1LXDA 2N7JA 4E3CA 2LI5A 4BZAA 4W9IA 3E56A 1GOZA 3SHQA 3DVGY 5AUIA 2WXJA 2K8BA 2DWQA 1WE6A 2LD9A 1WGDA 4PS7A 2GRIA 2LZ6A 1V6EA 3AB5A 3FILA 1KRHA 2WWZA 4MGYE 1WXAA 4LJOB 1WH3A 4GDLA 2MCNB 2WXKA 4IM2A 1N63A 1BT0A 3E9SA 4FXCA 4C00A 3ML9A 4LJPB 1PYWD 1MI0A 3W1SC 1ZDXA 4NPNA 4GOCA 1WRIA 4HJGE 3V60A 4P7IA 4AS1A 1QOGA 1C4CA 3V3XA 3ZJTA 1P7FA 3TCAA 1QOBA 1C79A 1GNUA 4XX5A 4DDGD 4B6WA 2BQQA 5JHAA 2FUHB 1T3QA 1WI0A 1WSPA 3Q3MC 1FXIA 4MGKE 4RFBA 2JSVX 4RF0A 3VH4B 4LLGM 4XE0A 3VR9B 1HXYD 2BYVE 2M0XA 3ABVB 4HKQA 4IM3A 4F1SA 4NAWB 1QQRA 1RYJA 2KDEB 5IOIA 2NTSA 1TKGA 2I2YA 1HQRD 2ZW0A 3QK0A 1P9DU 4XWTA 3AE8B 4JL9A 2KDBA 2UYZB 4MSMB 1WR6E 2JZ3B 3K9OB 4OZCA 1QLBB 3NVYA 4MH0E 2WU5B 1VZ6A 1TZ1A 2QJLA 1I4GA 3ZNID 2QCZA 3ZNGC 2ZW1A 4DHZB 2HE7A 2KLGA 1RFKA 1TIFA 1V1PA 1STEA 2Z8LA 3H7SA 1ENFA 4E74A 1WXQA 2NPTB 4W9GA 3MC8A 2FNJB 3RCZA 1HEZE 2IO3B 3A4SC 2K6QA 2ZCBA 3Q3FA 1JRUA 1RFAA 4GXBA 5JH5C 3H6NA 2R2OA 1D5XC 1Q1OA 3A9JA 1ACCA 2MBHA 4IG7B 4IKGA 3IAM1 1WGHA 1QOFA 3MJWA 3NS8A 3UGBB 4HEA1 3ZJUA 5LXIB 1GJZA 3VRBB 4WIPA 3B2GA 3DVGX 5DPTA 2KANA 2EMSA 3MC9A 1JQ4A 4W9HA 2DZKA 3MTNB 2NVUI 5LNK1 1NYQA 3AN1A 1F1HA 2K0PA 2JZZA 3U7DA 2K22A 2IDYA 2M56B 1NBFC 4ANXA 2JWZA 4PS3A 4W9JA 4F8CB 2MBQA 2BS4B 1K51A 2JXTA 4Q2JA 2J4XA 3R7RA 1U4AA 2K8HA 4JIOU 5G5HA 4MT5A 3EFCA 3P4QB 4W9FA 4MGIE 4URKA 3AEBB 2LGYA 2RDBC 4ZDVA 1AW7A 3RPFC 3VFKA 5J2RA 1F52A 5D3IB 3BVMA 2NBVB 2KX0A 1I4PA 1DOXA 4ZYSA 3WCQA 1MG8A 1ZOYB 4QAYA 2HJ8A 3QA8A 1HZ5A 2RMMA 2GLSA 4MJSB 4A9AA 1CQVA 4TSSA 1CZPA 2IYDB 3O65B 2FCSA 2KQ4X 2G3QB 3IHPC 2JUOA 1DGJA 1E7PB 2LJ5A 3Q8EA 1J7CA 1GC7A 1QILA 2J52A 4IDIA 5BYQA 2R61A 4W9CA 3N3KB 2IPKD 3QAQA 1WM3A 3HK0A 1ZGUB 2O6VA 2RPVA 3IG3A 2KVRA 2IO2B 1WX8A 1VZ7A 3L17A 3AEEB 1EUVB 4PYZA 1YQBA 1E7UA 3KLSX 1VZ8A 1WX9A 1L7YA 1WX7A 4IWQA 3TEWA 2XK5B 2FBWB 2EKIA 1GUAB 2IZVB 3TEXA 3GE8C 5IO9A 2K39A 2KDFB 1RRBA 5AZFA 3QHTA 1XXGA 2JU6X 4HCNB 1XLQA 4XWWA 4A3OA 2YEPF 3DDCB 2WXPA 4JX1C 2M19A 2NBUA 2KWDA 2LHEA 2KWVB 1GAQB 4DXFA 2AQ2B 3VTUA 2REXA 2ZZPB 3PZ7A 2MBEA 3Q8FA 2MH7A 4OVZA 2UU7A 2OJWA 3PVLA 2OEDA 1SBBB 2RPQA 3QWZB 4MELA 1JRPA 2WYQA 3R2IA 2WS3B 1SF0A 3ALBA 2IGHA 1AN8A 2D3AA 5EE9A 4WWMA 3N30A 3B0AA 3CSFA 3NRZA 3AMZA 1E10A 2QDFA 3HM6X 4JLCA 4P6VF 3M63B 2W3RA 1IGCA 2KDIA 3ZO5B 2NMQA 5D7GA 1TTNA 2L83A 4PYUA 1I7HA 3QX1A 4HK2A 3VVWB 2KN5A 4EZKA 2XBBC 1XT9B 4O1NA 2GBNA 3S2AA 5J18A 1PGXA 2AWTA 2K5PA 2KWCA 3I5JC 4GU2A 2L00B 5HFYA 3DQVA 4WWPA 2O2VB 4ZHPA 1NENB 4KSKC 2PVOD 1H8CA 1YD8U 1Z5SB 3ZLZA 4K7SA 3GZNI 2JWUA 3N20C 3QCAA 3QC8B 2KAJA 5HG2A 2FCNA 2KACA 4EOYA 1WWTA 1A70A 3PPAA 2RR9A 1YMHE 3SD5A 3TEZA 2GOWA 2WX0A 4EE2A 1WIAA 3WAMA 3AE5B 3CIRB 3AECB 3RUIB 4JPSA 5E6OA 2KTRA 1GB1A 1C3TA 1NI3A 1JWUD 3RI7C 5L83A 4GMVA 2DAJA 2BYEA 3VUWA 2I38A 1TBEA 1DOYA 5JZEB 1D4BA 2WXGA 2I1KA 3KWLA 4ZRQA 3DCGA 4LNNA 4RM9A 1EM7A 3P42A 1KF6B 1GC6A 1Y8RC 4EKUA 1CJEA 1AYFA 4JE3B 2CHWA 1YOVB 2K25A 1NYRA 4IOIE 2KFKB 2ZNVC 4G11A 2N9XA 1Q0WB 3J9CA 1L0XB 3H7PB 5BMHA 4NQKE 2MP2A 2B3AA 4TKNA 2KO3A 3B1LX 4W9KA 1I42A 3P2BA 3ZVVA 4DXGA 1D3ZA 1OQYA 1P7EA 5D3DA 4WJNA 4GDKA 3RZWC 3P1MA 2IY1B 3SDLC 4IW0A 2MJ3A 4RGTA 1N5WA 1FFUA 2V3PA 1TKEA 1TJEA 4M8MA 2JPHA 2EKEC 2DZMA 3IT6B 2GBJA 3LJ3A 1ZW7A 3DWMA 2LASA 4MH8A 1XCTL 1FM0D 4KIKA 1JWSD 2JRIB 4M0WA 3L13A 1RLFA 3BINA 3GZNB 4KZ0A 3HIZA 2PEAA 4EEWA 3AEDB 3NHEB 2N9PC 2W55A 2D3BA 4FJZA 1L5PA 4IM0A 3R66C 2K8CA 3KQ4A 5BO4B 4LNIA 3VRAB 1FNWA 1WM2A 4IC7B 3BK1A 1JWBD 2X8XX 2M4NA 3RYTA 1NDDA 3JSVB 3PV1A 1ROEA 2G1EA 2WXNA 1JALA 1E6EB 1PDXA 2NS5A 4EFOA 3RT3B 1WJ6A 4XZ4A 1T5XD 4YSYB 4RF1A 3GP7A 5EE1A 2ICIA 5CHWA 3IT4B 2IY0B 3GE3C 3AM9A 4ICUA 3NJTA 3L4PA 4HKZE 2N7DA 4PK1A 1FPYA 1VDVA 2LGIA 2PKOA 3UF8A 4GN1A 1EU3A 2MA9B 2ZJDA 1I35A 2QHOA 3L16A 1T0SC 1E8XA 2WNMA 1IYFA 4NAMA 3BYTB 1TZOA 1F2RC 3NUHB 5I4DA 4FLHA 1KLGD 5HKHA 2JYTA 4WQMA 2DAFA 2LXAA 1ZPSA 4GLSC 3V6EB 4FHKA 3SFDB 2WXFA 2KMAA 4K3BA 3MHZA 3AE3B 1EU4A 3Q8AA 4OVVA 2LMCA 1LM8B 3DVNV 2KNBA 5BMIA 4EZLA 3PRPB 1K52A 3APCA 4C56C 1Q10A 4RGMA 2BYTA 4NAWA 3OLMD 3X23A 3DHHC 2NR2A 2D10A 3X0WA 2MBOA 4C4VA 4B95A 2LUEA 4BKSD 4PT5A 2N9KA 1IUEA 1IPGA 1V97A 4YXDB 4CO7A 3RNAC 1T0YA 1WGYA 2AX5A 4K81A 1E0ZA 2LFIA 1FXTB 2AQ3B 2KMMA 3IBEA 2X38A 1RWSA 4L23A 4DBGA 2LHDA 1WE7A 2JRHA 2MLBA 2BF8B 2BWFA 5J17A 4HDOA 2N7EA 1P0RA 2NPTA 4K1RB 2KFJA 1XCQL 4LCDE 1P98A 2QC8A 3C0RB 3UINB 2JQRB 3DHIC 3P63A 1ZE3D 3AEAB 1E8YA 2FAZA 4DHJD 2MBBB 1SE4A 1NEKB 3SEBA 1N5XA 1UWMA 1OTRB 4C7YA 1XF5L 3C8YA 1IBXB 3FC4A 2Y3AA 3BVGA 3OJ3A 2WDTB 4ACFA 4ANVA 1EWCA 3KW5B 4XC2A 3V05A 2MRPA 4FULA 3EUB2 3T8MA 4KGSA 2LUMA 2ZEQA 1FFVA 4FHJA 1R4NI 2MQJA 1V1OA 3M62B 1QF6A 2EMTA 1OFFA 1WF9A 2FIFA 3QIJA 1T0RC 1YN4A 4TMAB 3BY4B 1LFDA 5CHFA 2BTEA 2KOXA 4LDTB 5D2MB 1L0YB 2D3GA 3WAOA 4DHZE 2VZKD 1V1PB 1JMLA 2QILA 4IWOA 4XGAB 4AOFA 2K9XA 2WP9B 2KKCA 3NY5A 4YL8A 4US8A 1VJKA 3ZGZA 2LRWA 3W9CB 1J7AA 5GXGB 1D6EC 4S17A 3CWIA 4XDDA 4R3DA 3N9YC 3TL5A 4HWIB 2YVCA 2MSED 1YN3A 2JT4B 1LQBA 1SEBD 1V5TA 4KSLC 2J0KA 1L6VA 2M1MA 2WXRA 3NG0A 4UDUC 2JXXA 2CJOA 3TUOA 5IAAC 3N32A 2L8JA 5BYSA 1GPXA 3QJZA 2B76B 2XN9C 2QEJC 2N4FA 1V9JA 5MPOA 1BUIC 2K1FA 1WZ0A 2KWUB 5KHQA 2DLBA 3LDZE 1GB4A 3ZUNA 3RULA 3W2DA 2GB1A 3V62A 3NZUA 5HHDG 3TJPA 1WXVA 4II3B 1L2NA 4J3OD 3MP9A 2CS4A 4ARCA 3BVZA 3AEGB 4HJKA 1ZXIA 3TEYA 4A20A 1WRDB 1DYQA 1Q5WB 1EF1A 3B9JA 3U30A 2XK5A 4BVUC 3KYDD 2RSUA 3VTVA 3IAS1 2KC1A 1I4XA 3PHXB 1SJED 4C7ZA 3MFGA 2CU3A 3AV8A 4MM3B 2NTTA 4WJPA 2BB5A 1HZ6A 2QMTA 1FIQA 5JXVA 1XD3B 3P4PB 4NNJB 4XYCA 2KN4A 1ZP0B 1OGWA 2DZIA 3ZTDA 1KH0A 3ZW3A 2RDHA 3KUCB 1WGRA 3MJ5A 2ZCCA 2O6VB 2EELA 3BYYB 4YSXB 5C3JB 1UELA 4HPPA 3ZJVA 2WHIA 2KHWB 3Q6BA 4TV3A 2NBWB 3VHTC 5H92C 3KWVA 1I4HA 1WYWB 2LJIA 3EGRA 2INPE 4OZAA 2KYWA 1ZDVA 1KM7A 2N1VA 3P4RB 1VR9A 2GMIC 2NCNA 4LDTD 4AJWA 2ZPYA 3SR6A 1H4RA 5C2TB 2L0FA 2WDRB 1BXTA 2PVGC 2WXIA 1T0QC 2WQYB 3KYCD 1Y56A 2BBCA 1MFWA 2O2VA 3RNGC 3T3NA 3PLUA 5D6JB 2BKRB 4EZJA 1FXAA 4HCPB 4RM8A 3WA0A 2PJHA 3HRDD 2Q5WD 3IFWB 1MHXA 3SFEB 3AH7A 1TY2A 2QSDA 1SIJA 3A1QA 1XLNA 2KJRA 5C1ZA 3ENEA 4RH6A 4BAXA 4NZLB 1PGBA 1KJTA 2XEWA 2BGFA 3L10B 4KDIC 1L4DB 2L32A 2PMVA 4ZRKA 2N9LA 2DYOA 4ANWA 2IO1B 2V1YA 4P1BC 5G2NA 4JGHB 4REZA 1R4MI 1L0VB 1UWXA 2OHFA 5CHVC 3VTWA 2ZNVB 5LXHA 3EECA 4JWUC 3LXFA 2YLMA 3MC0B 1F2RI 1WGKA 1SE2A 3AE2B 2DENB 2BWES 2L0TA 4BBNF 2JVCA 4RMAA 3I57A 1EWYC 4TQ1A 3UQAA 2JZPA 2BT6A 2N0SB 1TKYA 2G45B 3ZQ4A 1FO4A 2AYOB 4FA6A 1UZXB 1BMLC 4IWPA 1V80A 4ASWC 2C7HA 2JY6A 1LO5D 2HJ1A 1TY0A 2KFKA 4KGRA 4A3PA 3RNCC 2MJEA 4XDCA 4B0MA 3H7PA 3Q3OC 4WH4A 2SAKA 2Y5PA 2TSSA 4N58A 1L6UA 2INCC 3FKYA 2A5UA 3DBHI 1K8RB 1SE9A 4DDID 2LVPA 3RNBC 3I3TB 1GG3A 4X57B 1J0GA 2BYFA 2MX2A 3BWUD 3Q2AC 5L95C 3TSSA 4B9KA 4M8NA 5CX3A 3RNEC 3AE4B 4KDLB 3UQBA 4GIVA 3Q3NC 4RCOA 5G55A 1JW9D 2Z59B 1EO6A 1JROA 4BKGA 2KTRB 2M0AA 3NVZA 1FD6A 3OG5A 1XO3A 3Q8BA 4MDKE 2UWQA 1JWAD 2ON8A 4IUMB 2O6VD 4HPLB 2KDMA 2J53A 3RD2A 4N59A 3HM3A 1D5MC 4S0RA 2Z0EB 3DWGC 3ZNZB 1ISNA 1KLVA 3PGEA 1YJIA 2MJDA 2BKFA 4II2B 3AU5A 3ECIA 3DVNU 3N1ZC 4DHJB 1FRRA 1KFYB 2BPSA 3I9V1 4NJ6A 2MP2B 1J8CA 4I6NB 1UBQA 1QOAA 5IKCM 4NJCA 1K50A 1ZUD2 5EE0A 3W1SA 1TGZB 3JSVA 1C9FA 2N1WA 2KZRA 1R4MB 2V0GA 2C7NB 1V81A 3Q69A 2D2QA 2A4ZA 1FNVA 3R3MA 2PIAA 1KOTA 1I4RA 1PGAA 2PLPA 2JX5A 4RGNA 1UD7A 2ASQA 4HPMB 2JYEA 1V86A 5FR3A 3PHWB 2K3UA 3APFA 2WXQA 2INDC 3U52E 3L0WB 1C76A 1WMHB 3TMPB 2IO0B 3A9KB 3AE9B 2VZKB 2D07B 4KIKB 3AE6B 4EUTA 2AQ1B 2MWSB 3V61A 3VR8B 4I6PA 1C1YB 4ARIA 2KJ6A 5KHOA 2I1JA 4G50A 4KKIA 3GB1A 5AEKB 4BKTA 5FR6A 4DQOC 4OVUA 3ML8A 2KQ7A 4YSZB 4GSWA 3UIPB 2N9EB 4DK5A 5H8YE 3PRZA 4AWJA 1WYGA 2PW9A 2WXMA 4CHKA 3ZXVA 4ZOHC 2VRRB 2WXOA 1UF0A 2IGDA 3VAWA 1S1QB 3VUXA 2DNFA 3K9PB 1XEEA 1F9JA 2HTHA 1FNUA 2LVQA 1UH6A 3VXWA 1HTOA 3B2FA 4LNKA 1OEYJ 3LYYA 1FMAD 1SXTA 1P3QU 1T6BX 3PTFC 2H89B 3PLVA 3HUIA 5TR5A 4F7ZA 4ICVA 1YQ3B 3FILB 1TS2A 5AUKA 4GDLB 4ZHOA 1SJHD 4W9EA 2MW5A 3L08A 2LGDA 5JHBA 4P1CC 3P4SB 3V6CB 2BS3B 2YEPB 2KT7A 2J0JA 4TQ0A 3ZYYX 3PZDA 1IGDA 5E6PA 1SIFA 1E9MA 4YTNB 3OWEB 2W9NA 2LVOA 4ZRJA 4WJOA 3N1YC 4FN2A 2W54A 4YTPB 4HLEA 2ACZB 4G0NB 5DPWA 1IBXA 4NJ7A 4RGOS 4YWGG 2V4LA 4I6LB 3ZTCA 5AZGA 2C60A 4C4VB 4RNAA 2OJRA 1UGJA 3WALA 2KTFA 4LTUA 1OQRA 4FJYA 1UBIA 5FK9C 3EHVA 2AL6A 3DOWA 1YX6B 3UI3A 3QQ8B 1RAXA 2DYBA 3DHGC 4WJQA 4KVGB 1M94A 2D11A 3EC8A 1QZEA 1MPEA 2BW2A 1WJ4A 2ZVNA 3PREA 3GS2A 4K3CA 1WR1A 4A55A 1IP9A 1FCCC 1TS5A 2FCMA 3NZSA 3EA6A 3PO0A 1EF5A 3UIOB 5DCNA 4DXAB 2GBRA 2ZPNA 3CMMB 2XNAC 1MVKA 2E6XA 3T9LA 4MEMA 3AI5A 3I63C 3EFUA 4N9F4 4WAAA 1OEYA 2IGGA 3JVZX 1HTQA 2BS2B 3DPDA 1WY8A 3R7QA 3DBSA 4AQ7A 4AUQC 2GI9A 4AJYB 1CMXB 3BK2A 4TUUA 3L54A 3ZRFA 2LXCA 1M4VA 2RGFA 1FCLA 4M01A 3TIXA 1C4PA 4A8XC 2JF5A 1N62A 2FIDA 4YT0B 1X1MA 3RZFA 2W82A 1I4QA 4MJSA 1J7BA 3JW0X 3ZXRA 1P1AA 3A9JB 1FRDA 2SEBD 4HVBA 4FJVB 4M02A 1YIWA 4G3XB 2AL3A 3PS6A 1NVID 1SSNA 3B08A 2C5LC 2L05A 2RD0A 1UGMA 4C80A 2IJ0A 4OW0A 1TS4A 3U2SC 2AEHA 4FADA 1AARA 3D32A 4J6IA 1F0ZA 2J42A 3M95A 4HROA 4ZRIA 4L1BA 4FBJB 3AE7B 4YTMB 1UNSA 2HTME 5EE3A 1E5WA 3W5UB 4BBNC 2V3SA 1XLOA 4MM3A 3ONSA 1UUPA 2KLCA 3ZRCA 4A6QA 4D2KA 2K6DB 2R2QA 2L1AA 2ZVOA 2BB6A 3ZIMA 3PT2B 1LGRA 2PE6B 5BMGA 1L4ZB 2KK8A 2PE9A 5TSSA 2D5GA 1HA5A 2WXLA 2CKHB 2GBMA 1ZKHA 2L3ZA 1C4AA 3FAHA 2V4IB 4US9A 2DHZA 1R7SA 4WAFA
chains in the Genus database with same CATH topology
3RYTA 1NDDA 3JSVB 2G45B 1WGGA 3PV1A 4BFRA 3H7SA 2FCQA 4E74A 2AYOB 4FA6A 1UZXB 2NPTB 3DBRI 2NS5A 4W9GA 4EFOA 3RT3B 4IWPA 1V80A 3AULA 2FNJB 1WJ6A 1A5RA 4XZ4A 2C7HA 3RCZA 2JY6A 2Y5BB 4ASWC 5DPSA 2KFKA 2IO3B 3A4SC 3VQIA 4A3PA 2OOBB 2PPHA 2K6QA 3ZNHB 2ZCBA 3Q3FA 5CHWA 3MHSD 2IY0B 3H7PA 1JRUA 1RFAA 4GXBA 4ICUA 5IA7A 1SGHA 5JH5C 2N7DA 4JQWC 3H6NA 2R2OA 2HD5B 4GGQA 3KUZA 3UF8A 4GN1A 1Q1OA 1S3SG 1YX5B 2MA9B 2ZJDA 3A9JA 1NI2A 1I35A 2A5UA 2MBHA 4IG7B 3ZDMC 3DBHI 1K8RB 1SE9A 1WGHA 2QHOA 3L16A 4DDID 3MJWA 2M8SA 1E8XA 3NS8A 3UGBB 2LVPA 3KH0A 1IYFA 3I3TB 1GG3A 4X57B 1J0GA 1XQQA 2BYFA 2MX2A 4NY0A 5LXIB 5L95C 1GJZA 4B9KA 4M8NA 5CX3A 4FLHA 4KDLB 3UQBA 5HKHA 3DVGX 3OAWA 5DPTA 4GIVA 2DAFA 2CR5A 2G4SA 2KANA 5G55A 2EMSA 2LXAA 1E8ZA 1EO6A 2Z59B 2M17A 3V6EB 4BKGA 2KTRB 4W9HA 1VCBA 4FHKA 3AU4A 2DZKA 3MTNB 2KMAA 2NVUI 4MDKE 4WWNA 2UWQA 2KMCA 3CF6E 4IUMB 3KVFB 2DX5B 4OVVA 1E8WA 2O6VD 1LM8B 3DVNV 2KNBA 2JZZA 5C23A 4HPLB 3U7DA 1NBFC 4ANXA 4EZLA 2JWZA 3PRPB 4PS3A 4W9JA 4F8CB 2MBQA 3RD2A 3APCA 3HM3A 4NAWA 3OLMD 3X23A 1E7VA 1WZ3A 2LRUA 2Z0EB 3R7RA 2G4DB 2NR2A 4E71A 1U4AA 2K8HA 4JIOU 2D10A 3ZNZB 1ISNA 4W9FA 2MBOA 3GOEA 3X0WA 4MGIE 4URKA 4B95A 2LGYA 2LUEA 4BKSD 4ZDVA 3PGEA 1KLVA 3OJ4B 2DYMA 3VFKA 2KQSA 1IPGA 5J2RA 2BKFA 4II2B 3AU5A 3ECIA 3DVNU 4CO7A 2J7QB 2NBVB 1HE8A 3HHMA 2KX0A 1T0YA 1WGYA 4DHJB 1MG8A 2BPSA 4K81A 2HJ8A 3QA8A 4NJ6A 1FXTB 2MP2B 1J8CA 4I6NB 1UBQA 3IBEA 4MJSB 3DBLI 2KJHB 3W1SA 2IYDB 4DBGA 3O65B 4NQLB 2C7MB 1WE7A 2JRHA 3KUDB 2MLBA 1TGZB 2BF8B 2FCSA 4PS8A 1V2YA 2G3QB 3IHPC 2JUOA 3JSVA 2BWFA 4K7WA 2N1WA 2KD0A 2KZRA 5LLIA 5J17A 4HDOA 2N7EA 2C7NB 1P0RA 4HXDA 1YJ1A 2NPTA 1V81A 2LJ5A 4K1RB 2D2QA 2KFJA 4GB9A 1GC7A 2A4ZA 2LGXA 4LCDE 1P98A 3C0RB 3R3MA 1KOTA 3UINB 4W9CA 3N3KB 3VUYA 1UD7A 2ASQA 3QAQA 1E8YA 2FAZA 4HPMB 1WM3A 3HK0A 1ZGUB 2L76A 1V86A 4DHJD 2MBBB 2O6VA 1G6JA 3PHWB 3IG3A 3APFA 3A33B 2KVRA 2IO2B 1OTRB 3A1QB 1WX8A 3L17A 4ANUA 3L0WB 1WMHB 1EUVB 3OJ3A 3TMPB 2IO0B 3A9KB 2WDTB 4PYZA 4ANVA 1YQBA 1E7UA 2D07B 3IVFA 3KW5B 4XC2A 2CHXA 2MRPA 4KIKB 2WX1A 4EUTA 4FULA 1WX9A 1L7YA 1WX7A 2MWSB 3T8MA 3V61A 4BKSA 4I6PA 1V5OA 2ZEQA 1C1YB 4IWQA 4FHJA 2KJ6A 1R4NI 5KHOA 2XK5B 2I1JA 2MQJA 4DWFA 4G50A 3M62B 1WXSA 2EMTA 1GUAB 5AEKB 1WF9A 2IZVB 4BKTA 1WXMA 2FIFA 4W9DA 5FR6A 3QIJA 2K39A 3VH3B 4OVUA 2KDFB 3BY4B 1LFDA 3ML8A 2KQ7A 1RRBA 5CHFA 4GSWA 2KOXA 3M3JA 3UIPB 5AZFA 4LDTB 5D2MB 2GBKA 2N9EB 3QHTA 4WWOA 4HCNB 4DK5A 3PRZA 2D3GA 3WAOA 4A3OA 4AWJA 4DHZE 3DDCB 4CHKA 4IWOA 3PRMB 1J19A 2NBUA 4AOFA 2VRRB 4KV2A 2KKCA 2KWVB 3NY5A 4YL8A 3VTUA 2REXA 1S1QB 2ZZPB 3VAWA 1WFYA 2LRWA 3VUXA 2KXJA 2MBEA 4BOZB 3K9PB 1F9JA 2KX3A 3TL5A 3ZKJC 2HTHA 1WJNA 3PVLA 2LVQA 1UH6A 3VXWA 4HWIB 2CU1A 2RPQA 2MSED 2YVCA 1OEYJ 2LWPA 2JT4B 3QWZB 1LQBA 4MELA 1V5TA 2WYQA 4KSLC 2J0KA 4WQOB 3WAPA 2M1MA 1P3QU 2JXXA 3PTFC 3PLVA 5TR5A 4F7ZA 3ALBA 4ICVA 2KC2A 3N30A 5IAAC 3B0AA 3CSFA 3SU8X 3N32A 2L8JA 4ZYNA 3QJZA 3HM6X 2N4FA 4GDLB 1V9JA 4JLCA 3M63B 2Z0DB 4W9EA 2KDIA 2MW5A 2K1FA 1WZ0A 2KWUB 2LGDA 3L08A 5AZHA 3ZO5B 3V6CB 5JHBA 3LDZE 5KHQA 3QARA 3ZDTA 5D7GA 1TTNA 3WANA 3ZUNA 2J0JA 4TQ0A 4PYUA 3PZDA 3CSTA 5E6PA 3QX1A 4HK2A 3RULA 1SIFA 3V62A 3NZUA 3VVWB 1VD2A 2KN5A 2W9NA 2LVOA 3TJPA 4EZKA 2XBBC 4ZRJA 1WXVA 4WJOA 4FN2A 1XT9B 4HLEA 4II3B 2GBNA 4BOSC 3S2AA 4CYEA 1L2NA 3NOBA 5J18A 2AWTA 3UQAA 2KWCA 4G0NB 2CS4A 5DPWA 1WMHA 3H1UA 4GU2A 2L00B 3AXCA 4HJKA 5GMVA 3A9KA 3DQVA 3PSEB 3VDZA 4GDKB 4NJ7A 4WWPA 2C9WB 2O2VB 2CHZA 4HDQA 1Z2MA 2V4LA 4I6LB 4KSKC 1H8CA 3ZTCA 1YD8U 5AZGA 3APDA 4A20A 1WRDB 1Z5SB 2C60A 3ZLZA 5D94A 4AP4C 4K7SA 2OJRA 1Q5WB 2L7RA 3GZNI 3WALA 1EF1A 3U30A 2KTFA 3QCAA 4FJYA 2XK5A 4BVUC 1UBIA 3KYDD 3QC8B 2RSUA 3VTVA 3W1YA 3EHVA 2AL6A 3DOWA 1YX6B 1PQSA 3H9DA 2FCNA 2KC1A 3QQ8B 3TBLD 4EOYA 1RAXA 2DYBA 4K7UA 3PPAA 4KVGB 3PHXB 1M94A 2D11A 4WJQA 2RR9A 3EC8A 4MSQB 1QZEA 3Q3JA 2J0MA 3SD5A 2DZJA 2GOWA 2WX0A 4WJPA 1WIAA 1V49A 3A4RA 2IBIB 1WJ4A 4M0WB 1E90A 3WAMA 2ZVNA 3PREA 4MGZE 3RUIB 5EDSA 1WR1A 1XD3B 1IP9A 5CTRC 2FCMA 1WJUA 3NZSA 4NNJB 4KZCA 5E6OA 4W9LA 5DPRA 3WIMA 2KTRA 5E6NA 1EF5A 3UIOB 5DCNA 4DXAB 1C3TA 1OGWA 2GBRA 2ZPNA 3CMMB 2DZIA 3JYUA 3ZTDA 5L83A 3U8ZA 4GMVA 1LXDA 3ZW3A 2DAJA 2BYEA 3VUWA 4E3CA 2LI5A 4W9IA 3KUCB 3T9LA 1TBEA 1WGRA 4MEMA 5JZEB 3AI5A 3EFUA 2ZCCA 2I1KA 4N9F4 3SHQA 2O6VB 3DVGY 4WAAA 3DCGA 1OEYA 2K8BA 3JVZX 4RM9A 3DPDA 1WY8A 1UELA 1WE6A 3R7QA 2LD9A 1WGDA 2KHWB 3DBSA 4PS7A 2LZ6A 1GC6A 1Y8RC 4EKUA 1V6EA 4TV3A 4AUQC 4AJYB 2WWZA 4MGYE 2NBWB 1WXAA 4LJOB 1WH3A 2CHWA 4GDLA 2MCNB 1CMXB 3VHTC 2K25A 4IM2A 2KFKB 4TUUA 1WYWB 3L54A 2ZNVC 1BT0A 3ZRFA 2LXCA 4G11A 2N9XA 2RGFA 1Q0WB 1KM7A 3TIXA 3ML9A 2JF5A 4LJPB 2N1VA 3H7PB 2FIDA 4NQKE 1X1MA 2B3AA 2MP2A 3RZFA 4TKNA 3W1SC 2GMIC 4NPNA 2KO3A 4GOCA 4MJSA 3JW0X 2NCNA 3B1LX 4LDTD 1P1AA 4AJWA 3A9JB 3V60A 4HVBA 4FJVB 2ZPYA 4P7IA 1YIWA 4G3XB 1H4RA 4W9KA 1I42A 2AL3A 3PS6A 2L0FA 3TCAA 3P2BA 1GNUA 3ZVVA 4XX5A 4DDGD 1D3ZA 4B6WA 3B08A 2C5LC 1OQYA 2L05A 3KYCD 5JHAA 4WJNA 2RD0A 4GDKA 2FUHB 2O2VA 1UGMA 3RZWC 1WI0A 4MGKE 3PLUA 2AEHA 5D6JB 2BKRB 2IY1B 3SDLC 4FADA 4IW0A 1AARA 3D32A 4J6IA 4EZJA 4HCPB 4RM8A 3VH4B 3WA0A 3M95A 2PJHA 3IFWB 4ZRIA 2BYVE 2M0XA 4M8MA 3A1QA 2JPHA 2EKEC 2KJRA 4FBJB 2DZMA 2GBJA 3LJ3A 3ENEA 5C1ZA 1ZW7A 2LASA 2XEWA 1KJTA 4IM3A 2BGFA 4F1SA 3L10B 1E5WA 4NAWB 2KDEB 4KDIC 4BBNC 2V3SA 4KIKA 4MM3A 4ZRKA 3ONSA 2JRIB 2KLCA 1P9DU 3QK0A 3ZRCA 2K6DB 2DYOA 2R2QA 3L13A 4ANWA 2ZVOA 1RLFA 2IO1B 2V1YA 3BINA 3PT2B 3ZIMA 4KZ0A 5G2NA 2PE6B 4JL9A 2KDBA 3HIZA 2UYZB 4JGHB 4MSMB 2PEAA 4EEWA 2KK8A 2PE9A 1R4MI 5CHVC 3NHEB 3VTWA 1WR6E 2JZ3B 2N9PC 2ZNVB 5LXHA 3EECA 2CKHB 2GBMA 2YLMA 1ZKHA 3K9OB 2L3ZA 4FJZA 4IM0A 4MH0E 3R66C 1TZ1A 2DENB 2K8CA 2BWES 2L0TA 3ZNID 3ZNGC 4BBNF 5BO4B 2DHZA 2JVCA 4RMAA 4DHZB 2HE7A 1WM2A 2KLGA 4IC7B 4TQ1A 2M4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYT A;  1NDD A;  3JSV B;  2G45 B;  1WGG A;  3PV1 A;  4BFR A;  3H7S A;  2FCQ A;  4E74 A;  2AYO B;  4FA6 A;  1UZX B;  2NPT B;  3DBR I;  2NS5 A;  4W9G A;  4EFO A;  3RT3 B;  4IWP A;  1V80 A;  3AUL A;  2FNJ B;  1WJ6 A;  1A5R A;  4XZ4 A;  2C7H A;  3RCZ A;  2JY6 A;  2Y5B B;  4ASW C;  5DPS A;  2KFK A;  2IO3 B;  3A4S C;  3VQI A;  4A3P A;  2OOB B;  2PPH A;  2K6Q A;  3ZNH B;  2ZCB A;  3Q3F A;  5CHW A;  3MHS D;  2IY0 B;  3H7P A;  1JRU A;  1RFA A;  4GXB A;  4ICU A;  5IA7 A;  1SGH A;  5JH5 C;  2N7D A;  4JQW C;  3H6N A;  2R2O A;  2HD5 B;  4GGQ A;  3KUZ A;  3UF8 A;  4GN1 A;  1Q1O A;  1S3S G;  1YX5 B;  2MA9 B;  2ZJD A;  3A9J A;  1NI2 A;  1I35 A;  2A5U A;  2MBH A;  4IG7 B;  3ZDM C;  3DBH I;  1K8R B;  1SE9 A;  1WGH A;  2QHO A;  3L16 A;  4DDI D;  3MJW A;  2M8S A;  1E8X A;  3NS8 A;  3UGB B;  2LVP A;  3KH0 A;  1IYF A;  3I3T B;  1GG3 A;  4X57 B;  1J0G A;  1XQQ A;  2BYF A;  2MX2 A;  4NY0 A;  5LXI B;  5L95 C;  1GJZ A;  4B9K A;  4M8N A;  5CX3 A;  4FLH A;  4KDL B;  3UQB A;  5HKH A;  3DVG X;  3OAW A;  5DPT A;  4GIV A;  2DAF A;  2CR5 A;  2G4S A;  2KAN A;  5G55 A;  2EMS A;  2LXA A;  1E8Z A;  1EO6 A;  2Z59 B;  2M17 A;  3V6E B;  4BKG A;  2KTR B;  4W9H A;  1VCB A;  4FHK A;  3AU4 A;  2DZK A;  3MTN B;  2KMA A;  2NVU I;  4MDK E;  4WWN A;  2UWQ A;  2KMC A;  3CF6 E;  4IUM B;  3KVF B;  2DX5 B;  4OVV A;  1E8W A;  2O6V D;  1LM8 B;  3DVN V;  2KNB A;  2JZZ A;  5C23 A;  4HPL B;  3U7D A;  1NBF C;  4ANX A;  4EZL A;  2JWZ A;  3PRP B;  4PS3 A;  4W9J A;  4F8C B;  2MBQ A;  3RD2 A;  3APC A;  3HM3 A;  4NAW A;  3OLM D;  3X23 A;  1E7V A;  1WZ3 A;  2LRU A;  2Z0E B;  3R7R A;  2G4D B;  2NR2 A;  4E71 A;  1U4A A;  2K8H A;  4JIO U;  2D10 A;  3ZNZ B;  1ISN A;  4W9F A;  2MBO A;  3GOE A;  3X0W A;  4MGI E;  4URK A;  4B95 A;  2LGY A;  2LUE A;  4BKS D;  4ZDV A;  3PGE A;  1KLV A;  3OJ4 B;  2DYM A;  3VFK A;  2KQS A;  1IPG A;  5J2R A;  2BKF A;  4II2 B;  3AU5 A;  3ECI A;  3DVN U;  4CO7 A;  2J7Q B;  2NBV B;  1HE8 A;  3HHM A;  2KX0 A;  1T0Y A;  1WGY A;  4DHJ B;  1MG8 A;  2BPS A;  4K81 A;  2HJ8 A;  3QA8 A;  4NJ6 A;  1FXT B;  2MP2 B;  1J8C A;  4I6N B;  1UBQ A;  3IBE A;  4MJS B;  3DBL I;  2KJH B;  3W1S A;  2IYD B;  4DBG A;  3O65 B;  4NQL B;  2C7M B;  1WE7 A;  2JRH A;  3KUD B;  2MLB A;  1TGZ B;  2BF8 B;  2FCS A;  4PS8 A;  1V2Y A;  2G3Q B;  3IHP C;  2JUO A;  3JSV A;  2BWF A;  4K7W A;  2N1W A;  2KD0 A;  2KZR A;  5LLI A;  5J17 A;  4HDO A;  2N7E A;  2C7N B;  1P0R A;  4HXD A;  1YJ1 A;  2NPT A;  1V81 A;  2LJ5 A;  4K1R B;  2D2Q A;  2KFJ A;  4GB9 A;  1GC7 A;  2A4Z A;  2LGX A;  4LCD E;  1P98 A;  3C0R B;  3R3M A;  1KOT A;  3UIN B;  4W9C A;  3N3K B;  3VUY A;  1UD7 A;  2ASQ A;  3QAQ A;  1E8Y A;  2FAZ A;  4HPM B;  1WM3 A;  3HK0 A;  1ZGU B;  2L76 A;  1V86 A;  4DHJ D;  2MBB B;  2O6V A;  1G6J A;  3PHW B;  3IG3 A;  3APF A;  3A33 B;  2KVR A;  2IO2 B;  1OTR B;  3A1Q B;  1WX8 A;  3L17 A;  4ANU A;  3L0W B;  1WMH B;  1EUV B;  3OJ3 A;  3TMP B;  2IO0 B;  3A9K B;  2WDT B;  4PYZ A;  4ANV A;  1YQB A;  1E7U A;  2D07 B;  3IVF A;  3KW5 B;  4XC2 A;  2CHX A;  2MRP A;  4KIK B;  2WX1 A;  4EUT A;  4FUL A;  1WX9 A;  1L7Y A;  1WX7 A;  2MWS B;  3T8M A;  3V61 A;  4BKS A;  4I6P A;  1V5O A;  2ZEQ A;  1C1Y B;  4IWQ A;  4FHJ A;  2KJ6 A;  1R4N I;  5KHO A;  2XK5 B;  2I1J A;  2MQJ A;  4DWF A;  4G50 A;  3M62 B;  1WXS A;  2EMT A;  1GUA B;  5AEK B;  1WF9 A;  2IZV B;  4BKT A;  1WXM A;  2FIF A;  4W9D A;  5FR6 A;  3QIJ A;  2K39 A;  3VH3 B;  4OVU A;  2KDF B;  3BY4 B;  1LFD A;  3ML8 A;  2KQ7 A;  1RRB A;  5CHF A;  4GSW A;  2KOX A;  3M3J A;  3UIP B;  5AZF A;  4LDT B;  5D2M B;  2GBK A;  2N9E B;  3QHT A;  4WWO A;  4HCN B;  4DK5 A;  3PRZ A;  2D3G A;  3WAO A;  4A3O A;  4AWJ A;  4DHZ E;  3DDC B;  4CHK A;  4IWO A;  3PRM B;  1J19 A;  2NBU A;  4AOF A;  2VRR B;  4KV2 A;  2KKC A;  2KWV B;  3NY5 A;  4YL8 A;  3VTU A;  2REX A;  1S1Q B;  2ZZP B;  3VAW A;  1WFY A;  2LRW A;  3VUX A;  2KXJ A;  2MBE A;  4BOZ B;  3K9P B;  1F9J A;  2KX3 A;  3TL5 A;  3ZKJ C;  2HTH A;  1WJN A;  3PVL A;  2LVQ A;  1UH6 A;  3VXW A;  4HWI B;  2CU1 A;  2RPQ A;  2MSE D;  2YVC A;  1OEY J;  2LWP A;  2JT4 B;  3QWZ B;  1LQB A;  4MEL A;  1V5T A;  2WYQ A;  4KSL C;  2J0K A;  4WQO B;  3WAP A;  2M1M A;  1P3Q U;  2JXX A;  3PTF C;  3PLV A;  5TR5 A;  4F7Z A;  3ALB A;  4ICV A;  2KC2 A;  3N30 A;  5IAA C;  3B0A A;  3CSF A;  3SU8 X;  3N32 A;  2L8J A;  4ZYN A;  3QJZ A;  3HM6 X;  2N4F A;  4GDL B;  1V9J A;  4JLC A;  3M63 B;  2Z0D B;  4W9E A;  2KDI A;  2MW5 A;  2K1F A;  1WZ0 A;  2KWU B;  2LGD A;  3L08 A;  5AZH A;  3ZO5 B;  3V6C B;  5JHB A;  3LDZ E;  5KHQ A;  3QAR A;  3ZDT A;  5D7G A;  1TTN A;  3WAN A;  3ZUN A;  2J0J A;  4TQ0 A;  4PYU A;  3PZD A;  3CST A;  5E6P A;  3QX1 A;  4HK2 A;  3RUL A;  1SIF A;  3V62 A;  3NZU A;  3VVW B;  1VD2 A;  2KN5 A;  2W9N A;  2LVO A;  3TJP A;  4EZK A;  2XBB C;  4ZRJ A;  1WXV A;  4WJO A;  4FN2 A;  1XT9 B;  4HLE A;  4II3 B;  2GBN A;  4BOS C;  3S2A A;  4CYE A;  1L2N A;  3NOB A;  5J18 A;  2AWT A;  3UQA A;  2KWC A;  4G0N B;  2CS4 A;  5DPW A;  1WMH A;  3H1U A;  4GU2 A;  2L00 B;  3AXC A;  4HJK A;  5GMV A;  3A9K A;  3DQV A;  3PSE B;  3VDZ A;  4GDK B;  4NJ7 A;  4WWP A;  2C9W B;  2O2V B;  2CHZ A;  4HDQ A;  1Z2M A;  2V4L A;  4I6L B;  4KSK C;  1H8C A;  3ZTC A;  1YD8 U;  5AZG A;  3APD A;  4A20 A;  1WRD B;  1Z5S B;  2C60 A;  3ZLZ A;  5D94 A;  4AP4 C;  4K7S A;  2OJR A;  1Q5W B;  2L7R A;  3GZN I;  3WAL A;  1EF1 A;  3U30 A;  2KTF A;  3QCA A;  4FJY A;  2XK5 A;  4BVU C;  1UBI A;  3KYD D;  3QC8 B;  2RSU A;  3VTV A;  3W1Y A;  3EHV A;  2AL6 A;  3DOW A;  1YX6 B;  1PQS A;  3H9D A;  2FCN A;  2KC1 A;  3QQ8 B;  3TBL D;  4EOY A;  1RAX A;  2DYB A;  4K7U A;  3PPA A;  4KVG B;  3PHX B;  1M94 A;  2D11 A;  4WJQ A;  2RR9 A;  3EC8 A;  4MSQ B;  1QZE A;  3Q3J A;  2J0M A;  3SD5 A;  2DZJ A;  2GOW A;  2WX0 A;  4WJP A;  1WIA A;  1V49 A;  3A4R A;  2IBI B;  1WJ4 A;  4M0W B;  1E90 A;  3WAM A;  2ZVN A;  3PRE A;  4MGZ E;  3RUI B;  5EDS A;  1WR1 A;  1XD3 B;  1IP9 A;  5CTR C;  2FCM A;  1WJU A;  3NZS A;  4NNJ B;  4KZC A;  5E6O A;  4W9L A;  5DPR A;  3WIM A;  2KTR A;  5E6N A;  1EF5 A;  3UIO B;  5DCN A;  4DXA B;  1C3T A;  1OGW A;  2GBR A;  2ZPN A;  3CMM B;  2DZI A;  3JYU A;  3ZTD A;  5L83 A;  3U8Z A;  4GMV A;  1LXD A;  3ZW3 A;  2DAJ A;  2BYE A;  3VUW A;  4E3C A;  2LI5 A;  4W9I A;  3KUC B;  3T9L A;  1TBE A;  1WGR A;  4MEM A;  5JZE B;  3AI5 A;  3EFU A;  2ZCC A;  2I1K A;  4N9F 4;  3SHQ A;  2O6V B;  3DVG Y;  4WAA A;  3DCG A;  1OEY A;  2K8B A;  3JVZ X;  4RM9 A;  3DPD A;  1WY8 A;  1UEL A;  1WE6 A;  3R7Q A;  2LD9 A;  1WGD A;  2KHW B;  3DBS A;  4PS7 A;  2LZ6 A;  1GC6 A;  1Y8R C;  4EKU A;  1V6E A;  4TV3 A;  4AUQ C;  4AJY B;  2WWZ A;  4MGY E;  2NBW B;  1WXA A;  4LJO B;  1WH3 A;  2CHW A;  4GDL A;  2MCN B;  1CMX B;  3VHT C;  2K25 A;  4IM2 A;  2KFK B;  4TUU A;  1WYW B;  3L54 A;  2ZNV C;  1BT0 A;  3ZRF A;  2LXC A;  4G11 A;  2N9X A;  2RGF A;  1Q0W B;  1KM7 A;  3TIX A;  3ML9 A;  2JF5 A;  4LJP B;  2N1V A;  3H7P B;  2FID A;  4NQK E;  1X1M A;  2B3A A;  2MP2 A;  3RZF A;  4TKN A;  3W1S C;  2GMI C;  4NPN A;  2KO3 A;  4GOC A;  4MJS A;  3JW0 X;  2NCN A;  3B1L X;  4LDT D;  1P1A A;  4AJW A;  3A9J B;  3V60 A;  4HVB A;  4FJV B;  2ZPY A;  4P7I A;  1YIW A;  4G3X B;  1H4R A;  4W9K A;  1I42 A;  2AL3 A;  3PS6 A;  2L0F A;  3TCA A;  3P2B A;  1GNU A;  3ZVV A;  4XX5 A;  4DDG D;  1D3Z A;  4B6W A;  3B08 A;  2C5L C;  1OQY A;  2L05 A;  3KYC D;  5JHA A;  4WJN A;  2RD0 A;  4GDK A;  2FUH B;  2O2V A;  1UGM A;  3RZW C;  1WI0 A;  4MGK E;  3PLU A;  2AEH A;  5D6J B;  2BKR B;  2IY1 B;  3SDL C;  4FAD A;  4IW0 A;  1AAR A;  3D32 A;  4J6I A;  4EZJ A;  4HCP B;  4RM8 A;  3VH4 B;  3WA0 A;  3M95 A;  2PJH A;  3IFW B;  4ZRI A;  2BYV E;  2M0X A;  4M8M A;  3A1Q A;  2JPH A;  2EKE C;  2KJR A;  4FBJ B;  2DZM A;  2GBJ A;  3LJ3 A;  3ENE A;  5C1Z A;  1ZW7 A;  2LAS A;  2XEW A;  1KJT A;  4IM3 A;  2BGF A;  4F1S A;  3L10 B;  1E5W A;  4NAW B;  2KDE B;  4KDI C;  4BBN C;  2V3S A;  4KIK A;  4MM3 A;  4ZRK A;  3ONS A;  2JRI B;  2KLC A;  1P9D U;  3QK0 A;  3ZRC A;  2K6D B;  2DYO A;  2R2Q A;  3L13 A;  4ANW A;  2ZVO A;  1RLF A;  2IO1 B;  2V1Y A;  3BIN A;  3PT2 B;  3ZIM A;  4KZ0 A;  5G2N A;  2PE6 B;  4JL9 A;  2KDB A;  3HIZ A;  2UYZ B;  4JGH B;  4MSM B;  2PEA A;  4EEW A;  2KK8 A;  2PE9 A;  1R4M I;  5CHV C;  3NHE B;  3VTW A;  1WR6 E;  2JZ3 B;  2N9P C;  2ZNV B;  5LXH A;  3EEC A;  2CKH B;  2GBM A;  2YLM A;  1ZKH A;  3K9O B;  2L3Z A;  4FJZ A;  4IM0 A;  4MH0 E;  3R66 C;  1TZ1 A;  2DEN B;  2K8C A;  2BWE S;  2L0T A;  3ZNI D;  3ZNG C;  4BBN F;  5BO4 B;  2DHZ A;  2JVC A;  4RMA A;  4DHZ B;  2HE7 A;  1WM2 A;  2KLG A;  4IC7 B;  4TQ1 A;  2M4N A; 
#chains in the Genus database with same CATH topology
 1R4N B;  1WGG A;  4BFR A;  2FCQ A;  1N61 A;  3R2T A;  1AWD A;  3DBR I;  1B1Z A;  3AUL A;  1A5R A;  4WUR A;  2Y5B B;  5DPS A;  5E6J A;  1F77 A;  3VQI A;  4LNO A;  2OOB B;  2PPH A;  1ZXH A;  3ZNH B;  3LB8 C;  2V3N A;  4ITK A;  3MHS D;  5FKA C;  1JWM D;  5IA7 A;  1SGH A;  4JQW C;  2HD5 B;  4GGQ A;  3KUZ A;  1S3S G;  1YX5 B;  1NI2 A;  2W3S A;  3ZDM C;  2V9H A;  2M8S A;  1ET9 A;  2LEK A;  3KH0 A;  1N6Z A;  1XQQ A;  4NY0 A;  3NZ3 A;  2H88 B;  3OAW A;  2CR5 A;  2G4S A;  1E8Z A;  2M17 A;  1YNT E;  3HVZ A;  1VCB A;  5IP4 D;  2CJN A;  1MG4 A;  1RM6 C;  3AU4 A;  4HRS A;  4WWN A;  3U4E G;  2WDQ B;  2KMC A;  3CF6 E;  3KVF B;  2DX5 B;  4KGT A;  2L52 A;  1E8W A;  5C23 A;  3RMK C;  3H8H A;  1E7V A;  1WZ3 A;  2LRU A;  2G4D B;  4E71 A;  2QIE B;  1SE3 A;  3GOE A;  4H2A A;  2WXH A;  3AEF B;  3OJ4 B;  2DYM A;  2KQS A;  2J7Q B;  2PTL A;  1HE8 A;  1N60 A;  3HHM A;  1OQQ A;  4P16 A;  2WGS A;  3Q14 C;  1C77 A;  1TT5 B;  2INN E;  3DBL I;  2KJH B;  2G9H D;  4NQL B;  2C7M B;  3KUD B;  4PS8 A;  1DOI A;  1V2Y A;  4MAC A;  4OZB A;  4K7W A;  2KD0 A;  2RDG A;  5LLI A;  2KVZ A;  3PZ8 A;  4JWS C;  4HXD A;  1YJ1 A;  4GB9 A;  1YQ4 B;  2DBY A;  2LGX A;  1FEH A;  2WLB A;  1JCK B;  3VUY A;  3AE1 B;  2WU2 B;  2L76 A;  4L2Y A;  3BII D;  1G6J A;  4OHJ A;  2D3C A;  3A33 B;  3A1Q B;  4ANU A;  3DBR B;  3N1X C;  3W5V B;  2FE8 A;  3URY A;  3IVF A;  2CHX A;  3HVD A;  2WX1 A;  4CQN A;  4BKS A;  1V5O A;  1SB3 C;  4A90 A;  4USA A;  4DWF A;  1WXS A;  1YJJ A;  5T8I A;  1WXM A;  3R8B A;  4W9D A;  2BVC A;  1KTK A;  3VH3 B;  3IXS A;  3M3J A;  5IN7 A;  2GBK A;  1ESF A;  4WWO A;  2WDV B;  1PFD A;  2Y5C A;  2MHJ A;  3PRM B;  1J19 A;  4KV2 A;  1C78 A;  4KKJ A;  1K53 A;  5BYR A;  1WFY A;  2KXJ A;  4BOZ B;  2KX3 A;  5HI1 A;  3ZKJ C;  1WJN A;  1V8C A;  3Q8C A;  2CU1 A;  2HDE A;  2LWP A;  4LNF A;  4WQO B;  3WAP A;  2KC2 A;  4M00 A;  1YN5 A;  3SU8 X;  1CK1 A;  4ZYN A;  2FUG 1;  1PUT A;  1D5Z C;  2Z0D B;  5AZH A;  3QAR A;  3ZDT A;  3WAN A;  3RNF C;  3BZD B;  1VLB A;  4LK0 M;  1ET6 A;  3CST A;  1TYG B;  3DBL B;  1VD2 A;  3NVV A;  4BOS C;  2VH1 A;  4CYE A;  3NOB A;  2ONQ A;  1WMH A;  3H1U A;  3AXC A;  5GMV A;  3A9K A;  3PSE B;  3VDZ A;  4GDK B;  2C9W B;  2CHZ A;  4HDQ A;  1Z2M A;  3APD A;  4AP4 C;  3T3O A;  5D94 A;  1MJD A;  4ZRP A;  2L7R A;  1KLU D;  4B0E A;  3U7Z A;  3C19 A;  2E3T A;  3ETR A;  3W1Y A;  1QKZ A;  1PQS A;  3H9D A;  3TBL D;  4K7U A;  4KX6 B;  3O13 A;  4MSQ B;  3RFZ B;  1VRA B;  3Q3J A;  2J0M A;  2DZJ A;  1V49 A;  3A4R A;  2IBI B;  4M0W B;  2VH2 A;  1E90 A;  5G5G A;  4MGZ E;  1B9R A;  3NS1 A;  5EDS A;  1TS3 A;  5CTR C;  3RN9 C;  1WJU A;  4KZC A;  4W9L A;  5DPR A;  3WIM A;  1QT9 A;  5E6N A;  1MHH E;  4N6E B;  1XLP A;  3JYU A;  3NVW A;  3DBH B;  2LGS A;  3U8Z A;  2MEK A;  1LXD A;  2N7J A;  4E3C A;  2LI5 A;  4BZA A;  4W9I A;  3E56 A;  1GOZ A;  3SHQ A;  3DVG Y;  5AUI A;  2WXJ A;  2K8B A;  2DWQ A;  1WE6 A;  2LD9 A;  1WGD A;  4PS7 A;  2GRI A;  2LZ6 A;  1V6E A;  3AB5 A;  3FIL A;  1KRH A;  2WWZ A;  4MGY E;  1WXA A;  4LJO B;  1WH3 A;  4GDL A;  2MCN B;  2WXK A;  4IM2 A;  1N63 A;  1BT0 A;  3E9S A;  4FXC A;  4C00 A;  3ML9 A;  4LJP B;  1PYW D;  1MI0 A;  3W1S C;  1ZDX A;  4NPN A;  4GOC A;  1WRI A;  4HJG E;  3V60 A;  4P7I A;  4AS1 A;  1QOG A;  1C4C A;  3V3X A;  3ZJT A;  1P7F A;  3TCA A;  1QOB A;  1C79 A;  1GNU A;  4XX5 A;  4DDG D;  4B6W A;  2BQQ A;  5JHA A;  2FUH B;  1T3Q A;  1WI0 A;  1WSP A;  3Q3M C;  1FXI A;  4MGK E;  4RFB A;  2JSV X;  4RF0 A;  3VH4 B;  4LLG M;  4XE0 A;  3VR9 B;  1HXY D;  2BYV E;  2M0X A;  3ABV B;  4HKQ A;  4IM3 A;  4F1S A;  4NAW B;  1QQR A;  1RYJ A;  2KDE B;  5IOI A;  2NTS A;  1TKG A;  2I2Y A;  1HQR D;  2ZW0 A;  3QK0 A;  1P9D U;  4XWT A;  3AE8 B;  4JL9 A;  2KDB A;  2UYZ B;  4MSM B;  1WR6 E;  2JZ3 B;  3K9O B;  4OZC A;  1QLB B;  3NVY A;  4MH0 E;  2WU5 B;  1VZ6 A;  1TZ1 A;  2QJL A;  1I4G A;  3ZNI D;  2QCZ A;  3ZNG C;  2ZW1 A;  4DHZ B;  2HE7 A;  2KLG A;  1RFK A;  1TIF A;  1V1P A;  1STE A;  2Z8L A;  3H7S A;  1ENF A;  4E74 A;  1WXQ A;  2NPT B;  4W9G A;  3MC8 A;  2FNJ B;  3RCZ A;  1HEZ E;  2IO3 B;  3A4S C;  2K6Q A;  2ZCB A;  3Q3F A;  1JRU A;  1RFA A;  4GXB A;  5JH5 C;  3H6N A;  2R2O A;  1D5X C;  1Q1O A;  3A9J A;  1ACC A;  2MBH A;  4IG7 B;  4IKG A;  3IAM 1;  1WGH A;  1QOF A;  3MJW A;  3NS8 A;  3UGB B;  4HEA 1;  3ZJU A;  5LXI B;  1GJZ A;  3VRB B;  4WIP A;  3B2G A;  3DVG X;  5DPT A;  2KAN A;  2EMS A;  3MC9 A;  1JQ4 A;  4W9H A;  2DZK A;  3MTN B;  2NVU I;  5LNK 1;  1NYQ A;  3AN1 A;  1F1H A;  2K0P A;  2JZZ A;  3U7D A;  2K22 A;  2IDY A;  2M56 B;  1NBF C;  4ANX A;  2JWZ A;  4PS3 A;  4W9J A;  4F8C B;  2MBQ A;  2BS4 B;  1K51 A;  2JXT A;  4Q2J A;  2J4X A;  3R7R A;  1U4A A;  2K8H A;  4JIO U;  5G5H A;  4MT5 A;  3EFC A;  3P4Q B;  4W9F A;  4MGI E;  4URK A;  3AEB B;  2LGY A;  2RDB C;  4ZDV A;  1AW7 A;  3RPF C;  3VFK A;  5J2R A;  1F52 A;  5D3I B;  3BVM A;  2NBV B;  2KX0 A;  1I4P A;  1DOX A;  4ZYS A;  3WCQ A;  1MG8 A;  1ZOY B;  4QAY A;  2HJ8 A;  3QA8 A;  1HZ5 A;  2RMM A;  2GLS A;  4MJS B;  4A9A A;  1CQV A;  4TSS A;  1CZP A;  2IYD B;  3O65 B;  2FCS A;  2KQ4 X;  2G3Q B;  3IHP C;  2JUO A;  1DGJ A;  1E7P B;  2LJ5 A;  3Q8E A;  1J7C A;  1GC7 A;  1QIL A;  2J52 A;  4IDI A;  5BYQ A;  2R61 A;  4W9C A;  3N3K B;  2IPK D;  3QAQ A;  1WM3 A;  3HK0 A;  1ZGU B;  2O6V A;  2RPV A;  3IG3 A;  2KVR A;  2IO2 B;  1WX8 A;  1VZ7 A;  3L17 A;  3AEE B;  1EUV B;  4PYZ A;  1YQB A;  1E7U A;  3KLS X;  1VZ8 A;  1WX9 A;  1L7Y A;  1WX7 A;  4IWQ A;  3TEW A;  2XK5 B;  2FBW B;  2EKI A;  1GUA B;  2IZV B;  3TEX A;  3GE8 C;  5IO9 A;  2K39 A;  2KDF B;  1RRB A;  5AZF A;  3QHT A;  1XXG A;  2JU6 X;  4HCN B;  1XLQ A;  4XWW A;  4A3O A;  2YEP F;  3DDC B;  2WXP A;  4JX1 C;  2M19 A;  2NBU A;  2KWD A;  2LHE A;  2KWV B;  1GAQ B;  4DXF A;  2AQ2 B;  3VTU A;  2REX A;  2ZZP B;  3PZ7 A;  2MBE A;  3Q8F A;  2MH7 A;  4OVZ A;  2UU7 A;  2OJW A;  3PVL A;  2OED A;  1SBB B;  2RPQ A;  3QWZ B;  4MEL A;  1JRP A;  2WYQ A;  3R2I A;  2WS3 B;  1SF0 A;  3ALB A;  2IGH A;  1AN8 A;  2D3A A;  5EE9 A;  4WWM A;  3N30 A;  3B0A A;  3CSF A;  3NRZ A;  3AMZ A;  1E10 A;  2QDF A;  3HM6 X;  4JLC A;  4P6V F;  3M63 B;  2W3R A;  1IGC A;  2KDI A;  3ZO5 B;  2NMQ A;  5D7G A;  1TTN A;  2L83 A;  4PYU A;  1I7H A;  3QX1 A;  4HK2 A;  3VVW B;  2KN5 A;  4EZK A;  2XBB C;  1XT9 B;  4O1N A;  2GBN A;  3S2A A;  5J18 A;  1PGX A;  2AWT A;  2K5P A;  2KWC A;  3I5J C;  4GU2 A;  2L00 B;  5HFY A;  3DQV A;  4WWP A;  2O2V B;  4ZHP A;  1NEN B;  4KSK C;  2PVO D;  1H8C A;  1YD8 U;  1Z5S B;  3ZLZ A;  4K7S A;  3GZN I;  2JWU A;  3N20 C;  3QCA A;  3QC8 B;  2KAJ A;  5HG2 A;  2FCN A;  2KAC A;  4EOY A;  1WWT A;  1A70 A;  3PPA A;  2RR9 A;  1YMH E;  3SD5 A;  3TEZ A;  2GOW A;  2WX0 A;  4EE2 A;  1WIA A;  3WAM A;  3AE5 B;  3CIR B;  3AEC B;  3RUI B;  4JPS A;  5E6O A;  2KTR A;  1GB1 A;  1C3T A;  1NI3 A;  1JWU D;  3RI7 C;  5L83 A;  4GMV A;  2DAJ A;  2BYE A;  3VUW A;  2I38 A;  1TBE A;  1DOY A;  5JZE B;  1D4B A;  2WXG A;  2I1K A;  3KWL A;  4ZRQ A;  3DCG A;  4LNN A;  4RM9 A;  1EM7 A;  3P42 A;  1KF6 B;  1GC6 A;  1Y8R C;  4EKU A;  1CJE A;  1AYF A;  4JE3 B;  2CHW A;  1YOV B;  2K25 A;  1NYR A;  4IOI E;  2KFK B;  2ZNV C;  4G11 A;  2N9X A;  1Q0W B;  3J9C A;  1L0X B;  3H7P B;  5BMH A;  4NQK E;  2MP2 A;  2B3A A;  4TKN A;  2KO3 A;  3B1L X;  4W9K A;  1I42 A;  3P2B A;  3ZVV A;  4DXG A;  1D3Z A;  1OQY A;  1P7E A;  5D3D A;  4WJN A;  4GDK A;  3RZW C;  3P1M A;  2IY1 B;  3SDL C;  4IW0 A;  2MJ3 A;  4RGT A;  1N5W A;  1FFU A;  2V3P A;  1TKE A;  1TJE A;  4M8M A;  2JPH A;  2EKE C;  2DZM A;  3IT6 B;  2GBJ A;  3LJ3 A;  1ZW7 A;  3DWM A;  2LAS A;  4MH8 A;  1XCT L;  1FM0 D;  4KIK A;  1JWS D;  2JRI B;  4M0W A;  3L13 A;  1RLF A;  3BIN A;  3GZN B;  4KZ0 A;  3HIZ A;  2PEA A;  4EEW A;  3AED B;  3NHE B;  2N9P C;  2W55 A;  2D3B A;  4FJZ A;  1L5P A;  4IM0 A;  3R66 C;  2K8C A;  3KQ4 A;  5BO4 B;  4LNI A;  3VRA B;  1FNW A;  1WM2 A;  4IC7 B;  3BK1 A;  1JWB D;  2X8X X;  2M4N A;  3RYT A;  1NDD A;  3JSV B;  3PV1 A;  1ROE A;  2G1E A;  2WXN A;  1JAL A;  1E6E B;  1PDX A;  2NS5 A;  4EFO A;  3RT3 B;  1WJ6 A;  4XZ4 A;  1T5X D;  4YSY B;  4RF1 A;  3GP7 A;  5EE1 A;  2ICI A;  5CHW A;  3IT4 B;  2IY0 B;  3GE3 C;  3AM9 A;  4ICU A;  3NJT A;  3L4P A;  4HKZ E;  2N7D A;  4PK1 A;  1FPY A;  1VDV A;  2LGI A;  2PKO A;  3UF8 A;  4GN1 A;  1EU3 A;  2MA9 B;  2ZJD A;  1I35 A;  2QHO A;  3L16 A;  1T0S C;  1E8X A;  2WNM A;  1IYF A;  4NAM A;  3BYT B;  1TZO A;  1F2R C;  3NUH B;  5I4D A;  4FLH A;  1KLG D;  5HKH A;  2JYT A;  4WQM A;  2DAF A;  2LXA A;  1ZPS A;  4GLS C;  3V6E B;  4FHK A;  3SFD B;  2WXF A;  2KMA A;  4K3B A;  3MHZ A;  3AE3 B;  1EU4 A;  3Q8A A;  4OVV A;  2LMC A;  1LM8 B;  3DVN V;  2KNB A;  5BMI A;  4EZL A;  3PRP B;  1K52 A;  3APC A;  4C56 C;  1Q10 A;  4RGM A;  2BYT A;  4NAW A;  3OLM D;  3X23 A;  3DHH C;  2NR2 A;  2D10 A;  3X0W A;  2MBO A;  4C4V A;  4B95 A;  2LUE A;  4BKS D;  4PT5 A;  2N9K A;  1IUE A;  1IPG A;  1V97 A;  4YXD B;  4CO7 A;  3RNA C;  1T0Y A;  1WGY A;  2AX5 A;  4K81 A;  1E0Z A;  2LFI A;  1FXT B;  2AQ3 B;  2KMM A;  3IBE A;  2X38 A;  1RWS A;  4L23 A;  4DBG A;  2LHD A;  1WE7 A;  2JRH A;  2MLB A;  2BF8 B;  2BWF A;  5J17 A;  4HDO A;  2N7E A;  1P0R A;  2NPT A;  4K1R B;  2KFJ A;  1XCQ L;  4LCD E;  1P98 A;  2QC8 A;  3C0R B;  3UIN B;  2JQR B;  3DHI C;  3P63 A;  1ZE3 D;  3AEA B;  1E8Y A;  2FAZ A;  4DHJ D;  2MBB B;  1SE4 A;  1NEK B;  3SEB A;  1N5X A;  1UWM A;  1OTR B;  4C7Y A;  1XF5 L;  3C8Y A;  1IBX B;  3FC4 A;  2Y3A A;  3BVG A;  3OJ3 A;  2WDT B;  4ACF A;  4ANV A;  1EWC A;  3KW5 B;  4XC2 A;  3V05 A;  2MRP A;  4FUL A;  3EUB 2;  3T8M A;  4KGS A;  2LUM A;  2ZEQ A;  1FFV A;  4FHJ A;  1R4N I;  2MQJ A;  1V1O A;  3M62 B;  1QF6 A;  2EMT A;  1OFF A;  1WF9 A;  2FIF A;  3QIJ A;  1T0R C;  1YN4 A;  4TMA B;  3BY4 B;  1LFD A;  5CHF A;  2BTE A;  2KOX A;  4LDT B;  5D2M B;  1L0Y B;  2D3G A;  3WAO A;  4DHZ E;  2VZK D;  1V1P B;  1JML A;  2QIL A;  4IWO A;  4XGA B;  4AOF A;  2K9X A;  2WP9 B;  2KKC A;  3NY5 A;  4YL8 A;  4US8 A;  1VJK A;  3ZGZ A;  2LRW A;  3W9C B;  1J7A A;  5GXG B;  1D6E C;  4S17 A;  3CWI A;  4XDD A;  4R3D A;  3N9Y C;  3TL5 A;  4HWI B;  2YVC A;  2MSE D;  1YN3 A;  2JT4 B;  1LQB A;  1SEB D;  1V5T A;  4KSL C;  2J0K A;  1L6V A;  2M1M A;  2WXR A;  3NG0 A;  4UDU C;  2JXX A;  2CJO A;  3TUO A;  5IAA C;  3N32 A;  2L8J A;  5BYS A;  1GPX A;  3QJZ A;  2B76 B;  2XN9 C;  2QEJ C;  2N4F A;  1V9J A;  5MPO A;  1BUI C;  2K1F A;  1WZ0 A;  2KWU B;  5KHQ A;  2DLB A;  3LDZ E;  1GB4 A;  3ZUN A;  3RUL A;  3W2D A;  2GB1 A;  3V62 A;  3NZU A;  5HHD G;  3TJP A;  1WXV A;  4II3 B;  1L2N A;  4J3O D;  3MP9 A;  2CS4 A;  4ARC A;  3BVZ A;  3AEG B;  4HJK A;  1ZXI A;  3TEY A;  4A20 A;  1WRD B;  1DYQ A;  1Q5W B;  1EF1 A;  3B9J A;  3U30 A;  2XK5 A;  4BVU C;  3KYD D;  2RSU A;  3VTV A;  3IAS 1;  2KC1 A;  1I4X A;  3PHX B;  1SJE D;  4C7Z A;  3MFG A;  2CU3 A;  3AV8 A;  4MM3 B;  2NTT A;  4WJP A;  2BB5 A;  1HZ6 A;  2QMT A;  1FIQ A;  5JXV A;  1XD3 B;  3P4P B;  4NNJ B;  4XYC A;  2KN4 A;  1ZP0 B;  1OGW A;  2DZI A;  3ZTD A;  1KH0 A;  3ZW3 A;  2RDH A;  3KUC B;  1WGR A;  3MJ5 A;  2ZCC A;  2O6V B;  2EEL A;  3BYY B;  4YSX B;  5C3J B;  1UEL A;  4HPP A;  3ZJV A;  2WHI A;  2KHW B;  3Q6B A;  4TV3 A;  2NBW B;  3VHT C;  5H92 C;  3KWV A;  1I4H A;  1WYW B;  2LJI A;  3EGR A;  2INP E;  4OZA A;  2KYW A;  1ZDV A;  1KM7 A;  2N1V A;  3P4R B;  1VR9 A;  2GMI C;  2NCN A;  4LDT D;  4AJW A;  2ZPY A;  3SR6 A;  1H4R A;  5C2T B;  2L0F A;  2WDR B;  1BXT A;  2PVG C;  2WXI A;  1T0Q C;  2WQY B;  3KYC D;  1Y56 A;  2BBC A;  1MFW A;  2O2V A;  3RNG C;  3T3N A;  3PLU A;  5D6J B;  2BKR B;  4EZJ A;  1FXA A;  4HCP B;  4RM8 A;  3WA0 A;  2PJH A;  3HRD D;  2Q5W D;  3IFW B;  1MHX A;  3SFE B;  3AH7 A;  1TY2 A;  2QSD A;  1SIJ A;  3A1Q A;  1XLN A;  2KJR A;  5C1Z A;  3ENE A;  4RH6 A;  4BAX A;  4NZL B;  1PGB A;  1KJT A;  2XEW A;  2BGF A;  3L10 B;  4KDI C;  1L4D B;  2L32 A;  2PMV A;  4ZRK A;  2N9L A;  2DYO A;  4ANW A;  2IO1 B;  2V1Y A;  4P1B C;  5G2N A;  4JGH B;  4REZ A;  1R4M I;  1L0V B;  1UWX A;  2OHF A;  5CHV C;  3VTW A;  2ZNV B;  5LXH A;  3EEC A;  4JWU C;  3LXF A;  2YLM A;  3MC0 B;  1F2R I;  1WGK A;  1SE2 A;  3AE2 B;  2DEN B;  2BWE S;  2L0T A;  4BBN F;  2JVC A;  4RMA A;  3I57 A;  1EWY C;  4TQ1 A;  3UQA A;  2JZP A;  2BT6 A;  2N0S B;  1TKY A;  2G45 B;  3ZQ4 A;  1FO4 A;  2AYO B;  4FA6 A;  1UZX B;  1BML C;  4IWP A;  1V80 A;  4ASW C;  2C7H A;  2JY6 A;  1LO5 D;  2HJ1 A;  1TY0 A;  2KFK A;  4KGR A;  4A3P A;  3RNC C;  2MJE A;  4XDC A;  4B0M A;  3H7P A;  3Q3O C;  4WH4 A;  2SAK A;  2Y5P A;  2TSS A;  4N58 A;  1L6U A;  2INC C;  3FKY A;  2A5U A;  3DBH I;  1K8R B;  1SE9 A;  4DDI D;  2LVP A;  3RNB C;  3I3T B;  1GG3 A;  4X57 B;  1J0G A;  2BYF A;  2MX2 A;  3BWU D;  3Q2A C;  5L95 C;  3TSS A;  4B9K A;  4M8N A;  5CX3 A;  3RNE C;  3AE4 B;  4KDL B;  3UQB A;  4GIV A;  3Q3N C;  4RCO A;  5G55 A;  1JW9 D;  2Z59 B;  1EO6 A;  1JRO A;  4BKG A;  2KTR B;  2M0A A;  3NVZ A;  1FD6 A;  3OG5 A;  1XO3 A;  3Q8B A;  4MDK E;  2UWQ A;  1JWA D;  2ON8 A;  4IUM B;  2O6V D;  4HPL B;  2KDM A;  2J53 A;  3RD2 A;  4N59 A;  3HM3 A;  1D5M C;  4S0R A;  2Z0E B;  3DWG C;  3ZNZ B;  1ISN A;  1KLV A;  3PGE A;  1YJI A;  2MJD A;  2BKF A;  4II2 B;  3AU5 A;  3ECI A;  3DVN U;  3N1Z C;  4DHJ B;  1FRR A;  1KFY B;  2BPS A;  3I9V 1;  4NJ6 A;  2MP2 B;  1J8C A;  4I6N B;  1UBQ A;  1QOA A;  5IKC M;  4NJC A;  1K50 A;  1ZUD 2;  5EE0 A;  3W1S A;  1TGZ B;  3JSV A;  1C9F A;  2N1W A;  2KZR A;  1R4M B;  2V0G A;  2C7N B;  1V81 A;  3Q69 A;  2D2Q A;  2A4Z A;  1FNV A;  3R3M A;  2PIA A;  1KOT A;  1I4R A;  1PGA A;  2PLP A;  2JX5 A;  4RGN A;  1UD7 A;  2ASQ A;  4HPM B;  2JYE A;  1V86 A;  5FR3 A;  3PHW B;  2K3U A;  3APF A;  2WXQ A;  2IND C;  3U52 E;  3L0W B;  1C76 A;  1WMH B;  3TMP B;  2IO0 B;  3A9K B;  3AE9 B;  2VZK B;  2D07 B;  4KIK B;  3AE6 B;  4EUT A;  2AQ1 B;  2MWS B;  3V61 A;  3VR8 B;  4I6P A;  1C1Y B;  4ARI A;  2KJ6 A;  5KHO A;  2I1J A;  4G50 A;  4KKI A;  3GB1 A;  5AEK B;  4BKT A;  5FR6 A;  4DQO C;  4OVU A;  3ML8 A;  2KQ7 A;  4YSZ B;  4GSW A;  3UIP B;  2N9E B;  4DK5 A;  5H8Y E;  3PRZ A;  4AWJ A;  1WYG A;  2PW9 A;  2WXM A;  4CHK A;  3ZXV A;  4ZOH C;  2VRR B;  2WXO A;  1UF0 A;  2IGD A;  3VAW A;  1S1Q B;  3VUX A;  2DNF A;  3K9P B;  1XEE A;  1F9J A;  2HTH A;  1FNU A;  2LVQ A;  1UH6 A;  3VXW A;  1HTO A;  3B2F A;  4LNK A;  1OEY J;  3LYY A;  1FMA D;  1SXT A;  1P3Q U;  1T6B X;  3PTF C;  2H89 B;  3PLV A;  3HUI A;  5TR5 A;  4F7Z A;  4ICV A;  1YQ3 B;  3FIL B;  1TS2 A;  5AUK A;  4GDL B;  4ZHO A;  1SJH D;  4W9E A;  2MW5 A;  3L08 A;  2LGD A;  5JHB A;  4P1C C;  3P4S B;  3V6C B;  2BS3 B;  2YEP B;  2KT7 A;  2J0J A;  4TQ0 A;  3ZYY X;  3PZD A;  1IGD A;  5E6P A;  1SIF A;  1E9M A;  4YTN B;  3OWE B;  2W9N A;  2LVO A;  4ZRJ A;  4WJO A;  3N1Y C;  4FN2 A;  2W54 A;  4YTP B;  4HLE A;  2ACZ B;  4G0N B;  5DPW A;  1IBX A;  4NJ7 A;  4RGO S;  4YWG G;  2V4L A;  4I6L B;  3ZTC A;  5AZG A;  2C60 A;  4C4V B;  4RNA A;  2OJR A;  1UGJ A;  3WAL A;  2KTF A;  4LTU A;  1OQR A;  4FJY A;  1UBI A;  5FK9 C;  3EHV A;  2AL6 A;  3DOW A;  1YX6 B;  3UI3 A;  3QQ8 B;  1RAX A;  2DYB A;  3DHG C;  4WJQ A;  4KVG B;  1M94 A;  2D11 A;  3EC8 A;  1QZE A;  1MPE A;  2BW2 A;  1WJ4 A;  2ZVN A;  3PRE A;  3GS2 A;  4K3C A;  1WR1 A;  4A55 A;  1IP9 A;  1FCC C;  1TS5 A;  2FCM A;  3NZS A;  3EA6 A;  3PO0 A;  1EF5 A;  3UIO B;  5DCN A;  4DXA B;  2GBR A;  2ZPN A;  3CMM B;  2XNA C;  1MVK A;  2E6X A;  3T9L A;  4MEM A;  3AI5 A;  3I63 C;  3EFU A;  4N9F 4;  4WAA A;  1OEY A;  2IGG A;  3JVZ X;  1HTQ A;  2BS2 B;  3DPD A;  1WY8 A;  3R7Q A;  3DBS A;  4AQ7 A;  4AUQ C;  2GI9 A;  4AJY B;  1CMX B;  3BK2 A;  4TUU A;  3L54 A;  3ZRF A;  2LXC A;  1M4V A;  2RGF A;  1FCL A;  4M01 A;  3TIX A;  1C4P A;  4A8X C;  2JF5 A;  1N62 A;  2FID A;  4YT0 B;  1X1M A;  3RZF A;  2W82 A;  1I4Q A;  4MJS A;  1J7B A;  3JW0 X;  3ZXR A;  1P1A A;  3A9J B;  1FRD A;  2SEB D;  4HVB A;  4FJV B;  4M02 A;  1YIW A;  4G3X B;  2AL3 A;  3PS6 A;  1NVI D;  1SSN A;  3B08 A;  2C5L C;  2L05 A;  2RD0 A;  1UGM A;  4C80 A;  2IJ0 A;  4OW0 A;  1TS4 A;  3U2S C;  2AEH A;  4FAD A;  1AAR A;  3D32 A;  4J6I A;  1F0Z A;  2J42 A;  3M95 A;  4HRO A;  4ZRI A;  4L1B A;  4FBJ B;  3AE7 B;  4YTM B;  1UNS A;  2HTM E;  5EE3 A;  1E5W A;  3W5U B;  4BBN C;  2V3S A;  1XLO A;  4MM3 A;  3ONS A;  1UUP A;  2KLC A;  3ZRC A;  4A6Q A;  4D2K A;  2K6D B;  2R2Q A;  2L1A A;  2ZVO A;  2BB6 A;  3ZIM A;  3PT2 B;  1LGR A;  2PE6 B;  5BMG A;  1L4Z B;  2KK8 A;  2PE9 A;  5TSS A;  2D5G A;  1HA5 A;  2WXL A;  2CKH B;  2GBM A;  1ZKH A;  2L3Z A;  1C4A A;  3FAH A;  2V4I B;  4US9 A;  2DHZ A;  1R7S A;  4WAF A; 
#chains in the Genus database with same CATH homology
 3RYT A;  1NDD A;  3JSV B;  2G45 B;  1WGG A;  3PV1 A;  4BFR A;  3H7S A;  2FCQ A;  4E74 A;  2AYO B;  4FA6 A;  1UZX B;  2NPT B;  3DBR I;  2NS5 A;  4W9G A;  4EFO A;  3RT3 B;  4IWP A;  1V80 A;  3AUL A;  2FNJ B;  1WJ6 A;  1A5R A;  4XZ4 A;  2C7H A;  3RCZ A;  2JY6 A;  2Y5B B;  4ASW C;  5DPS A;  2KFK A;  2IO3 B;  3A4S C;  3VQI A;  4A3P A;  2OOB B;  2PPH A;  2K6Q A;  3ZNH B;  2ZCB A;  3Q3F A;  5CHW A;  3MHS D;  2IY0 B;  3H7P A;  1JRU A;  1RFA A;  4GXB A;  4ICU A;  5IA7 A;  1SGH A;  5JH5 C;  2N7D A;  4JQW C;  3H6N A;  2R2O A;  2HD5 B;  4GGQ A;  3KUZ A;  3UF8 A;  4GN1 A;  1Q1O A;  1S3S G;  1YX5 B;  2MA9 B;  2ZJD A;  3A9J A;  1NI2 A;  1I35 A;  2A5U A;  2MBH A;  4IG7 B;  3ZDM C;  3DBH I;  1K8R B;  1SE9 A;  1WGH A;  2QHO A;  3L16 A;  4DDI D;  3MJW A;  2M8S A;  1E8X A;  3NS8 A;  3UGB B;  2LVP A;  3KH0 A;  1IYF A;  3I3T B;  1GG3 A;  4X57 B;  1J0G A;  1XQQ A;  2BYF A;  2MX2 A;  4NY0 A;  5LXI B;  5L95 C;  1GJZ A;  4B9K A;  4M8N A;  5CX3 A;  4FLH A;  4KDL B;  3UQB A;  5HKH A;  3DVG X;  3OAW A;  5DPT A;  4GIV A;  2DAF A;  2CR5 A;  2G4S A;  2KAN A;  5G55 A;  2EMS A;  2LXA A;  1E8Z A;  1EO6 A;  2Z59 B;  2M17 A;  3V6E B;  4BKG A;  2KTR B;  4W9H A;  1VCB A;  4FHK A;  3AU4 A;  2DZK A;  3MTN B;  2KMA A;  2NVU I;  4MDK E;  4WWN A;  2UWQ A;  2KMC A;  3CF6 E;  4IUM B;  3KVF B;  2DX5 B;  4OVV A;  1E8W A;  2O6V D;  1LM8 B;  3DVN V;  2KNB A;  2JZZ A;  5C23 A;  4HPL B;  3U7D A;  1NBF C;  4ANX A;  4EZL A;  2JWZ A;  3PRP B;  4PS3 A;  4W9J A;  4F8C B;  2MBQ A;  3RD2 A;  3APC A;  3HM3 A;  4NAW A;  3OLM D;  3X23 A;  1E7V A;  1WZ3 A;  2LRU A;  2Z0E B;  3R7R A;  2G4D B;  2NR2 A;  4E71 A;  1U4A A;  2K8H A;  4JIO U;  2D10 A;  3ZNZ B;  1ISN A;  4W9F A;  2MBO A;  3GOE A;  3X0W A;  4MGI E;  4URK A;  4B95 A;  2LGY A;  2LUE A;  4BKS D;  4ZDV A;  3PGE A;  1KLV A;  3OJ4 B;  2DYM A;  3VFK A;  2KQS A;  1IPG A;  5J2R A;  2BKF A;  4II2 B;  3AU5 A;  3ECI A;  3DVN U;  4CO7 A;  2J7Q B;  2NBV B;  1HE8 A;  3HHM A;  2KX0 A;  1T0Y A;  1WGY A;  4DHJ B;  1MG8 A;  2BPS A;  4K81 A;  2HJ8 A;  3QA8 A;  4NJ6 A;  1FXT B;  2MP2 B;  1J8C A;  4I6N B;  1UBQ A;  3IBE A;  4MJS B;  3DBL I;  2KJH B;  3W1S A;  2IYD B;  4DBG A;  3O65 B;  4NQL B;  2C7M B;  1WE7 A;  2JRH A;  3KUD B;  2MLB A;  1TGZ B;  2BF8 B;  2FCS A;  4PS8 A;  1V2Y A;  2G3Q B;  3IHP C;  2JUO A;  3JSV A;  2BWF A;  4K7W A;  2N1W A;  2KD0 A;  2KZR A;  5LLI A;  5J17 A;  4HDO A;  2N7E A;  2C7N B;  1P0R A;  4HXD A;  1YJ1 A;  2NPT A;  1V81 A;  2LJ5 A;  4K1R B;  2D2Q A;  2KFJ A;  4GB9 A;  1GC7 A;  2A4Z A;  2LGX A;  4LCD E;  1P98 A;  3C0R B;  3R3M A;  1KOT A;  3UIN B;  4W9C A;  3N3K B;  3VUY A;  1UD7 A;  2ASQ A;  3QAQ A;  1E8Y A;  2FAZ A;  4HPM B;  1WM3 A;  3HK0 A;  1ZGU B;  2L76 A;  1V86 A;  4DHJ D;  2MBB B;  2O6V A;  1G6J A;  3PHW B;  3IG3 A;  3APF A;  3A33 B;  2KVR A;  2IO2 B;  1OTR B;  3A1Q B;  1WX8 A;  3L17 A;  4ANU A;  3L0W B;  1WMH B;  1EUV B;  3OJ3 A;  3TMP B;  2IO0 B;  3A9K B;  2WDT B;  4PYZ A;  4ANV A;  1YQB A;  1E7U A;  2D07 B;  3IVF A;  3KW5 B;  4XC2 A;  2CHX A;  2MRP A;  4KIK B;  2WX1 A;  4EUT A;  4FUL A;  1WX9 A;  1L7Y A;  1WX7 A;  2MWS B;  3T8M A;  3V61 A;  4BKS A;  4I6P A;  1V5O A;  2ZEQ A;  1C1Y B;  4IWQ A;  4FHJ A;  2KJ6 A;  1R4N I;  5KHO A;  2XK5 B;  2I1J A;  2MQJ A;  4DWF A;  4G50 A;  3M62 B;  1WXS A;  2EMT A;  1GUA B;  5AEK B;  1WF9 A;  2IZV B;  4BKT A;  1WXM A;  2FIF A;  4W9D A;  5FR6 A;  3QIJ A;  2K39 A;  3VH3 B;  4OVU A;  2KDF B;  3BY4 B;  1LFD A;  3ML8 A;  2KQ7 A;  1RRB A;  5CHF A;  4GSW A;  2KOX A;  3M3J A;  3UIP B;  5AZF A;  4LDT B;  5D2M B;  2GBK A;  2N9E B;  3QHT A;  4WWO A;  4HCN B;  4DK5 A;  3PRZ A;  2D3G A;  3WAO A;  4A3O A;  4AWJ A;  4DHZ E;  3DDC B;  4CHK A;  4IWO A;  3PRM B;  1J19 A;  2NBU A;  4AOF A;  2VRR B;  4KV2 A;  2KKC A;  2KWV B;  3NY5 A;  4YL8 A;  3VTU A;  2REX A;  1S1Q B;  2ZZP B;  3VAW A;  1WFY A;  2LRW A;  3VUX A;  2KXJ A;  2MBE A;  4BOZ B;  3K9P B;  1F9J A;  2KX3 A;  3TL5 A;  3ZKJ C;  2HTH A;  1WJN A;  3PVL A;  2LVQ A;  1UH6 A;  3VXW A;  4HWI B;  2CU1 A;  2RPQ A;  2MSE D;  2YVC A;  1OEY J;  2LWP A;  2JT4 B;  3QWZ B;  1LQB A;  4MEL A;  1V5T A;  2WYQ A;  4KSL C;  2J0K A;  4WQO B;  3WAP A;  2M1M A;  1P3Q U;  2JXX A;  3PTF C;  3PLV A;  5TR5 A;  4F7Z A;  3ALB A;  4ICV A;  2KC2 A;  3N30 A;  5IAA C;  3B0A A;  3CSF A;  3SU8 X;  3N32 A;  2L8J A;  4ZYN A;  3QJZ A;  3HM6 X;  2N4F A;  4GDL B;  1V9J A;  4JLC A;  3M63 B;  2Z0D B;  4W9E A;  2KDI A;  2MW5 A;  2K1F A;  1WZ0 A;  2KWU B;  2LGD A;  3L08 A;  5AZH A;  3ZO5 B;  3V6C B;  5JHB A;  3LDZ E;  5KHQ A;  3QAR A;  3ZDT A;  5D7G A;  1TTN A;  3WAN A;  3ZUN A;  2J0J A;  4TQ0 A;  4PYU A;  3PZD A;  3CST A;  5E6P A;  3QX1 A;  4HK2 A;  3RUL A;  1SIF A;  3V62 A;  3NZU A;  3VVW B;  1VD2 A;  2KN5 A;  2W9N A;  2LVO A;  3TJP A;  4EZK A;  2XBB C;  4ZRJ A;  1WXV A;  4WJO A;  4FN2 A;  1XT9 B;  4HLE A;  4II3 B;  2GBN A;  4BOS C;  3S2A A;  4CYE A;  1L2N A;  3NOB A;  5J18 A;  2AWT A;  3UQA A;  2KWC A;  4G0N B;  2CS4 A;  5DPW A;  1WMH A;  3H1U A;  4GU2 A;  2L00 B;  3AXC A;  4HJK A;  5GMV A;  3A9K A;  3DQV A;  3PSE B;  3VDZ A;  4GDK B;  4NJ7 A;  4WWP A;  2C9W B;  2O2V B;  2CHZ A;  4HDQ A;  1Z2M A;  2V4L A;  4I6L B;  4KSK C;  1H8C A;  3ZTC A;  1YD8 U;  5AZG A;  3APD A;  4A20 A;  1WRD B;  1Z5S B;  2C60 A;  3ZLZ A;  5D94 A;  4AP4 C;  4K7S A;  2OJR A;  1Q5W B;  2L7R A;  3GZN I;  3WAL A;  1EF1 A;  3U30 A;  2KTF A;  3QCA A;  4FJY A;  2XK5 A;  4BVU C;  1UBI A;  3KYD D;  3QC8 B;  2RSU A;  3VTV A;  3W1Y A;  3EHV A;  2AL6 A;  3DOW A;  1YX6 B;  1PQS A;  3H9D A;  2FCN A;  2KC1 A;  3QQ8 B;  3TBL D;  4EOY A;  1RAX A;  2DYB A;  4K7U A;  3PPA A;  4KVG B;  3PHX B;  1M94 A;  2D11 A;  4WJQ A;  2RR9 A;  3EC8 A;  4MSQ B;  1QZE A;  3Q3J A;  2J0M A;  3SD5 A;  2DZJ A;  2GOW A;  2WX0 A;  4WJP A;  1WIA A;  1V49 A;  3A4R A;  2IBI B;  1WJ4 A;  4M0W B;  1E90 A;  3WAM A;  2ZVN A;  3PRE A;  4MGZ E;  3RUI B;  5EDS A;  1WR1 A;  1XD3 B;  1IP9 A;  5CTR C;  2FCM A;  1WJU A;  3NZS A;  4NNJ B;  4KZC A;  5E6O A;  4W9L A;  5DPR A;  3WIM A;  2KTR A;  5E6N A;  1EF5 A;  3UIO B;  5DCN A;  4DXA B;  1C3T A;  1OGW A;  2GBR A;  2ZPN A;  3CMM B;  2DZI A;  3JYU A;  3ZTD A;  5L83 A;  3U8Z A;  4GMV A;  1LXD A;  3ZW3 A;  2DAJ A;  2BYE A;  3VUW A;  4E3C A;  2LI5 A;  4W9I A;  3KUC B;  3T9L A;  1TBE A;  1WGR A;  4MEM A;  5JZE B;  3AI5 A;  3EFU A;  2ZCC A;  2I1K A;  4N9F 4;  3SHQ A;  2O6V B;  3DVG Y;  4WAA A;  3DCG A;  1OEY A;  2K8B A;  3JVZ X;  4RM9 A;  3DPD A;  1WY8 A;  1UEL A;  1WE6 A;  3R7Q A;  2LD9 A;  1WGD A;  2KHW B;  3DBS A;  4PS7 A;  2LZ6 A;  1GC6 A;  1Y8R C;  4EKU A;  1V6E A;  4TV3 A;  4AUQ C;  4AJY B;  2WWZ A;  4MGY E;  2NBW B;  1WXA A;  4LJO B;  1WH3 A;  2CHW A;  4GDL A;  2MCN B;  1CMX B;  3VHT C;  2K25 A;  4IM2 A;  2KFK B;  4TUU A;  1WYW B;  3L54 A;  2ZNV C;  1BT0 A;  3ZRF A;  2LXC A;  4G11 A;  2N9X A;  2RGF A;  1Q0W B;  1KM7 A;  3TIX A;  3ML9 A;  2JF5 A;  4LJP B;  2N1V A;  3H7P B;  2FID A;  4NQK E;  1X1M A;  2B3A A;  2MP2 A;  3RZF A;  4TKN A;  3W1S C;  2GMI C;  4NPN A;  2KO3 A;  4GOC A;  4MJS A;  3JW0 X;  2NCN A;  3B1L X;  4LDT D;  1P1A A;  4AJW A;  3A9J B;  3V60 A;  4HVB A;  4FJV B;  2ZPY A;  4P7I A;  1YIW A;  4G3X B;  1H4R A;  4W9K A;  1I42 A;  2AL3 A;  3PS6 A;  2L0F A;  3TCA A;  3P2B A;  1GNU A;  3ZVV A;  4XX5 A;  4DDG D;  1D3Z A;  4B6W A;  3B08 A;  2C5L C;  1OQY A;  2L05 A;  3KYC D;  5JHA A;  4WJN A;  2RD0 A;  4GDK A;  2FUH B;  2O2V A;  1UGM A;  3RZW C;  1WI0 A;  4MGK E;  3PLU A;  2AEH A;  5D6J B;  2BKR B;  2IY1 B;  3SDL C;  4FAD A;  4IW0 A;  1AAR A;  3D32 A;  4J6I A;  4EZJ A;  4HCP B;  4RM8 A;  3VH4 B;  3WA0 A;  3M95 A;  2PJH A;  3IFW B;  4ZRI A;  2BYV E;  2M0X A;  4M8M A;  3A1Q A;  2JPH A;  2EKE C;  2KJR A;  4FBJ B;  2DZM A;  2GBJ A;  3LJ3 A;  3ENE A;  5C1Z A;  1ZW7 A;  2LAS A;  2XEW A;  1KJT A;  4IM3 A;  2BGF A;  4F1S A;  3L10 B;  1E5W A;  4NAW B;  2KDE B;  4KDI C;  4BBN C;  2V3S A;  4KIK A;  4MM3 A;  4ZRK A;  3ONS A;  2JRI B;  2KLC A;  1P9D U;  3QK0 A;  3ZRC A;  2K6D B;  2DYO A;  2R2Q A;  3L13 A;  4ANW A;  2ZVO A;  1RLF A;  2IO1 B;  2V1Y A;  3BIN A;  3PT2 B;  3ZIM A;  4KZ0 A;  5G2N A;  2PE6 B;  4JL9 A;  2KDB A;  3HIZ A;  2UYZ B;  4JGH B;  4MSM B;  2PEA A;  4EEW A;  2KK8 A;  2PE9 A;  1R4M I;  5CHV C;  3NHE B;  3VTW A;  1WR6 E;  2JZ3 B;  2N9P C;  2ZNV B;  5LXH A;  3EEC A;  2CKH B;  2GBM A;  2YLM A;  1ZKH A;  3K9O B;  2L3Z A;  4FJZ A;  4IM0 A;  4MH0 E;  3R66 C;  1TZ1 A;  2DEN B;  2K8C A;  2BWE S;  2L0T A;  3ZNI D;  3ZNG C;  4BBN F;  5BO4 B;  2DHZ A;  2JVC A;  4RMA A;  4DHZ B;  2HE7 A;  1WM2 A;  2KLG A;  4IC7 B;  4TQ1 A;  2M4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...