1XTEA

Crystal structure of cisk-px domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Sgk3
publication title Structural basis of membrane targeting by the Phox homology domain of cytokine-independent survival kinase (CISK-PX)
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 27
structure length 116
sequence length 116
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 1xteA00
3FOGA 3HPBA 4IKBA 2REAA 2YPSA 2AR5A 3DYTA 1OCSA 2V6VA 1H6HA 2IWLX 1OCUA 2RAKA 2WWEA 1KMDA 4PQOA 4PZGA 2RAJA 4AKVA 2REDA 1O7KA 1XTEA 1KQ6A 4ON3A 2I4KA 3IQ2A 4IKDA 4IKBB 4P2IA 1GD5A 2ETTA 2L73A 3LUIA 3P0CA 4BGJA 2DYBA 4HASA 4OXWA 4PQPA 1XTNA 2V14A 3HPCX 4P2JA 4AZ9A 2CZOA 2CSKA 2RAIA
chains in the Genus database with same CATH superfamily
3FOGA 3HPBA 4IKBA 2REAA 2YPSA 2AR5A 3DYTA 1OCSA 2V6VA 1H6HA 2IWLX 1OCUA 2RAKA 2WWEA 1KMDA 4PQOA 4PZGA 2RAJA 4AKVA 2REDA 1O7KA 1XTEA 1KQ6A 4ON3A 2I4KA 3IQ2A 4IKDA 4IKBB 4P2IA 1GD5A 2ETTA 2L73A 3LUIA 3P0CA 4BGJA 2DYBA 4HASA 4OXWA 4PQPA 1XTNA 2V14A 3HPCX 4P2JA 4AZ9A 2CZOA 2CSKA 2RAIA
chains in the Genus database with same CATH topology
3FOGA 3HPBA 4IKBA 2REAA 2YPSA 2AR5A 3DYTA 1OCSA 2V6VA 1H6HA 2IWLX 1OCUA 2RAKA 2WWEA 1KMDA 4PQOA 4PZGA 2RAJA 4AKVA 2REDA 1O7KA 1XTEA 1KQ6A 4ON3A 2I4KA 3IQ2A 4IKDA 4IKBB 4P2IA 1GD5A 2ETTA 2L73A 3LUIA 3P0CA 4BGJA 2DYBA 4HASA 4OXWA 4PQPA 1XTNA 2V14A 3HPCX 4P2JA 4AZ9A 2CZOA 2CSKA 2RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOG A;  3HPB A;  4IKB A;  2REA A;  2YPS A;  2AR5 A;  3DYT A;  1OCS A;  2V6V A;  1H6H A;  2IWL X;  1OCU A;  2RAK A;  2WWE A;  1KMD A;  4PQO A;  4PZG A;  2RAJ A;  4AKV A;  2RED A;  1O7K A;  1XTE A;  1KQ6 A;  4ON3 A;  2I4K A;  3IQ2 A;  4IKD A;  4IKB B;  4P2I A;  1GD5 A;  2ETT A;  2L73 A;  3LUI A;  3P0C A;  4BGJ A;  2DYB A;  4HAS A;  4OXW A;  4PQP A;  1XTN A;  2V14 A;  3HPC X;  4P2J A;  4AZ9 A;  2CZO A;  2CSK A;  2RAI A; 
#chains in the Genus database with same CATH topology
 3FOG A;  3HPB A;  4IKB A;  2REA A;  2YPS A;  2AR5 A;  3DYT A;  1OCS A;  2V6V A;  1H6H A;  2IWL X;  1OCU A;  2RAK A;  2WWE A;  1KMD A;  4PQO A;  4PZG A;  2RAJ A;  4AKV A;  2RED A;  1O7K A;  1XTE A;  1KQ6 A;  4ON3 A;  2I4K A;  3IQ2 A;  4IKD A;  4IKB B;  4P2I A;  1GD5 A;  2ETT A;  2L73 A;  3LUI A;  3P0C A;  4BGJ A;  2DYB A;  4HAS A;  4OXW A;  4PQP A;  1XTN A;  2V14 A;  3HPC X;  4P2J A;  4AZ9 A;  2CZO A;  2CSK A;  2RAI A; 
#chains in the Genus database with same CATH homology
 3FOG A;  3HPB A;  4IKB A;  2REA A;  2YPS A;  2AR5 A;  3DYT A;  1OCS A;  2V6V A;  1H6H A;  2IWL X;  1OCU A;  2RAK A;  2WWE A;  1KMD A;  4PQO A;  4PZG A;  2RAJ A;  4AKV A;  2RED A;  1O7K A;  1XTE A;  1KQ6 A;  4ON3 A;  2I4K A;  3IQ2 A;  4IKD A;  4IKB B;  4P2I A;  1GD5 A;  2ETT A;  2L73 A;  3LUI A;  3P0C A;  4BGJ A;  2DYB A;  4HAS A;  4OXW A;  4PQP A;  1XTN A;  2V14 A;  3HPC X;  4P2J A;  4AZ9 A;  2CZO A;  2CSK A;  2RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...