1XTIA

Structure of wildtype human uap56
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
381
structure length
381
Chain Sequence
b'GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 128
structure length 381
sequence length 381
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA02
2O8CA 1E2LA 4Q1CA 2JCSA 3CX8A 1MO3A 2VHCA 1E1RD 1MABA 2E9SA 2QMUA 3MMPA 4IOJA 4MGYR 2NPFA 1L4YA 3NBYC 3T35A 4IXNA 4TN1A 3VR6A 1X8LA 3C16C 4P3YA 4RFSB 4QRHA 1EGAA 1SKYB 2QRZA 3C15C 4WOPA 1T5LA 1XMIA 2WPDA 4CF7A 4G01B 3WHLA 5ELXA 1GFIA 4ACAA 2G0NA 3EARA 2BBOA 4LV5B 4EPXA 4MRRA 3LAWA 4BRUA 4OQXA 2JEOA 4AWXA 1CLUA 3KUDA 2O0KA 1CS4C 1UF9A 3VKHA 1N0VC 1BMFD 1H8HD 2FZ4A 5JJIA 2V1XA 2FPKA 1C1YA 1KK2A 1UM8A 1DS6A 2C78A 4NCNA 1ZU5A 4RSGA 2ZROA 3ND9A 1LY1A 4P4SB 5TVKA 3R7WA 1KI6A 1R0ZA 3KUCA 2CHQA 1UEJA 4C0SA 5J4VA 4ASUA 2PLRA 4M1KA 5CDFA 5HZHA 3QG5A 4JT2A 4OHZA 3EA5A 1E2EA 4YMVA 1ZRHA 1Q22A 1T91A 2YWEA 4D0NA 4DIEA 4XH9B 2NGRA 1Z6YA 4QNMA 4DEXA 4EAQA 3VR3A 2QUZA 4MKHA 5BN5A 4Q7LA 1NLYA 5CDFE 3IBGA 4QG7A 1M8PA 2CNWA 5KPDA 1LNZA 4O25A 1XZQA 3T5DA 4KCGA 3X1WA 1YZTA 4JS0A 5A0FA 1YZQA 2XJ9A 5CLQA 3OE7A 5HCIA 3QF7A 1Q1EA 2C8VA 1P73A 5FBLB 1E98A 1E6CA 1O87A 3KJIA 4UQOA 4TLCA 3H86A 1KAGA 4ZCLA 1NVUQ 2HT6A 1J8MF 5L3SA 4I99A 3TKLA 4QHYA 3L8ZA 3KJHA 2IYZA 1GZSA 1ZINA 2VL7A 4K81B 4PQYA 3HJNA 3OEED 2JDID 1X6VA 4UNRA 3KFXA 1FOEB 1VYUA 1WMSA 2ZRGA 4LBVA 3BB3A 1W2GA 1EWQA 3LQRA 4FWIB 2WSSA 1E79D 4W5JA 3KFVA 1OFHA 1VIAA 4JLVA 4M1OA 4Q18A 5EE5B 3BFXA 2NIPA 4V0KA 3ASZA 2XNDD 4AIIA 3MJHA 4TT3A 4OL0A 2WTUA 2F3RA 3GD7A 3LBHA 5E7IA 5EE0A 3H1TA 1HTWA 4QBGB 4OHXA 4Q01A 4IFEA 4Q9IA 4XVRA 1XEXA 1E9CA 2VSOA 2XB2A 1H65A 4BFVA 5EXSA 3B82A 4KVGA 1UBCA 3KXKA 3K70C 4KJZA 3BWDD 2ZM5A 3FOZA 1KO7A 3GLGA 4PC3A 1G19A 1SXJC 5F2EA 1E9BA 4RJLA 1FTNA 1DAGA 5A5GA 4E22A 2DFTA 2XXAB 1NIJA 3HU3A 3WMEA 1NSFA 2EFEB 2ZI3A 1JJVA 3SJCA 5JJKA 3C5CA 1P62B 2FSGA 2YOFA 3C5HA 4MGKR 1YRAA 2QAGB 1E2PA 3AP3A 3CONA 5BWMA 8OHMA 4PAOA 2F55A 4GOXA 1SXJA 3SYNA 4JL5A 3TIFA 2C04A 3MSXA 721PA 3AB3A 1N5LA 2CEAA 2KI5A 5LPNA 1WDTA 3MD0A 1AN0A 4MH0R 1T9HA 1YU9A 2C77A 1DO2A 2VPPA 1LS6A 2O8DA 1Z47A 3IQXA 1SXJE 5M04A 2R6AA 3MFYA 2CJWA 2Q3FA 4MRNA 3E2IA 4H1UA 4B32A 2W6ID 4NZYA 1E2KA 3K0FA 2ERXA 1PZNA 2A5GA 5KU1A 3AKYA 4W5WA 2EVWX 2Q9AA 3PUXA 1UPTA 3HPRA 3SQWA 1BKDR 2WOJA 1E9AA 2E1RA 2B8TA 4F91B 3DOEA 1XPUA 4A36A 2ZI9A 1ZM7A 1Z28A 2D06A 4I4LA 4Z8XA 3TUIC 5JHGB 4JJKA 1AS2A 1EK0A 3NC1C 2DCUA 4E07A 1BO6A 3OIUA 2O8BA 2XAUA 1MRSA 1DBSA 4NU0A 1T3HA 3LFUA 1UEIA 3TK1A 1HUQA 4Z8YA 1GM5A 4OI1A 4RCZA 4MKIA 4LC1A 1OHHD 1AIPA 3AGPA 4DRZA 4G5QA 4C7OA 1SHZA 2J59A 1KI3A 3SU8A 2FDCA 3GEIA 2QA5A 3PIRA 4AYXA 1U0LA 5LD2C 1J70A 4BFUA 1N6OA 2HLDD 4Z51A 2J3EA 4ZCIA 2A3RA 4MITA 1DO0A 4QC2A 2JGNA 1TF7A 3K0AB 1JQJC 2G83A 4DB2A 5E95A 1ZM3A 2AK3A 4G5GA 2RGAA 4HEJA 1KYIA 2YYZA 4LY6A 4EIWA 2VP6A 4XSGA 2W6JA 3QI2A 4HAUA 4R2HA 3VX3A 2GCOB 2C2HA 4CEHA 1KGDA 1QBKC 3BFKA 2W0MA 2A5YB 1WRBA 4FCTA 3HDTA 1HV8A 5EUQB 1Q1BA 3B1ZA 3VR4A 1VDZA 3Q5EA 2BCJQ 2W58A 3Q7PA 5JEEA 3HYRA 3H2YA 2PEYA 1RIFA 4R71A 1P7CA 5KO2A 2PT7A 4CEJB 5FUVA 2GTPA 2EYUA 3WP0A 2QGZA 1Q1ZA 2ZJ2A 4LPKA 1IN6A 3SOPA 5LDDC 2VYFA 3AGQA 1Z5ZA 3K0CC 4X8LA 5AJZA 4MKGA 1ZVQA 4QBHA 1XDBA 3MWKA 4LHWA 1XB2A 4KLZA 3H4MA 3LX5A 3K8YA 1KKLA 2FSHA 1W5TA 2L0XA 2MMCA 2ZE5A 3EX7C 2DR3A 3BH6A 1YR8A 3K0CA 1N5IA 4I1UA 1ZJ6A 3U7EB 1KSJA 1NRJB 2GF9A 3BXZA 4NPHA 1NKSA 4Q48A 2QG6A 4QNRA 1UDWA 5B2ZA 5EP4A 1FQKA 4GL2A 2VP4A 1U0HC 1H8ED 3BE4A 2C99A 1KI9A 3MJRA 1XWIA 4JVMA 2H5EA 1NN5A 3QBTA 4LHVA 1DELA 1NMYA 1VHLA 1U8ZA 2VP2A 3K9NA 5J47A 2IXEA 2BOVA 1IXRC 1G16A 2ZTSA 1S96A 2EW1A 1XNJA 1XCPA 5GJWC 2GJ9A 1E2JA 2WWIA 3CWZA 4IEEA 1F2TA 3TVTA 2PZEA 4CW7A 5BYKA 2PX0A 3OESA 1W48A 2FH5B 2GJSA 3MWLA 2ODBA 1RRCA 2IYWA 3REFA 4Q1EA 1FUKA 4RD2A 2GESA 5F9HA 3O8BA 3BRWD 1P2UA 5TDHA 1IY2A 1VYTA 3VAAA 4C0QC 3TSOA 3HYTA 3R8CA 3O8CA 1HYQA 2EQBA 4XJXA 1T8TA 1FW6A 3JVUA 2A5FA 4DLTA 4DVGA 5KOYA 1A1VA 1EESA 3K0EA 4M1TA 3MG9A 1AJEA 2ZU0C 5EZ6B 1EFHA 3KJGA 1PLJA 3THWB 2V7QD 4CZ2A 4MRPA 4ZPXA 4PPQA 2HYDA 3NH9A 3QUSA 4M9QA 4Q4LA 4TYYA 3NG1A 2P2LA 1G8FA 2EFGA 2A5JA 4RD4A 2QAJA 3GLHB 2JLXA 3DMDA 3KQHA 3AM1A 4LK2A 1FP6A 2ZRCA 3GP8A 1Z22A 3K9GA 5E7MA 3TMKA 3W34A 4JLBA 1ZYUA 1VG9B 3UXMA 4CT4B 1XXHA 2IEZA 1CR2A 1M7GA 2BJVA 3TW8B 3SR0A 2JAQA 4C30A 3QF4B 1TADA 1E0KA 2XNSA 4A6PA 5JMTA 3I4LA 4PC2A 4TSFD 1NN1A 2KE5A 1XXHE 3RWOA 1QHHB 2XSZD 5HTKA 3GJ8A 1M34E 2VQSA 1ZD8A 4AURA 2VSXA 4EFMA 2N46A 3DHWC 4KFUA 4US1R 1WB9A 4KBFA 1YZLA 1ZIPA 4WXRA 5JHHB 1YVDA 3GJ4A 4IJMA 3AF1A 2HJGA 5J40A 1NVWQ 2HYIC 1JI0A 2ZVQX 5KHOC 2F3TA 1XPOA 2QROA 2GHIA 2WVJA 1RYFA 2PJZA 4JLMA 4BGDA 3KQUA 2BKUA 3U60B 1G1MA 4UNSA 2D7CA 2X77A 4V0OA 1Q57A 1II8B 3CLVA 3SFZA 2F6RA 2BHRA 2VP9A 1ZD9A 4FMDF 2ZRMA 1JJ7A 3D7MA 3LH5A 4F38A 4AY2A 3D31A 1ANKA 1X8KA 1HT1E 1F5NA 1JEDA 1CJKC 2OHFA 5EP2A 3EPLA 4RFVA 2J5XA 2FFQA 2X2FA 1E1QA 2JIZD 3AP2A 4GMDA 4HZIA 4R2IA 5KPJA 1DVRA 3VR1A 5JLJA 2FV8A 1U98A 3W6OA 3NXSA 1RRGA 2G6BA 2TMKA 3GLFB 2YC4C 5FBVB 4XD7A 4DT1B 2UZ3A 1S9HA 1FNNA 1ZNYA 3CIOA 3MWJA 5CJ2A 3WMGA 4ARZB 5FPHA 3B1YA 3UWKA 5HKKD 5AUPB 1XRJA 3UK6A 2F9MA 3ECCA 3V4FA 4N1AA 1K8RA 3KX2A 4A2PA 5K8UA 3CW2A 4FI3C 4HATA 1TQ6A 3IDQA 3FHTA 1XCMA 1W0JA 5HPYB 4DUGD 3CWQA 3IUYA 5BW8A 4AYWA 4HUQA 3Q8XB 3PEWA 2E87A 4TMKA 3RYTC 4Z1MD 1ESNA 4LUCA 5CB8A 1LB1B 2FPMA 2WSMA 1UBGA 4LC0A 4IOLA 2YJTD 2OBLA 1FQJA 2NO9A 2J0QA 3BERA 1NNEA 4AKIA 5E4FA 5AWFC 3LVQE 1R6BX 2ZSFA 2AFHE 2ZE7A 3CPEA 3QKRA 2JLRA 2OO7A 4ZCMA 2Q9BA 2H92A 2WMOB 1G5PA 1GG2A 3B1XA 3X2SA 2RKOA 4Q5IA 2XGJA 4MRVA 3PCRB 4EQ6B 3I92A 3GJ5A 4B71A 2NO6A 3QJYA 5AJWA 4DWJA 3NBXX 1BIFA 2AKAB 4A15A 2OESA 2CE2X 2WOOA 3TW4A 3THXB 2UVQA 1GP2A 2NO0A 2R6CA 3LW7A 1N6KA 3G5UA 5L3QB 1D5CA 1R5BA 1YKSA 5JRJA 1OSNA 3EASA 1CBUA 4NBSA 2HJVA 1U8YA 4MUBA 5B58C 1EFRA 2QQ0A 2GA8A 2ZRNA 4LJYA 2IYXA 4W9MC 5FI1B 4BZPA 1E4YA 1Z2AA 2MSCB 2RMKA 3K09C 3KTAB 4JBYA 1SZPA 1XD2B 2J1LA 3LBIA 5GADl 1NJFA 4N0EA 2XZPA 1GNQA 4M8NE 1OH5A 1OXUA 1TTTA 1TL7C 4TLDA 3VU9A 4GOKA 3ZVRA 5KSZA 2ZJBA 4LWZA 4MYTA 2IYTA 1GL7A 5CIQA 3E5HA 2RB4A 3K09A 3EPHA 5IT5A 4WBSA 2ZETA 3QKSB 4DSOA 2FWRA 3FMOB 3W5JA 2QL6A 3D8BA 4V03A 4NONA 2CDNA 1N25A 2VHJA 2OSBA 4Q4JA 5C1BA 3ZH9B 1Z0FA 3SDZA 1ZCBA 2NQ2C 2ZJOA 3DMNA 1JR3A 3PUYA 1OYYA 1G6HA 1ZIOA 3H0KA 1XZPA 4A8JB 5IK2D 4JMPA 5D3MB 3NVAA 1QG4A 2RGDA 4IFBA 1K5GA 1VPLA 4AG6A 5JFGA 1KSHA 3LA6A 1JR3E 1CIPA 1ZNZA 4EPWA 2WKPA 1OIXA 1EX7A 4DDVA 1YJ5A 1RJ9A 2Q3MA 2ZRDA 4JIMA 4B43A 1Z06A 4D0GA 4KAXA 4M1WA 2JJ2A 4NHOA 4CVNA 1R0YA 1KI7A 1VECA 2CE7A 2RGGA 4I81A 3SN6A 2IX3A 2J0SA 2O5VA 4PHHA 3THOA 2VBCA 5SZIA 2DYKA 4P31A 3RC3A 1SHKA 2FG5A 2J46A 5CYOA 1R5OA 1SVMA 2JLYA 3N70A 2YZ2A 4FMDB 1NLZA 1E2DA 3P4XA 4GSYA 3LXRA 1KOFA 4P32A 4XSHA 1KK1A 2IT1A 4YXWA 2SHKA 2YNMA 2KB0A 4ACBA 3JZAA 1JB1A 2RGNC 1GAJA 4BLPA 3KKOA 2CVFA 3AVOA 1FMJA 1Q3TA 2GK7A 2XTMA 2CL6X 1AQUA 4PHTA 2P5SA 4DCSA 3GQBA 2RGNA 5JBQA 4PR0A 5AUQA 3FB4A 3QNUA 4JVLA 5FUWA 1KI2A 4D4KA 1L8QA 3IEUA 1M7HA 2DY1A 4AI6A 3QIAA 5AUOB 3B60A 1S0UA 3NKVA 4UNPA 1M7BA 2OEPA 2VH5R 2VLIA 4OHWA 2QZ4A 3THYA 1RKBA 1NVXQ 3A8TA 3PEUA 3PG5A 1IY1A 1UJ2A 1SVIA 1Z83A 4B3GA 1G6OA 4ZDJA 1JECA 1T0HB 1IJFA 2ZR9A 1G7CA 3PXGA 1W36C 3B13B 2W0SA 1LVGA 1PJRA 4LBZA 1WBDA 1P75A 4D2IA 1WP9A 1IN8A 3LBNA 3EC2A 1OJLA 4G5OA 2ZYTX 5C4GB 4PXAA 2GXSA 1XJQA 2ZJAA 1RYHA 3ZZUA 3ZD7A 2AWOA 2FU5C 2ZR0A 3BC1A 4CGZA 1R10A 3U61B 2BMFA 4I1VA 3DKPA 1OLOA 1NY6A 2Z0MA 3DM5A 3IILA 5EUMA 1FZQA 1OYWA 2G1JA 4DCVA 3ZD6A 2PH1A 4HAYA 2RHMA 5SZKB 3B5JA 4TYWA 2Z43A 1N5KA 4TLEA 3F8TA 2REXB 3U3KA 2J87A 3A1TA 1HE1C 3BS4A 1FX0A 4A92A 4NYJQ 2BBSA 3OFNA 1JALA 3AEZA 4QM7A 521PA 2VP5A 4YLGA 2H17A 4HSEA 4GP7A 2P3SA 4KSCA 1GKIA 1J99A 4MKFA 4B74A 4ZKDA 1JNYA 3K53A 4B3DA 2CXXA 3QOFA 4IDNA 4Q7MB 2R65A 2WMNB 3RNLA 2IYUA 1GNRA 2DHRA 1S3SA 2KWIA 5CIWA 2D74A 4BQSA 2ZS9A 1P9NA 1R5NA 4URYR 3GLIA 2ZRIA 1J7KA 2YV5A 1OXXK 1PUJA 4LX0A 3UIEA 1SULA 6Q21A 5TMPA 4JYCA 2QM7A 1XF9A 2WAYA 3GMTA 1W4AA 5DN6A 4B2PA 1A82A 3IHLA 1DAHA 2JJ1A 4RY2A 4M1MA 1W0KA 4MA4A 3GLIE 4IVPA 2YOHA 2HXYA 2ZEJA 3BD9A 4NCIA 2GEDA 3PR1A 3N2EA 5CLLA 1XMVA 3R9XA 4YQFA 1KNQA 1KZGB 1PVOA 4EJSC 3DL0A 2WIAA 1E96A 1A7JA 1GILA 1E9SA 2Z83A 3K0AA 4TL6A 1MV5A 4LJ5A 4BFSA 3AVXA 2V6JA 1Q20A 1TNDA 2YINC 4EJSA 4C2UA 4GI7A 1S3GA 3U4QA 1VKJA 2OE2A 4O2LA 3W5IA 1JQLB 4JLJA 1QF9A 2V8OA 3B8HA 2C95A 2DWQA 2ZI7A 4HLDA 4KVAA 4AKHA 3OZXA 4JLDA 4Q9HA 4F7WA 3I1FA 3L8YA 1DG1G 3S1AB 2FSIA 1NSTA 3X1DA 3UPUA 1NKTA 1W44A 4L5BA 3O8RA 3K70D 5B64A 1CP2A 1GITA 2OFXA 3GJ7A 2GVDC 4RZXA 1QHIA 2ZYVX 4QGAA 1ODFA 1EXMA 1E1RA 621PA 1NIPA 4WAUA 1SVWA 4S35A 4JKYA 1N6NA 3EPJA 1A2BA 3PITA 2YHSA 3GJ3A 2RGCA 4LJ4A 4WA7A 1UBEA 1XEFA 5FOVA 2WV9A 4NH0A 3TAHA 4PX9A 3JVVA 1R8SA 3ZIAD 3ZS8A 4BLTA 3V9PA 4ZDKA 3FKSD 3QG1A 4LCBA 1CJTC 4B73A 1TU4A 2OAQ1 5DI9A 4BEBA 2GXAA 4B6EA 2R62A 1J8YF 4LHXA 3TUZC 1NP6A 3AVUA 1YE8A 4HZUA 5J4HA 1BMFA 1H8HA 2XB4A 4L4UA 1KKMA 1FNMA 3L0SA 2WKRA 4HAVA 3FHCB 3LV8A 1F3OA 3FPAA 1JPNA 3N2IA 5FI0B 2GDJA 3UG7A 3KQNA 1I4DD 3B78A 2IA5A 2IF2A 4BE7B 4Q1FA 1KI4A 1EX6A 1NJGA 2FN4A 2IK8A 2WJYA 5JWOA 5CK5A 4A9AA 2VA8A 1Q21A 1W5SA 1G5TA 2J9RA 4Q47A 1Z6TA 3QKUA 5AJVB 2QM8A 2ANCA 3MWYW 1MOZA 1DPFA 5CB6A 4M9XA 2G88A 2ZR7A 3CNLA 1WXQA 3BAFA 2FNAA 1GRNA 2J0UA 3QENA 1E9DA 4AD8A 4G3XA 3T06B 2BEKA 4OQNA 1W46A 1KO5A 1RVDA 1FMLA 2JLQA 3CM0A 3DOFA 3RSLA 1CXZA 3GJXC 3OEEA 1VCIA 2JDIA 2G9NA 2VP0A 2C9YA 3QEJA 1KAOA 4D25A 2PJRA 1E79A 3K0SA 2J41A 3I5YA 3IIKA 1E32A 4OKSA 1DEKA 1W7AA 4O3MA 3KJEA 2LCFA 3PENA 5DI3B 3MRSA 3ADCA 3T1OA 3TNFA 1G3MA 2XNDA 5F3WB 2IL1A 3P27A 1RC8A 2LKCA 1QZXA 1M74A 1ZM4A 4WXPA 2K5UA 2F7SA 3W3ZB 4QHSA 2OG2A 4PO9A 2XEXA 4Q02A 4M9ZA 4BECA 2NMVA 2YOGA 4Q66C 1OW3B 3RWMB 1NN0A 5FBWB 2WWFA 5IDVA 4B2IA 2WIBA 2O52A 1G8PA 2BMEA 3W6PA 2MMGA 4YMSA 3HU2A 2O8CB 3RDPA 2XTZA 4BZXA 4NDZA 2B7BA 5GVRA 1E99A 5K8TA 1MABB 3OEHD 1LS1A 4JL6A 4KXFB 1RE0A 2FPLA 5J4LA 3CRQA 1VMAA 1KJYA 1P9WA 3T5GA 5IF9A 1ETUA 3EW9A 4L16A 2R6GA 5TB5A 3V00A 2W83A 5BYJA 1L4UA 5J4KA 1KK3A 5AR1A 1KY3A 2ZS7A 4J0QA 2EYQA 1G20E 1P2TA 3ZVNA 4ESVA 4NYIQ 4JLOA 4D6PA 2ZJ5A 4NYIR 2EFHB 4RD0A 3TVDA 2A30A 4TQAA 3R7WB 2OBMA 1KI6B 1KJZA 2W6IA 4YMTA 1TPZA 3RS4A 1OB2A 2GAOA 3U3JA 2LKDA 4HDQB 4TMWA 2VHTA 4S2EA 1AKEA 1YR7A 1W1WA 2WJIA 1IJEA 4NE2A 5P21A 3ZQJA 4RKFA 5DGXA 2GBLC 3NHAA 3RVBA 2R6DA 4D0LB 3SJBA 2NOAA 4TTRA 4AG5A 2QP9X 4MYUA 1EG7A 1CRQA 2OUKA 4DLZA 1A5TA 3CRMA 4L15A 1US8B 4IVQA 2GBLA 5DYIA 2ZI6A 3AKCA 2IYVA 4C0JA 1CJMA 3AVWA 5J4YA 4EUNA 5L8VA 4F4CA 2AD5A 1OHHA 4KU4A 5DHAA 1Z0JA 2F1RA 4UXHA 2GXQA 2QP3A 1HQCA 1Z6AA 4LHZA 1TX4B 5KDLA 3SC3A 1E9FA 4UNNA 2IYYA 2ODEA 3NEYA 3IQWA 1Q0UA 3EWSA 2YWHA 4G1UC 1Z6XA 2HLDA 3DM9B 5JSZA 1G7SA 2WWWA 3M0EA 4ZIRA 3ICEA 1E9RA 4NCHA 5FL7D 4NCJA 2NPIA 4PHFA 2OZEA 3SBEA 2P6UA 5FH9A 4B75A 1QVRA 1IN7A 1U8AA 4BLSA 2R2AA 5F98A 1UKEA 4D4LA 2G77B 2ZAMA 1E2MA 3QXHA 3CPJB 3HU1A 2PMKA 4Q4AA 5KNCA 2O0HA 1E69A 4N0DA 1XEXB 1Z08A 1EFUA 1GIAA 3CBQA 3F0TA 4WVFA 5JCPA 2IW3A 3SJAA 5KNDA 3BORA 2QBYA 3A1UA 4XVQA 1E0AA 4EFLA 5FUYA 5AJYA 1XMJA 3LW8A 5TV2A 2IYRA 1LV7A 4C3ZA 3GLGB 3HR8A 4JVNA 1DAKA 4IHQA 2D7DA 1VCMA 1AA9A 2HCBA 2WJHA 4B76A 1P72A 3RC8A 3I32A 2OCYC 1MO4A 3BH0A 3I61A 3WXMA 3K70B 1UKVY 3R20A 4EPRA 1JPJA 3EZ6A 2RGBA 2O8FA 2XOKA 1ZAKA 1SXJB 4HLCA 4KFSA 1SVOA 3SHFA 3SQXA 4O0MA 2YKGA 1MR3F 2GCPA 1RZ3A 1XTSA 4DDUA 1P61B 2O8DB 4OI2A 2VEDA 2VIIA 3CH4B 4FD2A 5SZHB 2FGJA 2AD1A 2CJWB 2OILA 1G4UR 1F2UA 2Z6VA 4R9UC 5JS8A 2JLZA 2WJJA 3A1VA 3AF2A 3T15A 1MRNA 1U90A 4LBWA 1GOTA 3AKDA 3K0FB 1XJ0A 2JJ8A 1FPMA 2D4HA 4PO8A 1YRBA 1ZW6A 1X86B 4U02A 2J7PD 1G3QA 1H8EA 4HDOB 5JEDA 2EWVA 2AL7A 4OI4A 4AC9A 4CYMA 2DFLA 4B6FA 3AVVA 1G5RA 3EIQA 3AP1A 1N2CE 2Q3HA 2N42A 4M9SA 2QQEA 3DDCA 2D3WA 2O8BB 4TWZA 2O8EA 2N1BA 1HA3A 3U3MA 2CL7X 2C98A 3FFBA 3U7FB 3A1WA 5FFMA 4DEYA 3U6KA 4M1YA 5KDDA 4M53A 2OT3B 4B48A 1MH1A 4URWR 4CRWB 2KBEA 2OAP1 4IDPA 4OK5A 3L2OB 3UG6A 4C7OB 4LGMA 2O0JA 4R7ZA 4EKDA 2ZQ5A 2J0VA 1UFQA 1W0JD 2GKSA 4MGZR 2NZ8A 4MYHA 4AKGA 2HF9A 1Q1QA 5DNYB 1MKYA 3TUJC 1KSFX 1S1MA 2OM2A 3AF4A 1CTQA 2GAAA 3LQQA 1ZC4A 2GEUA 3L0IB 1G3RA 1VTKA 3G82C 4MRSA 4L9WA 5KSYA 4LYFA 2WWGA 4OQFA 5LD2B 4WZAE 4CEIA 3T1TA 2XTNA 3KB2A 4Q1BA 4B33A 2ATVA 4A2QA 2QGNA 5H70A 1UKYA 5C2JB 2R8RA 3LX8A 2EU8A 1F48A 3OIVA 4IKEA 4CEHB 3OIYA 5G41A 3TR5A 4LYJA 4URXR 5HZKA 1BYIA 2IBMA 2V7QA 3U7HB 1E2IA 3EA0A 2C5LA 2ZYUX 1KDOA 3GJ6A 5GJVC 2CL0X 1OE0A 2GK6A 5FPTA 2UKDA 2CVHA 3NC0C 1Z07A 3R9WA 2VHUA 1KTVA 3GCGA 121PA 3BFVA 4TQ9A 2JATA 3TR0A 4NCKA 4IOMA 4DB4A 2FEOA 3OAAD 3W3AA 4KODA 1TQ4A 1XEWY 4QHTA 2OLJA 5K8LA 3QSYA 2WJVA 3GEEA 4TSFA 5DSZA 5ANRB 4V0MA 2XSZA 2F43A 4RZ3A 3FGNA 3VKGA 1AQYA 5DLQC 2QE7D 4HUTA 1MT0A 4RZUA 1AGPA 3AKEA 1O3YA 2H16A 2QT1A 3MUFA 4QXAA 4GDFA 3TQCA 4V0ME 2GZDA 4QFMA 5CM8B 1D9XA 4W5HA 4XWAA 4Y0AA 1KK0A 1LF0A 3FFAA 1XMSA 3TQFA 3EAQA 3RHFA 3K1JA 3T1VA 2WICA 4TMZA 5FOSA 3EZFA 4U7DA 2ZXUA 1PV4A 1KDTA 3CRW1 4C0BA 2GNOA 1OV4A 2F9LA 2VHQA 2V9PA 4OHYA 1CU1A 4H9GA 1OXVA 2ZS8A 3FE2A 4TTPA 1G64A 3RRYA 3TRFA 3VTKA 4DDTA 2ZRAA 4B3FX 3LDAA 2PCJA 3A4NA 1E2GA 2X2EA 3RS3A 2GXUA 1KNXA 3UMSA 2QMEA 2GILA 3M4YA 2GJ8A 4F92B 5KDOA 3EZ7A 5AJXA 3C4JA 3C7KA 1TF2A 4Q4HA 2FA9A 3B9QA 1LTQA 1XP8A 1GRRA 2BDTA 1F2TB 5KUTA 1F6BA 1N5JA 5HR5A 3QEOA 1QRAA 5DE3A 3CZQA 1MO6A 3BK7A 2PZGA 5HKKA 2CLDX 2KSQA 2RAPA 2P65A 2JJ2D 1RRFA 1XU4A 2ZE8A 4P33A 4Q00A 1NMXA 3AVPA 3EIEA 3A1SA 2AFIE 2DFKB 1EFTA 3CRVA 4TL8A 1SKQA 3ZVLA 1KMHA 2P5TB 1II9A 3HP1A 1T5IA 4H1VA 2IS2A 4DUGA 3KKQA 1C9KA 2X8AA 3OHMA 4DCNA 4TTQA 1KJWA 1BH2A 2BKEA 2IYLD 1CR1A 3OF5A 4P4TA 4YXWD 4PQRA 1JAIA 4Z1MA 3B2EA 5D3QA 4DC9A 5KYKA 3RS7A 1VYVA 1T6NA 1COWD 2GRJA 3CZPA 4G0NA 3TBKA 5FUXA 5EJEA 4LRWA 3CH5A 1P9RA 3A37A 4NMMA 2W2XA 3UWOA 1K6MA 5FPKA 4C0KA 1R2QA 4RFSA 3D3QA 2KJQA 1ZP6A 1D2EA 3I8XA 1N6LA 3GEHA 2QU8A 2VSFA 3L43A 1S8FA 2RGXA 5DH9A 4IEIA 2V3CC 4OK6A 3TSWA 5CM9C 4DZZA 3M6AA 4A2WA 3SFVA 1KI1A 1Q3HA 1SKYE 1N6RA 4DLSA 3I72A 1XXHB 2AN9A 2ZRHA 3ETLA 1UDXA 3IIJA 1B0UA 3IPYA 3SNHA 1FTSA 2VO1A 2ZI5A 1L7VC 4BLRA 2BMJA 3NTUA 4P4SA 2PLFA 3HR7A 4JLPA 1G291 1V43A 3A6PC 2AK2A 5EZ5A 2F1IA 3AVTA 3KKNA 3CRRA 3ZS9A 5KNBA 2NZJA 3RRNA 4PAMA 1IOZA 3GPLA 2ZUBA 4M2LA 4AKEA 4L8GA 1AGRA 4LJAA 4C0LA 3BGWA 1S2MA 4LZZA 4ZI3A 1E94E 1D8TA 1OIWA 2ZRLA 3W8RA 1TUIA 5G3YA 3IHWA 1Z2CA 4HLUC 1SVLA 2F1JA 4GZMA 4BFZA 4QJ4A 2IS1A 4US2R 1OF1A 1NBMD 2H7VA 1OH7A 2FFHA 1VIYA 3M1IA 4HAZA 5H8WA 3KZ1E 5DHFA 4A0GA 2A2ZA 2HXSA 4V0NA 4TMVA 3TAUA 5EQTA 2ZRFA 3Q72A 2LWIA 1S1CA 4HLUA 2MSDB 3PEVA 3WY9A 4D4MA 2XZLA 1T8UA 4JT4A 4DSTA 4P0TA 2R6FA 3DVLA 3JZMA 2ECKA 4PZYA 3KL4A 1TQ2A 4TLBA 4TZ0A 1NMZA 1S9DA 2CK3A 4URVR 1YQTA 4UJ5A 1IQPA 4DLRA 2ORIA 5IK2A 3PUVA 1N6PA 4FMCB 4Q9KA 4BWYA 3I3SR 3T34A 3ADBA 2BJWA 5FTNA 5L3VA 4DLYA 4M22A 3E70C 4GFDA 3E1SA 2BC9A 3NDBB 2BIFA 2P67A 2FMXA 5BN4A 1B23P 4TLAA 4HUQB 1A4RA 2QN6A 2ZVPX 4JJZA 1OKKD 3SZRA 2CBZA 2GCNA 2BVNA 2GWHA 4YDHB 2QAGC 3RRZA 4DKXA 2WM9B 3F3YA 1KSGA 4GMXA 1Z0IA 2PL3A 5DYGA 1JAHA 3FWYA 4JBWA 2XXAA 3PUWA 5EXXA 1OFUX 1CKEA 2XZOA 2QAGA 2WPDD 1FP7A 4A0RA 2W2VA 3QKRB 4DLWA 5FTMA 1QHNA 5EXTA 1VG8A 1CR4A 4BUJA 3PV0A 5BXQC 1LFDB 5C18A 1NVVQ 4XWKA 1T0JB 1NVVR 3PEYA 2PCLA 1TQDA 2PMDA 1ZBDA 3AVYA 3CR7A 4ZDWA 3X1XA 1U9IC 3CUEF 1ZNXA 3REGA 2REBA 1N0UA 1KMQA 3L0PA 4ASUD 2ZSEA 1X3SA 3ZYCA 4QBIA 3PJRA 3RRMA 2ODNA 1NG9A 4FIDA 1IY0A 4D82A 4OQMA 2QI9C 1U9IA 4PZLA 3QE0A 4IDHA 3ZDQA 2QMOA 4M0LA 4C4PA 2WBLC 4HDCA 2CNWD 3TE6A 4NKRA 3DKVA 4HAWA 2QEQA 3ZJYA 4LJ8A 3VU9B 4ABYA 3OE7D 4G5SA 2P6RA 1T3SA 3PVSA 2JASA 4DXAA 3D6TB 3WNDA 3N5CA 1BS1A 4PTLA 3U3OA 4JLNA 1ZUIA 1QHXA 1P4SA 4LHYA 2BWJA 2P6NA 3ND8A 1IHUA 4BLQA 4LPSA 1RFLA 1CRPA 4Q4JB 4QL3A 2WSSD 1QHYA 3EIHA 3AUXA 3W8NA 1QG2A 4KFRA 5JS7A 4KO8A 3RSOA 2RH5A 2ZIAA 5JWHA 4GPTA 2FFAA 1D6JA 1VG1A 2DFNA 4HI0E 4X8OA 1OH6A 1P60A 2ZRPA 1KHTA 3ONWA 2W00A 3A58B 5EXPA 4KYIB 4TT3D 5JI3E 4Q7JB 3ICQB 1ELOA 2ONKA 2ZU6A 4XOIA 2C03A 1KO8A 3IBYA 1IAQA 5G53C 1ZM2A 1I4TD 1RJ9B 2CLCX 1Z6GA 821PA 4HLQB 1G3UA 4OYHA 2GCOA 3CX7A 2UZIR 2IXFA 5JI2E 1NY5A 4RZ2A 3GFTA 4IVRA 2Z4RA 2OFWA 3P20A 1E2QA 2A5DA 4LDJA 4C0HA 3FHOA 4GP6A 4JVSB 5AUNB 3MCAA 1EFCA 2VF8A 4FXPA 3ZLJA 2DBYA 3LO5A 1GVNB 2ZSDA 2B6HA 2OV2A 2IHBA 1GUAA 1W2HA 5FR2A 4B44A 4CEJA 1SXJD 3RS0A 4KV9A 1T4GA 3Q9LA 5EP1A 4U00A 1HY3A 1WCV1 4D26A 3U6BA 1L2TA 3PFIA 1WQ1R 4JLKA 4ZI2A 2IHYA 1XBTA 2CCJA 2ZPTX 1US8A 4EPTA 1DAMA 2ZYWX 4NL4H 1P3JA 1QHGA 4HAXA 4Q1AA 4TZ6A 1J2JA 3IGFA 4URUR 1AS3A 5FOXA 2OCAA 1PLLA 3KB1A 4QKQA 1OIVA 1HT2E 1V5WA 4MYCA 3ZGXA 3KQLA 4IDOA 1GNPA 2PBRA 3QY0A 2ONJA 1WA5A 4GBMA 3DEFA 2I4IA 2GJKA 3GJ0A 2NTYC 1II0A 1KO1A 5KSPA 1U0JA 3KKPA 3THYB 1CEEA 3QXSA 3DPUA 3QVVA 1VCNA 3U44B 1LW7A 1IONA 1AZSC 1DE0A 4LOAA 1YZNA 3W90A 2Q6TA 1GTVA 4XTCS 5TXGA 4QOSA 1OH8A 2C96A 4FMBB 2QNRA 3BJIC 3GFPA 2AHOA 4IOKA 4UXJA 1P2VA 4BPBA 5FOWA 3QKTA 1VCOA 1R0XA 4PPNA 5JECA 1W36B 1D2MA 1E9EA 1N0WA 1S4QA 2QENA 2CHGA 3QXXA 4KYUA 1JR6A 4XIGS 3H84A 3VR2A 3TLXA 4ZV4A 5FR1A 1PLKA 1SVSA 5SZJA 1GL6A 4TQUS 3GLGE 4KITB 3O8DA 5F9FA 2V55B 2JA1A 3AUYA 2OBNA 3FKQA 4OBEA 4B2LA 4DSNA 4M21A 4TMXA 2Q9CA 1N3BA 4E03A 3VX4A 5BN3A 5A4JA 1Z63A 1LF5A 2W6JD 1KO4A 2ODWA 2IUTA 1G8HA 3ZIAA 4F4JA 2WJGA 3FKSA 3WBJA 1FX0B 2V6IA 2ZANA 3THWA 5H68A 3FMFA 3LNCA 1G17A 3C14C 1OFIA 3RS5A 2H18A 2GVZC 2I3BA 3VNVA 2CLSA 2GETA 3BH7A 1XTJA 3GLHA 2AWNA 2NG1A 3T1QA 5JJLA 1UADA 5CITA 3WHKA 1XPRA 2PZFA 1XD8A 3GLHE 1G4AE 4Y0VA 5C46F 3A4MA 1GDDA 3QF4A 4A1FA 1ZNWA 1XX6A 4PQFA 1WBBA 3GLIB 4DLVA 1E2HA 1QHHA 3QXJA 5CK4A 4Q03A 2X19A 1NI3A 3VR5A 2JLUA 1T3LA 2Q0HA 4C2TA 5KTYA 3T61A 3CKLA 1E2FA 2QY9A 1FFHA 1GWNA 1OPXA 4MDEA 4GRAA 1Y63A 4RCYA 3LXXA 1UAAA 3B6EA 1CJUC 3SHWA 3SE0A 3EG5A 1VG0B 1XEWX 3NWJA 2QRNA 2FSFA 3KDSE 1XD9A 1II8A 4ON9A 4GNKA 3ADKA 1DADA 4RVCA 4JBXA 4Q9LA 2QPAA 4EJSB 4LI0A 2A7QA 3I73A 2REOA 2XJ4A 3VMFA 3BIFA 3U4QB 4JLAA 2IWRA 3T12A 3VFDA 4CDGA 4IW3B 3EPKA 1GL9B 3ADDA 4PSKA 421PA 1VHTA 1HE8B 4XWOA 3I62A 4DSUA 3ZVMA 1YHNA 4LJ9A 2FOLA 4MQBA 4TL9A 1EWRA 4QJ3A 1I2MA 2QP4A 2QPTA 1E0JA 3TSZA 3GLFA 4TYPA 4DT1A 4OJKA 4US0R 4ARZA 4DJTA 1CJVC 5L3SB 1UKZA 3MLEA 5KSOA 3AQ4A 4IDQA 1ZCAA 4MDFA 3GLFE 2XOKD 1X1SA 4UXIA 3VHLB 1IM2A 4QGFA 4LV8B 5FTLA 1ZM9A 4I1OA 3OEHA 5DIFA 1FUUA 2WZQA 4X8MA 1G8GA 2WKQA 4M4SA 2D2FA 2ORWA 3CB4A 3LVRE 4UNQA 2PX3A 1ZU4A 3SEAA 3Q3JB 3ZZTA 1E0SA 2YVUA 4JYBA 3KXIA 2Z4SA 3G0HA 1D2NA 3AH8A 3DO6A 4C9BA 4MUAA 2ZUDA 5JCZA 1U94A 4YONB 3VHXA 4BFXA 2FEMA 3GFOA 4HZUB 4P4UA 1FL9A 3RS2A 3EWAA 5HCNA 2WWYA 221PA 1W4BA 4KHZA 2QMHA 2OXRA 1I2DA 1ZD1A 4EQ6A 1TAGA 4NP6A 2NO1A 2IWHA 3C41J 1XTKA 3CF0A 3QPVA 1N6HA 2ZRKA 4EDHA 4TMTA 1ZMXA 4Q21A 2ZJ8A 3THXA 2ZE6A 4PFSA 4HB2A 3WBKA 4KSBA 2VF7A 2RGEA 3QBVA 1CULC 3V4RA 3WP1B 5L3QA 1YZUA 1R4AA 1KDPA 4Q9JA 4KLNA 1DAIA 2C9OA 2B21A 3Q7QA 1NG1A 1GSIA 2ZSAA 2ZITA 1QVAA 2QTVB 3QPUA 4UKDA 5H1YA 3R9IA 1TUEA 1AK2A 1NL3A 5E3HA 3NEJA 2J0UB 4D4JA 1Z29A 4IXMA 3FMPB 4B35A 2QT0A 3KTAA 4WZBE 1G3IA 1XD2A 1R8QA 1HH4A 2VRWA 4CT5A 1X8JA 3B7GA 1CR0A 2ZAOA 3CNNA 4LJ6A 3B85A 1JXOA 2BMDA 3SBDA 1KDRA 1TMKA 3BBPA 4JZKA 4F4IA 5LB4A 1BOFA 3L0OA 3QKSA 2YWFA 4F93B 1Z8FA 2HV8A 5FL7A 4A8JC 1E1QD 2ZJYA 5G40A 3EZ2A 1Y3AA 2JLWA 2BBTA 2GZAA 1E4VA 3IEVA 3WYAA 5GJCA 2A9KA 4XD7D 2EFDB 4B3BA 4A8JA 1F60A 1MO5A 5D3MA 3UKDA 1TEVA 2ZRJA 1QHSA 4GOJA 4OI0A 2PEZA 4NYMQ 2KBFA 2B92A 5LBIA 4NYMR 2BV3A 3QVUA 3CF2A 2IUUA 1E3MA 2H8KA 1CF4A 4QGGA 2BEJA 3LY5A 3BOSA 1ZUNB 2OCBA 4KI0A 2IYQA 2HUPA 1G7TA 1E2NA 4TL7A 4LJ7A 1Q12A 2HDNB 3IIMA 2EFCB 2QPOA 1Z0AA 2GZHA 1DAFA 3P1JA 4Q1DA 3TJZA 3U7GA 4X8HA 2H57A 4PSAA 2J45A 2AR7A 4POAA 3SI7A 2ERYA 3UATA 3ASYA 4K8OA 4B47A 2IEYA 2F1HA 1M1YE 3B1VA 1P5ZB 2WWHA 5E7JA 4K46A 4W7SA 3DZDA 4A82A 1G21E 1XTQA 2P0EA 2IF0A 4A0FA 3VNUA 2B8WA 3A36A 4A4DA 1XJCA 4LBYA 4HB4A 1WE2A 2OFOA 4EPYA 2AXNA 3AF3A 5LB2A 1OB5A 4YMWA 1IXZA 3PUZA 3R8FA 2V4ZA 3W6NA 3ZZ0A 3CX6A 2NO7A 3EXAA 2J7PA 1ZUHA 2ASEA 3K9HA 2WAXA 4HB0A 4DCUA 2AX4A 1U99A 1EFRD 2QTHA 5FTJA 4XVUA 1R0WA 2ZI4A 1KIMA 4YC7A 4I1SA 1IN5A 4PZZA 2X1VA 3QXCA 2FJUA 4FMCF 1UBFA 4JL8A 5TY0A 4AK9A 1SGWA 3WYFA 1X1RA 1IN4A 3CPHA 5J5CA 3NHBA 1HURA 3BB4A 1DARA 5FBQB 1W4RA 1I4LD 3Q85A 4FN5A 5JSZB 4QGHA 5DISB 1YR6A 4EFNA 4ZIRB 4AYTA 3U5ZB 2ZSBA 3WRXC 4LV6A 4BFYA 4ILEA 2DWPA 1SVKA 2RCNA 4PANA 1AKYA 3NH6A 2OCPA 3CR8A 4GT1A 4LYAA 1DOAA 4G5RA 1JR3D 1SQ5A 4Q4AB 4DLXA 4Z54A 4DDWA 1N6IA 2JIZA 3AVQA 2D62A 4E5UA 2C9CA 1P6XA 4CIDA 2BM1A 1BYUA 4WIAA 2QBYB 2AXPA 2QTFA 3IO5A 4JKIA 3WNCA 4B3XA 1HEIA 2BM0A 5G3ZA 3I8SA 1PUIA 4DIDA 2WWXA 1Z3IX 2AKYA 4LYHA 1RRPA 1JXMA 2WHXA 5TARA 2ZREA 3LWNA 2ZJZA 3SJZA 3VQTA 5L3RA 2W2TA 2O8FB 4PPFA 2FFBA 3SYKA 5IHPA 1ZC3A 3OAAA 1WF3A 3P26A 5JWRA 2D2EA 3CNOA 3I5XA 4U5XA 1Q44A 2J7KA 2IS4A 3LLUA 4OQLA 4ERNA 1IBRA 4PO1A 2ZRBA 1RW4A 4HYYA 5B30A 4KFTA 4YDSA 4C0AC 1F2UB 4KBGA 2G0TA 2QE7A 2V1UA 1JBKA 2XITA 2DWOA 5DO9A 2CCKA 5FOUA 1QDEA 2FGKA 1D9ZA 4QBFA 3U3RA 2HF8A 2FF7A 4II7A 3DZ8A 3OIWA 3K9LA 1U81A 1GRQA 1TU3A 4WZ6A 3SS8A 3W9YA 3HWSA 1XTRA 3KQKA 2FX3A 4ZKEA 3FDIA 1NLFA 1C4OA 3RABA 4Q19A 4PHGA 4BASA 4ZDIA 4JSYA 1DAEA 2DPXA 4PC6A 2O8EB 5GJBA 2CK3D 5CJPA 4O2RA 2BBWA 3L82B 1NF3A 4JSTA 3RAPR 1W47A 4DCTA 2QORA 2GJAA 3MGCA 4ZO4A 5FPSA 5K8IA 4FW9A 4YMUA 2PT5A 4RD3A 3U2QA 4FCVA 5EE3A 3B1WA 1NN3A 4A6XA 2FE4A 3AF0A 4QM6A 3CO5A 3MAAC 3AV0B 3VKWA 4OHVA 3LD9A 4TYNA 3LRPA 3RANA 5JRZA 1P2SA 2IC5A 4LSGA 4URZR 3NBZC 1XFAA 2Q21A 2DB3A 1AS0A 5GVSA 1KY2A 3EZ9A 3KKMA 2QSYA 3F5FA 2JLSA 1W36D 3WYGA 3X1ZA 4WW0A 1YR9A 3IO3A 2R44A 4PAQA 3S1AA 4N3NA 4PC1A 4CEIB 1JEEA 4A0HA 3FMIA 4E09A 4B3CA 2RHDA 1HQYE 4FWTA 2ATXA 2GF0A 2IUSA 1A2KC 1COWA 4L9SA 4ITRC 3WRYC 2HT1A 4RD6A 5B57C 1YZKA 3X1YA 1Z0KA 5FTKA 5HE9A 5AK0A 1DTSA 5C4MA 1K5DA 3UMFA 3J81k 3KXLA 4IRUB 1M6NA 1ESMA 3Q5DA 2CCGA 3FTQA 2H1LA 3LLMA 4BEJA 1XTIA 1Z0DA 1GKUB 4EPVA 4R98A 1G41A 2OLKA 2YWGA 3P32A 4BRWA 3OFND 4D81A 1J90A 1AM4D 1W49A 4RD1A 1G8YA 4GZLA 4TYQA 3NBFA 1OXSC 2YC2C 4DLUA 3SYLA 5FL3A 2HCJB 1G18A 1YZGA 1KZ7B 2F43B 1R7RA 2OXCA 5FBRB 3IKJA 3U44A 1ONBA 3TGPA 1AZTA 3WMFA 4Q7KA 4BFTA 3BB1A 2VTKA 3A4LA 2I1QA 2MSEB 2HEIA 4FCWA 1M2OB 3B9PA 2BCGY 2R9VA 4QJ5A 2ANBA 4PPGA 4V0LA 5IRCD 2IYSA 5DN6D 3IPXA 1XCGB 2CMKA 2IS6A 2JJ1D 4BLOA 1W0KD 4M1SA 1G9XA 4HB3A 1OXTA 2GEVA 5CYPA 1NBMA 3ZQ6A 2ZUCA 1OT3A 2EWWA 3EC1A 1G7RA 2I1VB 4PC7A 5EE9A 5FPYA 2JLVA 4DBLC 4V02A 5FOTA 2Z5FA 4BZQA 5EE1A 4OJQA 4RKEA 1NBME 5EP3A 5BQ5A 1IXSB 2QSZA 4Q4HB 1OFTA 4NTZA 3NIBA 2FZLA 4UJ3A 2B7CA 3C8UA 1GKYA 3WNBA 5JZVA 2V54A 4FINA 1U2RA 4BFWA 4ESHA 3CF6R 3FVQA 4D80A 5DI3A 3O47A 2ORVA 2XX3A 3P4YA 5UKDA 4DHEA 4MGIR 4PSVA 2IXGA 2Y8EA 3TH5A 1TF5A 2G3YA 4NYJR 5HE8A 1W4CA 1KMHB 2A78A 3FYHA 3PQCA 2CHVA 3QQ5A 3QPWA 3RLFA 1DG3A 3UMRA 1RPZA 3UANA 1TEXA 1KI8A 2G1KA 3NDPA 4XTRA 3HPQA 1OKKA 4B34A 4OK3A
chains in the Genus database with same CATH superfamily
4Q1CA 3JYPA 2JCSA 3D3JA 3UGKA 5HRUA 2H00A 4D9BA 1MABA 2QMUA 2E9SA 4CKBB 4UVEA 4BMYA 4S3MA 4JR2A 3NBYC 4OGFA 3DG9A 3H7AA 1B8UA 2C31A 2QI9F 3C16C 4RFSB 1EGAA 5FLXA 3C15C 3O1HB 4E51A 4UBIA 4WUTA 1X3LA 4G01B 4M0UA 4HO1X 4JODA 4ZC1A 1FDIA 3VH4A 1SKAA 2AS0A 1QQ6A 4JKOA 4EPXA 4BRUA 5KJFA 4ER0A 1KVSA 2JEOA 2OZLA 2QWXA 3IQHX 1BEZA 4QPCA 1UFVA 1ICEA 4XAQA 4CDRA 3ENQA 5I9TA 4I4NA 5I9NA 5JJIA 3ROTA 3TN7A 1Y6QA 1XA0A 1C1YA 1UM8A 4NCNA 2O06A 4P8RA 4RSGA 4DWOA 2E5WA 4Q9AA 1RP7A 1LY1A 2HGZA 1ZVMA 4JXKA 5TVKA 2Y0BA 4PGGA 3WWEA 2CHQA 5CBPA 4OFWA 3ER8A 2Q2NA 4OHZA 3QV2A 1ZRHA 2DUMA 3TO5A 1EH5A 3HWRA 4LMBA 1ONSA 4ER5A 4XH9B 3H5AA 3HWX1 4BDTA 1Z36A 3E1KA 2D3TA 1RMYA 2QUZA 5IXJA 5CDFE 4QPZA 1KC1A 4GLJA 4QG7A 2CNWA 3DEYX 3EFOA 3GN2A 1OOEA 3Q6NA 4V2UA 4ZVPA 2GM9A 4I6EA 2AG1A 5CLQA 2NTNA 5HCIA 1NXVA 3QF7A 2TS1A 1FUYB 1P73A 4XCXA 4DMFA 1O87A 2Q4BA 1HKHA 4FDUA 1Z3CA 3H86A 4TLCA 4UMDA 3CUSA 2A4KA 4HX2A 5FUMA 1J8MF 2EDCA 1HORA 4JT9A 2E1PA 2IYZA 2VTVA 3L4SO 4UU0A 5G0WA 3KK0A 3P2EA 5BNIA 2YHIA 4MV5A 4ZQHA 2VL7A 4K81B 1GKLA 1YL6A 1JQAA 3HJNA 4MO2A 3UMYA 4A27A 2JDID 1QAMA 4LSMA 3JU3A 3ROEA 1VYUA 2AXEA 4UDNA 4E1BA 5GIPE 2JFZA 1X80A 1USIA 1XO1A 5F5XA 3RE1A 3TJMA 2CUKA 1DTWA 1VJDA 2WSSA 4X3OA 4EEKA 1W6RA 3AUKA 1OFHA 3FNBA 3KFVA 1N2ZA 4KQJA 1BHJA 1NZJA 1E89A 4JLVA 4QIHA 1KR2A 5EE5B 5SV2A 2JB9A 3LCUA 3NGLA 3U7IA 4DLKA 4J1SA 3A4TA 3BFXA 4M60A 4YJ3B 3ROXA 1N33B 1TAHA 3JWEA 4B2YA 4CGYA 4QJBA 1U2QA 4TT3A 1RNLA 3GVIA 4CMHA 2FZKA 2H1IA 4OHXA 4IFEA 4XDHA 1KFCB 4XQ0A 5BN4B 3I52A 3SY8A 4F06A 4L9RA 5LQCA 4P81A 5EXSA 4KVGA 3KXKA 3JATB 3DOHA 3F7TA 3A10A 3FUWA 5DOZA 1U1IA 1KO7A 1P9OA 1BW9B 3RODA 3GLGA 4HVLA 2JAXA 1WABA 5J2UA 2ISCA 4RUKA 1I3MA 5JISA 3QLTA 4DIBA 3HU3A 5AVUA 3DE5X 2CXOA 2FWMX 4UBNA 3GAZA 1D2RA 1JJVA 3AI2A 3Q3HA 1P91A 4EKNB 3C5HA 1P62B 1YGYA 2FSGA 2JAHA 2YOFA 4MCHA 1E2PA 1RQ2A 2F55A 4PAOA 5MFZA 2AW5A 4F46A 4JL5A 3TMAA 1AXGA 1CUAA 2C04A 5SICE 1UK6A 5KC8A 1UT6A 3HB7A 2J3KA 2VUUA 1WDTA 2B94A 1AN0A 3LS2A 1T9HA 3MD0A 4RPLA 4XYBA 3CMCO 2P2SA 4ZOLB 5GINE 1PK7A 2O8DA 3GRRA 4QWWA 1SXJE 2E21A 4G4SP 2YIMA 2ZT6A 3X0DA 2R6AA 4ZO8A 4BV8A 3L79A 4C4AA 2Z8YA 1LBQA 3CUVA 2A57A 1VKRA 4H1UA 4D45A 3W4IA 1W581 5A02A 2P35A 3ZLTA 2AQIA 1QRSA 4FZ3A 1JHAA 3HMKA 5I7AA 4H0FA 3HKCA 4J07A 3K0FA 2AHRA 2ERXA 1X9IA 1O8CA 3CR3C 3PPWA 3ZWYA 1PZNA 1XAJA 4ITUA 3AG6A 4OHBA 3AKYA 4ZQIA 3L49A 1T35A 2NTJA 2WOJA 3CW9A 2EL9A 3HBMA 3ICOA 4TRNA 4E0BA 3A9VA 1T3ZA 4F91B 3K5HA 2ZI9A 3L8EA 2KMLA 3QU9A 4GKKB 3OBBA 5JFOA 1XDUA 5ALVA 1U11A 2C7QA 1Z5VA 4LOKA 4D57A 4PAGA 4XM1A 3ZLUA 5CA1A 2E4UA 4MI6A 1WSDA 3CPSA 5A7FA 4AY4A 2O8BA 2XKKA 1MEEA 4EA8A 2VDOB 2XAUA 5JARA 3N1UA 3EVFA 1YRYE 1T3HA 3LFUA 5EERA 3BRSA 3JQ7B 4E12A 2W43A 4R1TA 5CX4A 1NBAA 3QHQA 3WAJA 2Q7DA 4LYGA 3TDNA 4CLRB 3K6SA 1JB9A 5FWYA 3V8MA 1A9PA 1P7VA 4H77A 5A4MS 5FFFA 1OHHD 2NP6A 3ZK7A 3DEIA 3P9PA 4MUFA 3WSWA 1KI3A 1SZJG 2LBPA 2Q0XA 4JP1A 1B7GO 3GARA 3LT0A 2P9BA 3PIRA 2DU8A 4GEKA 2X5XA 1E3EA 5C51B 2B34A 2WU8A 4OBWA 2FXVA 3OY2A 1DRVA 4HQ0A 4ZCIA 3COVA 3OZGA 2ZUWA 3EF1A 1YU6A 2AMJA 2QQ5A 2QW0X 3AHGA 4IJUA 4MITA 4E08A 2C2OA 2JGNA 2FMTA 3KPYA 1EJBA 3PE6A 3IJPA 3EH1A 3HCBA 2CLEB 4HGRA 3QX3A 1KYIA 5L51A 2YYZA 4D8UA 3D0QA 4IMPA 2HZ7A 2VP6A 4J16A 4XSGA 3U3ZA 3QI2A 1O0SA 1XFDA 3WQQA 3AL2A 1I6KA 2GCOB 3SKXA 5CB4A 2QTNA 3D6VA 1KGDA 4RULA 5THKA 1JR2A 2HBYA 4IGEA 3VSEA 4Y7DA 2WVHA 3HDTA 4FCCA 4KEAA 3B1ZA 3JASA 3VVLA 2JD0A 4IF6A 1VDZA 3Q5EA 4DBVO 2HB6A 5JNUA 1NPYA 2XODA 3Q7PA 1T5BA 3NNSA 4XX1A 3WMRA 1UDRA 2J6BA 5MF6A 3L6DA 5JROA 4AF8A 5KO2A 1ZZGA 4WCFB 3B51X 1NQAO 5BSUA 3WP0A 3NC4A 4Y67A 2IPOA 3LQYA 4G81A 3DBHA 4L95C 4YJ2B 1CFZA 1OROA 4LPKA 1NJ1A 1WW8A 1ZL0A 2ADMA 5LDDC 5AJZA 4HFJA 5EJ8A 1V8BA 4QBHA 4KUEA 1GNVA 1JE1A 1E1MA 2OP1A 5CVCA 3OTWA 2XBUA 2NXWA 3GLTA 3N7AA 1Y7PA 1Z5WA 3K8YA 1KKLA 1ADGA 2MMCA 2ZE5A 4COKA 4EB8A 5LXTA 3WWYA 4I1UA 1N3LA 1ZJ6A 5JG7A 2XDWA 4ARSA 2OHHA 1KSJA 3WICA 2PFKA 4OB6A 1SA0B 3BXZA 1V1JA 2RAUA 4Q48A 4QNRA 2O2XA 2DR0A 1WLYA 4K3VA 4K0RA 2VP4A 3GF4A 1U0HC 2GD0A 1F5SA 2G04A 2Y4OA 2O6LA 1CW2B 5ESRA 1JMKC 5I7VA 2C99A 1KI9A 4ISBA 2BUBA 4JVMA 1IIRA 3L01A 2H5EA 2HADA 1NN5A 5AOBA 1VJRA 1BXRB 2ONZA 3L6BA 3OZIA 4JQZA 4FGUA 2GK4A 1VHLA 2CLKB 2VP2A 2PSSA 1J5PA 4KGDA 5YASA 3C8MA 3F7NA 2AI3A 3LC2O 2YY7A 3GU3A 4DA4A 3L06A 2OKGA 3OFSA 3QU7A 4TOIA 2QN3A 1VMEA 1MFZA 4IUCS 5GJWC 1B6TA 3BICA 3LWZA 3NHKA 4X7MA 1NVEA 5AJTA 5JQGB 5LJIA 1F2TA 5LYJA 3R23A 2PZEA 2L2QA 5T6MA 5B2FA 4J0JA 2CFSA 3NBQA 3AR3A 2PX0A 4YRMA 4LDRA 5AKHA 3OIDA 2GJSA 1RRCA 2IYWA 3REFA 3K6KA 1FUKA 3UUGA 1RAIA 3EWIA 1UDCA 5C7LO 3STWA 2NTVA 4I50B 2IXTA 1Y33E 3C1OA 3O9VA 1ECFA 3O8BA 4JJ4A 3BRWD 1B0AA 4CKXA 1XCOA 3G3EA 2ZFUA 5C8YB 1QHFA 3T4UA 1JPUA 3LY7A 4HVTA 3VZRA 4KXMA 5ARCA 8ATCA 4POOA 1D6NA 3HFJA 3R8CA 4D0RA 1GTRA 3KTDA 5JNTA 4X3CA 3GGPA 4YPOA 5BN3B 1I2AA 3OHSX 2YJGA 1A1VA 1USVA 4M1TA 4H6WA 1UK7A 2ZU0C 4GX1A 4HDSB 3ZLBA 3R75A 3BJMA 2BZSA 1K4YA 3HA5A 1Y5IA 4PYJA 5K0CA 4YTEA 3G59A 4CZ2A 3T7DA 3NRBA 4M9QA 4DJJA 1Q7GA 4E5MA 3L7NA 3NG1A 2P2LA 4LRUA 1P0PA 2EFGA 2NAFA 5E9AA 1JVNA 4RD4A 2QAJA 1AXEA 2V3WA 1NDQA 3KQHA 1SIUA 3AM1A 1VIVA 3A9TA 3FYSA 3N8HA 3PE3A 2P9ZA 2R7MA 1XUOA 3CUWA 3NALA 4JLBA 4MWSA 4XB2A 1VG9B 4CT4B 4FR0A 1CR2A 4BVJA 2BJVA 5JR3A 4DR5B 3SR0A 1K1EA 2XMGA 1SG0A 1TADA 1E0KA 2OSVA 3QF4B 4MR8B 4AJ4A 4GYKA 4PC2A 2WP8J 1KARA 1NN1A 2KE5A 4YECA 1QHHB 3FI9A 3IAFA 5K0SA 1A5AB 4MK4A 5HA5A 2EP5A 1ZOSA 4QICA 3AHCA 3S5UA 1ZLYA 4AURA 1L7BA 1SRRA 1UIMA 4B87A 4EW2A 2N46A 1T1IA 2YZNA 4KBFA 4L08A 2OCGA 5E4YA 3ILYA 2A0FA 1U04A 2Y77A 1YVDA 4WXRA 3JALB 4YJGB 4L4YA 4NIMA 1PR1A 1R27A 1U8XX 2OQIA 4JUFA 1JI0A 2ZVQX 4MQUA 1AA6A 3LY9A 2QROA 4LNUA 1XPOA 3QUTA 2XMQA 3MS2A 4GE0A 4O08A 3U60B 3G17A 1XRPA 2GZ1A 4UNSA 4CMBA 1YZVA 1Q57A 1II8B 2QZZA 3PE4A 2GPAA 4RABA 2F6RA 2BHRA 4AULA 2VP9A 1ZD9A 1WXXA 3O38A 3V32A 3QW4B 4EGAA 4UFNA 4YT4A 1P29A 3D31A 1P0QA 1X8KA 5EP2A 3EPLA 4RFVA 3O8LA 1CJBA 2FFQA 1GZDA 3QW2A 1RQXA 4HXYA 4YXFA 4ALMA 5IN5A 5EJ6A 1RRMA 4L5CA 5JLJA 1YK1A 2DKNA 5AKXA 4CTNA 1U98A 1RRGA 2IELA 2PGDA 1E59A 3DE6X 2UZ3A 4HHEA 1FNNA 2IYAA 3CIOA 5CJ2A 2QVGA 3GFSA 5DN9A 5FPHA 3FBWA 1OBFO 3ECCA 3KX2A 4BNXA 1PWHA 1J8VA 3Q6IA 3ANLA 2ZAGA 3IRUA 2WU3A 4EKIA 1N77A 4C1NA 1MW8X 2B4AA 4JBHA 3CWQA 3IUYA 1U0RA 1YXMA 3F8WA 3NIDB 4HUQA 1T1GA 4YJHA 1MGPA 2PNFA 4J91A 3ZBUA 3PEWA 2E87A 4TMKA 4O8ZA 1GLVA 3RYTC 2X5OA 4JGBA 4Z1MD 1ODKA 2CF6A 3PXEA 1UBGA 4KTVE 1C30B 4O02B 2BYTA 5F73A 4IOLA 4MEBA 4K03A 3TS1A 4QXOA 2DTDA 3FUCA 4BO3A 3RRXA 3VHXB 4RHEA 3WLIA 1CUEA 3G5TA 3SZUA 2Y6VA 5E4FA 3LVQE 1R6BX 2AFHE 2ZE7A 4N03A 1Z15A 1RR6A 4K05A 3WJ2A 3Q87B 2G5CA 3PUJA 2Q9BA 4EELA 1OC2A 1CE8A 3EQ6A 4CMIB 5AIBA 2RKOA 5BSWA 2G09A 4ND6A 2HJ9A 4EMUA 1DAPA 3M5PA 3MT0A 2NO6A 4ARUA 4B71A 1JW9B 4DMKA 4KJXA 3JQQA 2ZT8A 3I9NA 1FU8A 5CVDA 3VV2A 1XQ9A 5AM3A 2J8ZA 4HC4A 1DKMA 2NO0A 2WAMA 2WLTA 5TEWA 5B2EA 3RYCB 2I4NA 3E22A 1YKSA 3HJCA 2CZQA 2KHZA 4KRFA 1NSYA 4BJ1A 2GGSA 2OVBA 4NDAA 1XZBA 5K4AA 1FLAA 1INLA 4INJA 3G0IA 4WZBB 5JW6A 3AYZB 1L7QA 1IDN1 1SBZA 2QQ0A 2GA8A 1Q91A 4LJYA 1T9DA 3ZWVA 4PNEA 4MHSA 3DVQX 3FPJA 4KLCA 4LJSA 1E4YA 3NI2A 2W5UA 3F6EX 1M5UA 4ZVOA 5ICSA 4MVJG 1HOTA 5GADl 4KQGA 1GNQA 2HMUA 2A0KA 2ETVA 4TLDA 4GOKA 3CYFA 2P9YA 2X0FA 3KNZA 4N5IX 3ZVRA 4DMGA 4P0PB 4R2XA 1LEHA 3JQBC 5EPEA 3CCFA 4IHJA 3G7UA 3FCOA 2H1RA 4B34A 3EPHA 3TPFA 1DIBA 2YTZA 1KZHA 3PHGA 4ZOBA 1RZVA 3QKSB 1E3LA 3D7SA 1KA9H 1UCFA 2OOSA 3D8UA 3FMOB 4O4LA 2O14A 4JUDX 3NBMA 5EKTA 3W5JA 1W19A 3WMWA 2AT1A 3MYYA 1VIDA 1ISIA 3JQBA 2YY6A 5DBOA 4D56A 2OWEA 4F6LA 4YIHA 3IUSA 5TE9A 2HFJA 2IYNA 3FLEA 1A97A 2OCDA 4CKBA 3BHJA 1ECCA 4BMVA 1MZPA 5AICA 1Z0FA 3SDZA 3RU7A 3DMNA 2CUZA 3KV3O 1OYYA 2XF8A 2YXDA 3MAGA 2XOXA 1NKVA 3BDAA 3WAKA 5ADUS 1ODSA 1BS2A 1YTLA 4MINA 4X6XA 3E7FA 4KIUA 2RGDA 3AUUA 3PS9A 2ZTLA 1KDZA 3V8EA 4D8XA 1UPAA 1VPLA 1KSHA 1I30A 4EPWA 5JSKA 3RTGA 3PC4A 5EKSA 4EABA 1OIXA 3KJQA 3W5AA 3T3IA 2QJOA 5D3KA 1A4XA 2MYUA 2ZRDA 1DT5A 2JJ2A 5KJ6A 3SN6A 2RGGA 3OT1A 2UV8A 4OVKA 3WDMA 2WQ6A 3R5KA 2J0SA 3CBGA 3X1KA 2DYKA 4DQ0A 1GGFA 1ZX1A 3OU6A 4K2AA 4NZPA 3WGTA 1SOUA 2H7CA 4Y9TA 2PUAA 2EG9A 2JLYA 1NLZA 3P4XA 3QEMA 3KJZA 1PJ2A 1KOFA 4UCWA 1L4FA 2QTCA 2IT1A 2PMFA 2GFIA 3Q3EA 1W85A 5FLEX 2ST1A 3KKOA 3AVOA 1JF8A 3ZZNA 3IL2A 4FHZA 1Q3TA 5EZYF 3M3DA 3BWXA 3KOMA 3UH1A 8ABPA 5IT9A 1SUEA 2OK8A 3RUCA 1OZFA 1NNUA 3I6YA 2QN1A 3ITKA 4P2BA 4PHTA 4UBJA 4D3ZA 3GQBA 2J3QA 2JLBA 1W8DA 1E64A 5JBQA 1ACJA 4PR0A 3WA7A 1Y5NA 2YIVX 3FB4A 3QNUA 1KI2A 5FUWA 3RYIA 3V4VB 1TAUA 2AG5A 2Y1XA 3IEUA 4MIOA 3GGOA 3ZHUA 1TYDE 1YVUA 1OXKB 2QRJA 3QIAA 4H7JA 4BJHB 5E1DA 1CUZA 2EFJA 2JANA 5AUOB 5I4BA 3SHQA 1QH9A 2GYVA 1S0UA 3FUXA 4R1OA 3F96A 2OEPA 3ZLVA 4JCCA 1TTPB 3OPQA 2UUPA 3IQDB 3HEMA 3L1JA 2J07A 1EXDA 5CW2A 4NRDA 1B15A 3PEUA 4R05A 1QJ4A 2I7XA 3BCUA 2R7NA 3HKDA 1Z8NA 3PIDA 5DNVA 3ZZMA 4EO4A 5IBQA 1BJRE 3KOOA 4I46A 5KKCA 2OZVA 1JECA 4Y0NA 1K63A 1JDPA 3C3BA 3OTGA 4RSMA 1XVUA 2YZGA 5CDGA 2Y1EA 3B13B 1NUSA 5EAIA 2Q45A 3SQDA 4LBZA 1ULHA 5LMNB 1OFGA 1EUDA 3A9CA 1MAHA 3MCTA 2FTKE 4D2IA 1QRRA 1J9EA 3ESBA 4MPRA 2TSYB 4TS9A 1ULSA 2VDVE 1X77A 4IIXA 1WV0A 1M2VB 1VLZA 3EZYA 3A1FA 1A5ZA 1R9NA 1J0EA 5CB0A 4MUYA 1RYHA 3ZZUA 4KG7A 3ZD7A 1QWOA 2CLOB 2FU5C 2Q4RA 5TPZA 1RJGA 1DCTA 1DLIA 3LXUX 1P6QA 1JDJA 3V80A 4J4HA 4QX6A 4CKYA 2NXCA 5FWNA 4IIGA 3ZHBA 4TQGA 2O4CA 3ES9A 3KSUA 2ZDHA 3B1KA 3DKPA 2QYTA 3PEEA 3FSGD 1N36B 1B0PA 1AB6A 1NTRA 3L8GA 3NHYA 4ALLA 3WOVA 4Y2JA 3FTPA 3PGXA 2I4LA 1HE2A 1PW5A 3Q41A 2CHEA 5DHPA 5K0LA 1XCBA 3F8TA 5K3SA 5LMUB 1DUVG 3FPSA 1QPGA 1QZUA 1NR7A 1YB4A 1ZK2A 3PFHA 4RA9A 1NW8A 1HE1C 5I45A 1EFPA 1PZXA 2BKAA 3I30X 3BTVA 4UM8B 4PCVA 4QM7A 1FNBA 1WZUA 4C7VA 4N3BA 1JJAA 2PU5A 4HSEA 5KX5A 1J99A 4HDMA 4MKFA 2WUEA 1JLLA 3R4CA 4NF2A 4QLAA 4XGRA 1JNYA 1VBKA 2WUGA 5DBIA 3E35A 3K53A 3B3QA 4PINA 4GICA 4X0EA 4G5HA 4JY7A 1G5QA 4AWBA 3KQOA 2WMNB 2IYUA 1CB0A 5KYTA 1E60A 5KWEA 3B7WA 4QZVA 4M0PA 2QSUA 9LDBA 1QXSA 3D0OA 3GRVA 1R5NA 3B6JA 4FGZA 5JMPA 4D6YA 1Y89A 1WUHS 4K9NA 4BO5A 1GAWA 1ORIA 2ZRIA 4KOAA 1HKUA 3UIEA 4HEHA 2I1WA 1T8YA 1B6RA 2QM7A 4B2PA 3K20A 1W4AA 3GCDA 3QEKA 5AKIA 3QBDA 4EY7A 2EHJA 4ZGBA 2HDHA 3D59A 2D1RA 1ISHA 1PQ4A 1V6CA 3M70A 3OF2A 4G4JA 3UJ8A 3GLIE 1DQZA 1QE3A 3H4VA 3K9BA 2YOHA 1SUWA 3KBBA 1VE1A 2YMMA 4FFLA 1A98A 3ND5A 2DBZA 2HRCA 4LJRA 1Z7BA 4XLTA 4B81A 3ZXXA 3BD9A 2GEDA 2W8ZA 3PR1A 1E5TA 3A27A 3AR7A 5FA5A 4Z9BA 4EA9A 5C0OE 1XMVA 2E4VA 3N7TA 4YQFA 4MJ3A 3IOYA 3M5WA 2VQ6A 1K9VF 2A9FA 4ZU1X 1LUAA 4YGYA 5KYUA 2AZMA 4NG5A 3TB4A 1E96A 1A7JA 1XZNA 1E9SA 1NBIA 3DR5A 4HWPA 1GQFA 4RX1A 1OA0A 1EEHA 2GBFA 1QIKA 3PC6A 4LXUA 4QTTB 2V6JA 4DARA 2BFCA 4DMCA 1M6VA 4C2UA 3AJDA 4XOUA 3DOCA 3WC4A 4F5ZA 2WY2D 3HNRA 5JD4A 4DV0B 5CD9A 1VKJA 3U4QA 2HL6A 4ENQA 3CTPA 2C00A 3COSA 1L3BA 1SNYA 4AZTA 1TIKA 2V8OA 2IX9A 2NAPA 5GONB 3WGKA 5I4KA 5ALTA 2OAGA 3GJRA 2CW5A 4GR4A 4KVAA 3P2OA 3RO7A 3L8YA 2Z08A 1EBBA 2GX6A 3TLKA 3ET5A 3JD1A 2PQ6A 5L40A 1GJRA 2G9VA 2H1VA 4CM5A 4TUYF 3NZEA 4LNAA 1BNCA 1Z0SA 2IOHA 2Q2QA 3E23A 1ZN2A 5AH0A 4H31A 3IVRA 3V1UA 4AP5A 1HK7A 4YRAA 2I6TA 4MB0A 1NP3A 5J23A 2WK1A 1UT5A 3WYEA 1LLFA 1GSAA 3RYHA 4QVIA 4P7GA 3OQNA 2NYRA 1P4HA 1PEKE 3EPJA 5C1IA 5L3VA 2RGCA 2OENG 3O3OB 4LJ4A 3NJ4A 4PX9A 3H2GA 3HG7A 1D0SA 5CNIA 3V9PA 3FKSD 1ZZEA 2CN1A 4LCBA 4AUEA 5LKAA 2OAQ1 3HNOA 1DIAA 5A05A 1KE2A 1QYRA 5E0OA 4B6EA 1C0EA 2W70A 4AUMA 4LHXA 3TUZC 3I62A 3OOWA 4PONA 1YE8A 5C37A 5J4HA 1XTTA 2UUCB 1XZIA 4L4UA 2JFXA 4OM8A 1KKMA 2H2FA 3S2IA 5EXDA 1CT9A 3SFTA 3VZCA 3L0SA 1QK4A 3AT1A 2J9XB 1O96B 4HAVA 4IHAA 1ML3A 1OD6A 2PWBA 3NVMB 5LDGA 3UAZA 4H1WA 3K4QA 5KWJA 1XQYA 4L8VA 5LQNA 4MI1A 3VTAA 3UG7A 3KQNA 1I4DD 5L4SA 2XAAA 3EODA 1UBMS 4Q1FA 1NJGA 1BXRA 3EQ7A 5CFQA 2XH8A 2P68A 1U1FA 1W5SA 3TRDA 2IEAA 1YACA 2FPRA 2V7XA 3NQ41 1H6BA 1VHDA 1PQPA 1V1MA 2YFHA 1U4OA 2JI6A 1XHLA 1MOZA 2FI1A 1P1RA 3BZWA 5AK5A 1NFQA 2G88A 5AXCA 3CNLA 3TL2A 3CXUA 1GRNA 3F74A 2J0UA 4XWWA 1XC7A 1ZQ1A 3ZKWB 2ZJ4A 1ODLA 1K89A 1D2AA 4KQFA 3PDCA 5KQGA 2BEKA 1KVRA 1XRSB 4E3ZA 1KO5A 4XR9A 2CXNA 1GZ7A 3CM0A 4EJMA 5KWIA 2A5LA 4WD3A 3GJXC 3OEEA 1NVKA 5LNK6 2C9YA 2IXDA 1E1NA 1KPHA 3QVXA 4WV3A 2ZTMA 3DF7A 2HZBA 5PGMA 4BQQA 2XNCA 3VZDA 3G2NA 1JSCA 1YR3A 2QR5A 3I5YA 5B6PA 1E32A 1P18A 1U7WA 4OOEA 4R8LA 1JXQA 1OGIA 4ZOEA 5BYBA 1U0FA 3TFQA 2VDWA 5C53B 3KJEA 1FDWA 2LCFA 5DI3B 5HE8A 1BVYF 5IVPA 3DHEA 3IJEB 4IZHA 2EW2A 3T1OA 2FJPA 5F3WB 2XNDA 4IV0A 4PLYA 1RC8A 2WFLB 1QE0A 3B20A 2QRVA 1A04A 3RIEA 1ZXBA 2BGWA 4O0LA 2F7SA 3DYBA 5BSRA 1I7PA 4Q02A 4M9ZA 1NW6A 3U81A 1F7UA 4G5YA 5B1SA 2CD9A 3KU4A 5FBWB 3GVHA 4Z5XA 2O52A 2OPBA 3IPAA 3IH5A 4FLEA 4BP9A 3HU2A 1ZI6A 1N5DA 1PAUA 2B7BA 2ES4A 4HWSA 2P0YA 1LS1A 3LIPA 4JL6A 5IFLA 1PFVA 3BX1A 2F3UA 3CRQA 1J2TA 1V5EA 2ODTX 4MR8A 5TC4A 4F2WA 5IF9A 5JNLA 1WX1A 3IMEA 1KZ1A 2R6GA 2J4DA 3ZC3A 4NZ9A 3QXGA 4QOIA 1VPEA 4HN2A 1EX1A 5BYJA 3GHHA 3FVTA 2EEZA 5JXIA 5MGNA 4I4TF 2V7WA 4OHUA 3RBAA 3SIWA 4J0QA 3W5CA 3WAGA 3Q1KA 1G20E 3LUAA 4C08A 4UNIA 3ZBQA 1C3LA 5EMKA 3UJ9A 3N2ZB 3IDFA 2EFHB 4NYIR 4RD0A 4WASA 2BEUB 3TVDA 1XZMA 4QG3A 4K3UA 3JVEA 4GI5A 1MJHA 3R7WB 1KI6B 4OQQA 4YMTA 5DSTA 3IODA 5AOAA 5MN5A 1YS4A 3DAPA 3QOWA 4UHEA 3AERB 1UPXA 2RGWA 3RSZA 1QONA 4Y2UA 2FPPA 1S8OA 2WJIA 3MOGA 3R77A 5DGXA 3PFWO 3RVBA 3SJBA 2C1EA 2DPGA 2GERA 1MC8A 4IIUA 3T3DA 2H2GA 4MYUA 3ZU6A 1ULBA 1TVCA 2MOKA 1UEXC 3LHFA 1T34A 1YB2A 1IZ8A 4AMYA 4DLZA 4XI9A 1HRDA 4RTKA 1HEYA 2CXSA 1JZQA 2J67A 1PL0A 1US8B 4WNIA 3V34A 1H2RS 1M2WA 5IJ9A 3OQOA 1BHQ1 4F4DA 3VDXA 2M32A 5IZCC 2OGUA 5KHLB 1JEJA 2I54A 1PT7A 3KZMA 3NETA 4YJFA 4BP8A 4CF3A 3EN0A 1XA4A 4EUNA 3VJRA 3AOEC 5ETJA 4TYMA 4HQFA 1A9XA 1QZTA 4H3VA 1EQUA 3EVBA 2IGTA 3MGAA 1YNOA 5IZCA 1QTRA 2DHDA 4DA0A 4RE6A 4R1PA 5KDLA 1YS6A 2IYYA 3ABSB 1AX9A 1S2DA 1Q0UA 4C87A 3ZDRA 3AOEA 3DM9B 1BX0A 4HAOA 3KWJA 2RDMA 2RBGA 2V7GA 3M0EA 4I1RA 3U31A 4G41A 4NCJA 1GTG1 1YQEA 4AMGA 2IV7A 2NPIA 5IJAA 2OZEA 5FH9A 3RQSA 3UUWA 1B3RA 1QVZA 4UHJA 1QVRA 3TOVA 1P5JA 3NP9A 4FEEA 3QXHA 5B5SA 3HU1A 3SKVA 4A10A 4CCYB 1MXHA 1HT0A 2HF7A 3CBQA 5BT9A 1GIAA 5HUJA 3F0TA 1YIOA 1P33A 2PKRA 3NBUA 4WVFA 2OD2A 1SY7A 3BORA 3T6KA 2J6IA 1J97A 5KNDA 3A1UA 1WULS 1SBHA 6ADHA 2F90A 1XMJA 3LW8A 4YP7A 3M8KA 4MR7B 1Z13A 2L18A 5DTJA 4JVNA 4WGGA 1DAKA 1MVLA 4IHQA 5TR9A 2D7DA 1Y6JA 1FRFS 4IJKA 1VCMA 1G1AA 2HCBA 3VR5H 4CM4B 2DUWA 3HJHA 3RADC 3I32A 2IHNA 2QV0A 1NP7A 1MIOA 2OCYC 1J9ZA 2FB9A 2WJZB 2DGDA 1UKVY 4J1NA 3TRHA 1U7PA 4LF7B 2NQTA 1BMTA 1CQPA 1G8AA 1ZAKA 2XOKA 3AR2A 3EIFA 4FE3A 5GPBA 4YUVA 5I5GA 3L92A 4D9MA 1MOSA 1SVOA 2VH1A 3VYSB 5B37A 4CM1A 4D3SA 1NDHA 2OD7A 4QPNA 2VWPA 1MOQA 4QREA 4DQLA 4D8VA 1RZ3A 3O2JA 1XTSA 3EGXA 4XDGA 1KBQA 1P61B 1TLLA 5EINA 2ZZMA 1Y5RA 5LYJF 4OI2A 4FD2A 1M2JA 2IYFA 2JBAB 3EGVA 1SOVA 4MI3A 4EJ2A 1F17A 2C59A 4LSWA 2OILA 4MWOA 1O97C 2WJJA 2JF0A 1W5FA 2AOUA 2M6LA 1AUVA 4OSEA 1U90A 4BO0A 3BN3A 3MJSA 3NTLA 4LBWA 2D59A 4RO0A 4QQKA 3AKDA 3BMNA 4WNYA 4JEHA 5AW9A 2VDUE 1XJ5A 4DA6A 5J1SB 3DE0X 1YRBA 3A9RA 3OE1A 2GYYA 3ORQA 3IVGA 3TOSA 3RTEA 2J7PD 5BV7A 4W6ZA 1G3QA 5TQ0A 4Z0PA 5JEDA 3VPHA 2AL7A 3I23A 5ERXA 1YD7A 1M2EA 3ENVA 1F20A 4PG7A 3WOHA 4B6FA 1N2CE 4TVOA 4IMIB 2R7LA 1YQ9A 5JTTA 2PS9A 1V71A 1XYYA 1Z4NA 3AFNA 4AKSA 1HA3A 3U3MA 1P5RA 2C98A 5IC6A 1H4QA 3U7FB 1WVMA 4C5CA 1U63A 2H2DA 2VXYA 2WDZA 2JGEA 4M53A 4H7HA 2L19A 3MTGA 5BVHA 3OZWA 4CRWB 1NU6A 1SMKA 1W93A 1YE5A 3L2OB 3NYWA 4P3PA 4D0SA 5JYEA 4G84A 4EKDA 4R7ZA 1GT6A 1TMYA 4G23A 1ZA1A 2PS0A 4FJ1A 1TUBB 2JJMA 5DCLA 4KVZA 5DNYB 1GGKA 4WZAA 4OA8A 2AIRA 2C4UA 1J21A 3RVDA 3WQSB 1G3RA 5DHTA 4PM4A 3GGGA 1VTKA 4V3CA 5TLSA 1P2FA 1SZDA 4LYFA 1DGQA 2DJIA 4FEAA 4R8SA 4PO3X 3RVOA 4DR1B 3I0MA 4OQFA 2ZYHA 3SD7A 3QE9Y 4Q1BA 4B33A 3WBBA 3HFSA 2QGNA 4Q34A 2V4MA 4PICA 1U2PA 2R8RA 4RXUA 4PLGA 4G9BA 4E88A 1KAHA 2V7QA 1IWPB 1JN0A 2HKIA 5KVSA 3UJDA 1D7OA 3UJAA 4OJTA 1KDOA 4U2DA 1OE0A 3HDGA 1BU5A 2CZCA 2HQ1A 2CVHA 3FCCA 4MVJI 1FFSA 3R9WA 1I9GA 3WK4A 4X6YA 5CLHA 3WZLA 2X5NA 1QYDA 2N1MA 3BFVA 3OO1A 1T9BA 3EGEA 4A2CA 2QM0A 4NNOA 4AJ1A 2FW8A 3GBSA 5CPBA 1USGA 3K92A 4L27A 5D7BA 2GD1O 1VP9A 1TQ4A 5K3FB 1GZ3A 4ZT3A 2OGWA 1NWHA 4K9DA 2XR1A 4MW0A 3H8WA 3CVXA 1QFJA 2XSZA 2F43A 1CUDA 4M0EA 4INAA 4RZ3A 3E2PA 3FGNA 1AQYA 2ATEA 1RLUA 2FZ5A 1NGSA 3OJEA 1L5WA 1LV8A 2AH5A 5EJ4A 5L4NA 1CQJB 3AKEA 2Q4OA 5F5LA 4GDFA 2UAGA 3TQCA 1V6SA 4V0ME 3GT0A 3IEPA 4OUDB 4RZIA 2N9UA 3FYUB 4IQGA 5H02A 2QRUA 3V3KA 1Y3HA 4AX8A 2GCGA 3NDIA 3K1JA 4X1OA 3P2IA 5FOSA 3EZFA 5JD6A 2ZXUA 1PV4A 5CFRA 3CRW1 1OV4A 2ZYRA 1A95A 2GHTA 3WLJA 4HDNA 2F9LA 4YI3A 4I19A 2OM6A 2PZKA 4X63A 4BO4A 3KJNA 1CZHA 2EJVA 2Y67A 2GKOA 3FE2A 1EEXB 1G64A 4N7BA 4Y98A 3E4CA 4UTZA 1OAAA 3M33A 3RRYA 3TRFA 2C88A 2F62A 2I8LA 2AUMA 4TTAA 3RROA 1OJ7A 2ZWIA 3WJ1A 3SIRA 4MUHA 1A3CA 4KN9S 1KNXA 4C6TA 2PFSA 1BA2A 1ZEJA 3I76A 3NWBA 3B1JA 3DDNA 1Y3CE 5AI8A 3C4JA 1JHZA 1HR0B 4Y9RA 5JYBA 1LTQA 4RAOA 2BDTA 4P3NA 2IKQA 5MDHA 4Z0TA 1T6XA 4UREA 3F98A 4AJPA 4GKJB 3ONVA 4O4IF 1QRAA 1TMOA 4AS1A 1MO6A 2GNPA 3EXFB 3MQFA 5DHUA 1HPLA 2CLDX 4BQPA 4WLOA 5EXEA 2WLSA 2YQ5A 2JJ2D 1CD5A 1RRFA 2P4HX 2YR0A 2ZE8A 1HG1A 3MBKA 3ASUA 3PFCA 4P33A 4R2JA 2DY0A 3D4LA 2AFIE 2DFKB 5FP0A 1V45E 2PUFA 4QAJA 1OFVA 3UO8B 4BMXA 1KMHA 3ZQKA 1FLNA 4H1VA 2IS2A 3BBLA 4L57A 3OHMA 5G02A 3FTFA 1RQRA 2V7BA 2KYRA 2GUWA 2ECFA 1ZGBA 2ZXEA 4Z7JA 4CQMB 2HJWA 2QD4A 4CIBA 1WR8A 3DXFA 1CRZA 4P4TA 2JHFA 4L4RA 1JAIA 3P9ZA 1GHTA 3R3VA 3DTVA 1GU1A 4W9NC 3WLNA 1T6NA 1O0CA 4G0NA 4ENPA 1SUDA 1T2CA 5I01A 1EM6A 1E1YA 3CH5A 4P5DA 1U8CB 3LP5A 4YJDA 5AXDA 3SS7X 1K6MA 10MHA 2Q0QA 4OP1A 4IR7A 3ZWDA 3V1MA 4IIBA 1ZP6A 1D2EA 1K86A 1ZGGA 4W9NA 5EJAA 3V2HA 3L43A 4PZDA 1DV1A 1RU3A 3WIBA 4NNJA 2V3CC 1V3QE 3NAMA 3PL1A 4DZZA 5B6IA 1U5AA 2KPOA 4A2WA 5IM4A 1A4IA 1LBHA 3B2NA 3I72A 2ZRHA 2TMYA 3BKWA 2XRFA 4RMHA 1NTOA 2VO1A 2ZI5A 3RVPA 1L7VC 1TKCA 1V2GA 5JVDA 4BLRA 4OX9B 3NTUA 1XROA 4QXQA 4P4SA 2ZPUA 4KO3S 3A6PC 3ETGA 4S12A 4KR6A