1XTIA

Structure of wildtype human uap56
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
381
structure length
381
Chain Sequence
GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Probable ATP-dependent RNA helicase p47
total genus 128
structure length 381
sequence length 381
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA02
3O8DA 3R8FA 4CT5A 2GZAA 4ITRC 4LBZA 5FUYA 4HI0E 1ZYUA 2C96A 3DHWC 4XWAA 4DLRA 3U44B 4Q18A 4CEJB 3TR5A 2IYXA 3HYRA 4NE2A 1W0JD 1ZCAA 2CL7X 1WP9A 2ZVPX 1JB1A 2IF2A 1NN5A 1GKIA 821PA 1FOEB 5ANRB 2IS6A 2WWIA 3IHLA 3QPWA 1XJCA 4HZUB 3VMFA 4TZ6A 1R0YA 1XTSA 3AVOA 4KFTA 4HB4A 1N0VC 1NL3A 3QF4B 2GF9A 3MJHA 1IM2A 2VBCA 4OHVA 1JPJA 3L0OA 5CM8B 4FD2A 4R9UC 1XB2A 3A1SA 3QOFA 1I2MA 1IJFA 3TSWA 2HYIC 1T3LA 4YXWD 1IQPA 1AIPA 2FFQA 5KSYA 5G41A 2GXUA 5B64A 5FR1A 1G3MA 4CEHB 5FOTA 3CO5A 5CYPA 3CM0A 1DBSA 1II9A 2GJKA 3K9HA 4OJQA 3OAAA 4Q9HA 2EFCB 2ECKA 4M1OA 1ZUIA 3AF1A 2JLUA 4QJ5A 4RZUA 3U4QA 5E4FA 1E2GA 3OIWA 3QPUA 4DLSA 1KSHA 1Q1BA 2BC9A 4RD3A 2HLDD 2AK2A 1SKYB 2J0UA 4MKGA 3WY9A 1A1VA 1YRAA 3OIUA 5JHHB 1SQ5A 4DXAA 2D4HA 3K1JA 3SJAA 3LQRA 3PITA 4N3NA 2WVJA 5KOYA 4JLVA 2YWHA 3IQXA 2AX4A 4YDSA 2I1QA 3AVXA 2YWFA 3RAPR 1PV4A 5DGXA 1P3JA 1W1WA 5GJVC 2GK7A 1PLJA 1LV7A 3I5YA 4RD1A 1KYIA 5M04A 1WMSA 5JS7A 3U6KA 4P31A 3QENA 4DWJA 1EGAA 1OSNA 2GNOA 2O0KA 3NG1A 4A8JC 4HZIA 5B30A 4C0SA 3GJ7A 2VSXA 1DG1G 4FCVA 3W6NA 4C0KA 1AS0A 3X1WA 4DCTA 1ZC4A 3TVDA 2JDIA 4BLSA 4DIEA 3U3KA 4Q9LA 2WJIA 4CVNA 4URUR 3U5ZB 1EFRA 4V02A 3K09C 1W0KD 4W5WA 3C4JA 4QG7A 1YZKA 2IS1A 4Q4JB 3AF2A 1C4OA 2OFXA 2FH5B 4JSYA 1E2MA 4EQ6A 1P75A 4ILEA 1LW7A 4BFYA 4QHTA 1IBRA 3CRRA 3EASA 4BFWA 3QXCA 2YV5A 4Q02A 1COWD 1UKYA 3VKWA 2B8TA 4RCYA 2A5DA 1SXJE 4XSGA 4EKDA 1RYFA 1KAOA 4FMCB 3V00A 1GNQA 3RC8A 3AP3A 1G8YA 1JQJC 1G20E 1G5TA 3BBPA 2YINC 3U4QB 3U60B 1BYUA 4POAA 2GZHA 1YU9A 2GESA 3T5DA 4H9GA 1J2JA 4YXWA 1EFUA 1P9NA 5L3QB 4XIGS 3KQHA 1I4LD 3EXAA 5DIFA 4EJSA 2ZAOA 2OEPA 2ZREA 4KSCA 4BFZA 2QTVB 2J45A 4XWKA 4ZIRA 1EFHA 4HUTA 3CRQA 5FTKA 3NEYA 1CR4A 2NIPA 5B2ZA 2QU8A 1K8RA 5GVSA 2FPLA 4A8JB 5JRJA 2L0XA 3K0FA 2ZPTX 3MWJA 2WWWA 1ZNYA 2X2FA 1I4TD 5EXPA 4L8GA 3AV0B 1E94E 4Q7KA 4RFVA 4QBGB 5A4JA 4YC7A 4FWTA 3MFYA 3QI2A 5AK0A 3EPLA 2QGNA 3VNVA 4DVGA 1LFDB 3TE6A 1B23P 3CR8A 1KKMA 4LHZA 4RD2A 2RHMA 3ETLA 3BFVA 3CIOA 3GLGB 2Q3FA 4PHTA 4P3YA 4KODA 1G8HA 3VX4A 1EFTA 1XTIA 4ACAA 3NDBB 2GTPA 1XMJA 1XXHE 1JXMA 3N5CA 4OK3A 2WOOA 2ZROA 3EG5A 4ESHA 4NYMQ 2KB0A 3FVQA 1XTQA 5K8TA 4H1VA 3S1AB 1E4YA 1RFLA 5JBQA 1ESMA 1KJWA 2XB4A 3ND9A 1G5RA 2ZITA 2JLRA 3ZD7A 1EWQA 3IPXA 1N6HA 2JASA 2RCNA 4MKIA 2J0QA 1XWIA 4TMXA 4B3XA 1DAHA 3SOPA 5E3HA 2ZIAA 3TQCA 2NQ2C 4KXFB 1TQ2A 3EA0A 1TEXA 2V6JA 1GWNA 2JLVA 3H1TA 2EFEB 5CDFE 3ZLJA 3VR5A 4AYTA 4B43A 4HATA 4GZMA 2F9LA 4GPTA 2XNDD 3DZ8A 4LV6A 2NZ8A 1PLLA 2PMDA 4IOMA 2BCJQ 5G3YA 3AH8A 1U99A 4G3XA 4PFSA 1GIAA 2HCBA 3ZZUA 3CX7A 1N6NA 1QG2A 4IDQA 4LDJA 4NYMR 2AK3A 4BFXA 3TMKA 3NHAA 3W34A 3AP1A 1JEDA 1KO1A 1Z0DA 1ZP6A 5TDHA 5L3VA 3THWB 1DAMA 5C1BA 3X1YA 4B71A 1F6BA 1Z6GA 2ZRBA 2XZOA 4QC2A 2R2AA 1GNPA 5L3QA 3QG5A 2GWHA 1KI4A 1T4GA 1UEIA 2CHVA 2IYYA 4TL9A 1VYVA 3QEOA 1FZQA 1ZD9A 3OHMA 3VR1A 1EX6A 4RCZA 5EJEA 2Z6VA 4ZIRB 2B8WA 5DISB 1E0SA 1E6CA 5E7MA 3JZMA 5LPNA 2DFTA 4IOKA 3G0HA 3B1WA 2WJHA 3QXXA 1NJFA 1W47A 3K70C 1N0UA 3SI7A 5BYKA 2ZSAA 2HEIA 3LBHA 4CEHA 1IXRC 2CEAA 2Q3HA 1KMHA 4P32A 4OHZA 3RSOA 1Q57A 1GM5A 1GFIA 4IFEA 1MKYA 4A0RA 3MG9A 1DTSA 3ZH9B 4TYNA 3DKVA 3RLFA 1RVDA 3R7WB 3N2EA 1X8LA 4Q4AA 3V4RA 2AR7A 2PJZA 2J0SA 1P72A 4GT1A 2FN4A 1BYIA 3ZQJA 3L82B 3U7GA 1XPUA 4IDHA 5AJZA 5H8WA 3GLHE 1G7CA 2V55B 2QAGB 5B58C 4DSUA 4FW9A 4Q00A 3UMSA 4HB3A 2ZJAA 2NO1A 4M1YA 2NMVA 3TIFA 4PQFA 1P73A 4Q4HA 3WMFA 2DBYA 3TVTA 1DAEA 2ZRJA 4JBWA 5G53C 1UEJA 3NEJA 1N2CE 4Z1MA 2IA5A 2EYQA 4LJ4A 2BBTA 2GCNA 3THYA 1ZUHA 1KKLA 3PUZA 2HLDA 2ASEA 2XXAA 4MUAA 3UATA 2A5JA 3FFBA 2CVFA 4Z8YA 3NC0C 2VP9A 3ADCA 3KJHA 4DLYA 1EX7A 1ZJ6A 1FTNA 2ZI5A 4IOJA 3KKPA 2NG1A 3A36A 4DLZA 2QROA 1KNXA 3C15C 4H1UA 4MRRA 1UBEA 4TQUS 3M1IA 2Q21A 1E2IA 1T0JB 2C77A 3LW8A 5KYKA 2VP6A 2JLQA 1MRSA 1RIFA 3KKNA 1VG8A 1UFQA 5KTYA 3EZ6A 1XMVA 2JLWA 1WF3A 4NU0A 1ZM2A 4NZYA 2OESA 2QG6A 4D4KA 4EPTA 2KE5A 3OFND 1RKBA 5FUWA 1EXMA 1VKJA 4RKEA 5GJBA 1X8JA 3HR7A 5IDVA 1W44A 2IXFA 4A9AA 3QF7A 3WMEA 1DEKA 4HSEA 3T12A 5C4GB 3OESA 3W3AA 1DO0A 4MKFA 4V0ME 1DAGA 2ZRIA 2ZS8A 2ZRLA 4E09A 4TN1A 3AGPA 2FPMA 3HU2A 1TTTA 3VX3A 3GJ8A 2RAPA 1XNJA 3UMRA 3ADDA 2H92A 3EIHA 4EFLA 5JWRA 1ZIOA 1E2NA 2QBYB 3N2IA 5L3SB 1LY1A 2OCYC 2WBLC 2ZSBA 4NP6A 4J0QA 4Q4JA 1JAIA 3PG5A 2OSBA 5BN4A 3RWOA 1D9ZA 1D9XA 2FMXA 1SZPA 2NTYC 2ODEA 4AYXA 2IX3A 1Z6XA 3ZIAD 4ZKDA 4B73A 2OUKA 1F3OA 1T5IA 2ZRCA 4PC2A 4RD6A 3LH5A 5FH9A 1VHTA 2GJSA 2BMDA 4N0DA 1UKZA 8OHMA 5JJIA 4QOSA 1YR9A 3P20A 3CUEF 1GAJA 3GLFE 5CIWA 1SHZA 3EAQA 4XVRA 3WNBA 4D6PA 1M7GA 5AUNB 2DFKB 2MMCA 2GJ8A 1ANKA 2R6CA 2Y8EA 3KZ1E 1NKTA 3FKSA 4PANA 1E2LA 4PO1A 3BGWA 2ZSFA 4FWIB 1KDRA 3NHBA 1LS6A 4JBYA 2FWRA 3ZS8A 4A6PA 2PT7A 2WJJA 4YONB 1OIXA 3K9GA 4TYYA 1SVSA 4OK5A 2A78A 2B92A 1ZRHA 4F92B 4OQXA 1VCNA 3L0IB 3EZ9A 4O2RA 1X6VA 3B9PA 4IDNA 1C9KA 1E2HA 1QHGA 1II0A 1S96A 4CDGA 3BOSA 5DSZA 1T0HB 3TW4A 4LGMA 4FIDA 2ZRDA 1G41A 4BFUA 1EG7A 4TSFA 1BOFA 2O0JA 3F8TA 1P2UA 3TH5A 1P9RA 1GKUB 5KDOA 4JL6A 5DNYB 2J7PA 2QI9C 2IT1A 3A4LA 3PIRA 1GOTA 1VG0B 4DCUA 3GFTA 1AM4D 1XF9A 3K0EA 2OBNA 1R0ZA 1T5LA 2P67A 3QKTA 3QIAA 2FA9A 3GJ6A 3CF6R 1U9IC 4LJ6A 3PUVA 1OLOA 5KNBA 3Q7QA 4UXIA 2AD5A 2F3RA 3FMIA 1OXUA 3I92A 3TLXA 5IK2D 3K0SA 3KJIA 3S1AA 2PZEA 2F43B 1E2KA 5JSZB 3ZQ6A 2GCPA 4PX9A 3GPLA 5E7JA 4YMTA 4Q1CA 4G5GA 1HTWA 1KOFA 1Q22A 2HDNB 1CS4C 1G21E 2PMKA 4DKXA 1CLUA 5LD2B 3K09A 5FBRB 2QN6A 4TTPA 1XPRA 1S9DA 3OFNA 1T6NA 5A0FA 1RYHA 3VU9A 3AF0A 3ICEA 3JVVA 2BCGY 3VQTA 4NKRA 4R2HA 1KAGA 4UNSA 1AGRA 1E9SA 5FTMA 3KX2A 4ZCIA 4AKHA 4M1KA 1ONBA 3DVLA 2WIAA 4TT3D 3T1QA 4OHYA 1XMIA 2ZYTX 3B1VA 4ZCLA 1GP2A 1NLZA 2WZQA 3C16C 3GJ5A 4UNPA 4V0NA 4G5RA 4QNRA 3C5HA 4UJ3A 1KI1A 2PX0A 1GRNA 2GA8A 3IQWA 4TLCA 1WBDA 4QKQA 2ERXA 2BHRA 2NO9A 4EPXA 2W6ID 1H8EA 2ZRHA 4D80A 4HAWA 1TU4A 2AN9A 1WE2A 3FTQA 5KSOA 4AIIA 1E1QD 4V0KA 1T3SA 4JVMA 1LS1A 4PSVA 1UKVY 3CNOA 3KKMA 3CBQA 1T8TA 4Q1FA 4C4PA 5J5CA 2V1UA 3H84A 3BD9A 2JIZA 2PZGA 3V4FA 3SYKA 1ZUNB 1Z06A 4WAUA 5FUXA 1WRBA 5JHGB 2AWOA 2Q9CA 4OQNA 2LKDA 2XTMA 4P4UA 1SXJD 3RWMB 4LJ5A 1AA9A 1EFCA 1UBGA 2YNMA 1HY3A 2QMHA 4B44A 1JR3E 3CWZA 4C0JA 3SFZA 3QSYA 2JLZA 3ONWA 4A92A 1G3QA 2F7SA 2WTUA 2WV9A 4K8OA 1W5SA 1KDTA 2RMKA 2CK3D 3DMDA 3GLHB 1ZVQA 3PENA 4LPKA 2J87A 1FMJA 1YRBA 2J0VA 4B6EA 4C7OA 5BWMA 2NO0A 3LV8A 1W2GA 3ZZ0A 3CNLA 4BGDA 2HJVA 2RH5A 4IW3B 4B33A 1L8QA 3MWLA 3KQLA 2FEMA 3CLVA 1J8MF 3CPHA 4MH0R 4JLOA 3CPJB 2EYUA 2J7PD 3ZGXA 2QORA 5FUVA 2NPFA 3K8YA 1KSFX 3SJBA 5JS8A 4HEJA 4HAYA 2VSFA 4JJKA 2VL7A 4MKHA 4D0NA 1N5JA 3PUWA 1F2UB 1VG9B 3E2IA 4I81A 5JSZA 1AQYA 3LLUA 1FMLA 5A5GA 1KIMA 3EPJA 3GJ0A 2QQEA 1Z6AA 1JQLB 2AFIE 4OKSA 5DI9A 2N42A 3RABA 1G7TA 4W9MC 1KK0A 1OFTA 4F4JA 3UXMA 3LXXA 2XXAB 1XEWY 4JMPA 2VF7A 4Y0AA 2E1RA 2RGDA 2CHQA 2VP4A 4C30A 2IUUA 1DE0A 3B8HA 5C2JB 3PJRA 5CYOA 2REOA 4C0AC 1M6NA 3C5CA 4HLUC 1W5TA 1NNEA 5TMPA 1NKSA 1JXOA 1OE0A 2XZPA 4IFBA 3W9YA 5KSPA 4AYWA 1HE1C 3CONA 3AKYA 1BS1A 1IY0A 3FHTA 3NXSA 3AB3A 1WB9A 5FBQB 4Q4HB 4Q7MB 4CIDA 4NYJQ 3LLMA 2PCLA 4JLMA 1KY2A 3LRPA 1OH5A 3WP1B 1Z07A 2HCJB 4EPWA 3O8CA 2ZS9A 2GETA 2XEXA 2IUSA 2JATA 4EPVA 4DDUA 4OI1A 2V1XA 1LNZA 5DI3B 5KO2A 1QHYA 3W90A 5BW8A 1I2DA 221PA 4TYWA 2B7CA 5IT5A 4MRVA 1RRFA 3F5FA 2R6FA 2RB4A 2IYTA 3H2YA 1W36C 1KI9A 1KTVA 3SFVA 2P6NA 2QTHA 5KUTA 4CF7A 2A2ZA 2W0MA 1XU4A 3KKQA 2IC5A 3Q7PA 3QF4A 4ZDIA 1TADA 4AURA 4PAOA 2IYSA 4Z8XA 3KXIA 1OIVA 1QHSA 4OJKA 5FOUA 1P2TA 4A2WA 3P27A 1GTVA 4F4CA 3C14C 3LW7A 2FSHA 3Q72A 3W5IA 1Q44A 3ZVRA 4D2IA 3SQWA 4MGIR 2CCGA 2ORVA 4PO9A 2C2HA 1KK1A 2IEZA 1D2NA 1SVOA 1IN7A 4FCTA 1Z47A 4KO8A 1W0JA 4F4IA 2AL7A 2BM1A 1NN0A 1NRJB 3IHWA 4RVCA 1MABB 3GLIE 3GJ4A 2BV3A 2PLRA 4M9SA 1NLYA 2KSQA 2K5UA 3KXKA 1E9BA 1Q12A 5FFMA 2PZFA 2JLYA 1M2OB 1OB2A 2CL0X 4XD7A 2DY1A 1NI3A 2WPDD 4L4UA 2BJWA 1FNNA 1WXQA 3I3SR 4DLUA 2IF0A 1BMFD 2ZVQX 4KSBA 5EP3A 4DSTA 1OXSC 5K8UA 4LYJA 1JJVA 2ZE6A 1IXZA 1CRPA 1N6OA 3BAFA 4QJ3A 5FOVA 4QL3A 1OF1A 3LBNA 3MCAA 4BLTA 5FOXA 3GMTA 1FP6A 5JWHA 4I1UA 1ZM4A 3PV0A 4KYIB 4Q9KA 5JFGA 3HWSA 4AKGA 2KI5A 3SBDA 2DFLA 4URWR 1Z29A 4GMDA 4EIWA 1UF9A 1II8B 4NYJR 5IHPA 4AY2A 2MMGA 2SHKA 2WKRA 1G6OA 4Q7JB 4B3CA 1T8UA 3E1SA 3THOA 4Q48A 4M21A 3NH9A 5AJVB 4NCJA 1ZINA 4MYTA 4YMSA 4GDFA 1Z0FA 3IKJA 4M1TA 5JCZA 3ASYA 2ZRFA 4C0LA 2G83A 3CH5A 4QHYA 1ZM3A 5EE3A 1MRNA 1KSGA 3PFIA 4RD0A 1U8YA 4WXPA 4YDHB 2I4IA 4LYHA 3W3ZB 4Q1EA 4GL2A 2EW1A 3D3QA 3A1TA 4PSKA 1VTKA 3PVSA 4BASA 2N1BA 3F3YA 2RKOA 4AKEA 2DWPA 1ZAKA 1R8QA 4W5JA 1I4DD 2ZUBA 2ZJ2A 2AFHE 1P2SA 5FOSA 3QQ5A 2G6BA 2OZEA 4LI0A 4S2EA 4EFMA 1E2QA 4YQFA 2I3BA 3VAAA 2VA8A 2ZJ8A 2FOLA 1R4AA 1P6XA 2IXGA 2J7KA 3FE2A 4TMTA 4TMWA 2DR3A 5TY0A 2KWIA 2P3SA 2GXQA 2DWQA 4MITA 1QG4A 1Q1EA 5GADl 4DUGD 3U7HB 2ZU6A 3AUYA 4TL7A 4JT2A 1F60A 4BE7B 2AXNA 2V6IA 3ADBA 2O8FB 4LBYA 1UPTA 5DN6D 1XEXA 3CKLA 4C3ZA 3U7FB 4B2LA 4ON9A 2Z43A 3GQBA 1J99A 4TLAA 1VIYA 1W46A 2C04A 5AJXA 4WBSA 1YZGA 1ZU4A 2CLDX 2X77A 5J4HA 5TV2A 4TQAA 1H8HD 4C2TA 4XJXA 4Q4LA 1R5BA 4JIMA 2D7DA 3FMOB 1UM8A 3BE4A 1CJTC 3M6AA 4M0LA 5CLLA 2VQSA 2OFOA 4NDZA 1WBBA 2IYQA 4ASUD 1UBCA 3Q3JB 3O8RA 3ZVLA 2QBYA 1YKSA 1DS6A 1SVWA 5GVRA 1AS2A 4TTRA 5CM9C 4DHEA 1WDTA 1NBME 1JPNA 3LFUA 5FTNA 4L16A 3QXSA 5E7IA 4CW7A 5BXQC 3VKHA 1KZGB 4B48A 2IHBA 2QE7A 1FUKA 5FTLA 4C0BA 4QM6A 4LJ9A 2OM2A 1YHNA 3AVTA 1ELOA 3MD0A 2OFWA 4MUBA 5CIQA 1XTKA 1AK2A 2XSZD 4LV8B 1W49A 2C9YA 3K70D 1E9EA 4URXR 1QHNA 1NBMA 4OL0A 4Q1AA 1CR0A 3KXLA 2Z83A 1R2QA 5TXGA 1DADA 4CT4B 1CF4A 3LY5A 2G3YA 1E32A 3HR8A 1TF7A 1YZTA 3K9LA 4MGYR 4A4DA 4B6FA 3FYHA 1M1YE 1XTJA 3Q5DA 4DZZA 4FCWA 1U0HC 4TZ0A 1O87A 4UNNA 4LOAA 4ZCMA 2X1VA 1NN3A 5JI3E 1Z0AA 4LHYA 4M9ZA 5JCPA 4QGFA 2FZLA 5GJWC 3A37A 4XVQA 3AEZA 3NWJA 1HA3A 1CU1A 1E4VA 1IN4A 2QP3A 1QHHA 2WMOB 2C9OA 5H1YA 4NYIQ 3EC1A 4KBFA 2G88A 3CWQA 5EXXA 4PC3A 1M7BA 3DO6A 3ZJYA 1X1SA 4TLEA 3LX8A 4P0TA 3MAAC 4Q1DA 3I72A 1MOZA 3QVUA 3HP1A 5HCNA 2PL3A 2XITA 2ZR9A 3CX6A 5LB4A 1F2TA 5C18A 3VNUA 1U90A 3J81k 2ORWA 4TYPA 4HAUA 2HXYA 5TARA 3AP2A 3CRMA 3OIVA 1E79A 2CK3A 3A1UA 4KBGA 2OCPA 2BM0A 1PLKA 1N3BA 4PPFA 2XAUA 3CR7A 3GJ3A 2JIZD 4GP6A 5HE8A 3BK7A 4HLCA 2ZSEA 4C9BA 3X1ZA 2G0TA 3AVQA 4LBWA 1KJZA 4JYBA 4FXPA 4KFSA 2W2VA 2D3WA 5JRZA 3IILA 4U00A 4B3DA 4U7DA 3LNCA 5AUQA 2OBLA 4B35A 3B1ZA 2ATXA 4RKFA 1UAAA 4MYCA 4DDVA 4L9WA 2GHIA 2ZXUA 3FWYA 2GRJA 1OYYA 4DB4A 4LBVA 4YLGA 3I62A 2GILA 3OEEA 5FPTA 1EWRA 4HAVA 4Q9JA 1QHXA 1ZD8A 3BS4A 3HDTA 2GVZC 1KK2A 3W8RA 5CLQA 4LV5B 1A5TA 3ZYCA 2GBLA 1IOZA 2BMEA 4GP7A 4KCGA 1FW6A 4Q21A 4M4SA 521PA 3VKGA 1P60A 1RPZA 2CNWD 1Z6YA 5AR1A 4LJ7A 1NIPA 4RZXA 2Q6TA 2QM7A 4DBLC 5JEDA 3U44A 3B5JA 3LVRE 2FZ4A 1XBTA 1JR3D 4HUQB 1E9CA 1DARA 2ZUCA 5BN3A 3IIJA 4TSFD 3RS3A 5EUMA 1D6JA 2P6UA 1OIWA 2FNAA 3FDIA 2J3EA 4PPNA 4G01B 1Z22A 3I61A 3T06B 2WOJA 3REGA 1IN8A 1ESNA 3P1JA 2R62A 4JZKA 4BLOA 3DMNA 3UG7A 4U5XA 4YMVA 2V8OA 4PHHA 4DEYA 2Z4RA 4Q19A 3KFVA 4DEXA 4DUGA 2V7QD 2O52A 3WNDA 1FX0A 1G8GA 4JLBA 4ZPXA 4HB0A 4M1SA 4B3BA 4B2PA 4DDWA 2CJWB 3LAWA 2OCBA 2R9VA 3UMFA 1AKEA 4I4LA 1X1RA 3DOFA 3VR2A 4UJ5A 1OH7A 1CTQA 2ANBA 4URVR 2ZYVX 2GAOA 2REBA 1II8A 1OPXA 1CULC 2F9MA 1F48A 2P65A 1IXSB 5FBVB 1WA5A 2RGAA 4BLPA 2QRZA 4HDQB 1O3YA 1YZQA 4B32A 4KFRA 3KJEA 4KHZA 1NG1A 1OXTA 2ZAMA 1UDWA 4B3FX 5JECA 2NGRA 3W8NA 1A2KC 2ZRNA 4JL5A 4BUJA 2H5EA 2JA1A 3AKCA 1Q3HA 3LO5A 2AKYA 1NN1A 2Q3MA 1H8ED 3PEWA 4GOKA 1D8TA 2ZRGA 3T35A 3AQ4A 4V0OA 4B76A 3IO3A 1AKYA 2GXAA 4D4MA 1MV5A 2OLKA 2CLSA 3QEJA 1R0WA 2IYVA 4BZXA 2YC4C 3GJXC 3A1WA 2QAGC 1G4AE 4TQ9A 4B34A 2W2TA 3FGNA 3C8UA 1RW4A 3QG1A 4IXMA 2QP4A 1E2DA 2F1IA 2GF0A 5CJ2A 3EA5A 1R5NA 4DT1B 4V0LA 4PZLA 2O8CB 3G5UA 3OEHD 5C46F 4D25A 3EC2A 2PCJA 1S3SA 5FPYA 1IN5A 1N5KA 1VCIA 4G5SA 3GFOA 1G8FA 3BB4A 3IEVA 4ERNA 3T61A 1XEFA 2Z5FA 721PA 2QA5A 4FMBB 3U3RA 4LJYA 1FX0B 3NBXX 2IEYA 5HTKA 3KFXA 5KNCA 4NPHA 1XD2A 2EQBA 5J47A 1H8HA 1KI6A 3RSLA 2A9KA 4YMWA 2JAQA 4LWZA 1E2JA 2H16A 2BVNA 1DELA 2RGBA 2DFNA 3MGCA 1OV4A 2GZDA 3TAHA 4I1SA 3KTAA 4LYFA 1CRQA 4WA7A 2BOVA 1XRJA 1ZM7A 2W6JD 3W5JA 4G5QA 4ARZA 5FTJA 1JR3A 1QDEA 5DI3A 1VYUA 2ZJ5A 2NOAA 1XMSA 3K0AB 2ODBA 3TR0A 2QENA 2RGNA 3VR4A 1YZUA 4JLDA 1X3SA 1UBFA 1HEIA 2GJ9A 2ZE7A 2BBWA 4P4SA 5EP4A 4C2UA 3EIEA 1V43A 1KI8A 1OFIA 3EX7C 1S1CA 1XD8A 1A7JA 4IVQA 1N5LA 2W00A 4DLXA 1NVXQ 2LWIA 3BB1A 5CITA 1ZBDA 2XSZA 3GLIA 2O5VA 4X8HA 4OHXA 1YR7A 2D2FA 3W6PA 3WRXC 1ZC3A 4EDHA 2YWGA 2VSOA 2WSSA 3DM9B 2IYZA 2Z4SA 2WAXA 2YOFA 4US0R 5DHAA 5AJYA 1MR3F 3QKSA 3VU9B 2J5XA 5KNDA 1RRGA 4JVNA 5F9HA 1M74A 5B57C 3MLEA 4K46A 4NYIR 1J7KA 3CZQA 4I99A 1E0KA 3WYAA 1GL7A 2ONJA 4IDPA 2YKGA 2CBZA 2ZU0C 4MA4A 2JJ1D 2ZR7A 1N5IA 1HH4A 3TNFA 1TPZA 2BDTA 4HZUA 1CJMA 2RGGA 4RJLA 2EWVA 3PEVA 4Z54A 4NCIA 3ICQB 1FP7A 4A6XA 1KI6B 1G7SA 4ABYA 3AVPA 2GDJA 1V5WA 2ZANA 4CEIB 4G5OA 1KSJA 3NH6A 5EXTA 4KITB 1JNYA 1M34E 1Z0KA 4PR0A 4IJMA 3KB2A 1KI3A 2WWHA 3VHLB 4KU4A 3EARA 4E22A 2HF8A 1DAIA 3LXRA 3QPVA 1PZNA 1YR8A 1XJQA 1S2MA 3KUCA 4WVFA 4MRNA 4LHWA 1VHLA 1HT1E 3VTKA 4M8NE 2GEUA 4BFSA 3ZVNA 1TAGA 5AJWA 3AVVA 3AVUA 4F93B 2BJVA 1R6BX 1XCGB 4QNMA 3SNHA 3UKDA 3R9XA 1TMKA 3AUXA 1S3GA 3RS4A 3RS7A 4FN5A 2HV8A 2IW3A 2P5TB 3NIBA 4DCVA 4DSOA 1ZD1A 4AWXA 4M53A 2W6JA 3EIQA 1CJKC 1ZIPA 4IVPA 4RSGA 4D82A 3CW2A 4JVSB 2OLJA 1CP2A 4R2IA 3CH4B 1NVVR 3NTUA 3L0PA 1YZLA 2FGJA 2RGXA 4ZDWA 5JZVA 1E1QA 1N25A 1U94A 1Q21A 2ZJOA 1CEEA 3U2QA 5E95A 4ARZB 4LHXA 5HCIA 5UKDA 4OI4A 1JI0A 3U61B 4TL8A 5K8LA 3BH0A 1JEEA 3EZ7A 4D0GA 2OO7A 4PZYA 2FSIA 4DLWA 1T3HA 1U9IA 4TLBA 3B7GA 3QXHA 4LZZA 2ZUDA 4QFMA 3GLIB 4YMUA 2DWOA 2QAGA 4CEIA 1S8FA 4RZ3A 1VMAA 1BKDR 3WXMA 2ZRPA 2IYLD 2H1LA 2AKAB 1LF0A 4HB2A 2D74A 5D3QA 3B6EA 4P4TA 3IGFA 3KUDA 2FF7A 3TUJC 1AZTA 3SJZA 4A0HA 4OHWA 3SBEA 5J4VA 3A6PC 3OF5A 3U7EB 3L8ZA 4CZ2A 4NONA 5KPDA 4EPYA 3BFKA 2QY9A 4QBHA 2KJQA 2ATVA 1Z3IX 1PUIA 4FI3C 1MO6A 5IF9A 2XZLA 2REXB 3K53A 1P4SA 3SS8A 3ZD6A 2C95A 4A0FA 3CF0A 4BLQA 3BH6A 3FHOA 3OZXA 5D3MB 4NCKA 3CF2A 5FL7A 1AJEA 1QHIA 4FINA 3UANA 1U98A 1MH1A 5FI0B 2ODWA 3PR1A 1D2MA 1K5DA 2OAP1 4LY6A 2O0HA 2YWEA 4M2LA 3PXGA 3L8YA 1S0UA 2H17A 2QUZA 3RHFA 3VHXA 3ZDQA 3QBVA 2OCAA 4A82A 2MSDB 4E03A 4BPBA 4EUNA 1E0AA 2R6DA 3WHKA 5DH9A 3JZAA 4IKEA 2VH5R 1M7HA 4Q01A 3SYNA 1OB5A 1Z6TA 3ECCA 1Q1ZA 5DYIA 3GP8A 4PSAA 4JKYA 1XZQA 2JLSA 3WP0A 4KAXA 2NZJA 3UG6A 1NVVQ 4OQFA 4I1OA 2J0UB 2R44A 2YJTD 4LUCA 1SXJA 4BZQA 5KU1A 3DZDA 3WYGA 4WZAE 4LSGA 3B82A 2FE4A 3P26A 2AHOA 3SDZA 2YZ2A 4PQRA 2F55A 4Q47A 2GJAA 4HDOB 3A58B 1FPMA 2EU8A 1NJGA 2H7VA 2KBEA 4Q03A 2JJ8A 1Z0JA 1G7RA 1M8PA 1T91A 5SZHB 5TB5A 1K6MA 2YYZA 4Z1MD 5FI1B 4WZ6A 1E99A 4O25A 5CDFA 2ZJBA 4M1WA 4W5HA 1K5GA 4UNRA 4G0NA 3QE0A 4AK9A 2LCFA 4PC7A 4GRAA 3FKSD 3H86A 3AVWA 3MUFA 2FG5A 1CJUC 1NVWQ 1WCV1 2OG2A 3K0AA 3TGPA 4QBFA 4ZDKA 1W7AA 1IN6A 1HV8A 1F2UA 5DHFA 3MWKA 4O2LA 2CE7A 3RC3A 3ZS9A 3GLGE 4GMXA 2OV2A 2O8BB 2HJGA 2XJ9A 4CRWB 621PA 2IBMA 2WKQA 5L8VA 1VYTA 2RGCA 2H57A 2QTFA 1Z2AA 3FOZA 2V7QA 4EFNA 4B74A 3CRVA 2QGZA 5F3WB 2PLFA 3B1YA 2MSCB 5KDDA 1ZW6A 3BJIC 1RC8A 2QE7D 1HQYE 1P62B 2BBOA 5P21A 3TBKA 4NL4H 4FMCF 4KI0A 1PUJA 4DSNA 2DPXA 5HZHA 4BRUA 1E9FA 5FL7D 3LD9A 2OAQ1 1Q0UA 4P4SB 4QXAA 1F5NA 1RRPA 3HJNA 2P0EA 3N70A 1N6KA 2C78A 2J41A 4MGKR 1E1RD 3BRWD 2PJRA 3X1DA 5IRCD 2JGNA 4IVRA 4X8MA 4JS0A 2VHCA 3TQFA 2CE2X 3BERA 3QNUA 1JALA 2W2XA 5F9FA 4A2QA 1KHTA 3P4XA 1NY6A 2IXEA 2AD1A 3KQNA 3ADKA 3R9WA 2C9CA 3GD7A 2PX3A 5CK5A 3IDQA 4HYYA 1DAKA 3BORA 1OXVA 4MDEA 1BIFA 1ZM9A 2ORIA 3QVVA 3DKPA 2QAJA 4AKIA 4A8JA 4R98A 1W2HA 3HPRA 3WBJA 1AS3A 4R71A 4GZLA 2BBSA 1MT0A 3R7WA 1GILA 5HE9A 1G3RA 3TUIC 2VF8A 2C5LA 1Z0IA 3AKEA 2GXSA 4BRWA 5EE5B 2F43A 3ZVMA 3SYLA 3PEUA 2O8BA 4LHVA 4PHGA 3BXZA 3IO5A 1XFAA 1L2TA 3AM1A 2WWGA 2PH1A 3CNNA 1NVUQ 2WICA 1ETUA 2EVWX 4L5BA 2EFHB 3SR0A 5JLJA 2CJWA 2P5SA 1OKKA 3B2EA 3IPYA 4O0MA 5EQTA 1OJLA 1QVRA 4FMDF 5F2EA 3L2OB 1OYWA 1N6IA 4LPSA 3VFDA 4E5UA 4JVLA 2N46A 1DAFA 3I5XA 2FEOA 4LJ8A 3LX5A 2GBLC 4A15A 4UKDA 1NMYA 3FMFA 1XCPA 3QUSA 1NF3A 1W4BA 1E0JA 2VIIA 1IY1A 2WPDA 1HURA 4PQYA 2O8EB 2ZR0A 3OE7D 2IL1A 1D2EA 5K8IA 1G6HA 1J90A 3EPKA 2BMFA 2WKPA 4OBEA 4TMKA 1X86B 4S35A 121PA 2WWFA 4RZ2A 4GSYA 1Y63A 3K0FB 3H0KA 4JKIA 2F6RA 2Q9AA 1G19A 4A0GA 2ZEJA 4TT3A 3SJCA 3T5GA 3P32A 3THXB 1RRCA 1GITA 1TF5A 3FMPB 3O47A 3QKRB 3RNLA 3FFAA 1XCMA 1SULA 1GDDA 1JAHA 2F1HA 2BKUA 3JVUA 3NBYC 4GFDA 4BQSA 3EWAA 3U3JA 1S9HA 1Z28A 4QM7A 1YR6A 4GOXA 3KDSE 2B6HA 2QEQA 5FOWA 3EPHA 3D31A 3WYFA 5AUPB 2QSYA 3U3OA 4B47A 3GLFA 2AWNA 3B60A 3CX8A 3QXJA 3RYTC 1NIJA 4TL6A 4IOLA 4AI6A 4M9XA 4V0MA 2FGKA 3HPQA 1E1RA 4F91B 4KFUA 2Q9BA 2XB2A 1GUAA 3QJYA 4MDFA 2ANCA 3AF3A 2IYUA 1LVGA 3KB1A 1U81A 4XTRA 2O8EA 2VP5A 1G18A 4DJTA 2Z0MA 1UKEA 4XVUA 2ZI9A 1Y3AA 1GG2A 1ZCBA 1IHUA 2VRWA 3O8BA 2XGJA 1ZNZA 6Q21A 2IYWA 3I4LA 3L43A 3IBGA 2BEJA 5CK4A 2FV8A 2HYDA 4WOPA 1XEWX 4MGZR 2OXCA 2IS2A 2XOKD 3LDAA 1G9XA 1XD9A 1NSTA 4HAXA 3SE0A 1R10A 3ZZTA 5KPJA 1IJEA 1JR6A 5L3SA 1GZSA 4V03A 1SVIA 1QRAA 2WJYA 4MQBA 4A1FA 5F98A 3EW9A 1XTRA 3ZIAA 2J59A 2C8VA 3RRYA 1R7RA 5D3MA 3K0CC 2O8DA 4BECA 2QPTA 2P6RA 1NMXA 5BQ5A 1OKKD 1BO6A 1TUIA 2QMOA 4LK2A 5FL3A 3PUXA 1OXXK 5JMTA 4PPGA 1GL6A 1W4RA 4X8OA 5L3RA 2DHRA 1EESA 3SU8A 1U0JA 1N0WA 2WSSD 5G40A 1KO5A 2ZI3A 3K9NA 3X1XA 2H18A 2UKDA 3I8SA 4DCNA 1KDOA 2H8KA 5TVKA 2FU5C 2HT6A 3LBIA 4XTCS 1E3MA 4IEIA 1AGPA 1ODFA 3QBTA 1NMZA 2BMJA 2PEZA 4NBSA 4RFSB 4M9QA 3VR6A 4XSHA 3U3MA 2ZJZA 2X19A 1E79D 1QVAA 5EUQB 4K81B 4KJZA 5FPHA 2VPPA 4NMMA 3IIMA 1G4UR 4PZZA 4EJSB 2HT1A 2VHUA 2D7CA 3T1OA 1P5ZB 3C7KA 1DVRA 2WWYA 4CYMA 1XP8A 2R8RA 5SZJA 5HPYB 1LTQA 1PVOA 3EZ2A 4R7ZA 2B7BA 4WW0A 4B75A 2AXPA 5KHOC 1RJ9B 4A2PA 2A5GA 4DLVA 2R65A 4OYHA 3QKUA 1J8YF 2I1VB 1U8AA 3CZPA 3D8BA 2PBRA 3NKVA 1B0UA 4HUQA 4MYHA 3VR3A 2ODNA 3M0EA 2TMKA 2IWHA 4B2IA 3SQXA 4LJAA 3T34A 2A5FA 2VP0A 2DB3A 1A82A 3MMPA 3CPEA 4NCNA 2RGEA 5BYJA 4AG5A 4DT1A 5LBIA 1H65A 4ZKEA 5FPKA 3C41J 3MRSA 2G77B 2QM8A 3RANA 2D2EA 2CVHA 2EWWA 3NBFA 4BFTA 4GBMA 3KQKA 2A7QA 1UADA 4EAQA 1KJYA 2ERYA 2PEYA 1IONA 2QT0A 3GCGA 4UXJA 2ONKA 2V9PA 2ZTSA 4OQLA 1W48A 3RRMA 2CNWA 3B13B 3Q9LA 4URZR 4MRSA 2QSZA 2PT5A 1U2RA 3WMGA 4Q7LA 4QGHA 1GVNB 2JJ2D 4QGGA 4Q66C 3THYB 1HYQA 1TQ6A 3RS0A 1NY5A 1RJ9A 2G1JA 2NO6A 2VHJA 1KI2A 3R20A 2WMNB 3RRNA 1DPFA 3FB4A 1YQTA 2GK6A 1CKEA 1TF2A 5FR2A 2D06A 1N6PA 2QQ0A 1N6LA 3F0TA 4M1MA 5JI2E 1VECA 2CHGA 2QZ4A 2QRNA 1L4YA 3GFPA 4JJZA 5DO9A 3SEAA 5JEEA 1WQ1R 3UWKA 2P2LA 1W4AA 4X8LA 1G291 1TQDA 1NLFA 2QT1A 1OH6A 4Q9IA 3AKDA 4PAMA 3B1XA 4IDOA 3IIKA 2BWJA 2ZE8A 1Z83A 4F7WA 4LRWA 2Q0HA 1G3IA 1G8PA 3GEEA 4US2R 1UDXA 3BWDD 3GLHA 3SHFA 4QRHA 1XX6A 4G1UC 2O8CA 3L0SA 1FFHA 2QNRA 5ELXA 2W6IA 1G16A 2ZE5A 3I73A 3GLGA 3NBZC 2FFBA 3DDCA 1R5OA 3BIFA 3UWOA 2HXSA 1GRRA 4HLUA 3A8TA 1KY3A 1W36B 5EP2A 1W4CA 1OH8A 1VIAA 1CR2A 2FJUA 2G1KA 1VDZA 2WHXA 2CL6X 1XD2B 3UK6A 3DEFA 3I1FA 5G3ZA 1HQCA 1E69A 3B9QA 4Y0VA 2E9SA 3PUYA 4JLNA 1DO2A 1QBKC 1Q20A 5JJKA 3FHCB 3QKRA 4BEJA 3TRFA 1RE0A 1XXHB 3FKQA 1DG3A 3KQUA 2VO1A 1FQJA 3WBKA 4NTZA 4ZI3A 4JL8A 1YVDA 1R0XA 4Q1BA 1US8A 4XH9B 3M4YA 1CBUA 3AGQA 4C0QC 3A4MA 3IBYA 2WWXA 5C4MA 3K0CA 2JDID 4HDCA 4C0HA 3Q5EA 4KV9A 1MO3A 3EZFA 2MSEB 2A3RA 1JECA 2RHDA 3QY0A 3ND8A 1SHKA 1EFRD 1S4QA 2XTZA 3HU1A 1GKYA 4RD4A 4BEBA 1S1MA 1GSIA 2UZ3A 1TUEA 4JSTA 2KBFA 1XPOA 4D0LB 3WHLA 1HE8B 3U6BA 5SZKB 2ZQ5A 4N1AA 3T1VA 4BLRA 2OT3B 1QZXA 1IAQA 5J4YA 3G82C 4WXRA 1DOAA 2G0NA 3DL0A 4DDTA 2ZSDA 3OIYA 4GOJA 2WJGA 3BB3A 1GNRA 3AF4A 3TW8B 2GAAA 2VLIA 5LDDC 5EE9A 1KK3A 1PJRA 4OI2A 4DRZA 4Z51A 2OILA 1P7CA 4AC9A 1E2FA 2OBMA 3CB4A 4ZV4A 1Q1QA 4JYCA 4TMZA 2QMUA 4EJSC 2ZYUX 2YOGA 4GI7A 3D6TB 4L15A 4NCHA 3KKOA 2IS4A 4HLDA 3PQCA 2J9RA 4LC0A 2A30A 3D7MA 1JJ7A 2V4ZA 5DN6A 5FBWB 4JLAA 5EZ6B 1OFHA 5HKKA 1L7VC 4PO8A 3SN6A 1TX4B 1CJVC 2FX3A 4D4JA 3NVAA 2IK8A 4UXHA 4GNKA 4XOIA 2O8DB 4DB2A 2G9NA 4PHFA 3TAUA 2HUPA 5H70A 2VYFA 1XJ0A 3P4YA 3OEHA 2VHTA 4F38A 1KNQA 2R6GA 4LC1A 2CMKA 3PCRB 4DIDA 4D26A 4UQOA 3GEHA 3SC3A 1BH2A 5EXSA 2QP9X 4PC1A 4ASUA 2YHSA 1YJ5A 2D62A 1COWA 2F1RA 3SZRA 2CLCX 4D4LA 1C1YA 4TMVA 1G5PA 1NG9A 5LB2A 1SVKA 1SVLA 4P33A 3DPUA 1HUQA 3NC1C 5HZKA 4CEJA 1L4UA 3OE7A 1D5CA 2JCSA 4NHOA 5AUOB 4PXAA 421PA 4DC9A 3RS2A 2JJ2A 4KYUA 3TK1A 2ZRKA 1G3UA 1XXHA 4IXNA 2VEDA 4JT4A 4PTLA 5J40A 4JLJA 3WNCA 4ESVA 4L9SA 2GKSA 2VHQA 1AN0A 5LD2C 2V54A 1US8B 2BEKA 1ZNXA 1W36D 1KI7A 1VPLA 4PPQA 3MSXA 2J1LA 3Q8XB 5JJLA 3KJGA 3PEYA 1FUUA 1UJ2A 3EWSA 1J70A 3MWYW 3B78A 2FDCA 2DYKA 1KZ7B 1GRQA 1LF5A 1E2EA 2OHFA 4BZPA 1Z2CA 3UIEA 4XD7D 1XDBA 4TWZA 1E98A 2R6AA 3I32A 4IRUB 5DYGA 5EE1A 5KSZA 1Z63A 2LKCA 1RZ3A 2OXRA 2ZRAA 1BMFA 1MO4A 2ZM5A 1GL9B 4CGZA 1VCMA 5EP1A 5BN5A 1E9RA 1KMQA 1YZNA 2C03A 4ACBA 5CJPA 4DCSA 3RRZA 4EPRA 3V9PA 1Z08A 3T1TA 2WSMA 3THWA 3LWNA 3A4NA 2QL6A 3B85A 3FPAA 5EZ5A 1T9HA 1ZU5A 1R8SA 2QPOA 4PC6A 2F1JA 4UNQA 3BC1A 2CXXA 4MYUA 1E96A 1OHHD 3R9IA 5J4LA 5HKKD 1YE8A 2CDNA 2FFAA 1TL7C 4ZI2A 2WM9B 3RS5A 2FSFA 1OW3B 1EK0A 2ZS7A 4WIAA 3R8CA 3AVYA 5J4KA 4LX0A 2VP2A 4HAZA 2F3TA 1XEXB 1W0KA 2QPAA 3KTAB 5CB8A 2ZRMA 4M22A 3E70C 3SHWA 3GEIA 3NDPA 2HF9A 5AWFC 3THXA 2FPKA 2YVUA 2RGNC 3K70B 3IUYA 1A2BA 2IWRA 4LCBA 1SKQA 2QMEA 3A1VA 4JLKA 4AD8A 2JLXA 4KLZA 2E87A 3ASZA 1TNDA 4Q4AB 1NP6A 2C98A 2VTKA 4II7A 4IEEA 4ZO4A 3GLFB 4KVAA 2O8FA 3T15A 2YC2C 4PAQA 1P61B 2ZI4A 3X2SA 4LYAA 4EQ6B 4HLQB 5CB6A 1FQKA 1X8KA 2B21A 1AZSC 3W6OA 3QKSB 4TYQA 2GEVA 1N6RA 2ZI6A 5KDLA 5DLQC 1TQ4A 2XOKA 2XNSA 3LA6A 3BH7A 4QGAA 5HR5A 1MO5A 5DE3A 1G1MA 1E2PA 1CIPA 2EFGA 4QJ4A 1ZMXA 3RVBA 3DOEA 2WJVA 4TTQA 2W83A 1JBKA 2DCUA 1Q3TA 3CRW1 1KGDA 3Q85A 4KVGA 3TSZA 2IHYA 5GJCA 3TKLA 4I1VA 1KO8A 1U8ZA 5SZIA 3MJRA 1A4RA 1Z8FA 1IY2A 1SKYE 4B3GA 2NO7A 1G64A 2FFHA 2IUTA 2XTNA 4BFVA 1XZPA 2OE2A 2C99A 1QHHB 4OQMA 1KO4A 3LQQA 1HT2E 5JWOA 1Z5ZA 3E5HA 4OI0A 3I8XA 1OHHA 4BWYA 1MABA 4C7OB 1U0LA 1LB1B 3KL4A 5IK2A 2X2EA 2ZETA 4FMDB 2CCJA 4O3MA 4RFSA 2BIFA 1F2TB 4IHQA 5FPSA 2V3CC 4ZDJA 1AQUA 1NBMD 2GCOA 2GVDC 3HU3A 2ZYWX 3DM5A 4WZBE 2XX3A 4N0EA 4QHSA 4QBIA 4E07A 2W0SA 3OAAD 4D81A 2FSGA 1TEVA 3LVQE 3REFA 4RY2A 5FBLB 2YOHA 1SVMA 3WRYC 3OEED 2EFDB 3UPUA 4AG6A 2WAYA 1SGWA 2A5YB 1CXZA 1OT3A 1CR1A 2UZIR 1P9WA 1VCOA 2WIBA 3BFXA 3HYTA 2NPIA 4W7SA 2ZJYA 2W58A 1E9DA 1P2VA 4TLDA 5EE0A 4OK6A 3RDPA 2XNDA 1OFUX 2IYRA 1NSFA 1G17A 2JEOA 1QF9A 1FNMA 1KMHB 2J46A 2X8AA 4JBXA 4MRPA 4US1R 1KO7A 4U02A 2ZI7A 4XWOA 4A36A 1ZNWA 1FTSA 3H4MA 1SXJC 3TSOA 3TJZA 4KLNA 5H68A 1KDPA 4JLPA 3TUZC 4Q5IA 4DLTA 2GCOB 1TU3A 1E9AA 1SXJB 2JJ1A 1VG1A 2XJ4A 2GEDA 4NH0A 2UVQA 2CCKA 4URYR 2BKEA 1FL9A 3IEUA
chains in the Genus database with same CATH superfamily
1WTAA 3MLBA 2XUQA 1KPHA 4IRMA 1TD1A 5ICFA 3MGBA 4LBZA 2BY4A 4ITRC 4CIBA 4C3OB 2GPBA 4HI0E 5IJAA 3I52A 3NZEA 2XE7A 3PFNA 4O4IA 3TR5A 3MJ4A 2DTDA 3HYRA 2MOKA 1I7NA 4DR6B 1WP9A 2HX1A 3NBAA 4F2PA 1JB1A 5HGXA 2XODA 2FHSA 5FCDA 4HY3A 1VE9A 2HRCA 4E7PA 2IS6A 5TPWB 3QPWA 1O6BA 4NFSA 1P4GA 4TZ6A 2WLSA 4WXHA 3AVOA 5A5VA 1ONPA 1A8IA 2SICE 1UMBB 3EA4A 4ZOEA 1IM2A 2DJIA 4R54A 5DTMA 4H7DA 2G36A 2D0PB 1JPJA 2FP4A 2I2BA 3I0NA 2J6IA 1SA0B 1Y4AE 4R51A 4FD2A 4R83A 2W2PA 1XB2A 3NTRA 3QOFA 4A8HA 1O94C 2HYIC 2I22A 3RC2A 4YXWD 1WTCA 4V24A 5B3AA 1P7ZA 1QF6A 3WAGA 1I6WA 5L6LB 1HLGA 5G41A 4C89A 5B64A 1WXGA 1WOYA 4K6HA 5LZ2A 1V71A 4CHTA 1II9A 4CMJA 1C8LA 1L6IA 3OAAA 3M4ZA 4Q9HA 3STXA 4NC9A 5AVVA 1KZ9A 2QN3A 4YJ3B 3E9ZA 4CN9A 4RZUA 2PUEA 3HDJA 1EBUA 1O5IA 3X44A 3U4QA 3OIWA 4ROSA 4DLSA 1ST3A 4Y9DA 1RBYA 2AK2A 2DHEA 4IPTA 3EN0A 4MKGA 4CLRA 3OIUA 2AC7A 1E7SA 4OFXA 1PS9A 3JQPA 3SJAA 4HN2A 1XDZA 3GT0A 1N34B 3CUKA 3VH1A 5KOYA 2JBWA 4BP1A 1CYEA 4RVDA 4YDSA 4AJNA 3WGUA 2Y99A 3OETA 2VJPA 3SEFA 3LLCA 4A0QA 3UOGA 3ZE2B 4E3WA 1IY8A 3KWFA 5GJVC 1AMNA 4IDAA 2QUKA 1LV7A 3I5YA 3C6BA 1C7EA 3DDOA 1IRXA 1EK2A 3GPDG 1KYIA 1KXZA 3CKKA 4B4DA 4YX9A 5F21A 3VZCA 1UKAA 2ISQA 3QENA 4Z53A 1VC2A 2GNOA 1OSNA 3D5EA 3HBAA 4CTMA 1NXXA 3GJ7A 1TEHA 3ASVA 4JITA 1DG1G 1TK3A 1C7ZA 3M4XA 1AS0A 2RGRA 3X1WA 1FUEA 5C5EA 3FRIA 1I7QB 1O8BA 3AR7A 3RUCA 3DLHA 1CY8A 3CU5A 2IS1A 1Y9AA 3AF2A 5IZ4A 4O4LA 4EQ6A 4QODA 5CVDA 3WWOA 5TGTA 1TO1E 4ILEA 1ZVVA 4QHTA 1IBRA 2PUHA 3ENNA 3DCJA 3F6SA 3L0CA 4O5AA 5GV8A 2OQVA 5H82A 4Q02A 4Z7QB 1TK2A 2Q0SA 4QE3A 4BU0A 2JANA 3T95A 1O6CA 2PLNA 2SKEA 2GCEA 3FB1A 5IUNC 1UKYA 3M81A 1ZW1A 2B8TA 3R23A 5CTAA 1SXJE 4XSGA 2DPGA 4IIYA 5IJWA 3A05A 5CT9A 2VYCA 1SCIA 4DR1B 4MAAA 3CZRA 2B5WA 2FZKA 4FGWA 1B3RA 1JQJC 3VO1A 3FLMA 3U4QB 3U60B 1BYUA 3PDCA 3HTXA 2GZHA 1YU9A 4YROA 1RS0A 2R68A 4HDNA 1S01A 4RMIA 1JH9A 4ZOQI 3HNOA 3KRTA 1EFUA 4CM3A 5L3QB 5C3MA 4MYSA 2J9YB 1DDOA 1K3FA 1VJ5A 3U62A 3QJGA 1DKOA 2HCFA 3L07A 2FEAA 5B6PA 2CXTA 3S5UA 4XM0A 2H11A 3CURA 2J45A 1U6JA 3OUUA 3C45A 4HYTA 3CRQA 3L0YA 1JU3A 1J8QA 3IBSA 1A9XB 3NEYA 5B2ZA 1K8RA 3SZOA 3OZWA 1X8XA 2PT9A 4G0VA 1EU1A 1LTKA 1SBNE 2O20A 5JSFA 3IQHX 3EDYA 3NTOA 4BVJA 2HQBA 2QLLA 2AE1A 4CODB 4Q7KA 1AMOA 1LDYA 2CNNA 5T8KA 2XRZA 5A4JA 1F1BA 4FWTA 1CY1A 1Z5UA 1JU4A 3QI2A 4GBGA 5TRTA 1ZRNA 4XW2A 4DVGA 3Q8MA 1UFOA 1LFDB 4MW2A 4RM2A 5DM70 3P19A 1KKMA 2QYHA 3EOAI 1DO8A 3ETLA 1B74A 1NXOA 3GLGB 2Q3FA 4PHTA 3OPMA 2XADA 2XIJA 1M1XB 1G8HA 3RKRA 1RAEA 3EF1A 3TQQA 1XTIA 2Q8PA 1YZHA 4UREA 1BW9B 1MPTA 2C4NA 2HMTA 3MUEA 3N28A 4ZPJA 5F1PA 3A4VA 5BN1A 3BSSA 2MSLA 1FTGA 2GD1O 2VTDA 2A84A 2QZPA 4O4LB 2Q46A 4W8OA 3HNRA 3OY2A 2IZ1A 4AUNA 1KETA 3RSZA 3RU3A 3FHJA 3BX1A 1QZTA 4PZUA 1C29B 1NSYA 5HM8A 4RV9A 4PFJA 1AF4A 1KZ1A 1ESMA 1L8OA 1NF9A 4IZIA 1CNFA 4FOTA 1JIQA 4BVEA 3B70A 3S8EA 2DXIA 1C0IA 4XASA 1DOHA 1G5RA 1B0ZA 2ZITA 3I2GA 4KLCA 4UHCA 3ORRA 1PR5A 4BJHB 2EX4A 3LECA 4EUEA 2NNLD 2J0QA 5EFZA 1X7DA 4BC0A 4CHGA 3VU3A 5C4IA 1JQEA 2GYVA 1LC3A 2FWAA 4H7FA 4AJ4A 3QX3A 1JBQA 2R96A 2Z1NA 3CF4G 3EVDA 3SOPA 2HSEA 5E3HA 2ZIAA 4MHOA 4OHBA 4KMSA 4MYRA 4MINA 2FUKA 1XZEA 2X9LA 4RYDA 3WDLA 5BSGA 2V6JA 2X8JB 2XE4A 1IIBA 3MBOA 4LZLA 4Q4DA 4TGLA 4BLPA 3H1TA 1XKXA 3JQ9A 4GGPA 4OMDA 4DSAA 3ROPA 1RQ7A 4DIBA 3VR5A 5NLLA 2AOUA 3F78A 3TTUA 1SUAA 1T3TA 5KTMA 2ODPA 2F9LA 1Y82A 1WXHA 1A9PA 1BHQ1 2TS1A 4TMFA 3RTDA 2XNDD 3DZ8A 2YMQA 4YJFB 1KDYA 3T3MB 4C4OA 4AY6A 1JH8A 5EG5A 4GBED 2BCJQ 1NMEA 1C5KA 1R9NA 1LTHR 1VL1A 1F2VA 3AH8A 3WGZA 3ZZUA 2HCBA 4Y6LA 2MYNA 3H1BA 4B7AA 3RREA 5EFOA 3C3XA 4KSYA 2YZKA 3NHAA 2XY4A 3NHUA 4QWWA 2NSYA 3TMKA 4BFXA 2HA4A 3ZX5A 2E89A 1DRWA 2DETA 3THWB 3GLRA 3L8FA 2OM6A 3RG8A 5C1BA 3KP1A 3TLGA 3TYXA 1DT3A 1MOPA 4OGWA 4XKJA 2ZRBA 5FAXA 3OA0A 1ZL0A 2R2AA 2ZG6A 3ZW8A 1MC4A 2XAAA 3L3BA 1M10A 2MSKA 3LE8A 4IQ0A 3QG5A 3BZWA 1VL2A 7AT1A 5FLKA 1J56A 1MXFA 2R6HA 2CHVA 4YH1A 4F9GA 5CYGA 3QVLA 1EJ6A 2O2CA 1FZQA 1I5OA 2QRQA 3DFKA 3NIFB 2CUNA 2WJWA 5KYVA 1QGUA 2QTRA 1BKYA 1PZMA 2E2WA 3OLQA 2QD5A 2QJRA 4HZGA 1XZAA 4WUVA 4XEUA 1AUVA 1EX6A 4MEJA 4BO8A 2AR9A 3GMDA 3OCZA 4IUYA 3UJHA 2H1CA 4BTLA 3JZMA 3OQPA 2DFTA 1PD0A 4IOKA 5BW6B 2WJHA 1MGPA 3HEMA 1PQPA 3SC6A 1W47A 1M6EX 1UM9B 5LYYA 5T41A 4BX0A 4JX9A 4LJSA 1LBTA 3LBHA 5DYYA 4CKBA 1IXRC 3RSOA 2R7NA 1KMHA 4JJFA 4YCBA 4OHZA 2OLEA 2PO5A 2VWPA 4N65A 1GFIA 2P69A 4IFEA 4RY0A 1NPYA 4ZA2A 4A0RA 4I14A 1QPBA 5C35A 1MNAA 4JEHA 5I9BA 1RVDA 3R7WB 4EG3A 1CFJA 1SU8A 2VNJA 4LJLA 5HF5A 1JHUA 2PJZA 4H3HB 2CV2A 4XIYA 1P72A 4U2DA 2HA6A 1IUKA 4ALMA 3HMKA 2BFWA 4AP6A 4AY4A 4I46A 3ZQJA 3AIMA 2Q0QA 5C1DA 4IDHA 1XPUA 1SURA 2ID8A 1U31A 1JU9A 3O73A 1G7CA 1NAHA 2A4KA 4Q00A 2OCXA 3UMSA 4DWOA 2GM4A 4M1YA 1SBIA 2NO1A 3CLSC 1JWBB 2VQ3A 2ZB2A 3G0GA 3PNBA 4EYOA 5LQUA 3EC7A 1NFQA 4FZVA 1YRWA 3BMXA 1SZDA 1YCFA 1HETA 3I9OA 4GE0A 5FT9A 5JH7F 1Z2PX 4WY8A 4U7WA 2FPUA 5DOVA 4RGBA 3TPCA 1N2CE 4Z1MA 3SFTA 2IA5A 2EYQA 4LJ4A 4XA8A 4DC1A 3HSSA 3ZEAA 1KJQA 3FJYA 1Y8AA 4RLFA 1PWYE 1KKLA 4I5GA 3QOXA 3RODA 1Y80A 2HLDA 4ZT6A 2CB0A 3B5EA 2JAPA 3RUIA 4AZWA 3BMCB 1WB6A 3ADCA 1K68A 1EX7A 2Q5CA 3BHNA 4IOJA 4FFOA 2PS3A 1E3EA 1KNXA 4H1UA 3UJ7A 3MWEB 4LSMA 4IR7A 4G85A 5KYKA 3OU6A 1FBTA 2VP6A 4Y2GA 4BBJA 1KH2A 4HDSA 1KZ4A 1NJ2A 4BWFB 1JLHA 1TIKA 2H1RA 3R3JA 4C7KA 4CG2A 2PANA 2CHFA 4EB0A 4EFKA 2NQTA 1NUSA 3AVYA 2COKA 4MW4A 1M2EA 1UPCA 3F3MA 3LWZA 2O3TA 1P39A 2Z09A 1QM5A 3RK4A 4H7KA 1H93A 1U7OA 3OFND 2G5TA 3T9FA 3SP1A 5FUWA 3V4VB 4AIRA 2IQIA 1AQ6A 1PW5A 3JQBA 2HB6A 1ZD4A 2D5CA 2QTAA 3V9AA 1OYOA 3PQ4A 1L7OA 3EY9A 1A8QA 3DZIA 4BQEA 4UQLA 4DV2B 4E09A 3QLUA 3AGPA 2XCSB 2VWGA 5JATA 2O23A 1S02A 1HT3A 2H9AA 3CEMA 1NUPA 3VX3A 3ZW9A 4CM9D 4PEVA 4KREA 2O2ZA 4BP8A 4E5MA 3HB1A 3RVOA 3R3WA 2H92A 3EIHA 1DCMA 1QSGA 1W1UA 1E2NA 2OGSA 3VPDA 2OCYC 2WBLC 2ZSBA 1PK7A 4NP6A 2A9FA 4G4SO 3FOWA 3PHHA 3MA0A 1D9ZA 2WYWA 1YACA 1SZPA 2NTYC 2W6CX 4ISBA 5FWXA 4YRZA 5COAA 2FZEA 4B81A 1V7CA 3GBVA 2HOQA 3MRTA 4D98A 3LH5A 1VHTA 5HMMA 1XRLA 4NJMB 2BMDA 3MJCA 4RF4A 3W2EA 4LE2A 4KQEA 1UKZA 2NU8A 2UXBB 3DEZA 4CU5A 1FS6A 2JIQA 4AM8A 3CRZA 3R6TA 5EYPA 3H6GA 4ZI7B 4B3RB 1HX7A 3GLFE 3G5TA 2AQ8A 3EAQA 1WKCA 5AUNB 1M7GA 1O94A 1ORWA 4JUDX 5DPMA 2MMCA 3M5PA 3HN6A 3NI2A 5KAPA 4BAGA 2AQIA 2Y8EA 4KTTE 4C4AA 1NKTA 2X22A 5L95A 4PANA 1E2LA 4URHA 3ZDCA 3E53A 2MCFA 3OM0A 4M9RA 4EG5A 4EHFA 3ZS8A 2PD6A 5CNIA 3AEKB 1OIXA 2YXPX 4TYMA 3LC2O 2NUTA 4F92B 3OOYA 1VCNA 1ZR4A 2I7DA 4ESOA 1X6VA 4M9UA 1XDWA 2CWWA 3DO5A 5HJ5A 3BHJA 2UUCB 4IKPA 2ZUVA 4ZOLA 3IC5A 5DSZA 1T0HB 3TVYA 4MCJA 4LGMA 3O0TA 3A4TA 3KWJA 4BB5A 2EF1A 1P3Y1 3WADA 2P40A 3T0GA 4LXYA 1RM0A 4TSFA 3GO4A 4G1MB 2UUPA 1UPFA 2BFCB 2GN2A 5EZQA 4YV0A 4R16A 1I14A 3F8TA 4LVCA 3TH5A 4M0EA 4JC5A 1AHIA 4TT8A 5AHRA 4EJ6A 2J7PA 1T0BA 2QI9C 2GZMA 1RJEA 1V11A 3QPBA 1IWPB 5ECWA 4BNYA 3EISA 3FCAA 3PIRA 1A97A 4IJ6A 1XRRA 2OBNA 1JLLA 3QIAA 5EJGA 1AG9A 5I48A 2FA9A 3GEDA 1EI9A 5EZYA 1QWSA 5DHQA 3VR6H 5K0SA 3I8OA 4CCWA 4BKRA 1U9IC 2QJWA 3B3JA 4UXIA 2AD5A 3FMIA 2XQVA 1OXUA 3I92A 4J7CA 4MV0A 1UMKA 3HZZA 4O4HA 1DX9A 3WS7A 1YL5A 2X8JA 3G88A 4IFTA 1PS8A 1T10A 1VJ1A 1ZXXA 1QLWA 2JI4A 4UZFA 3E05A 1XLTA 1V41E 3NOVA 4JB2A 1Q22A 3GDGA 5JNUA 2HDNB 4MUHA 2I29A 2NX2A 2G28A 4KUHA 4QDUA 4WKOA 3WB2A 5HKBA 1F17A 2EV9A 2FJ0A 2Q1WA 2VKQA 3OFNA 4LTNA 4YRLA 5E6UB 4LG1A 3T4XA 4Y9RA 3VU9A 3AF0A 5KQLA 2W2OA 3VQTA 1GPBA 2BCGY 3GJSA 2L82A 3HBLA 4R2HA 3ETGA 3V8EA 4HDRB 2WMYA 4CPDA 2C31A 1LQ2A 1ADJA 1QAMA 3W8FA 4OMUA 1ONBA 3OQVA 3W06A 2OFPA 4HV4A 4M89A 1XV5A 4MWSA 3ZZNA 2O2SA 3T1QA 3LBFA 2GFIA 1G5HA 4ZCLA 1GP2A 1NLZA 2WZQA 5HG0A 5HGJA 1J0DA 1XZMA 2I99A 1V8DA 1JSLA 4RK7A 3C5HA 3DLBA 1KI1A 4PCAA 3PDIA 1SG0A 4ZHQF 4W5NA 4MW9A 1GRNA 4JNKA 3SF8B 4TLCA 4DA6A 3KEMA 1WBDA 1YQWA 2ERXA 2QTZA 2YIDA 4B8YA 4NV0A 3IAS6 1BDBA 2CBXA 2GCIA 1Q5PA 4D80A 2HZBA 4MB2A 1VXOA 3PRKE 1WE2A 4CR8A 3S8YA 1UBSB 3SR4A 3FTQA 1ZMRA 2FFRA 1ISHA 3HB4X 1N8TA 1E1QD 1P0MA 1Q19A 3A6ZA 4V0KA 3UW1A 1LS1A 4PSVA 2IV2X 1YQEA 2VN8A 2HW8A 2ZBUA 3UOWA 1BFUA 2NWQA 4CMHA 1EDDA 1FUIA 3ZHSA 4O4JB 3GZ4A 2E37A 3WKDA 4X84A 1L7EA 1EEXB 2C3PA 1CRLA 4YMHA 1VPVA 1JR4A 2FRVA 2LKDA 1XOIA 1SXJD 1Y1TA 4GP9A 4IVNA 4P4UA 4LJ5A 4CIWA 3I05A 2FB9A 3PJFA 2CBGA 4J07A 2DVMA 1H0KA 2WT9A 4AUKA 4C29A 4IJVA 5BYBA 1CQPA 3EYWA 2X4LA 4UCQA 2AW3A 1M6VB 4JJIA 3BHMA 3DE3X 2WWRA 2XIQA 1W5SA 1KDTA 3DT8A 5ER9A 3PGJA 4PLHA 1ZVQA 1W88A 3AEQA 1EA5A 3HH8A 4A73A 4TWIA 2J0VA 1FBNA 1W2GA 4G0QA 4RQAA 1TUBA 4QVKA 2HJVA 4BGDA 4DV5B 4IW3B 3A4IA 4XDYA 1H3EA 3J7AC 3EDRA 3CPHA 4TLMB 4NWIA 2X9NA 2AN3A 1XTTA 3RYHA 3AXSA 4XE5A 3Q3CA 1Y3FE 4UTRA 4IL5A 5F77A 3AM3A 3LZCA 1Q50A 1HQKA 1IPFA 3DXXA 4JGGA 1PWEA 3B7PA 3CA8A 1AKUA 1VMEA 2YVKA 3K8YA 4XPIA 4YYZA 4NHEA 1Z2NX 3N76A 4G9GA 1OR8A 4V38A 4HEJA 3SDSA 1HQDA 3ESBA 1FFEA 4L85A 1ND5A 2VSFA 3CTMA 4HAYA 4MKHA 1NX9A 3UJCA 1NBHA 3ESRA 3ZK7A 2CF5A 1F2UB 4F72A 4PBTA 1Y7TA 1HZZC 4AFNA 3TPZA 3MUOA 1MC8A 4XDGA 3E22A 5DX0A 2Z2YA 3IAAA 1K3TA 2TMDA 5IJXA 5SY9A 3GJ0A 5A5GA 1ENOA 2I6UA 4GZ6A 1JQLB 1NX6A 2JI6A 1SC1A 2IH5A 1D3AA 2HNAA 1L5KA 1G7TA 4MQ6A 4F4JA 2B3DA 1UPBA 3R0VA 4MV7A 3NASA 2CNOA 1V9LA 2E1RA 3ESDA 4FX5A 2VP4A 4YJHB 3W5UA 3U16A 5EJ4A 1WCWA 3S40A 1ZI8A 3B8HA 3PEFA 5IC5A 4J0JA 1GN8A 1GV0A 5CYOA 5AKHA 5DWDA 3WK9A 3G2QA 1SQFA 1IN1A 2CLOB 2GEBA 3G8BA 4RO0A 2SCUB 3IQGX 3V1UA 1M1NB 1QQTA 3R4CA 1E5VA 2QIOA 4TV9B 3T6KA 1JXOA 2X0KA 3QOWA 1TZ2A 3ORHA 4J2TA 4NECA 3T4EA 4AYWA 5BRAA 4MP8A 4H17A 3I5AA 1BAPA 3CONA 1X0VA 1UJMA 3KJNA 4OL9A 1BS1A 5FNVF 1RHRA 3ZKAA 5HM6A 3H9GA 1NOIA 4PU0A 4ENVA 3NXSA 1PJAA 3FHTA 1I3KA 5FBQB 3K0KA 2G80A 4JA0A 2HQOA 4ZC1A 4ZGBA 5HJEA 1YBAA 5IW8A 1CY2A 4QGBA 5LP6C 1ML4A 5A71A 4JLMA 1NC1A 4MHSA 5EXEA 4B1FA 3LRPA 1OH5A 3OU7A 3B8EA 2QX8A 3K9BA 2HCJB 3TBHA 3WP1B 5U9CA 3G5LA 3BDIA 5ALHA 3LC1O 5F51A 1A69A 1NRWA 4MQEA 1MHTA 1LPAB 2DUNA 2J48A 1L9KA 2WSIA 2Y71A 4DMRA 3NBQA 4UUPA 4Z0NA 4F6LA 2ZJ3A 1IBLB 4LMRA 3V2UA 3QVJA 1GPJA 2EX1A 1V0JA 2V1XA 4J90A 5KO2A 3FGOA 1Q0HA 3MUNA 3PFHA 3CZCA 2Y68A 4L0DA 3N8DA 4MRVA 5D5QA 2J6BA 2RB4A 2IYTA 4PZ0A 1M67A 1W36C 2QTHA 3TMAA 3DOCA 1HKHA 3HHPA 4CF7A 4I6GA 3AUAA 3E82A 1XU4A 3N2GA 2HI0A 3JZIA 1EK6A 2B9EA 3QF4A 1WW3A 5JO0A 2DQKA 5LQRA 4K86A 4BMCA 4BMZA 3L1IA 4G0XA 4IZHA 3RUDA 4OXNA 2I4LA 4BP3A 4BL5A 1QHSA 3E35A 4OJKA 1H2FA 1IC6A 2FR1A 4WN3A 4A2WA 2ECPA 3NCTA 4JH0A 5JMWA 4GOOD 1D4AA 1PT5A 2D1FA 3LW7A 2FSHA 3ZVRA 4F4CA 1Q44A 3L46A 1JDTA 2OQRA 4AJ1A 3KKEA 4Z49A 1E8MA 1KK1A 1W25A 3QEAZ 2Q2NA 3G7SA 4KZKA 3V7YA 1VGQA 2PLWA 3OOEA 3MC1A 4J2HA 3G2HA 4Q24A 1NN0A 2PH5A 3FSGA 3T99A 4PYMA 2WA2A 3WQSB 1R0KA 3G2PA 4NZ9A 3JSAA 3WOVA 1NLYA 2KSQA 2NO4A 1Z6ZA 2QL9A 1NHWA 1OB2A 5FFMA 2HK8A 3MRVA 4MI1A 1NBAA 3H9QA 3P71T 4MV4A 2VJLA 4XD7A 2JFFA 3Q7EA 3H2KA 1Q6ZA 4RKYA 1G63A 1RACA 3AIOA 2AA3A 3DTVB 3KT0A 1DBVO 2AUMA 3JYQA 4XYEA 1Z7EA 4DLUA 4D9BA 3F71A 3L6OO 5BSFA 2LD4A 2CJYA 5F1OA 1VBNA 4KWIA 3OTWA 3ITDA 4U2EA 4YS6A 3BIOA 3CLKA 1CRPA 1E6EA 3KTFA 2PGNA 3D3EA 3EXEB 5ILQA 3R3ZA 4GPIB 5CA0A 1A9RA 1NATA 2RBKA 3LBNA 2OCKA 4K2HA 4V39A 3NKLA 1GSHA 4O59O 3PV0A 4KYIB 4Q9KA 5DBHX 3HWSA 5FUMA 2GN4A 1S3FA 4S0XA 4PLZA 2BJHA 4DOMA 1L9XA 3UMMA 3KUUA 4BE4A 5AI8A 1I5RA 5IHPA 4JJ7A 1YQXA 4X1IA 1QG0A 2D0OB 5MN6A 4B80A 5JZOA 4ZVPA 1WLSA 1U7PA 3RHSA 2RK6A 2I0FA 4MCHA 4OQDA 5AJVB 2ZTVA 1I1OA 4JQYA 1ZINA 4UEJA 3FSJX 3ZCQA 1UZUA 3CIFA 3NYQA 1JPVA 3VUFA 4X0EA 3ZE7A 3HO1A 1Z37A 1G4HA 4X44A 2ZRFA 5F4BA 5HA5A 4QHYA 2GEKA 3JVIA 3PT5A 2DQSA 1G59A 3O95A 4RD0A 4WERA 1XKQA 2VPWA 4YDHB 1OLXA 3A0RB 4NEHB 4QAJA 3QELB 4BASA 2N1BA 1DJNA 1Y42X 2AMLA 3ML1A 4PXSA 4J0IA 5FV4A 1I4DD 1Y7HA 2ZUBA 4R8MA 5JD6A 5FX2A 1QQ5A 2G6BA 2IHVA 2OZEA 4S2EA 2BW0A 2WWVD 1H3FA 1YZVA 2X15A 3L7AA 4EFMA 2JC3A 4YQFA 3ZG6A 1M34B 3KC2A 4OOFA 5H02A 5KNCD 4Q9AA 4MUGA 5TY0A 2J7KA 4QQNA 4BN0A 2DR3A 1APBA 2P3SA 2W4MA 2GXQA 2WE8A 1LBQA 2DWQA 3ES9A 4MITA 3WGHA 1XCBA 3PUKA 1Q1EA 1X15A 2OR3A 3ETDA 1E59A 2QTVA 5HUHA 3AUYA 2ACEA 4ZVQA 1KDZA 4EHKA 1F60A 5DCYA 4BE7B 4F9FA 5A04A 3ADBA 4JI5B 1SKUA 4E5DA 4C3ZA 1JKJA 3RYFA 4RTJA 5LZ9A 3U7FB 4M76B 3JALB 4RIGA 4YYEA 2Z43A 3GQBA 3RSHA 5IANA 5KOJA 4LF6B 3EWNA 1NXQA 3PLAE 1E61A 2RIRA 4TQAA 3NHLA 4C2TA 4Q4LA 5ER6A 2PKYX 5E1OA 3FMOB 2FEXA 5KAMA 2XZTA 2PXXA 4YRAA 3I9MA 1BWPA 2E5WA 5CLLA 1A8PA 5DBEX 2VUSA 4PGHA 3RBZA 3V4OA 1STOA 1WBBA 1G6KA 3Q3JB 1HNXB 3DVSX 2ZT6A 2QBYA 4DPKA 1AS2A 4MVCA 5K6TA 5LIPA 1QYDA 1G60A 1WDTA 4UM7A 5DNUA 4QA9A 5LKRA 5A03A 1VBMA 1WOMA 2J3KA 3I0MA 1DKQA 2G70A 1GAEO 3MPOA 5FTNA 1YVPA 4X90A 1KZGB 1RCFA 5DMXA 2B25A 1VZ2A 1ZSVA 5G0UA 4NEQA 1F7UA 4NZNA 1WV0A 4ZI7A 2PUJA 4QM6A 4LJ9A 4PVCA 1L7XA 1ELOA 4H6PA 2PU7A 3IP8A 1XTKA 1AK2A 2IODA 2PVCA 4PYKA 3GLUA 2GO1A 1QYWA 2QF7A 2XCQA 2PLAA 4C04A 3NJ8A 4WNIA 1DU4A 1KAEA 2R85A 4HWGA 1GRCA 2YXDA 3IUBA 2HPAA 3KXLA 1DADA 2B5VA 2F62A 4H08A 5TXGA 3GP5A 4BV3A 3BRCA 4WOJA 2DKNA 2O05A 1PX0A 1YZTA 1QKJA 5BQPA 4UUMA 3FZEA 4L4ZA 4TZ0A 1PFWA 2WSYB 3I76A 3UV3A 4L9AA 4W6ZA 3JWEA 2B99A 5IN5A 4R84A 2LP4Y 1Z0AA 2NO5A 3NWBA 4LHYA 4M9ZA 1JG1A 1IB6A 4H0FA 4IQ4A 5JCPA 4XUCA 4QGFA 3WL6A 2QRPA 5COBA 3JATB 3DLIA 3AEZA 3NWJA 3R6WA 1NZFA 2PGIA 1CU1A 4I36A 4E88A 5LQMA 4EG1A 1QHHA 3PL5A 5LC1A 1D2AA 2C9OA 2FWNA 3EAFA 4OBBA 2IHTA 4QXOA 3EC1A 1GPH1 3CWQA 5EXXA 1WR8A 2W2LD 3DO6A 1X1SA 4QLAA 4TLEA 4XX1A 2F67A 4P0TA 3J81A 3L7BA 3I72A 4C08A 3M49A 4RS4A 1WX1A 3G9XA 1B7GO 5LL6P 3VNUA 2WJ6A 4WFJA 2Q3CA 3K5HA 3IT3A 3O4VA 2ORWA 3WIDA 2UXCB 1LUAA 5JR3A 3H8JA 3LGAA 3DLAA 4Q3AA 1DBQA 2CK3A 5BURA 1AKTA 1PLKA 3M1LA 3NAQA 2XAUA 3WQHA 5AVTA 5EWMB 2B61A 2IBTA 3NVKI 4B4UA 4HLCA 4MV3A 2ZSEA 4C9BA 5JY1A 2APJA 3U3DA 4DYDA 2G0TA 3O4IA 1QFZA 5AW1A 3QVGB 3PHGA 4Q15A 1DQPA 1U9ZA 4LBWA 1KJZA 5F73A 3PLNA 3Q3IA 2X4DA 4FU0A 1GO2A 5JRZA 4B3DA 3GPIA 4OPMA 3LNCA 1XDSA 1K27A 5IFLA 4MDYA 1G38A 4BVLA 3M6VA 5BN3B 3B1ZA 2Z4TA 2ATXA 2XV1A 3QNWA 4L9WA 5F76A 2Y1FA 2IH4A 4KWCA 3FWYA 3LUFA 2YASA 3NRCA 4FYMA 3N75A 2IIVA 4CMKA 3OEEA 4HAVA 4Q9JA 9ABPA 2NP6A 4GPD1 2F1KA 1ZD8A 4AF7A 2CDAA 5IZCC 3HDTA 1UK7A 4FBMA 2UZ4A 1JZQA 3AZOA 3JAWB 4LZOA 3TFQA 1K7CA 1L4EA 3VPXA 3WLHA 3UPDA 5LU9A 4RV4A 3WLKX 3SZUA 2BHTA 2QTBA 2Y1DA 4E30A 2PKQO 3OKFA 4R68A 1EM8B 1YOVB 4L2IB 2IPAB 4EMUA 2GBLA 2BMEA 4GP7A 3ELWA 4G4JA 5FD8A 3PB3A 3FW1A 2EZTA 4D41A 1W6UA 4AQ7A 2B1JA 3OG9A 2VPTA 1J1ZA 2VOEA 2PXHA 1P5HA 1Z6YA 3LUHA 5AR1A 4TKMA 3ED5A 4YACA 3HKDA 3B5JA 5E4JA 1HL3A 2VNKA 1PJ3A 1Z8NA 2FZ4A 1XBTA 3FN4A 4HUQB 5ERXA 3JWGA 3UJ6A 3W8DA 5KYXA 2EZ9A 1K75A 3T0IA 2G4VA 3M5CA 3PFWO 3IIJA 5JV5A 3G13A 3RS3A 3TD9A 4ID9A 4QOJA 2QPLA 3O3MB 3P9CA 5JG7A 4AB1A 2FNAA 5LOVF 3FDIA 2NZXA 2VS1A 2WFLA 2Z5LA 1Z4OA 2ATCA 2Y3IA 1A4XA 3T06B 3KTOA 2HADA 1SQ6A 4IXWA 3G79A 3GH1A 2R62A 1IHPA 4DMUB 3OD5A 2NM0A 3TLJA 1PT7A 1YRQA 2FCRA 3LL7A 4DSZA 1I94B 2IDKA 3DFZA 3AR4A 1A9OA 3KFVA 3G0IA 4GM1A 4X6YA 2O52A 4G24A 1G8GA 1N1DA 1XTPA 2OB2A 5LMCA 5HF6A 2NP7A 2P4QA 4JUBA 2P9JA 4IIXA 3SKXA 3TOSA 4B3BA 4BJ1A 3MTQA 2I2AA 1YKFA 4HP8A 2TSYB 1XALA 1BJKA 1AKEA 2R9VA 2ZJFA 3DVAB 1JSRA 5DTRA 4RTKA 4QXRA 1TJPB 1IE3A 5MN5A 4R8SA 3Q3HA 3JWPA 4AO8A 4D3SA 1SG9A 4X63A 2AQHA 1II8A 2REBA 2F9MA 1F48A 1J07A 2P65A 3HB0A 5JNSA 4OHMA 3LQ1A 3PHIA 1W73A 4MXDA 1NYTA 3R5FA 1UXKA 1H6BA 1Z5PA 4X65B 4G0WA 1DQZA 1PDWA 1XMPA 1NG1A 3TTVA 5TMDA 2NGRA 3W8NA 1A2KC 1P2DA 4JL5A 4W9RA 3AKCA 4ZANA 5LZ4A 3LO5A 2AKYA 1OA0A 2Q3MA 3N74A 3O75A 1J2EA 4I3GA 4DCPA 3PEWA 4GOKA 4WK0B 1D8TA 1H4VB 1TI7A 2ZRGA 3VYRB 1U3CA 4RSHA 1Q0RA 5BVHA 2JK1A 3FVVA 4Z86A 3NHSA 1Y8RB 1J21A 1W9HA 4JXXA 3CZ9A 1ZI6A 1G8JA 1X7WA 3HRHA 2ACWA 4X1KB 2GXAA 1W30A 3LY8A 4XLTA 2OLKA 4E4TA 2CLSA 5ITVA 1R0WA 4YRCA 4BZXA 2YC4C 3E15A 3WLQA 3AJRA 4TQ9A 3FGNA 3C2QA 3C8UA 3II6X 5CAEB 1R37A 3NGMA 1SUFA 2PKRA 4OQZA 3ZWQA 2SCUA 4E13A 4PN3A 2GX6A 3KWLA 4DT1B 4FDLA 1CSEE 2E48A 2OV3A 1T5DX 1WMEA 1PR3A 3BXPA 3GVXA 3DKRA 3GVCA 4PZLA 5FFNA 2PCJA 1S3SA 2WW8A 5FPYA 2QLNA 3VISA 4BKOA 1H2ZA 3KSBC 1MF7A 1U9JA 4G5SA 3TKAA 4LZAA 1WZEA 2EIHA 1NOKA 1RJDA 3BB4A 4H6VA 3IEVA 1SRQA 3MCUA 3ZOZA 4KYVA 2HTFA 2QA5A 721PA 1EXDA 5C7LO 4FMBB 3LMKA 5L53A 4MW7A 5HTKA 4DEVA 1IK6A 4OHFA 4YR9A 5LBUA 2VT3A 1XD2A 5HK9A 5KTSA 2ETVA 4D02A 5J47A 1C1DB 1TO2E 3GARA 4ARSA 1UBTS 1KI6A 3RSLA 4WKPA 4GVPA 5CURA 1UWCA 3B1FA 1IQRA 3S2ZA 1U0BB 1JUDA 3BWBA 3LC7O 5HQ3B 3OCUA 4OKIA 5I01A 1VM6A 2R25B 5IWCA 4F9EA 4DTIA 1RPAA 3I9NA 3JQDA 1RKXA 3W5JA 3FPEA 4QLOA 3EIOA 1YASA 1L5YA 4YRNA 1QDEA 3O38A 4RA6A 1N2BA 2XGSA 4WCFB 5DI3A 1OY1A 1QFSA 2DT5A 3WZ2A 2GFQA 3TR0A 3N87A 3RHTA 1YZUA 4JLDA 1HEIA 3NDIA 4BB9A 2FP3A 1VBFA 4X61A 2BBWA 1Z0UA 3OEWA 1L1QA 4OJMX 3CSUA 4BQQA 3EX7C 3CVWA 2MT9A 4XXHA 2MDTA 1U3FA 5CITA 3F6BX 2DLNA 1G5QA 3UAXA 5EN4A 1EE9A 4O8CA 3E27A 1YR7A 4X85A 3ORSA 1MXHA 1J0AA 1FVOA 1XQVA 2DM6A 1TKAA 1YTLA 3HWX1 2HR1A 1DAPA 5KNDA 4RCVA 2YMMA 3NAGA 1UBRS 2ERCA 4US0R 3RR2A 4S05A 2BTEA 3ILYA 4JVNA 4CM7A 4UAJA 1NQ5A 4NYIR 2GASA 2PD3A 1PJQA 1T9DA 2DUJA 1RI2A 3GZTB 3BCHA 1E0KA 1EIZA 1MX9A 3WYAA 2YKGA 2ONJA 3HDGA 2BFMA 3ZY4A 5FEMA 2GUGA 3BGOS 1YCHA 4N39A 2NXWA 4MS3A 4HS4A 3H2BA 3KSZO 3TNFA 3ZV5A 4ZVMA 3F3SA 1PWZA 1DX4A 1YULA 2D2VA 2FQWA 2PUAA 1F06A 2OB1A 1GTG1 4MYDA 5FOQA 4K3UA 4LKRA 2DULA 4M7WA 2VI5A 2HSDA 1EJBA 3OE5A 5FA8A 1FP7A 3RC7A 2R8XA 1KI6B 1G7SA 4XYBA 3PXXA 4ABYA 2P75A 2C88A 4JBGA 3QM1A 2KQUA 2PKWA 3OQBA 3BCRA 1E5XA 3NH6A 1NC3A 1GQFA 1M34E 5KJFA 1K3UB 4PR0A 1RYDA 1RTKA 2WWHA 3L7LA 3TOXA 1AU9A 9LDTA 4F4HA 3EARA 1PIWA 4OOEA 5HSGA 4GKKB 1JWAB 2H5IA 2HF8A 1DAIA 1S2OA 3QPVA 4OJTA 2Q50A 1QV9A 1GFSA 1PZNA 1FFBA 3L84A 4KAJA 1XJQA 1ZY2A 3WL8A 2WIFA 5ICEA 1J42A 1HT1E 3OM1A 2ZBFA 3VTKA 3AYXB 3ZBTA 4M8NE 3TRDA 3L92A 1M8JA 1O95D 4BVKA 2BMWA 3AVVA 3AVUA 4IYRA 2UYQA 4DDKA 2OL4A 4F93B 4QNMA 3UKDA 1H85A 1OBVA 3FFWA 3D6NB 2PZKA 3GJTA 4H7JA 4FN5A 2HV8A 1XC7A 3NIBA 4JQZA 5IKOA 3RS4A 4D8VA 1N92A 4DCVA 4OVKA 4F06A 4BBPA 1OBCA 2KS6A 5EIBD 3EIQA 3I83A 3V1NA 2AJCA 2VDLB 4FSXA 3C5EA 3CW2A 4U7FA 2Q5JA 3LHDA 3GRUA 3B3AA 3GUZA 4R2IA 2ZM6B