1XTIA

Structure of wildtype human uap56
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
381
structure length
381
Chain Sequence
b'GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
molecule tags Gene regulation
source organism Homo sapiens
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
total genus 128
structure length 381
sequence length 381
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA02
4MRPA 4WA7A 2C96A 4YDSA 4EAQA 1DAKA 1OXUA 1WRBA 2QE7D 2ONJA 3SI7A 2WWHA 3L82B 5JFGA 4IEIA 1XPOA 3ZD6A 2C04A 4X8HA 2FOLA 5TARA 3A8TA 2W58A 1N2CE 4Z54A 2F7SA 2WTUA 4RKEA 2DB3A 3W6OA 2ANCA 3IEVA 1V43A 1L8QA 4B43A 221PA 1R8QA 3CRQA 5KHOC 3SYKA 4QJ4A 3RHFA 5L3QA 2ZJBA 1N6KA 1HTWA 3DL0A 2ORIA 2UKDA 3CW2A 1DEKA 5GVSA 1YQTA 3KFXA 1ETUA 4KVGA 1GM5A 4Q1EA 1UBGA 4QJ3A 2H1LA 2X2EA 4TLCA 1E4VA 1FNNA 2X19A 3ZS9A 1IN7A 3LLUA 4LHWA 3EA5A 3IGFA 4DSNA 4TSFA 1QVRA 3A58B 1RRCA 4N0EA 4IVPA 3MD0A 4A2WA 3ZS8A 4BPBA 3ADKA 1KDOA 2XITA 2O8CB 1VCMA 4DEXA 2C8VA 3QBTA 3BD9A 2WMNB 3D6TB 4A8JC 3HDTA 1QHSA 4BFSA 1ZUNB 4LYJA 4H1UA 4P0TA 1U0HC 5AUNB 4C7OB 3TJZA 5JJIA 2WIAA 3LBHA 5BN4A 1UEJA 3H84A 2QMOA 4DEYA 3AF0A 2XOKA 2FDCA 3VNVA 2CXXA 5FBWB 5E7JA 4EKDA 3FYHA 2V7QD 1VMAA 1N3BA 3IBYA 4KU4A 4FCVA 5JI3E 3THXB 4LJ7A 2FFAA 1TMKA 3DEFA 4HLCA 1JQLB 1Z06A 1IHUA 1DELA 4ACAA 2IUUA 2WJYA 4V03A 4YC7A 4C0KA 1EXMA 5AK0A 3LX5A 1UPTA 3IBGA 2RCNA 5HE8A 1RYHA 4URVR 1ZAKA 4QGAA 2GJKA 4YDHB 3OFND 1FL9A 1RC8A 4Q47A 2J7PA 3RDPA 2R6FA 1T5IA 4QNRA 2VBCA 2WPDD 1ZRHA 4LJ8A 3I1FA 1QHHA 4GOXA 3T12A 1GL6A 2OLJA 4JLAA 4L9SA 5E7MA 4LBVA 1LV7A 1UKVY 3EC1A 3QNUA 4C7OA 3IHWA 1HQCA 4TQ9A 2ZR7A 2XZPA 4QGGA 3OIVA 2Z4SA 1S3GA 2O8EA 4CEIB 3KKOA 4C9BA 4CT4B 4PO8A 2VP9A 4DDUA 3PUZA 3NDBB 1HUQA 1D9XA 3B78A 3GLIE 2CHQA 4V0KA 1G3UA 2OT3B 3LQQA 3M4YA 3Q72A 2GETA 5CIQA 3PIRA 1XNJA 2PLRA 2DBYA 2IYZA 2AWOA 2PZFA 4FD2A 4OHXA 5EP1A 4B2LA 3TSZA 3AVUA 1ZUIA 4Q9JA 1YZNA 3LW7A 4R71A 4Z8XA 4IDPA 4N1AA 4WIAA 1X6VA 1XXHA 1E9CA 1Z6TA 4K81B 4EPVA 5C2JB 1MRNA 4BRWA 1P75A 3V4FA 3P32A 4RZXA 3K53A 3A1VA 2QNRA 1AS0A 3QF7A 4PC2A 2BIFA 1G1MA 4P33A 1TU4A 2ZROA 4XJXA 2RGNA 4MRNA 1T3HA 4A8JB 3ZQ6A 1Z29A 1F2UA 2QTHA 4BLSA 2J46A 1SHZA 2FF7A 3BC1A 4D4KA 1SVLA 2BCGY 3DKPA 1WA5A 1Y63A 4TQAA 1DAMA 1P2VA 4BZPA 2WICA 4HYYA 4E09A 4F91B 2GCOB 1E2JA 1M34E 1RE0A 1W2HA 2A3RA 3P27A 4FXPA 2PMKA 2F55A 3LLMA 1VYUA 4HB4A 5GJVC 1XD2B 3D8BA 4PANA 1NIJA 1KSJA 3MFYA 4ZDIA 4TYQA 3H1TA 1P9NA 1U94A 4RZ2A 2FPMA 2ZRMA 1KK2A 1YRBA 3W3ZB 1N6NA 2I3BA 3EARA 1P72A 4R7ZA 3BGWA 1ESNA 3AVXA 3EZ9A 4TSFD 3TQFA 4A1FA 1ZM4A 4Q4JB 1Q20A 4KV9A 4JVMA 1G18A 4G5OA 1OE0A 2F3RA 1CJTC 4I1UA 1NKTA 3EZ7A 1WB9A 4URXR 2E87A 4QC2A 4M9QA 4LPKA 4PXAA 2B92A 3TVDA 1GP2A 1CRPA 2W0SA 1MT0A 3K09C 4H9GA 4ARZB 3CPEA 5EXTA 4MRRA 1R5NA 2OLKA 5M04A 4D81A 4DT1A 1E2DA 4KBGA 1O3YA 5HTKA 4QNMA 3TUJC 1XCMA 2QN6A 2ZYWX 4QRHA 3FHCB 2AD5A 3A4LA 4O25A 4PSAA 1S2MA 3KB2A 3ASZA 5JECA 1VYVA 3MRSA 1LTQA 1R0WA 2HJGA 3CWQA 4MGYR 1MO4A 2V1XA 5JWRA 1J8MF 4A8JA 1OIXA 1ZNZA 3VU9B 4LWZA 5DHFA 3QOFA 5A4JA 2C9CA 2ZRJA 1XZPA 1KAGA 4FN5A 4MGKR 3V00A 1R8SA 2NG1A 3T06B 2F9MA 1Z0KA 2IUSA 1X1SA 3UKDA 3K9GA 3SU8A 2ZU0C 3BB4A 4JLPA 3CLVA 2OEPA 3CO5A 1W0KD 5JSZA 1AKYA 4LCBA 1UBEA 5LB2A 1SVSA 1YJ5A 3NBZC 1HQYE 1YZQA 2IXFA 5FPHA 2H7VA 3R7WA 5AJYA 1R0YA 4IXMA 2CCJA 4R2IA 5CK4A 1E9EA 4Q4JA 4DJTA 2REBA 2WWXA 4BFWA 1KKMA 4TQUS 2VLIA 3LX8A 4A0RA 3FE2A 2J7KA 4NL4H 3S1AA 3C5CA 4D0LB 5J4LA 3J81k 2CE2X 2WSSA 4ON9A 5D3MA 4PAQA 4IDOA 4FWTA 3LQRA 1Z83A 1P73A 4C0LA 1AS2A 4PHGA 4IJMA 4GL2A 5E95A 2PJZA 1SKYB 2GXUA 1TAGA 4PPFA 2GHIA 4NONA 3NDPA 3BB3A 5FBQB 4U5XA 2QT1A 4OJKA 1D6JA 3IO3A 1XTSA 1T4GA 2B6HA 1G4UR 1SVWA 2WVJA 4G5GA 4AKIA 3AVTA 3GMTA 3QF4B 2OBMA 4Q4LA 5EXSA 4TTPA 1WXQA 5C46F 5FOUA 4QKQA 4Q7MB 3VTKA 1Z0FA 4TLEA 3K0EA 4HAYA 3Q7QA 2O8DB 4S35A 1YZTA 3AVPA 4LJ4A 3PCRB 2IWHA 5SZIA 4GNKA 4A9AA 2CL7X 1N5KA 2WZQA 3PITA 2G1JA 5EE1A 3WBJA 1W4BA 3GEIA 4GOJA 2ZRKA 4EPYA 4JLOA 1VTKA 4F38A 4TL8A 2OHFA 4OHYA 5L8VA 2V3CC 3AKYA 4TLBA 1NN5A 2ZREA 2QZ4A 4KAXA 2RGNC 4Q03A 1I4DD 4AYTA 4C2UA 2WMOB 1EFRD 2ZI5A 4AG6A 2K5UA 5JLJA 3WP1B 2WJHA 4O2LA 3GCGA 1NKSA 1KZGB 3GJ6A 3VR2A 4OL0A 4B71A 3NEYA 4NBSA 1J7KA 4M1SA 1XEWY 2G6BA 3C4JA 2ZJ8A 5FH9A 4A4DA 1RYFA 2IYLD 4M2LA 4PPQA 3MUFA 3DDCA 2CLSA 1CJKC 3EZFA 5J40A 4PQFA 1L7VC 1W5TA 4HSEA 1JI0A 1SULA 4P4SA 2XXAB 3PFIA 1SXJA 3DMNA 3KUDA 3CZQA 4M0LA 2P0EA 5DYIA 4OI0A 4DLVA 3RRYA 3PUXA 4DC9A 1U0LA 4MYTA 3D31A 1GOTA 2N1BA 2FPKA 5TMPA 3WNDA 1YKSA 2IS2A 3HP1A 4D4LA 2JIZD 2NO0A 2Q3HA 5EZ5A 1D2EA 4BFTA 1MH1A 1R5OA 1JAHA 1F2TA 3THYB 5EXXA 3L43A 2ORWA 4RSGA 2JA1A 3VX4A 1M74A 3KB1A 4URZR 1S4QA 1F6BA 4JLMA 3WYFA 2BMEA 1IN4A 1LW7A 3ZQJA 4DUGA 1B23P 4V02A 2IXGA 4LBWA 1XD2A 4Q48A 1P2UA 1OXTA 3NHAA 3TW8B 5FTMA 5F9FA 4M1TA 4HZUA 4IOMA 4C4PA 1QBKC 4RJLA 2ZRGA 2JIZA 5JJKA 2RH5A 3I73A 4OHVA 1FP6A 1N6LA 2WIBA 2IEYA 3KZ1E 2WKRA 3Q7PA 2LWIA 1ZW6A 3H0KA 1Z08A 2CL0X 3CF2A 1E9AA 1Z0DA 3DPUA 1G7RA 1NL3A 1LB1B 1W0JD 4IOLA 3I62A 4WAUA 4B3DA 4LOAA 4MKHA 1G8PA 2IHBA 3VR5A 5EE3A 1F60A 2QRNA 2D7DA 2ONKA 2XXAA 1HT1E 2QSZA 2QAGA 1G3IA 4M21A 1VECA 1COWA 1PV4A 2R2AA 1YR6A 1T3LA 4XSGA 5DI9A 5FUXA 5JEEA 2PBRA 2WWIA 1GIAA 3RLFA 1IXSB 3TW4A 3OESA 5KSPA 1BYIA 2GK7A 5A0FA 3ZJYA 4JLNA 4U00A 2ZM5A 1JPNA 4EFNA 1XB2A 2IA5A 5JWOA 2IYSA 4R9UC 1OFUX 2YWEA 2V4ZA 3BJIC 1UM8A 2QAJA 1TPZA 121PA 2ORVA 3A1SA 2FG5A 5AUPB 2H16A 1L2TA 3LO5A 1EK0A 2QMHA 2ZRLA 3B5JA 1Q1ZA 5J4HA 2IYUA 2AFHE 4IRUB 2VF8A 5G3YA 1NI3A 1QHIA 1X86B 2F43B 5BN3A 2FSGA 2GF0A 3QJYA 3VR3A 3TKLA 3GJ4A 4PHTA 1IN5A 3ND9A 3LNCA 4QGFA 3T61A 3MLEA 4IXNA 5FBRB 4DB4A 1CR4A 2JASA 2ZS7A 3T1OA 1FQKA 5C18A 2RGXA 3O8DA 2CE7A 1LFDB 4HB3A 3QPUA 2YYZA 2ZE5A 4HI0E 1DO0A 1DTSA 1TEXA 1UBCA 4D6PA 3HJNA 2I4IA 3F8TA 3SS8A 4EUNA 1ZU4A 2GEVA 5F3WB 3BFXA 3RNLA 4F7WA 1FZQA 2JJ2A 4LRWA 3OIUA 3AGPA 5CYPA 4X8LA 1KI1A 1GNQA 1T8UA 2QEQA 1ZIPA 3GJ7A 4QBIA 4TZ0A 2PZGA 4OQFA 4JT2A 2NMVA 1E9SA 5KUTA 3UIEA 4TT3A 2F1JA 1XZQA 3WRYC 1KO1A 5L3VA 2ZSDA 3CNOA 4IDNA 1ZC4A 2AWNA 4BWYA 2ZUCA 3T5DA 1ZYUA 1KI9A 4UKDA 1A82A 1KSHA 1W1WA 3M0EA 1UF9A 3BH7A 4OJQA 1LY1A 4V0LA 2LKCA 1FW6A 4NPHA 3FMOB 4Q5IA 5JS7A 3QKRB 2QE7A 1KMHA 3QEJA 5FBLB 1FMJA 3NH9A 3DM5A 1E9RA 3R7WB 4UXJA 4US0R 4TLDA 2V55B 1GDDA 1ZIOA 1J99A 2BEKA 4RFVA 5FTNA 1EX6A 2Y8EA 4QG7A 3R9XA 1KI7A 1Z6YA 3QPVA 2QM8A 1KDPA 2FE4A 2B7BA 1T5LA 2DYKA 4RD1A 1RRFA 2XJ4A 2GILA 4RZUA 3U7GA 3KXIA 3TNFA 4UNNA 3EASA 1NRJB 4LDJA 3O8CA 4L8GA 2PT7A 3LA6A 5TV2A 1PVOA 1EFHA 1W4RA 2QQ0A 1S3SA 2O8DA 4GMXA 1HY3A 1KIMA 3X1XA 3RWMB 4B33A 4PC6A 4Q7JB 1W4CA 2R6GA 4US1R 1DVRA 5FPYA 1AZTA 1RRPA 3QY0A 4U7DA 1TQ2A 4MUAA 4CVNA 4F4JA 3GQBA 3QKTA 4JMPA 1A5TA 4ZCLA 5C4GB 3KQNA 2EW1A 5DO9A 2XZOA 2ZE6A 1YE8A 1JBKA 3L2OB 4G01B 4JSTA 4OHZA 1M7GA 4AYXA 3QXCA 2YV5A 4TMXA 3TH5A 1ESMA 4LZZA 4B3XA 2PT5A 3UWKA 1XCPA 4A2PA 3UPUA 2ZI6A 4GSYA 2BJWA 4DT1B 4WZ6A 5EUQB 1GKYA 3FWYA 2AXPA 5EE5B 4F4CA 2V7QA 3DO6A 4GPTA 3HU1A 1Z8FA 2O0HA 2WOOA 3K70D 4N0DA 1G9XA 1FQJA 1M7BA 1U81A 2ZYUX 2OUKA 3AVOA 4D26A 4PO9A 1F2UB 3KJEA 4L15A 3RYTC 1CJUC 3CPJB 4WXRA 1WMSA 2QPOA 3W8NA 3BFKA 2HYIC 3IKJA 2W0MA 1NBMD 2Q21A 1KY2A 1OB5A 2JLWA 3SJZA 3E5HA 4AKGA 6Q21A 1RJ9A 1D8TA 2OAP1 3EIEA 5E7IA 4MDEA 3X2SA 2WSMA 2WJGA 4IDQA 5FOTA 3U3MA 2KWIA 2P65A 2QGZA 1Q1QA 2OV2A 5DSZA 3UXMA 1S96A 3OE7A 3TSOA 1CU1A 1QG4A 2HDNB 4KYIB 3ZVMA 4MKGA 2OFOA 1BMFA 1O87A 4TN1A 2JLSA 3B7GA 1CEEA 2IYYA 2A78A 1IXRC 4FMDF 4V0MA 1GAJA 3LBIA 3C41J 1KI4A 3GJ3A 4QJ5A 5FUYA 4DCVA 3A37A 3QSYA 1E2HA 1N6RA 2OILA 2IX3A 1J2JA 1W36B 3KKNA 2XNDD 1I4TD 3DM9B 4B48A 1OFHA 5LD2C 1FTSA 3GFTA 1JALA 1IN8A 1NP6A 1MABB 4ARZA 1P9RA 3ADDA 2NGRA 2ZR9A 2BBOA 3DKVA 2VHCA 1DADA 2CCGA 1N5JA 4TT3D 2OSBA 2OFXA 2QT0A 3EPHA 4P3YA 3AKCA 3CR8A 1Q22A 1W36D 2WBLC 3MWLA 5AJZA 3U3OA 4LX0A 3GEHA 3C14C 2BVNA 4C30A 5L3SB 3KJGA 1W46A 4DWJA 1NLYA 2FA9A 1N25A 5KU1A 2CLDX 1E6CA 3BORA 2NO1A 1NVXQ 1E0SA 1ZNYA 2XNDA 2H57A 4PSVA 4WW0A 4HB0A 1D2MA 4W5WA 4DKXA 2Q9AA 3NIBA 3CR7A 1F3OA 4X8OA 3W5JA 2O8EB 3KXLA 4A15A 1XFAA 1A4RA 4JL5A 3VR6A 3KTAB 2B8WA 2NO9A 3OHMA 1U8AA 3U7EB 3NVAA 4NYMQ 2EVWX 5JSZB 3V4RA 3W6PA 1W5SA 1R6BX 1MV5A 2R6DA 3SJCA 2WV9A 1I2DA 1SGWA 1GILA 4F93B 3AF3A 1Z2AA 1P60A 5FL7A 2HJVA 4B6FA 2J0UB 5HZKA 3VQTA 2KB0A 4TYPA 2JLQA 5C4MA 1KGDA 3WYAA 5KNDA 4KXFB 3PXGA 4G0NA 4CRWB 3U3KA 1KJZA 1IN6A 4LPSA 4NYMR 5DISB 1XBTA 2EFDB 2ZPTX 1ZM2A 5GVRA 1OSNA 5KSYA 1GZSA 1V5WA 1NVWQ 2A30A 4G3XA 4OHWA 1I4LD 3GEEA 3K1JA 1FX0A 1NJGA 2H8KA 3THXA 3UMRA 4M1YA 4ZO4A 4AC9A 1II9A 2X2FA 4FCTA 2GJ9A 3CRMA 4F92B 3WHKA 2QL6A 4J0QA 1Z2CA 2J7PD 2ERYA 2XTNA 4ZPXA 1FUKA 2OCAA 1E79D 3RS2A 3EXAA 4QHYA 1G4AE 5P21A 2W6JA 2GTPA 1K8RA 3CRW1 2IL1A 3Q3JB 1T0JB 4JLDA 4M9XA 5AR1A 5KOYA 4OK6A 3LVQE 3B1VA 4JJKA 4NTZA 3EZ2A 5TB5A 1XTIA 4B32A 3FFBA 4WVFA 2R6AA 1W36C 3AP1A 5FTJA 3W90A 5DI3B 2O8BA 2C2HA 4RD3A 1S0UA 3QPWA 4OQXA 4B75A 4KITB 3CZPA 2VP4A 1DAEA 3T1QA 3REGA 3B85A 3VAAA 3WNCA 1P62B 3PVSA 1PLKA 4BFUA 1NBMA 2GVDC 3ND8A 5DIFA 3UMFA 4BEBA 4DCTA 1GL7A 2V9PA 5E4FA 5LBIA 1FOEB 1JXOA 1Z6GA 4NMMA 4XH9B 4AYWA 2BDTA 2Q9BA 1Y3AA 2FGKA 2ZS9A 1Z22A 3A1WA 3BK7A 4LGMA 1CP2A 5LD2B 2DFNA 2Z4RA 3SC3A 5F9HA 1AA9A 3K9NA 3W8RA 2J1LA 1YR7A 4Q9KA 1H8ED 1N6OA 1U9IC 4PPGA 4EPTA 1UBFA 5B30A 3DVLA 3FB4A 1P7CA 3DOFA 4B44A 2C03A 2GK6A 3AUXA 4OK3A 3AVWA 4CIDA 3P26A 2FSIA 5FFMA 2GEUA 4RCYA 4YMWA 2VRWA 5IDVA 4P31A 1CTQA 2IS1A 3JZAA 2IBMA 2IYVA 1ZP6A 3ZZ0A 4XWOA 1CR2A 2HT6A 4KFSA 4N3NA 1RIFA 2AKYA 4IW3B 3SR0A 1AGPA 4CGZA 4FMDB 4DSOA 4FWIB 4OKSA 1SXJB 1OFIA 2ZQ5A 3LD9A 1XMIA 1XMVA 3EWSA 4HUQA 3I72A 1QZXA 4BECA 1II0A 1UJ2A 5L3RA 2WHXA 1NVVQ 1NMZA 4RKFA 3SNHA 1E2EA 4LHZA 4PQYA 3OEEA 4POAA 2FPLA 4JIMA 4W5JA 4O0MA 2OO7A 2YKGA 4EJSB 4E03A 4OI4A 1E0JA 5JRZA 3I5XA 3T1VA 3B2EA 3AKDA 1KO4A 4KBFA 1VG9B 1TQ6A 1NMXA 2PEZA 4LC1A 3IQXA 5HKKA 2ZAOA 4HLDA 4Q9LA 2ZXUA 3CX7A 3B9QA 3N70A 4HZUB 3TMKA 4UXIA 2JGNA 1JR3D 1XRJA 2QMUA 2W00A 3DZ8A 4Q01A 5H70A 5CITA 2A7QA 1XJQA 4P4SB 5JMTA 1ZVQA 4D4MA 3FKQA 2D2FA 2Z0MA 2ZI4A 4GDFA 4PFSA 4QOSA 3ZZTA 3PEWA 2ZRNA 2XAUA 3B1XA 5HCNA 4Q4HB 3K0CC 4GMDA 1JJVA 2VP6A 3DHWC 3I5YA 3EPLA 3U44A 1QHXA 3D7MA 1N6IA 3I8SA 4Z1MA 4LJ5A 4ZIRA 2R44A 1OIVA 1VPLA 5A5GA 1LVGA 5FPKA 5EE9A 1CBUA 1ZNXA 2G3YA 3SFZA 4BFYA 621PA 4C0SA 3AF2A 2HF9A 1CR0A 3TAUA 5KTYA 1ZD9A 3F5FA 4JL6A 3T34A 3RSLA 3MCAA 3O8RA 1H8HA 2YVUA 4A6PA 2QENA 3L8ZA 1P2TA 2KBEA 5JS8A 3OEHA 2B7CA 4TL6A 5FTKA 5KSZA 4QM7A 4UJ3A 1Q1BA 5CM8B 5UKDA 1HYQA 3WHLA 4AI6A 1LS6A 2CVHA 3QF4A 1OYYA 3ZDQA 3K70C 2D3WA 4KHZA 2OE2A 4IVRA 2QI9C 2J41A 4DLRA 2V54A 3NKVA 5EP2A 2GBLA 1NN1A 2CNWA 2QPTA 1XD8A 5CK5A 2ECKA 1J8YF 4ZDKA 2F1IA 1JEEA 1EX7A 3VFDA 1W2GA 4ZI3A 2OZEA 3T5GA 4FMBB 4KVAA 2G83A 4CEHA 2ATVA 1AZSC 3BAFA 4JVSB 2P5TB 3PUYA 2QP9X 2QBYB 5TDHA 4YXWA 2PMDA 2V1UA 2QRZA 5FOVA 2VQSA 1OYWA 1IY0A 1KK3A 1TNDA 3FGNA 5B2ZA 3K70B 3QXSA 3C15C 1QHHB 1IBRA 1C9KA 3BS4A 2BEJA 5K8TA 1XMJA 1TTTA 1SVIA 2RGGA 1UAAA 4HLUC 2BC9A 3TVTA 4M8NE 2AHOA 1VCOA 1QHNA 4HEJA 4U02A 1R4AA 1XF9A 1X8KA 1YZKA 3AB3A 2PL3A 3BH0A 3B1ZA 5CLQA 3NG1A 2W2XA 3ZIAD 1ZINA 4S2EA 1KYIA 4UNSA 4RVCA 2CHGA 1DAFA 3RABA 3GP8A 3LXRA 4URYR 5FOXA 2RGDA 1R7RA 3PEUA 2WAXA 4UNPA 3AEZA 2AK3A 2A2ZA 4LSGA 1Z5ZA 4DSUA 3B1YA 4W5HA 2Q3MA 1NF3A 4LHYA 1LS1A 5JJLA 3K0FA 1GNRA 3PENA 4C0BA 4DCUA 1TF5A 1JB1A 2W6ID 1G3RA 2YZ2A 4QGHA 1NY5A 2B21A 3QIAA 5DGXA 2J5XA 4BASA 4ITRC 4UNRA 3G82C 4MKIA 2CJWA 1L4UA 4D25A 4PC7A 5CB6A 3ZLJA 2IHYA 4ILEA 3I32A 4XIGS 3ZZUA 3LDAA 3KJHA 1KDRA 1G7TA 3EPJA 3EWAA 1IOZA 4DSTA 1DG3A 2MSCB 3BIFA 3LRPA 5CDFE 1W49A 2R8RA 4GRAA 4NE2A 2ZI3A 4IVQA 2G88A 2XX3A 1XWIA 3K0AA 4BEJA 1PZNA 1Q57A 4F4IA 2JDIA 2EWWA 2REXB 4TTQA 3G0HA 1XTKA 2QAGC 1NJFA 1GVNB 2AR7A 2DFKB 3GLIB 3PJRA 3PEYA 1E1QA 1NVVR 5HKKD 5F98A 1E2IA 1SKQA 2I1QA 2YWHA 4ZDWA 4FW9A 3M6AA 4OK5A 1RJ9B 5KPJA 1GTVA 5DHAA 2IF2A 1HT2E 3V9PA 4B3BA 1JR3A 2FN4A 1VCNA 1TF2A 3VNUA 2RHMA 1E94E 2R62A 3QKSB 5KNCA 5ELXA 2IT1A 3CONA 3CNLA 2GJSA 2QPAA 2ZJ2A 1GRNA 3RRMA 4BZXA 1SQ5A 4PSKA 2XJ9A 3CRVA 1G8HA 3RS7A 2J59A 4EQ6B 4Q1AA 5IK2A 3AUYA 2D06A 2JDID 4D2IA 4LK2A 1DOAA 1IJFA 2YWFA 4M22A 4YMSA 2QBYA 2PJRA 4ESHA 1Z28A 1NN0A 1EFUA 5CM9C 5SZHB 1JXMA 4DB2A 721PA 1P61B 1NVUQ 2ZRDA 2AN9A 2GA8A 5B64A 3KKPA 4EPWA 2EFCB 3OAAD 1VCIA 1CF4A 4CEJA 3B82A 3L0OA 3AF4A 1XTRA 4KODA 4TWZA 3TUZC 4MDFA 3K0CA 3ZVRA 3DOEA 4CW7A 4CDGA 8OHMA 2FJUA 1FX0B 4LV8B 5K8LA 1Q21A 2OXCA 1OW3B 2A9KA 4A2QA 3TR0A 2H92A 2DHRA 2GJ8A 5IRCD 5JCPA 4B74A 1C1YA 3S1AB 1T9HA 1UDWA 1EWQA 2LCFA 2G1KA 3A1UA 3THWB 1G17A 1E69A 5DE3A 3RVBA 3W9YA 1W7AA 1OH7A 3D3QA 4A82A 1BOFA 2GDJA 2VTKA 3MSXA 1W0JA 4OYHA 4DRZA 4ZDJA 4DXAA 1DAGA 3CRRA 3FMFA 4QHTA 4XWAA 2ZSFA 4BGDA 5DN6D 1G41A 4BUJA 4XWKA 1BKDR 3L8YA 4P4UA 2IEZA 2VO1A 3QQ5A 2AXNA 1OJLA 1LNZA 3ICEA 3GLHE 2YOGA 2CBZA 2O0JA 3SHFA 2DWPA 2WWYA 2D74A 3C16C 4FMCB 5KDOA 1OKKA 4L16A 5EQTA 1D5CA 2ZSAA 1NSFA 2GESA 3AP2A 3BBPA 4LUCA 4O2RA 2ZRIA 3SJAA 1MRSA 2FSHA 2GNOA 1JEDA 1N6PA 3CUEF 2YJTD 4Q00A 2Q3FA 4O3MA 3BOSA 4Q1BA 3FPAA 2GZDA 5EZ6B 4DVGA 4I1OA 4GP6A 5H68A 3ONWA 1CRQA 2C78A 4L5BA 2BKEA 3EC2A 3GLGB 1X1RA 4I1SA 1IQPA 2WPDA 1UFQA 2OAQ1 3IIKA 4HLUA 1XD9A 1G5TA 1A1VA 1E2GA 1E96A 1OIWA 5CIWA 4Q7LA 1QG2A 1KHTA 2VF7A 5TXGA 5KSOA 4EJSC 2HXSA 3AV0B 3EG5A 3I3SR 1X8LA 4B2IA 1CS4C 2AK2A 2F43A 2EFEB 2G77B 1YR9A 3WYGA 2C98A 2JJ1D 1H8EA 1A7JA 2Z5FA 3Q85A 4C0HA 1J90A 4G5QA 3KTAA 1M2OB 3LW8A 2JLYA 1M8PA 4JKYA 4KI0A 3RANA 1KNQA 5CB8A 1HH4A 1VIYA 2DFLA 2OBNA 2JJ2D 3IDQA 4TL9A 5IF9A 1G3MA 4RFSB 1UKZA 2P67A 1AGRA 4RD4A 3FDIA 1D2NA 4DIDA 5HZHA 2ZYVX 2ZJ5A 3TAHA 1XEXB 2QM7A 1G291 2OG2A 2GVZC 4K8OA 1E9BA 1VG1A 1VDZA 4UJ5A 2ERXA 3I92A 3LFUA 3WBKA 4W7SA 4XD7A 2RAPA 3WY9A 2VSFA 1K5DA 1VG0B 2GBLC 5LPNA 1Z6AA 3GJXC 1E99A 2REOA 1BYUA 3PV0A 3PG5A 2O8FB 4QXAA 4K46A 4NDZA 4PX9A 3GLFA 2HEIA 1R0XA 3E2IA 2PX0A 2J0QA 2FFQA 1Z0JA 4G5SA 1MO3A 5IK2D 1SHKA 1G16A 1Z6XA 2KI5A 3VU9A 4RD0A 4B34A 2GWHA 2ZI9A 1E9FA 3SEAA 2VYFA 4JKIA 4MUBA 3LH5A 2CCKA 5LB4A 2GXSA 2QAGB 1WCV1 3QBVA 4XD7D 3CF0A 4NU0A 1Q44A 1FUUA 1KK0A 2GCPA 4CEJB 1G8GA 4JLVA 4PAMA 3W34A 4JJZA 4PC3A 1G21E 1FNMA 4RCZA 4Q4AA 5JHHB 3KL4A 1P9WA 4HUTA 3BERA 2X1VA 4JYCA 4MRVA 2OCYC 2ZTSA 4Q9HA 4EFLA 4JS0A 2XOKD 4URWR 1GL9B 4HDOB 1S1CA 3K09A 3G5UA 2EYQA 1W0KA 1S1MA 2JJ8A 4IEEA 4IDHA 2GZHA 1U9IA 4LJ9A 4NCKA 1BIFA 3NC1C 1SVMA 2R65A 3AH8A 4AK9A 4KSBA 3GLIA 4ESVA 3IILA 3GFOA 4Q19A 4A6XA 2IWRA 4LY6A 5BQ5A 3RS3A 4DLZA 3AVVA 1J70A 1R2QA 3U6BA 3CX6A 4PQRA 4Q1DA 4R98A 4MKFA 3RAPR 2FEMA 4NZYA 4DUGD 4H1VA 3OFNA 1SZPA 3AF1A 2QMEA 4ASUA 1WBBA 1WBDA 1KDTA 1T91A 1WDTA 2GXQA 1XEXA 3KX2A 2IS6A 3WRXC 3UMSA 3KXKA 3DZDA 3MWKA 1E0KA 2CJWB 2J9RA 1F2TB 5J5CA 2BM0A 1P5ZB 5AUOB 1E2MA 4DLSA 1Q3TA 1KI3A 2ODBA 1KY3A 2VL7A 2CLCX 3BB1A 4NP6A 1VYTA 3CPHA 4GT1A 4JLKA 3SZRA 5K8IA 1PUIA 2ZJAA 2SHKA 1N0UA 1YRAA 1WF3A 5JWHA 3RSOA 4GFDA 4ASUD 2D62A 2ZR0A 4M1OA 3ADBA 1S9HA 1Z3IX 2P6NA 3IQWA 2J0VA 4C3ZA 1KI6B 1QVAA 3EIHA 1N0WA 1E79A 4FINA 4JLJA 1E1RA 3IHLA 2H17A 5BXQC 2X8AA 3CM0A 3EX7C 4HB2A 1NBME 2HLDA 5FUVA 4LI0A 3Q8XB 3KFVA 1NN3A 1NSTA 2VA8A 5DNYB 2B8TA 4PPNA 4RZ3A 3U3RA 3THOA 3TR5A 1EESA 1XU4A 4M1MA 3JVUA 3SYLA 1KOFA 1CJVC 4I1VA 1EG7A 1US8A 3X1YA 1M1YE 2QY9A 1XEWX 1GNPA 2QROA 3AVQA 4JVNA 2VSOA 4JBWA 2NOAA 1U90A 2ZJYA 4TL7A 2WOJA 2IC5A 5AWFC 3CB4A 4JBXA 1RW4A 2NO6A 2R9VA 3QXHA 2ZITA 2BJVA 3WMFA 2W6IA 1XTJA 2AKAB 1ZCBA 4MYUA 2OXRA 4LYAA 4D0GA 1XX6A 2IW3A 4E07A 2WWFA 4EPXA 1KI8A 1KNXA 3F3YA 2IYTA 4MYCA 3TIFA 1FFHA 1Q1EA 4I81A 4HAWA 4MH0R 4M53A 5TVKA 2D7CA 4DHEA 4JBYA 1P3JA 3B6EA 3A6PC 3B13B 5EP3A 4R2HA 1EFTA 1UKYA 2KBFA 3FMIA 1E2FA 3EIQA 4PHFA 3QG1A 1K5GA 4URUR 3CBQA 4LBYA 4Z1MD 2J0SA 3WNBA 3PQCA 3ICQB 3QXXA 3KUCA 1NMYA 3VR1A 4UXHA 5H8WA 4KSCA 1E2QA 1E2KA 3IPXA 4JT4A 2HYDA 2IYQA 4UQOA 1XXHB 4EDHA 3KKMA 4TYYA 1IY1A 1IONA 4KFRA 3AKEA 2VEDA 2EFHB 4CZ2A 2BBTA 1OPXA 1HV8A 3AM1A 1KO8A 1IY2A 2R6CA 4FI3C 1EFCA 3K9LA 1TU3A 5FBVB 1G6HA 2GZAA 2DWOA 4XSHA 3H2YA 4GOKA 5FTLA 2QP4A 2CDNA 3N2EA 3H86A 3TK1A 4D82A 5JHGB 2ANBA 2J3EA 2ZANA 3CH4B 4IHQA 1CIPA 2UVQA 2E1RA 5FR1A 2YOHA 2EU8A 3B1WA 4X8MA 4CF7A 5HPYB 2DFTA 2HF8A 3HYTA 4Q7KA 1G3QA 2P6RA 4JL8A 5HCIA 1XMSA 3SN6A 3TBKA 4CYMA 1WE2A 4UNQA 1BS1A 2ZYTX 1E32A 1XJ0A 2OCBA 3R9WA 1UEIA 2FV8A 3BRWD 4GZMA 3TUIC 2FGJA 4OI2A 3FHTA 4C0JA 4QM6A 1JPJA 1M7HA 1U98A 2FEOA 1UADA 2VP0A 3QVVA 5KPDA 4XOIA 1QF9A 2FX3A 3L0PA 3P1JA 5FI1B 1IJEA 4DIEA 3NC0C 4XVRA 2RB4A 5FL3A 1ZU5A 5DLQC 5D3MB 4EPRA 1PLJA 4KLNA 4QL3A 5FPSA 4JSYA 3NH6A 5G53C 1RVDA 2FFBA 4C0AC 4XVUA 2FU5C 1S9DA 2F1RA 3C8UA 1GKUB 2NTYC 4D80A 2JCSA 3K0FB 4DDWA 1ELOA 5DI3A 2N46A 2O0KA 4LJYA 2O8BB 4RD2A 3PR1A 5D3QA 1NY6A 2GAAA 3NBXX 3WXMA 4GZLA 1HURA 3TSWA 1P2SA 1ZNWA 2IF0A 2BBWA 4IOJA 2HCJB 5F2EA 2QORA 2UZ3A 2KSQA 2WSSD 1E4YA 4LYHA 4II7A 4BLTA 4HAZA 2BM1A 1E9DA 1KK1A 5HR5A 4B76A 3QVUA 2RGBA 3OIYA 4PTLA 4AY2A 1T8TA 2ZU6A 5IT5A 1G5RA 5KDLA 1P4SA 1GRQA 3NTUA 2P3SA 4HAUA 1ZM3A 5BYJA 5TY0A 5FOSA 1DO2A 2ZJOA 1MOZA 3FKSA 1LF0A 4TMKA 3RRNA 3ETLA 4QBHA 2YHSA 1W48A 3R8CA 4US2R 3KQUA 4NHOA 3P20A 2NPIA 2CHVA 2ZUBA 4WZAE 2D2EA 3BWDD 1XCGB 2D4HA 3SBEA 4MA4A 2O8FA 1YZUA 2F1HA 1ZBDA 3SHWA 4MGZR 2WAYA 4BFVA 2IYRA 4Q9IA 3GJ8A 2O5VA 1COWD 3GLFE 1XXHE 5E3HA 4PZYA 4V0NA 3BH6A 3K8YA 4DLUA 3NBYC 1FTNA 4NCNA 4GBMA 1BMFD 2ZE7A 4QHSA 3U6KA 2JJ1A 3O8BA 3QE0A 2ASEA 1VIAA 3K0AB 2BCJQ 1BH2A 1PJRA 4ERNA 3ASYA 1Z47A 1CKEA 2Z6VA 5B57C 3U7HB 4LC0A 4BZQA 3LY5A 4DLTA 1F5NA 3IPYA 2W83A 4I99A 4EFMA 1GRRA 3EA0A 2DPXA 2OM2A 1ZUHA 5B58C 3TGPA 4Q66C 1ODFA 3EPKA 5AJXA 2YINC 3FVQA 3WP0A 3RS0A 4EJSA 3KQKA 2JLUA 1RPZA 1GSIA 5CJ2A 1NNEA 1VKJA 1VHTA 3P4YA 2QP3A 3C7KA 3VKWA 4Q4HA 3U61B 2RGAA 4BE7B 3VKGA 3CWZA 3AGQA 5FUWA 1NG1A 4ZKEA 1FP7A 1OB2A 2J45A 4HATA 3QI2A 2BOVA 4PHHA 4FCWA 1IXZA 4KJZA 5KDDA 3U60B 1AS3A 3AVYA 2KJQA 1T0HB 3EW9A 2A5JA 3RC8A 2AD1A 5CDFA 3GLGE 1GFIA 1E1QD 3FTQA 2V8OA 4PR0A 3IO5A 4WZBE 3RC3A 3R8FA 2QTFA 2O52A 4ZIRB 3EAQA 1OXXK 3U4QB 2J0UA 5EJEA 2OESA 3KKQA 4KFUA 2XGJA 2RMKA 3WMGA 3OEHD 2F9LA 5FR2A 1JJ7A 3RS5A 2ZRCA 2E9SA 2BMFA 2JLXA 4B3FX 2PZEA 1U99A 4AD8A 1KSGA 5GJBA 4PAOA 3Q9LA 5AUQA 5FOWA 2RGCA 2OFWA 2ODWA 2C9YA 2WKQA 3NHBA 2PH1A 4V0ME 5DYGA 2Z43A 1A2BA 1CXZA 1E2LA 2VPPA 3QEOA 2AX4A 3SE0A 4YMVA 4EIWA 3K9HA 1TQDA 4V0OA 3QUSA 4A36A 3UATA 4C2TA 3LVRE 1OHHD 4Q1CA 1SXJE 3GJ5A 1KAOA 5J4KA 2BHRA 2C95A 1IM2A 3OZXA 2WWWA 4ZI2A 4LV5B 4OBEA 3MWJA 2F6RA 1ZM9A 5J4YA 5LDDC 2HV8A 3AQ4A 3TQCA 4A0GA 5J47A 5EUMA 1CLUA 1GWNA 1NLFA 2ZETA 4ACBA 421PA 1R10A 4HUQB 3E1SA 2RHDA 1I2MA 3PUWA 1NG9A 4L9WA 4LBZA 4Q21A 2X77A 5JBQA 2QG6A 4NCJA 4GP7A 3VX3A 3CF6R 4LJ6A 1MO5A 4PO1A 3TLXA 3HR7A 2ODNA 3ADCA 4A92A 4JLBA 3MMPA 3QKSA 4IFBA 1CULC 1U0JA 2HCBA 2ZJZA 3SFVA 1RRGA 2P2LA 3X1ZA 4NYIR 4NYIQ 3P4XA 1OH6A 3HYRA 2HUPA 2AFIE 2MSEB 3LV8A 1G64A 4CT5A 1ZD8A 2GEDA 3GD7A 1L4YA 1R5BA 4BRUA 2PEYA 3KQLA 3NXSA 4LYFA 4JVLA 1VHLA 1SXJC 1HE1C 2HT1A 5BW8A 2NPFA 1OH5A 1Q3HA 1RKBA 3QKRA 4NCHA 3NWJA 4HLQB 3SYNA 3FMPB 4I4LA 4BLRA 4AWXA 2HLDD 4Q4AB 3X1DA 2IUTA 3CIOA 3SJBA 4Z51A 1Q0UA 4WXPA 4RY2A 2A5YB 821PA 4HAXA 4IKEA 3MJRA 1PLLA 4BFXA 1W44A 1AJEA 2YC2C 1KJWA 2VIIA 4YLGA 3X1WA 4TZ6A 1UDXA 2P6UA 4E22A 4DLYA 4DLWA 3U2QA 1HEIA 4HDQB 1IAQA 1W47A 4MQBA 1A2KC 2A5FA 2G0TA 4OQNA 1DAHA 5C1BA 1UKEA 1JR6A 1X3SA 5EE0A 1YU9A 2ZSEA 4TTRA 2ZAMA 1XEFA 2CL6X 4D4JA 1KZ7B 2VSXA 1KMHB 2CEAA 1FPMA 1SVOA 2IXEA 3CH5A 3W5IA 3FFAA 1MR3F 4MITA 1FMLA 1F48A 2VHUA 5AJWA 3GLHA 1C4OA 5GJWC 3VHXA 1OLOA 4E5UA 4KLZA 3I8XA 4P32A 1W4AA 1SVKA 1U8YA 1OT3A 3DMDA 5BYKA 4LHXA 2ZEJA 1DBSA 3M1IA 5BN5A 2C99A 2QTVB 1XPRA 1CR1A 5FL7D 1ZMXA 1ZD1A 2FFHA 4RFSA 2N42A 1E3MA 4XTRA 5AJVB 4TMZA 1OXSC 3W3AA 3A4MA 3U4QA 2QU8A 4LV6A 4PZLA 2NIPA 2YNMA 3ZGXA 4AURA 3C5HA 2ZRHA 4OI1A 5EP4A 1G8YA 3MGCA 3ZVLA 3MWYW 5CLLA 3U44B 1JAIA 2G0NA 3IIMA 2FWRA 5L3SA 3ECCA 2GF9A 4QFMA 2XTMA 2FZ4A 2GCOA 4L4UA 4B3CA 5GADl 3Q5DA 4RD6A 1SXJD 1DS6A 3R20A 4TMWA 1AQYA 3VKHA 1ZM7A 4Q18A 5H1YA 4YONB 2ZRBA 4A0HA 3OF5A 1AIPA 2ZS8A 5G3ZA 3E70C 2YC4C 3SQWA 1S8FA 2F3TA 2VH5R 2W6JD 4JYBA 2C5LA 2DR3A 3THWA 4AKHA 1X8JA 2L0XA 2EYUA 2G9NA 3HU2A 4CEIA 5K8UA 2IYWA 1ONBA 4KYUA 4AG5A 1XJCA 3EZ6A 2CMKA 4MGIR 1GG2A 3CKLA 3GFPA 4G1UC 5GJCA 2A5DA 2IS4A 4GI7A 1Z07A 3VR4A 2V6JA 4HZIA 1HA3A 3L0IB 2DY1A 1N5IA 1G20E 1OV4A 2BMDA 3GLHB 4Y0VA 4B6EA 2HXYA 1G6OA 2EFGA 1EGAA 5JI2E 5IHPA 2GRJA 5CYOA 1EWRA 4MYHA 2CK3D 5L3QB 4W9MC 1TUIA 3BE4A 4B73A 1OKKD 3HPRA 1K6MA 5KYKA 1CJMA 3T1TA 3KDSE 2ZE8A 3T35A 1YZLA 3UANA 1TADA 3UG7A 1II8B 1KMQA 4TYWA 4DCNA 4Q1FA 1AN0A 3REFA 1NIPA 3ZD7A 3B8HA 4AKEA 1RFLA 3O47A 4Q02A 2XSZA 2GKSA 3SQXA 2FH5B 2Q6TA 3UWOA 1JECA 4ZCIA 1N6HA 4DDTA 2RKOA 3LAWA 2ZUDA 2WKPA 1VG8A 1SKYE 3LXXA 4FMCF 2IK8A 1KKLA 1JNYA 3QXJA 4ZV4A 3IIJA 1JQJC 4ABYA 3RWOA 2JATA 2YOFA 4TMTA 4KFTA 1LF5A 2NZJA 1QDEA 1ZC3A 2ZSBA 3ZIAA 4YMTA 4NCIA 2LKDA 1MABA 2ODEA 2DCUA 4M1WA 3HPQA 4YMUA 1OXVA 1E0AA 2NO7A 3ZH9B 4AIIA 2BV3A 4M4SA 4DBLC 3U3JA 1WQ1R 2FMXA 2XSZD 3N2IA 3PEVA 3KJIA 1DG1G 4NH0A 1DE0A 5CJPA 3SOPA 3HWSA 2BMJA 1P6XA 1QRAA 4P4TA 2XEXA 3HR8A 2WWGA 2NQ2C 3RRZA 2GXAA 1Z63A 1YHNA 4LJAA 521PA 4NKRA 1GKIA 2QA5A 4B47A 2XNSA 2RGEA 2VHTA 4XTCS 4Y0AA 4EQ6A 3A1TA 4PC1A 1TX4B 3F0TA 2JLVA 1Z0IA 3TE6A 2VHJA 1E2PA 1G7CA 3MG9A 2FSFA 3SBDA 2ZVQX 4OQLA 1JR3E 2EWVA 5EXPA 1Q12A 3A36A 1YVDA 1ZJ6A 2C77A 4B3GA 2I1VB 3VMFA 4DDVA 1Z0AA 2AL7A 2Q9CA 1YZGA 2ATXA 4NYJQ 5G41A 3FHOA 4WOPA 1XDBA 3JZMA 2EQBA 2H5EA 2ZRFA 4WBSA 1XPUA 1TEVA 3SDZA 2W2VA 1AKEA 5JZVA 3U7FB 2XB4A 5JEDA 1KJYA 2QQEA 5FPTA 2OCPA 3U5ZB 2ZRPA 5ANRB 4BLOA 2FZLA 1H8HD 5DH9A 3T15A 2Z83A 5JRJA 3LWNA 1N0VC 1XTQA 3CX8A 1RZ3A 3ZVNA 2BWJA 2DWQA 2YWGA 5G40A 2W2TA 1KO5A 3CNNA 1B0UA 3OEED 3QKUA 1AQUA 5JCZA 2XTZA 2VP5A 4B2PA 1KO7A 4TYNA 2JEOA 1U8ZA 2PX3A 1EFRA 3N5CA 2ZRAA 4D0NA 3NEJA 2GCNA 2WJVA 3VHLB 4B35A 3AP3A 1KI2A 1II8A 1US8B 3K0SA 2H18A 5HE9A 3BXZA 2CVFA 2FNAA 3B60A 1G19A 4YXWD 4CEHB 3R9IA 3H4MA 4M1KA 2GJAA 1D9ZA 1TF7A 1OFTA 4JZKA 4DZZA 3OAAA 3I61A 2BBSA 4YQFA 3FOZA 1DAIA 2KE5A 2PCLA 2WJJA 4M9SA 4ZKDA 2A5GA 1MKYA 1NLZA 4HAVA 1TL7C 4Z8YA 3UG6A 3UK6A 1G8FA 3L0SA 5SZKB 3RS4A 1OH8A 4IOKA 4A0FA 1OHHA 1GITA 3MAAC 4HDCA 2CK3A 1AM4D 1WP9A 1TQ4A 2MMGA 1QHGA 2WJIA 5BWMA 1HE8B 4C0QC 4OQMA 2QSYA 4M9ZA 3IEUA 2UZIR 3FKSD 4QBGB 2XZLA 3QENA 2IYXA 3BFVA 2QGNA 1E98A 4XVQA 1M6NA 3Q5EA 2BKUA 1GUAA 5DN6A 2JAQA 1DARA 1PUJA 2MSDB 2GAOA 5FI0B 1YR8A 1DPFA 2JLRA 3JVVA 3I4LA 2CNWD 4IFEA 2XB2A 2TMKA 1ANKA 1E1RD 1MO6A 3GPLA 1T6NA 1AK2A 3GLGA 2P5SA 2Q0HA 1KI6A 3GJ0A 1TUEA 3QG5A 3WMEA 3PUVA 4DCSA 3W6NA 4TLAA 1H65A 2PCJA 1XP8A 2O8CA 3LBNA 3B9PA 1KSFX 4BQSA 3THYA 3A4NA 1G5PA 5J4VA 3TRFA 4BLQA 5SZJA 5KO2A 2ZIAA 3HU3A 1BO6A 1OF1A 4TMVA 1T3SA 4BLPA 2NZ8A 1QHYA 2ZI7A 4MRSA 1N5LA 2OBLA 2J87A 4NYJR 1G7SA 2VP2A 4QBFA 2QUZA 3OIWA 2JLZA 2C9OA 1KTVA 3MJHA 3ZYCA 2V6IA 4KCGA 1E2NA 4ZCMA 4LHVA 3OE7D 5KNBA 3GLFB 2PLFA 4BFZA 4DLXA 2WM9B 1ZCAA 3KQHA 3IUYA 1R0ZA 4G5RA 2MMCA 2ZVPX 4KO8A 4PZZA 1U2RA 3NBFA 2VHQA 4FIDA
chains in the Genus database with same CATH superfamily
3MPUA 1QTRA 1BN6A 2NP7A 4J16C 4S05A 4TV9B 4ZMBA 4PE5B 1WRBA 2QE7D 3RLIA 3GMIA 3ZE9A 5GTDA 2WWHA 4LS3A 5JFGA 3D2AA 4IEIA 4KXMA 1I2ZA 3PB3A 1DKNA 1LTHR 1NNI1 2QYOA 4X8HA 3AOEA 5CJJA 5BSWA 3ZD6A 4ER3A 4MW1A 4EJMA 2DB3A 1XDGA 5KVCA 2UVPB 1BWSA 1XA3A 1B6GA 3EVZA 3I2FA 4RKEA 5ER6A 2Z04A 2VNAA 1QIMA 1CDDA 2IOFA 3CRQA 2J32A 3Q1KA 3PF9A 4JFAA 1K97A 3RHFA 3FWZA 4JOQA 3DL0A 3ICVA 2HPAA 2E2WA 2Q5IA 2JFPA 1IUKA 3KOWA 1WEKA 1DEKA 3W5UA 2Z57A 3CVUA 4O2BB 4OSPA 1CK4A 2ZULA 2VUSA 1GM5A 1NQWA 2KHZA 1YS7A 4Q1EA 1UBGA 4BV8A 4TLCA 2X2EA 4QXOA 4I08A 1U8CB 3IKMB 1E4VA 4D9NA 3ZLVA 4JK3A 4LHWA 4RMGA 2PSJA 1K6IA 3ET5A 3RK0A 1QVRA 3OZSA 4U7TB 1RRCA 3HVJA 1TKBA 1V8DA 3ZS8A 2FX5A 3RADC 3NHPA 4DEXA 2C8VA 3VR6H 3VR6D 3DO5A 2IV7A 4ND8B 1NI4B 1I1OA 2P62A 1NZFA 1UMCB 5EMJA 5AXDA 3VMMA 4EX6A 3HDTA 1QHSA 5K5EA 4F8YA 4HH3C 4BFSA 5CX1B 4UOZA 1WSWA 1ZUNB 2H48A 4HGPA 4LYJA 2Q4TA 5EI5A 3ZW7A 1H2WA 1U0HC 1U3WA 1CC1S 4K3UA 4C7OB 2O3RA 2WIAA 3EVGA 3KU4A 4EJ6A 5BN4A 1O4WA 2CYAA 3C3AA 4HBZA 2QMOA 3HCEA 4C06A 5HG0A 2X40A 3VNVA 2CXXA 2BI8A 1MJHA 2LIVA 1DX6A 2C42A 2DJIA 2GPBA 3QX9A 3WR5A 2V7QD 3D5TA 1KZHA 3QTLA 5LQJA 1RQ7A 1V8BA 1MB0A 3RJTA 4LJ7A 3QOXA 1WF6A 2G25A 5JG7A 3F2IA 1JXAA 1IHUA 2B78A 4V0QA 4ACAA 5A1JA 4KVZA 3UT5B 2WWRA 2EZ8A 5DM4A 4C0KA 4DS3A 5I3ZA 5AK0A 5BSKA 4KPUA 3IBGA 1DJOA 2RCNA 1EDZA 1B7GO 3TBFA 4AZ0B 1R18A 2GJKA 3OFND 5CDUA 1Q7GA 4JP5A 4K9NA 1RC8A 2AZDA 1HDYA 2ROQA 3E8XA 2AVNA 3ZK7A 4RHTA 2R6FA 1T5IA 1K8YB 2JVJA 3GRUA 4M7RA 5AI5A 3WS7A 3I1FA 1GL6A 1LJLA 4N7BA 1V2GA 8AT1A 1XRLA 2OLJA 3W5DA 2I3GA 2RBKA 1CUHA 1OZAA 2AG5A 2XRZA 4LBVA 3ICOA 4TTJA 3QNUA 4JZYA 1VJGA 3IHWA 3L05A 4OIMA 1SWWA 4W99A 3I12A 2YFYA 3CISA 3GH3A 4QGGA 2CT8A 1DPGA 3MN1A 4UBLA 4CT4B 2YZMA 5F1YA 3A6JA 4W8OA 1TCVA 3TIGA 5CCEA 2VP9A 1GFSA 1JHMA 1K66A 1FRVA 2CC2A 3NHZA 1C1XA 1ZIYA 1OLUB 2WF7A 1JLMA 1SQGA 4R8VA 3B78A 4YEDA 2NO5A 1E3WA 3DZIA 3NMUF 2OT3B 3E5RA 5CIQA 1Z3CA 1XJWA 3KLNA 1JSCA 2RBGA 4J1TC 5EP1A 2IYZA 1A9PA 2AWOA 4B2LA 3ER8A 1E5DA 1QU3A 2FHSA 3TSZA 4YCSA 2BFWA 3KQTA 4XWWA 2FPXA 1QF7A 4JB8A 3NKFA 3B1FA 3IUBA 4IDPA 3BCRA 3ITNA 4ND2A 4IXTA 1ISFA 4A26A 5D6OA 5EHZA 5BNTA 3MGGA 5COBA 1ZK3A 3A28A 2VH2A 1H0SA 4MPRA 4PONA 5HKLA 3PFCA 3V4FA 3P32A 4RZXA 1DIAA 3K53A 1ZJ5A 3QF7A 1SHLA 5CFNA 3BXEA 4RESA 4P33A 1LQ2A 1TU4A 3A25A 3EOAI 2RGNA 3ZWDA 3FNQA 3DTVD 1Q0LA 2BRUC 3AUFA 1MGOA 1RLJA 4EYOA 4HRXA 1TIBA 3KV1A 3RTDA 3A4IA 5DBOA 1S89A 4DA9A 3TECE 3PYLA 4MWDA 1PFWA 1Z4KA 1Z7EA 5B4UA 3ONEA 4YN3A 3UMBA 4E4TA 4PYKA 2WICA 1POWA 2GCOB 2RBEA 1YRWA 1W2HA 5BWNA 2YQ5A 4FT2A 4GM1A 1CQPA 1JAXA 1RXYA 5JQGB 1QCDA 2PMKA 4KIJA 1NAHA 4MVWA 4ZVNA 5LYYA 1AUXA 1C30B 1VYUA 3E03A 3H2ZA 4QDKA 1BAPA 2JJMA 3PR2B 3MFYA 4PANA 2OENG 4P93A 4ZDIA 4B3SB 2RHHA 2PT9A 1X7DA 2RFLA 2HADA 5ESRA 3V7UA 3KRTA 4L1KA 3BMXA 4PFJA 3EXHA 2R66A 2VPWA 3EARA 1UKAA 2F90A 1WHSB 2WM8A 3EXHC 4G4SO 2CSUA 4JR1A 1V1RA 5HA5A 4D3SA 2PKCA 3MAGA 3FN4A 4BCBA 1ESNA 1NXQA 3ZHRA 4W5QA 3EZ9A 4BCDA 4TSFD 3T3MB 1JEYB 4O2BF 5HKBA 2Q2NA 3GZJA 4MQEA 5IVPA 4X1YA 4ARVA 4UATA 4DIFA 3FGZA 2GM9A 2XKAA 4AP5A 4KLAA 3OOWA 2F3RA 2JH8A 4HN2A 4UMEA 1GHTA 2GCIA 3PPXA 4I1UA 4OLFA 4OKIA 1WCWA 3TVDA 2E6UX 3ZWWA 4PXAA 3GAFA 4EELA 4URXR 3ZJVA 3GGSA 3I58A 5EZQA 2LVBA 3HK2A 1GCAA 3I6BA 3BHMA 5ICMA 1CE8A 3CPEA 2A1UB 1JIVA 2XUGA 4NSNA 4REOA 5EXTA 2YV3A 4D46A 3KELA 4ZHSA 1C1DB 1S01A 2PWBA 1Z4OA 4FKZA 4DT1A 2PR7A 1E2BA 5HTKA 3V1MA 4PBSA 1KE1A 3QTTA 1XCMA 2QRPA 3ANLA 4TZTA 3GHYA 4YECA 3A4LA 1BXRA 4CLRA 2FI1A 2OZVA 3OMWA 4UU7A 3LSYA 4HXEB 4MW5A 2WVHA 4QUAA 2B5OA 2G9UA 1R0WA 4N6OA 3CWQA 4YH1A 2PBLA 1E63A 2AN5A 5JWRA 2QUJA 3PHLA 4N6NA 1DCMA 4ZOBA 2C5HA 4X20A 1JQKA 3VU9B 2D0OB 4X64B 5A0TA 2XTAA 4QRIA 3DQPA 4P92A 4R6WA 2TMGA 1A8UA 5DW0A 1VB3A 4D9HA 2ZT8A 1ZMOA 3EXFB 1KAGA 4FN5A 1TYAE 2R3SA 1R8SA 2WUWE 3V00A 2VKTA 2WIGA 5BQ3A 3KWLA 1Z4LA 2L2QA 2MTBA 3P2KA 2XMGA 2Y1LA 3WK9A 4H6VA 3K9GA 4L5AA 3O83A 4YJ2F 3SU8A 3NDJA 5K7SA 3PEWA 1G20B 2J3QA 1MT3A 3CO5A 5ICGA 4IDCA 5LYJA 4BNTA 4YCMA 1L5HB 3MEQA 1BWPA 2WABA 4D9BA 2G72A 1E3SA 2DOKA 1EYZA 4RQUA 1T8WA 1JVNA 2IXFA 3PFGA 5FPHA 2BGJA 3DCJA 3UHAA 4DIKA 1B6RA 2GPWA 3LT0A 4JBGA 4WTOA 5AJYA 3E23A 2B99A 4R2IA 1E1DA 2I7VA 4EY8A 4DJTA 1K9SA 2IHTA 2POQX 1PNOA 4N7MA 4TQUS 1FFGA 1BS2A 2J7KA 2V6GA 4AX4A 3C5CA 4X91A 4D0LB 5BUSA 1H3FA 2HWXA 2WJ6A 3ZDDA 5EIOA 2TYSB 4DMMA 4U7FA 5D3MA 4IDOA 2E4XA 1AS2A 3GVXA 4DNXA 4BZWA 1QZZA 1RSZA 1NLMA 2GXUA 5BSMA 3MJFA 4YCBA 2B2NA 3YASA 1HTBA 4N40A 4NONA 1P4RA 4G26A 4I1PA 1N57A 2QT1A 3OI7A 3HCWA 1T4GA 2B6HA 5ALSA 5JY1A 1G4UR 1SVWA 5TJHA 4BKOA 3PF8A 4KN9S 1KVUA 4YRTA 3GMTA 3QF4B 1J5EB 2OBMA 1GQOA 4QLOA 2FAXA 5EXSA 1JYEA 3GARA 4HVTA 1WXQA 4QYWA 4R8RA 4TQGA 1KMNA 5FOUA 1IY8A 3UHOA 2ZSJA 4Q7MB 1TLLA 1Z0FA 4DV1B 2WT8A 4Y30A 4HAYA 3LK6A 3NUZA 2JGMA 5K3EA 3TG2A 3V4SA 4E15A 1F6WA 5KQPA 4P7FA 1S8AA 3PXXA 2AQKA 3FCCA 4U6QA 1SFRA 2OL4A 4IX9A 2B8JA 1IK6A 1G42A 3QVJA 3ZNQA 4LWPA 4OLHA 2ZRKA 4EPYA 1VTKA 3GVIA 3CF4G 1ODSA 2ZJ1A 3N3BC 3RNOA 4CMJA 4F0JA 4F7DA 4TLBA 4PV7A 2ZREA 4BZZA 4BVJA 4BNFA 2XMBA 1Z0ZA 3E5MA 4A03A 2XCOA 5LP6F 4Q03A 1UZUA 4DCCA 2JFQA 2ZSHA 4RTQA 4AYTA 3JTEA 1X7XA 3L7CA 1EFRD 1I2CA 4K9KA 4CTKA 3E84A 1A7AA 3H75A 4NG5A 2K5UA 4AG6A 1Y8ZA 1K2VN 3ZCQA 4O2LA 5LR6A 5TSDA 1LVHA 2W93A 3GCGA 3AETB 2F1KA 4ZEWA 3VR2A 1RHKA 4HSGA 4IKOA 3R8XA 3U48A 1NVDA 4NBSA 3RTAA 3OCJA 3DVAA 3C4JA 4RPKA 3TNYA 4D8YA 3L6CA 3DWEX 1Y9DA 3PTAA 1RYFA 2XDWA 4UVGA 1ZJZA 2HHAA 3BTUA 1RBQA 3TQQA 4DRXA 1EXWA 1ZH4A 1XAHA 1CJKC 5DXAA 2C1XA 5NULA 1D8AA 1W5TA 1JI0A 5B1IA 3I6MA 4LFCB 3UBMA 3UA4A 1SXJA 5L4NA 4B4VA 1JV2B 2CBGA 4C03A 2DH5A 1H6AA 4D02A 1EA5A 1CYDA 1O97D 2FW0A 4YJGB 4OI0A 4XX1A 3EH2A 3JSAA 3MF4A 4MYTA 1CNFA 4F5YA 3B2QA 5TMPA 3WNDA 4I1YA 2QTCA 3RQIA 3G9QA 2ZAYA 4QFCA 1YUBA 1O4VA 1D2EA 4BFTA 3F4KA 3LDGA 1XCBA 2VRCA 1JAHA 3GEDA 4ZOLB 5GGXA 4AJ2A 4K6KA 4BBPA 1N92A 1C3XA 4D8VA 3THYB 5FV4A 4RSGA 2RH8A 2E6KA 2FXIA 5G1NA 1ISGA 3KB1A 3BGIA 2YY7A 3L6DA 3P9XA 1YOVB 2QD3A 3AYZB 4MUIA 1GN8A 2BMEA 1SEPA 1SPXA 2QRVB 1IN4A 3HCOA 3JWHA 2L42A 3DE4X 3ES9A 3WFZA 3JD3A 4YJ2A 1ZI6A 4DUGA 3WISA 1ISJA 2WTMA 2IXGA 4MOWA 4H1HA 4KXLA 1SKMA 1XD2A 5LYJF 2TS1A 2YMQA 1P2UA 4NS1A 2C9BA 3NHAA 2ECQA 2J9ZB 5FTMA 4R31A 1QZTA 2MOKA 3KQQA 4M1TA 1MEJA 4RLHA 1ZL2A 2BUCA 4LOKA 5CFPA 4IOMA 1YMUA 1ZA2A 4JCOA 4C4PA 3VGPA 2IBTA 4RJLA 1KPGA 3WGQA 4Q6WA 4XGIA 5SYMA 5IHXA 1DOHA 2JIZA 2RI1A 4QULA 3JPYA 3I73A 4EW3A 3FTNA 4IMRA 4O4IB 3G0BA 2ZTMA 5B53A 4XASA 5T3YA 3OQ6A 1IIRA 2EHDA 4FOLA 4CV2A 5PNTA 4LHEA 1JMYA 1ZW6A 4IGIA 1SU8A 4LWQA 1Z08A 1N2SA 2O2JA 3SBOA 1DJMA 3W7VA 3CF2A 1Z0DA 4IOLA 2FE1A 5C1DA 1YFKA 1A9ZA 1HYEA 3DYVA 2Q4RA 5KYYB 3L7NA 3L8MA 2YASA 1V47A 3Q98A 3S8EA 3ZWOA 4JQCA 4KDFA 5EE3A 3IDOA 4A7PA 1JQ5A 3C6XA 1F60A 4INZA 2XH8A 1K7FB 5K0SA 2HA3A 1L3CA 2G36A 4ROTA 4R2WA 4M21A 1VECA 3W4IA 1DKQA 3ZXUB 4MPJA 3G8BA 3INYA 5ARCA 1QCYA 1V4BA 1TC1A 1UPFA 4Q34A 1UXKA 5DI9A 4DJ5X 2PBRA 4C1BA 5ALVA 3S2SA 2EJTA 1GIAA 1T9DA 3RLFA 3TOCA 5THKA 3WYCA 1UBNA 3ZJYA 5IUKC 1XZNA 5FUBA 4GM0A 5BV1A 1WEHA 4WOJA 3GOQA 4AQYB 2GN0A 5JWOA 4R9UC 1OFUX 1ZH6A 1AGYA 2QAJA 1NMEA 2VUIB 3A1SA 3HKEB 3NOVA 2ZRLA 3C85A 4BLUA 5G3YA 2VF8A 1NI3A 3E58A 1QHIA 2F43B 5BN3A 3F5MA 3I04M 2OC9A 5J1SB 3LUFA 4CMEA 4RVHA 4EFKA 3OT4A 5TEWA 2QTVA 3D1LA 3DEYX 5BNWA 2PPVA 3PGVA 4DB4A 3LC7O 4WA8A 4Z86A 2CXTA 2ZS7A 3FKJA 2XUJA 2RGXA 3O8DA 1M6YA 1XKXA 2CE7A 4HB3A 1WO8A 3LUCA 1W52X 5ALKA 2YYZA 1MDFA 1U02A 1R9NA 3N0RA 4A0QA 1DO0A 1DTSA 1TEXA 1UBCA 3JVEA 3CJRA 4Z9BA 2O2DA 2I4IA 4MVYA 2PO7A 1ZGBA 3O2SB 2ZBRA 4RLFA 3AM5A 5LP6A 3BFXA 4XQGA 2XE6A 5ARBA 3MS2A 1M5TA 1WB4A 2O48X 4OFWA 1V8FA 4YJHB 1KI1A 2VDRB 1T8UA 2A1TR 3GJ7A 1PTKA 1OGYA 1U2TA 4M98A 4RQBA 2Z08A 3P9ZA 4YS6A 2FEKA 4L2IB 3L7JA 3IMGA 3PDJA 4JT2A 3RAJA 4LSMA 4MV3A 4NDNE 4TT3A 3GV0A 1KO1A 3UYKA 5ALOA 4EAAA 3L0BA 1GCOA 1ZC4A 4JXXA 2K7FA 2IZ1A 1ZZEA 1SHTX 5F64A 1J5PA 2ZUCA 3T5DA 4F84A 2DPGA 1BJRE 5LM3A 1KSHA 4WXEA 3JATB 2PKXA 5KS2A 4OQZA 3DAPA 1W73A 4FE3A 1DAPA 4NPHA 4K9LA 4HTFB 3GAMA 2QE7A 3QKRB 4BKUA 1E7SA 1KMHA 3DF9A 5BUCA 1RQLA 3QEJA 3OCZA 1DCKA 1NQVA 1YQGA 4U8HA 2R0QC 2AOTA 4CQMD 2FMTA 1QH8B 3W3AH 3W3AD 4XARA 3JR3A 3UB2A 2E85A 2HKIA 4XEUA 2GCEA 4ZVPA 4RY8A 3C70A 2RDMA 1S2GA 4R01A 4US0R 3EMDA 2FPOA 5MDHA 2BEWA 5F5LA 4BGEA 5EZSA 4RFVA 1EX6A 1QGUA 2WHPB 3F6PA 3GD5A 1WPRA 1KI7A 1P45A 3O94A 1W76A 3QPVA 2H8GA 2QM8A 1KDPA 5IMSA 2Q27A 4WV3A 2DYKA 1PHRA 2LUOA 2Q5CA 1RRFA 2XNHA 3ND7A 4MUKA 5U9CA 3HB5X 1MAWA 3U7GA 4ZU3A 4HNSA 2M6LA 1PR3A 3A2LA 2PS0A 1NRJB 4HVAA 3VU1A 1UPXA 2FQ1A 3RYIA 2AJBA 3LA6A 1PVOA 3DLTA 4BNKA 1ESEA 1IOWA 4JELA 3PDIA 2BGTA 3SQNA 3CEPB 1KIMA 4FR5A 1VBNA 3WHPA 2GWRA 3DDSA 1DVRA 2WLSA 3T6KA 3KSBC 2ID9A 2Q7XA 2DQYA 3HVUA 3ITKA 4GXRA 1NJSA 4B17A 2LR0A 3LP8A 2VHEA 4CL8A 4RGBA 2HSJA 3ZLJA 4MUAA 1T8YA 1KEWA 2B8EA 1DUIA 2XZOA 2EV9A 1YE8A 4G01B 4LZJA 3K2QA 4MYRA 1Y5MA 2HFKA 1ETHA 3G9XA 4RAOA 4PAWA 3ZBQA 2QL5A 2JKZA 2PT5A 3BA6A 1NHGA 3PGKA 4HWKA 4DMFA 4AT1A 5ADUS 2Y1XA 4MVJF 4CLDA 4ED9A 1DXOA 1FTGA 3D4LA 3R3HA 2VDQB 4FYWA 4U39A 3AW8A 3VUFA 4DT1B 1GKYA 2Y4NA 5BRAA 2AXPA 4V1CB 1J6UA 3EVTA 2V7QA 1C30A 3CW8X 4ZAGA 4GU5A 4AP6A 4IO1A 1Z8FA 3K70D 2RI6A 4RTJA 2RK3A 4ZO7A 1XRMA 2WYVA 4N4AA 3GMDA 3U7QA 4AU1A 4RSRA 3V2IA 1G9XA 1FQJA 1UJBA 1M7BA 1BX3A 3HZRA 4IVNA 5D1HA 1JTVA 4BHTA 4JU9A 4LKRA 1L9KA 1H5NA 6AT1A 4L4ZA 1U1IA 1F2UB 3VVLA 2HU7A 3KJEA 1B00A 4JV5B 3FAKA 3N5KA 1RP1A 3JYQA 1U9CA 3M6WA 3BFKA 2HYIC 2OXIA 1QRSA 2FETA 2FWPA 3L6OO 5AW0A 1HQDA 2X3YA 1R0BA 4PIMA 4ZHQB 2XDQB 3TD6A 4GX1A 2WFMA 3N1UA 3RT1A 4DOMA 2R48A 3E5HA 4AKGA 2VF5X 3A05A 1CZOA 1D8TA 3EIEA 3L3BA 4S1OA 3VSBA 3NT5A 4IDQA 1IRXA 4MICA 4KNYA 2XBLA 3P8ZA 1O2DA 1TVCA 2OV2A 1JIIA 2C92A 3HWX1 4HYEA 4U8GA 5DSZA 1ITZA 3TSOA 3W9UA 4JJ4A 5F3DA 2FWJA 5FJIA 4MKGA 2OFOA 1BMFA 2PU5A 4OOEA 2JLSA 4PLHA 5BW6B 1CEEA 2A78A 4KX3A 3G7SA 1QAOA 4ID3A 3RHSA 3EQ8A 3PRHA 2V7EA 3CSUA 4ENSA 1JG6A 3R74A 5IZ4A 4JJ6A 4LCEA 4Q6BA 3W2FA 3A37A 2ID7A 3CUKA 5GOTA 4I19A 1N6RA 2KYRA 4MAAA 1H1LB 4XPZA 5CTAA 4E5NA 1J2JA 4LTNA 3LY8A 2VDOB 1OFHA 1FTSA 2R00C 1JALA 5JMWA 1IN8A 1Q1AA 4MUYA 3D8NA 1NUUA 1BVRA 2EZUA 3L0ZA 1R64A 1YUNA 2Q6OA 3IERA 1PZFA 3R0VA 4ZVOA 3RU7A 3ZCPA 2I2DA 4MUXA 3ADDA 2BBOA 3MM4A 2VHCA 4PZDA 1LLFA 1PJCA 4XLZA 5ARDA 3UMJA 4F6RB 1A9XA 2OSBA 3DDHA 4HRAA 2GKGA 3N8HA 2G28A 2X9QA 5DGTA 5LLTA 1D2GA 1GYRA 1CQJB 1GTZA 1BZYA 1Q22A 2ZBPA 3A9TA 3D7LA 4FSHA 1FFEA 3H65A 4FYVA 5AIAA 3UUFA 3U3OA 3DVAB 4IR7A 3C14C 1WW8A 2P1DA 1R9JA 1NLYA 3AY7A 3DTVA 1CJSA 3ZHTA 4BAZA 4RTOA 1UXHA 3ZJUA 5DTJA 5ITVA 3Q15C 4WKNA 2XNDA 2IEGA 3RSZA 1SC6A 1IU9A 2VXCA 2EKPA 4HB0A 4DM4A 3RUPA 4EVQA 1AZLA 1I7PA 3CR7A 3WLJA 5D85A 2PRKA 4J7XA 4WSOA 2P7IA 4JL5A 3DH0A 2BUBA 5HMLA 3IOYA 3OHMA 1FDOA 3V5NA 3WIOA 4Y67A 3LLSA 1QOQB 2WW8A 2DT8A 3IQDB 3ANNA 2AXEA 3DBHB 1ZGCA 3L18A 1R6BX 2WV9A 3DQQA 1GDHA 1MIOA 1PVVA 1GILA 3BMQB 4BGIA 1N32B 5FL7A 1JPVA 1P60A 4OHRA 2I4TA 4Q3LA 4CCYB 2J0UB 5DYTA 3I05A 2I87A 3SP1A 4IP0A 3GY0A 3GU3A 2HJHA 4P4NA 4YXFA 1NQ5A 1O94C 4KXFB 4OLBA 4CRWB 1XRQA 5TF4A 1VSVA 1U31A 3U3KA 3EIUA 2BP7B 4LPSA 4NYMR 1XBTA 2EFDB 1OSNA 3AU8A 3BRWA 2IP4A 1NUQA 3K1JA 1NJGA 1VJ5A 2EBWA 2H8KA 2NSJA 1U3GA 4O29A 5K3BA 3I9NA 3F7MA 3BIWA 3SZMA 3UMRA 2H5JA 1II9A 3HVHA 2JGAA 2QUIA 1T2FA 3G2QA 4I3HA 3WHKA 2QL6A 2OYRA 2X1MA 2FQYA 5H59A 2J7PD 1I9CA 3GPDG 1VFPA 2ERYA 2GN2A 1EWKA 1KKUA 2P4SA 2QOEA 2XTNA 3C7AA 3LC2O 1A5ZA 1L6RA 3LGXA 1FUKA 2R1VA 2HN9A 2COKA 2X0KA 4L4XA 5E6SA 1A71A 1E79D 1PQYA 3CA8A 5DV9A 3RS2A 1M2KA 1M6VB 3TZHA 5AW7A 3SBXA 2ZKLA 5EXEA 3MMNA 4HJXA 4DWVA 1BSVA 4Q39A 4PS0A 1NSYA 1XTIA 2PD6A 2I8AA 3FCYA 2BKVA 2R6AA 3WKDA 4Z9FA 3W90A 1MAUA 3DNMA 2C2HA 3M6VA 5LQKA 3HWRA 2N0SA 5AKJA 2Q8PA 4FFDA 1HLPA 4MW9A 1HG0A 3RGWS 2Z56A 3UMVA 3VAAA 4YRNA 4NRDA 1BFKA 3IAS1 2ZIZA 4ZARA 3PVSA 1I3CA 2DY0A 4NLLA 1IZYA 1EDBA 3VJMA 2PMWB 1X3LA 3N53A 1IZ8A 1PI3A 2O7SA 3KPYA 2EDAA 1AOXA 2BFEA 4GHWA 1C7IA 1NNUA 4CQJA 2HM7A 5E4FA 4DLPA 5AESA 1L7PA 1QIIA 4IYRA 1JXOA 3C3WA 4JR0A 2R1TA 4NMMA 3ZGNA 1ZMBA 2OB2A 4Q9DA 1Y3AA 1MAVA 2FGKA 1Z22A 2GQ0A 2A33A 3PEEA 1IHXA 1P2GA 2P77A 2DFNA 1F8YA 2Z4RA 4PLGA 1AA9A 5F9HA 2NO4A 4K9QA 5HZMA 3K9NA 4MEJA 1ORIA 1D0IA 2J33A 1YR7A 2VYVD 4RY9A 3OTGA 4DQVA 4C5CA 2HJSA 3MTJA 4NDAA 1GR0A 1P7CA 2QIPA 3DOFA 4FGSA 2GK6A 1L8AA 4OK3A 4RZQA 4BQPA 4CKXA 5A9SB 5EHXA 3GPCA 1TM2A 4DCJA 4Z4QA 2IW1A 3A6FA 4MTCA 3SEZA 4N47A 2FSIA 4WNIA 5FFMA 3PE3A 3R0XA 4IUCS 4W5RA 4E33A 2O59A 5J2UA 2AX3A 3S55A 1A9RA 3ZZ0A 1A9XB 1ZP6A 3T8YA 4EB3A 2W2MA 4GOLD 4KFSA 4N3NA 2PWYA 4F1KA 1T6YA 3SR0A 5KOIA 4BBJA 2A9VA 1X80B 3HMQA 1NE7A 1XQ1A 2G4VA 1HEUA 3AUTA 3BUSA 1TD1A 3B7PA 4OKSA 2YS6A 3W5IA 4ZYTA 1XMIA 5AW6A 3R3XA 1CSEE 4HUQA 4BECA 2O5EA 1NVMB 1YAJA 2YIDA 5AM3A 2FZ5A 1NMZA 1J0AA 1YR3A 4MHSA 5T64A 3SNHA 4MROA 4PQYA 3WGGA 3CVOA 3THRA 4X1IB 5F7OA 1ZUWA 4O0MA 4H7PA 2XCUA 1YUMA 2YKGA 2J3HA 2NXNA 1BA3A 2RHWA 5KTMA 3LOQA 3I5XA 5DNVA 4M83A 1QFMA 2HDWA 2QMZA 1XP5A 1KO4A 3KM0A 5DHPA 5F5XA 3TTVA 4KTVE 3M9WA 4KPGA 2FDRA 3ZQKA 3IQXA 3A1NA 1ZIDA 2ZAOA 3VDQA 1KTIA 1M1NA 5CB0A 4HZUB 1ODCA 2OBBA 1XRJA 1QYCA 2QMUA 3MNFA 2WA2A 2Q29A 4P58A 3OQOA 4HGNA 5CITA 1XJQA 3Q2OA 3CZMA 4D4MA 3FKQA 1L4NA 4OU5A 4FW8A 4NV3A 2CFOA 4QOSA 4EARA 2VDWB 2ZRNA 3TLEA 1I7DA 1PE0A 1RTKA 3B3QA 1AUOA 2D1QA 3K0CC 3O4RA 3WLPA 3EPLA 3FF1A 4P2GA 1QHXA 4GMHA 1N6IA 2ZBEA 3I8SA 4I9NA 4ND6A 1B8UA 1QHEA 1MIHA 1RHMA 1DRVA 1LVGA 2V45A 4LGYA 5CW1A 3RRJA 7AT1A 2H6EA 4PW0A 4XM2A 5AHRA 5L3ZA 2DERA 1SXIA 3NWEA 1DSSG 3ZCVA 1ESDA 4EHHA 2RKWA 3IURA 2ZSKA 3F5FA 3KSUA 3T34A 3J81A 1E4EA 4QREA 1IM8A 2HD4A 1AMUA 4EDFA 1RWWA 1C4XA 1PR9A 3PDIB 2RIRA 4JXKA 2HIAA 5G0SA 5JS8A 5KOHA 5KSZA 1Q1BA 4P8RA 2YN4A 4GPBA 5CM8B 4ZYYA 4AY2A 4AI6A 3M81A 1Y9ZA 3QF4A 3L9WA 2OZPA 3K70C 2D3WA 4KHZA 3EVFA 3KPUA 2OE2A 2QI9C 3WLFA 4QU8A 4EEXA 5KYUA 3C3XA 4C2AA 4DLRA 5K01A 2V7WA 2LPMA 3FPJA 5KINB 1YA8A 4PO3X 3NKVA 2DBVO 5TPWB 3PTLA 3VZQA 1WMBA 4MTLA 2GBLA 2NU6A 4HDNA 1UH5A 4MV7A 1VSBA 3VZBA 4CIAA 4F3TA 2WZCA 2FZEA 1VM6A 2F1IA 5ALLA 2P41A 1EX7A 1J33A 2JFFA 3FPHA 1X7YB 2G83A 4IJVA 4ZCPA 5TT1A 3NOXA 3WRYC 3WSTA 2QBYB 4NWIA 4UBIA 5TDHA 5T8KA 4CM9D 4MS4A 2PMDA 5CD9A 3Q7EA 3KAQA 5C8DA 5FOVA 2VQSA 1IHYA 1OYWA 2B4QA 1T5TA 2R8XA 2X5JO 2GEJA 1YIOA 3K70B 1SU6A 1ZICA 3QXSA 5B2ZA 4RXMA 1BXGA 3EFHA 4J6EA 4Z9XA 1IBRA 5DK4A 3UB3A 4YBZA 3JQBC 4TKVA 3T3NA 2P9EA 2RGGA 1R6AA 5AWFC 3CMMA 2C3PA 1TVMA 5FLKA 1U7OA 4PYQA 2OSVA 1SBHA 2GYVA 2I4RA 2QRLA 3ZEIA 3LLCA 1E6WA 1XF9A 4FZVA 4K6FA 2DT5A 1QNLA 1MQ9A 2PL3A 3BH0A 3GIDA 4WKCA 2W2XA 3N6VA 1A04A 1ZINA 1KYIA 1SOVA 4UNSA 4RVCA 4XVHA 5IYZF 2D54A 1RLOA 4WBNA 2W6ZA 2RGDA 1KZ1A 3JXEA 4EHBA 2FN8A 3UJ3X 3WB1A 1DEOA 4UNIA 6PFKA 3NTOA 1OAOA 5IVHA 2ZWIA 3B1YA 5K6RA 5JJLA 4EYSA 1K9VF 4CHTA 1B8VA 2X6TA 1QJCA 5E9AA 3ML1A 4F21A 1G98A 2D5BA 3BQ9A 1QZ3A 3P2JA 4C87A 2HJWA 1XLTA 2B21A 3KOOA 2J5XA 4TKMA 5DGXA 4CL0A 4MKIA 4U2KA 5FEUA 3STXA 4D42A 3WK8A 3LDAA 1QYDA 2HIHA 1W4ZA 3DFKA 3B12A 2Q4EA 3KJHA 4J49A 3O03A 3EWAA 1VDMA 3PD0A 3BIFA 3GUYA 3N86A 2JF0A 4YJKA 5AVRA 2UUOA 5CDFE 2R8RA 4NE2A 3NYWA 4PGMA 3ZCSA 1AJEA 1IEXA 4U7WA 2C8LA 3IJPA 1JG4A 1MLDA 2F8LA 4HN9A 4HWTA 2QRVA 2R8PA 3GXOA 3K31A 2G88A 3L6BA 4GBED 4MZXA 3NT4A 3AHIA 1XWIA 3K0AA 3W8EA 2DLCX 2VVTA 1M1ZA 2FPGA 1DG9A 3NP7A 4HDSA 2P6OA 1TGVA 5IXJA 1U8FO 2Q07A 2PIAA 3DMYA 4UU1A 4CKWA 2XY4A 3RCBA 1J8DA 1NJFA 3GLIB 3B5EA 3G2PA 5HKKD 1THGA 4YUWA 5JPDA 1KIAA 4X92A 2NUAA 4ETIA 3M6AA 2MCFA 4GZ6A 3V9PA 4N0PA 1R37A 1TF2A 1N1MA 3WNVA 4BB0A 3DFFA 1X19A 4FYPA 5AYVA 2PUGA 3DO8A 5KNCA 3CONA 5JSFA 1FJHA 3LHFA 4KIFA 2GJSA 1OY1A 4Q3BA 5KAMA 2W2PA 1P9OA 4MINA 4H17A 4NEGA 4GUAA 4WDRA 5ES3A 5KYXB 4RTRA 2XJ9A 3DZJA 2WF5A 3RS7A 1PL7A 2X4LA 3VM6A 3OHPA 4UTRA 2P78A 4JQYA 2M9MA 1Q0SA 3HQ4O 3Q9NA 5FD8A 2QN7A 4W5OA 2ZW9A 4MEAA 3P9CA 1UQRA 1M10A 3T7DA 2C84A 4XLLA 2YWFA 3HKDB 5C8YA 2D00A 4YMSA 4MWEA 1GCUA 5C5EA 1SM4A 2PJRA 1M8KA 3DOJA 5DASA 2MINA 4WZBB 3VC2A 3EWIA 3KE9A 4KFCA 3PNVA 2JCYA 4UHFA 1W8DA 4EVRA 2ACWA 5SZHB 1JU3A 2HTFA 1D6SA 3IRVA 1P61B 5AKEA 4CIYA 2GKOA 3EGCA 4INAA 5GZ3A 2EFCB 1CF4A 4CEJA 5KJCA 1CLEA 3D81A 3L0OA 2XLCA 3GZTB 4YFVA 2XLBA 4RPLA 3WSWA 3TUZC 4Y1EA 4HWPA 4CDGA 8OHMA 5LQNA 2RGYA 3K94A 4WJKB 1L4LA 2YFKA 5YASA 1C7ZA 1GPKA 2C4WA 2C2GA 4ZYUA 4A2QA 1H4VB 2CLKB 3AL2A 1A8SA 4MUJA 4U9IS 3E8SA 1D03A 1NQOA 2C3YA 2XUAA 2Q5JA 3AIMA 5JO9A 4KQWA 1QU2A 1YFLA 1T9HA 4DQUA 1EWQA 1TYEB 2ZJ6A 3TCXB 2JFVA 1AQNA 1V48A 2G1KA 2BSAA 1UOEA 4DR7B 4W1PA 1G17A 1E69A 3RVBA 2Z2JA 1VL1A 1E3QA 3FYDA 1OH7A 4U0JA 3ZE0B 2GDJA 1Q6ZA 1U0GA 1NXOA 2E18A 3L41A 1TPYA 4DRZA 4ZDJA 1DDIA 3CRRA 2V7UA 4QHTA 2ZSFA 4U2DA 3AZQA 5B1EA 3W9SA 5JJ5A 4ECEA 1AO0A 3AXTA 1BKDR 4H1WA 4Y2UA 1MPXA 3JZDA 5H9VA 5L53A 3SHTA 2IEZA 1JP7A 1EFVB 1MUUA 5BSVA 3ICEA 4YAEA 2CBZA 4TS9A 2WWYA 1U2QA 3QYFA 5KDOA 5GV7A 4L16A 4MV1A 1D5CA 2IUFA 3NHKA 4LUCA 4XAQA 4DTCA 4EO9A 2B1JA 2AN3A 3P0IA 1EP3B 1VL8A 2PD3A 2GNOA 1N6PA 4WZAA 1T5BA 1HRDA 1Q0QA 2I6GA 4QJIA 2YJTD 1YJBA 3DSRA 4Q00A 3HCAA 4CDMA 3ZI4A 1FYDA 4C7JA 3BOSA 2CZCA 4UUAA 3EXG2 4IH1A 4DVGA 4GP6A 4I9HA 2ZT6A 4MW0A 3ONWA 5HOQA 5BR1A 3AUJB 4CNBA 3EC2A 1X1RA 3EG9B 4K2HA 4J9VA 1P0IA 1UOPA 3OZAA 1Y8AA 4D79A 4ZZ0A 1VIDA 3OC6A 2PLAA 1G5TA 2P9JA 4PRLA 2ENUA 5JQGA 3ZGZA 1E96A 3H17A 3CFYA 1EBFA 1FFCA 1Z82A 3DBHA 3ETHA 5TXGA 4ZJPA 5CDHA 4O3FA 3WRWA 3ZE8A 4EJSC 4YQYA 3ROZA 3FZGA 4IINA 3BSYA 4D92A 2ORYA 1RIIA 3EG5A 3I3SR 3I9V6 4PLPA 3VH3A 2C7BA 3H9EO 4KL8S 3O92A 1UMBB 3KZVA 4OHKA 3WYGA 4DSZA 3IE1A 4CKCA 2Z5FA 3Q85A 4C0HA 4OXKA 3G59A 2J9FB 3MC1A 1DGQA 1KF0A 1M2OB 3Q88A 4BVBA 2OB1A 3T5AA 2JLYA 4NCXA 4RH1A 4JKYA 3AIKA 4N3AA 1WOMA 3RANA 3UV7A 5A71A 5F77A 1V0JA 4EM6A 1HH4A 4D96A 5KX5B 1G3MA 2R7MA 2O8VA 4HWOA 3OKCA 2NZWA 1YS1X 2P67A 1AGRA 4GEGA 2G08A 3I23A 4OSOA 4RK6A 4RD4A 4PYRA 4GH5A 3FDIA 4CLOA 4DIDA 4UAJA 5A4FS 3NJ4A 3DE1X 1KFJB 3JQEA 4K8OA 4F85A 4YYZA 2ERXA 2YDYA 3HJAA 1W36D 4XD7A 3RS9A 2RAPA 2Y05A 1JAZA 1FLVA