1XTIA

Structure of wildtype human uap56
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
381
structure length
381
Chain Sequence
GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 128
structure length 381
sequence length 381
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA02
4S35A 4DT1B 2FDCA 2GBLC 2W6JA 3SHFA 2IX3A 4XWAA 2R6AA 4EPTA 1NKSA 3F8TA 2RGDA 4LCBA 4Q01A 2C77A 2QTFA 2QUZA 3I92A 3RSLA 2ZS8A 1KNQA 3AEZA 4E22A 3QVUA 4RD6A 1HE8B 1JXMA 2JA1A 4XIGS 3TVDA 1NN5A 2GTPA 2BMJA 4Q9KA 4Q1DA 4LWZA 1W2GA 1KDOA 1VTKA 1JPNA 3F3YA 2C04A 3IQWA 3RRNA 1M8PA 2ZQ5A 1FPMA 2QQ0A 1E2PA 4OK5A 3D7MA 1TUEA 2O8CB 2CLDX 4A36A 3CWQA 3BJIC 3L8ZA 3I1FA 3W6OA 2ZJBA 3X2SA 1G7CA 4IDNA 1FQKA 1G21E 1IOZA 4TQAA 3Q7PA 1ESNA 1PVOA 1G1MA 2C99A 3DZDA 3R9IA 4LYAA 1E2GA 1VG8A 3AKYA 4HDOB 3SDZA 2IS2A 5L3RA 1W36B 4Q19A 1GRRA 1MV5A 5EQTA 2JJ8A 1FTNA 3KUDA 1FP7A 4HUQB 1KI6B 4PAQA 3RVBA 2JLZA 3A37A 5EJEA 2NO9A 1LB1B 4QG7A 3CF0A 4FMBB 2YC2C 1G7TA 1P73A 3UK6A 2G1KA 1G6OA 3ZIAD 5F9HA 1TTTA 3VAAA 1W4BA 4NCKA 1OFUX 4UNQA 2ZRKA 5GJVC 3ZJYA 1XZPA 3M6AA 3ETLA 1R8QA 2ONJA 5L3VA 4IFEA 2QGZA 3D8BA 3SI7A 2FJUA 4M22A 1TNDA 1OH8A 1ZU5A 4LV6A 1N5LA 4X8HA 4BLOA 4C0BA 3AVXA 3PQCA 4A82A 2GRJA 1VECA 1VCOA 2H57A 4I1UA 3T34A 5KNCA 1IY0A 3L8YA 3DVLA 2PX0A 2PL3A 3IGFA 3RS0A 5J4VA 2W2TA 1XCGB 1XXHE 4BFZA 2WWHA 3KKMA 1NBMA 4TTPA 4XTRA 5C4GB 5TVKA 1L8QA 3IKJA 1VIAA 2CJWB 4CZ2A 2ZJ5A 5AJVB 4B3DA 5FL7D 4QGAA 2PH1A 1VG1A 4G0NA 4Q03A 1WF3A 4PZZA 2VQSA 3E70C 1LS6A 1QDEA 2GA8A 2GBLA 3TKLA 3GLHA 5HCIA 4UQOA 4DC9A 2QSYA 1A7JA 2OCPA 4BLTA 2WKRA 2FOLA 4Z8XA 3PUWA 1Q22A 2EWVA 1J70A 4IEIA 4AI6A 4M1OA 5DYIA 5F9FA 1DOAA 4DIDA 4MDFA 3K9LA 2G0TA 2HYDA 4NP6A 1U90A 3EAQA 1NVUQ 4E03A 4HZIA 2GK7A 4MYCA 1Z47A 5JJIA 2DFTA 1GP2A 5EUQB 4UNPA 1VDZA 1HYQA 4Q00A 4Q1EA 3TBKA 5JLJA 2IS4A 1KI8A 4RFSB 2YZ2A 2X8AA 3C15C 1UEIA 1KYIA 4GOXA 4HDCA 3PEUA 5SZIA 3AB3A 3T1VA 3FVQA 3A36A 2ZU0C 4EQ6A 4POAA 3KQNA 3K70B 1DAMA 4FMDF 3R20A 4AKHA 5CLLA 3WMEA 1IN4A 3NXSA 1KZ7B 1Y63A 3RDPA 2O8EB 3E1SA 1GZSA 5A4JA 1Y3AA 2J0UA 1KJWA 1P62B 1SXJC 1QHNA 1F2TB 1U81A 3EZ9A 3VX4A 4IJMA 3MWLA 4Q9JA 1G18A 1G6HA 3K9HA 1A82A 3QXJA 4QOSA 5CYOA 1XD2B 5EUMA 2GF9A 1Q1BA 1XMSA 2QTHA 1Z63A 2CCKA 3VR5A 3DOFA 1YRBA 1VCIA 3T1OA 2ODBA 1KK2A 4QJ5A 1DTSA 4B3BA 3VQTA 3QE0A 2F55A 4XWOA 4GP6A 1G3UA 1PLJA 2QRZA 3S1AA 4CEHA 3KJGA 1VMAA 2GZHA 2VP0A 1E98A 1I2DA 1L7VC 3KB1A 4FW9A 4C3ZA 2AN9A 5JWRA 5L3SA 2OG2A 1UKZA 1KMQA 3SQWA 5FBRB 1U9IC 3LXRA 1A5TA 2YINC 2JASA 1AS3A 1R5NA 2Z43A 2HJGA 1N3BA 4YC7A 4BFXA 4DVGA 2MMGA 1F5NA 5A0FA 4HB2A 4BRWA 3EPKA 1OLOA 4PXAA 2J7PA 1YKSA 2AX4A 1S3GA 3CNOA 1ZC4A 1Q3HA 4LJAA 4F38A 3LVRE 3KXKA 1FQJA 1N5JA 3E5HA 1MRNA 1SVWA 1I4DD 2WOOA 4HDQB 4AC9A 1ZD9A 4IHQA 4D0NA 1VHTA 1JXOA 1YZGA 1NY6A 4FI3C 1JR3A 1Q3TA 1Z6TA 2L0XA 3G82C 4LX0A 2E1RA 2WWGA 2YVUA 2PBRA 4KITB 1XDBA 1AS2A 1CRQA 2AK3A 1ETUA 1TF7A 2W2XA 3DZ8A 4K81B 1AK2A 1E2FA 4DCVA 4D82A 4CT5A 3T12A 2BHRA 4HAYA 2IYZA 2WBLC 4C0KA 1G3QA 3OE7D 1KY2A 3BAFA 1OYYA 4DZZA 3AVUA 2JATA 1YZNA 5TDHA 1W36C 4KSCA 3BOSA 2O5VA 5FPSA 3RC8A 2ONKA 2JAQA 3CWZA 4JYBA 2AFHE 4Q7KA 3OAAD 3UXMA 2P67A 5DI3B 2PCLA 5GVRA 3AH8A 4MRVA 1I2MA 3THWB 1P2VA 1RJ9B 3DL0A 5AUQA 2Z0MA 1Z06A 1ZP6A 1S8FA 4NYIR 3HWSA 4FD2A 3ZGXA 1E4VA 3C5CA 3CZPA 4TLDA 1G5TA 4NYJQ 1KI1A 2H7VA 4L9WA 2ZVPX 2WAXA 5TB5A 3VMFA 4FINA 1OXTA 2V1UA 3VKHA 4PX9A 1GILA 1TF5A 1OFHA 4B2PA 5DGXA 2N46A 3RWOA 4D2IA 3FHOA 5EXSA 4F4JA 4TL8A 1GL7A 2BBOA 5BWMA 4B76A 1OH5A 4EKDA 2XTZA 1M74A 5FBLB 4WZAE 2A5GA 1KAGA 2IHYA 2IYUA 2VL7A 2IHBA 4BECA 2XJ9A 1ZU4A 1C9KA 3SYKA 1SVIA 1DADA 1E0JA 4M1SA 5DISB 4JYCA 3AUXA 4DT1A 1U9IA 3SU8A 2B8WA 2CEAA 4V03A 5HE9A 1L4YA 1U94A 3EZFA 2CL7X 3AGPA 2DCUA 1G8GA 1MO4A 2IC5A 2ZI4A 5KDLA 4YXWA 1QHSA 4MRRA 4ZIRA 3AVTA 4LI0A 2OZEA 3QG1A 5KTYA 3DKVA 2W6JD 1KSHA 4QHTA 4A2QA 3KL4A 4EFMA 2CHQA 4XTCS 1JQLB 2B92A 4YMTA 2Z6VA 4NYMQ 1YE8A 1GDDA 4PTLA 3W9YA 4D0LB 2IXFA 2A30A 2QPOA 821PA 1C4OA 4U5XA 4MH0R 1DG3A 3T15A 3LLMA 4DLTA 2RGAA 1YQTA 3PITA 4MKHA 5AR1A 1HV8A 2Z5FA 3K70C 4LC1A 2BOVA 4H9GA 1N6RA 2QTVB 1KHTA 5GVSA 3CPEA 2BC9A 2R65A 3L82B 2W00A 4C0LA 1GKYA 4PQRA 1SVMA 4EPWA 3QVVA 4O25A 4KYUA 2IWRA 3V00A 3LNCA 2PEZA 3VR6A 4MRSA 4GL2A 1KO1A 4ON9A 4PAOA 4Q1FA 1L4UA 1KI6A 4R9UC 2F1IA 4URWR 5JHHB 1AZSC 1WMSA 2XB4A 1Z2AA 2OHFA 6Q21A 2FNAA 1FW6A 3R9WA 1DARA 1X8JA 1XBTA 2ZSEA 3RC3A 2NPFA 1SXJE 1T8UA 3EA5A 1OSNA 1ESMA 2ZU6A 2QAJA 4DCSA 4ZI3A 5HR5A 1EFCA 4Z8YA 2ZUDA 3AVOA 5G41A 2V7QD 1E9RA 4LJ9A 1L2TA 2BEKA 1E2LA 2ZRAA 1XF9A 2VO1A 2ZE8A 3KB2A 3QJYA 3IEVA 3EPJA 1AQUA 1ZIOA 3OFND 4KFRA 4MYHA 2BWJA 4ZCIA 4IW3B 3ZD7A 4G5QA 5JECA 2D2EA 3W6NA 5KDOA 4W7SA 1TPZA 4CIDA 4KFTA 4HB0A 4Z1MA 4CGZA 1AJEA 1WA5A 3P26A 4M1WA 5K8UA 4HSEA 1KKMA 3RHFA 3TMKA 2IA5A 1GAJA 2ZREA 2IL1A 2W2VA 5D3MB 5F98A 1G5PA 4TLCA 5JCZA 3M0EA 4TYNA 1G7SA 2CJWA 1NF3A 2FX3A 3A1TA 3BB1A 1P60A 4M0LA 1BKDR 1P3JA 3BORA 4MUBA 3IQXA 4TL9A 1CS4C 1DAIA 5FOTA 2NOAA 3CR8A 4B75A 1G19A 3QPVA 4E07A 4ZCLA 1XEWX 2BCGY 4TYWA 4OJQA 4JLNA 5H68A 1EFRA 4A2WA 1UFQA 1NBMD 3THYB 1ZRHA 4DCNA 1NIJA 2ZI6A 3AKCA 4B34A 4A0RA 4ERNA 4MKIA 4DB2A 5DNYB 2GXSA 3KFVA 2ZRGA 4Q9LA 2P65A 3BH6A 4NE2A 4ZDIA 4G5OA 2NQ2C 5AK0A 4LBVA 4I99A 5EZ5A 1KK1A 4Y0VA 3ZVLA 3P27A 1LTQA 5FR1A 4GI7A 2YKGA 2MMCA 4HAUA 2OT3B 1J99A 4IOLA 2VRWA 4BFYA 3QOFA 4PO1A 3HYRA 4C0JA 3LH5A 1G5RA 1NLFA 4AYWA 1W4CA 2A78A 1QVAA 2EW1A 2RGEA 2HLDA 2XTNA 4O2RA 4W5WA 1N6NA 5B30A 1S4QA 3EC2A 3B6EA 1WXQA 4BLRA 2DY1A 2WWFA 2XNDA 1XTJA 4TSFA 2O8EA 1XMVA 3ZVRA 2F1JA 1PLKA 2GHIA 5HCNA 3SR0A 2OUKA 2PT5A 3CRRA 2WWYA 4M4SA 3FGNA 1E99A 2ZJAA 3I32A 5BN3A 1XEFA 2ZJOA 2J0UB 2ZYVX 4IEEA 2BMEA 1N0UA 3GJ5A 3AP3A 3H2YA 2C8VA 2RB4A 3QNUA 3QXXA 2QQEA 1HEIA 1KJYA 1MO6A 3CLVA 2IXEA 5FPKA 2O0KA 3TUZC 1T8TA 4F4IA 4QC2A 1NI3A 4PSVA 4NDZA 1GKUB 1Z83A 4BFUA 2QP3A 1G16A 3HDTA 2DBYA 3C7KA 3MWYW 3I62A 3AP1A 1ANKA 2EYQA 3DO6A 3CUEF 2ZYWX 2ZJ2A 4RVCA 2V3CC 5HZHA 1IY1A 1GL9B 2IEYA 3GLIE 2ZM5A 4PZLA 5IT5A 2QAGA 3S1AB 4B3FX 4A0HA 1Q1EA 2O52A 2Q6TA 4ZV4A 1OIWA 4DXAA 3ADKA 4QRHA 3THXA 4A2PA 4QJ4A 1A1VA 3TAUA 2JGNA 3K0SA 1YR8A 1M1YE 4QFMA 3TUJC 3GLGA 2FE4A 4MGZR 1N2CE 2ZS9A 2IBMA 1O87A 3X1YA 2CE2X 1X8LA 1N6PA 2RMKA 2LKCA 4BEBA 3OIYA 2R6DA 2EVWX 4BE7B 1R4AA 3PEYA 1ZM7A 3OEHA 2IWHA 2BKUA 1X1RA 2H1LA 2J1LA 5H70A 3ZZ0A 3DM5A 4DCTA 5JWOA 1VHLA 1O3YA 4IOJA 3MJRA 2XITA 3Q5DA 4KODA 3LA6A 5BYJA 5K8TA 5ELXA 2J7PD 1E2HA 3VU9B 2W0MA 2JLYA 1F3OA 3MSXA 4UXJA 4FWTA 3KZ1E 2LKDA 1P4SA 3UMFA 1ZUIA 5FH9A 3NBXX 2FGKA 4HUTA 1TADA 4Q7MB 3QY0A 4M1YA 5FTNA 3WBKA 1JR3D 4BRUA 4II7A 5JHGB 1FNNA 5F3WB 4HAXA 4C0SA 4D80A 2HT6A 1P2TA 2VHUA 5EZ6B 1HTWA 2FN4A 1LFDB 5FOUA 5FBVB 2XAUA 1QZXA 2CVHA 5KU1A 3CKLA 4JVLA 3FHCB 4FIDA 3WNBA 1B23P 2QRNA 3NDPA 4ABYA 5E7JA 3UWOA 4BWYA 4D4KA 1Z28A 3BWDD 1KI7A 5FOVA 4NCJA 1Z0JA 1GVNB 3FYHA 1T6NA 1CF4A 1DEKA 1HUQA 3KKQA 4JS0A 2ZSFA 4DDWA 4XSHA 3O8RA 2E87A 3A1WA 1SGWA 3F5FA 4B6FA 1E1RD 1UBEA 1M6NA 1II9A 5AUPB 1D2MA 1XD8A 4UNRA 1GNRA 4PHGA 1LV7A 4OQMA 4KHZA 1S2MA 2FSGA 4AK9A 1GOTA 3QF7A 1T3LA 1ZMXA 1Z07A 4QL3A 5BN5A 1HH4A 2A5YB 5JI2E 2OFWA 1OB2A 3R8CA 2SHKA 3REFA 4EAQA 1NN3A 1U0JA 3BK7A 2GXAA 3C41J 1G291 1SVLA 2OLKA 2ORVA 4B2IA 1W5TA 3CRQA 1G8YA 2ZR0A 1C1YA 4KBGA 5EE1A 5KSZA 3BS4A 3W90A 1CIPA 3GLFE 1E2NA 2J41A 3CB4A 3Q5EA 2EYUA 2GESA 2D62A 5AJWA 3RS2A 3WY9A 5FPHA 2G0NA 4LPKA 1YU9A 3ZDQA 1V43A 3PV0A 2WAYA 2ZJ8A 4B73A 4EFLA 1FUUA 3C8UA 4AKGA 1D9ZA 1KDTA 4V02A 2GK6A 3HYTA 4M53A 4W5HA 4D0GA 4ZKDA 3CF2A 1G3MA 3CX6A 4M21A 4QBIA 3IIKA 2WJIA 3M1IA 5HPYB 2CE7A 3A1UA 4LV5B 2FSHA 4ZIRB 1KSGA 2FSIA 3OEEA 3Q85A 2FH5B 3WMGA 2ATVA 1CP2A 1NMZA 2JJ2A 1JI0A 1M2OB 3LRPA 1CTQA 3NWJA 4JSTA 4YXWD 1G4UR 3ECCA 4HLUC 2CBZA 4CEIB 4G5GA 2JLRA 3B1WA 3KXIA 1TAGA 4KFUA 1GG2A 5UKDA 4US1R 3AF3A 4A9AA 4BPBA 1QG2A 1R0ZA 5K8IA 2LCFA 3CZQA 2IT1A 2XZOA 4BGDA 4W9MC 4JMPA 2UKDA 1OH6A 2ERYA 1F2UB 1QHIA 1OXXK 2FWRA 2AL7A 5KO2A 3U6KA 1K8RA 2ZSAA 1XMJA 4P3YA 2XZLA 4D25A 1U8AA 4UNSA 5TXGA 4GSYA 3UWKA 2ZPTX 4UXHA 1RW4A 1NRJB 4W5JA 3SBEA 3GP8A 4EPXA 3OIWA 4AD8A 1TEXA 1ZNXA 2J45A 5E3HA 4IDOA 2R2AA 1RRGA 5LDDC 4B32A 3TIFA 1E0KA 2QI9C 2CNWD 3SEAA 2YWFA 3EW9A 1Q12A 1W36D 2OO7A 4GT1A 2FPMA 1SQ5A 4Q66C 1FTSA 2R44A 2CCJA 1KMHB 3SC3A 4DJTA 4I1SA 2NO1A 1W1WA 1KO8A 2ZE6A 3KJIA 3AVYA 3LLUA 2IUUA 1X3SA 3OHMA 4EJSA 1IBRA 3BXZA 3KXLA 4PZYA 2B7CA 4P33A 1DVRA 4WAUA 4DBLC 2ANBA 3TE6A 3HP1A 3QI2A 2WJVA 3B82A 3MCAA 3BB3A 4OHWA 4ESHA 3OIVA 2FEMA 2HXSA 2RGBA 1KIMA 3NH9A 1MABA 1XTSA 1JEEA 2PZEA 3T35A 2AHOA 2IS6A 2XZPA 1KDRA 2EWWA 3MWJA 4A92A 4BFVA 3CO5A 5D3MA 3TW8B 5BW8A 3B2EA 4BUJA 5JEEA 4DDUA 1IN5A 2W83A 1SZPA 2DWPA 2H8KA 1LS1A 2W0SA 3I72A 2IW3A 2OXRA 3FB4A 5EP1A 2ZETA 5EP4A 5FI1B 1BH2A 3LX8A 4G3XA 2HJVA 2WM9B 4UJ5A 3PG5A 5FUXA 4FXPA 1TEVA 3THYA 4PC7A 2PMDA 5CLQA 5DSZA 3JVUA 1JEDA 3FE2A 3LXXA 1GWNA 2KJQA 2IUSA 2NGRA 4PO9A 2H17A 3H1TA 2WZQA 2PCJA 1W0KD 2XTMA 4YONB 2HYIC 2K5UA 1ZIPA 3ND8A 4EFNA 2G83A 4GMXA 5CDFA 3TSWA 1LVGA 2OCYC 4G1UC 3RYTC 1EFRD 4TTQA 3N5CA 4KLZA 1N6KA 5B57C 4FCVA 3MD0A 1ZD8A 4KVAA 2PZGA 4V0NA 2O8CA 2Z4RA 1CBUA 1KJZA 4V0MA 5B58C 5LD2B 2JLVA 3RWMB 1CU1A 3GJ3A 3P1JA 4R7ZA 4HLUA 4MGIR 5JCPA 2VIIA 1ZCAA 3QF4B 4X8OA 3RRZA 5L3QB 2QP9X 1QF9A 5DH9A 4PQYA 1N6HA 3K53A 3LY5A 4TMVA 1E79A 4GOKA 1M34E 4IVPA 3K8YA 2RCNA 5KOYA 3A4MA 3TSZA 1ZINA 4BZPA 2WWWA 2QMOA 3Q72A 4UKDA 3BB4A 2WHXA 4CRWB 2ZRJA 4MQBA 4BASA 2VP5A 2QORA 1QBKC 1X8KA 2G88A 2J87A 3K70D 4LBYA 4JL8A 4XVUA 2IYQA 4OHZA 2HLDD 1CXZA 3PUYA 4RD2A 1TQDA 2XNDD 3MGCA 5FOWA 3PEWA 4WW0A 5A5GA 1WBBA 1RKBA 4MYTA 1JJVA 2YOFA 4F91B 1EFUA 2GCNA 3LV8A 4PSKA 3VHLB 2VSFA 2WMNB 1AGPA 1FL9A 3TJZA 3U2QA 2A3RA 1QHHB 4TT3A 1HE1C 4HLQB 2PJRA 2G6BA 1W2HA 5H8WA 3D31A 1KO7A 5DN6A 3T06B 2D4HA 4RSGA 5FOXA 3U3JA 3BERA 4LHVA 1T91A 3CRW1 1AZTA 4NHOA 1EK0A 2PEYA 3LQQA 1KK0A 3GJXC 4FMDB 5EP3A 3SYNA 4C7OB 2GJSA 2QAGB 2V1XA 4LHWA 4QJ3A 2AXNA 2BJVA 2XXAA 2XOKA 1ZD1A 4PQFA 2Z83A 2NO7A 4RKEA 4P4TA 3THXB 1N5IA 1NBME 2WPDD 3VNUA 3NIBA 3A1SA 1XTRA 4R71A 1FFHA 3GLGB 3UPUA 1VIYA 621PA 2JDIA 3AQ4A 3HR7A 2JLWA 2YWEA 3N2IA 1XU4A 3KX2A 3GLHE 4OQLA 3BGWA 4AKEA 1NSTA 3Q9LA 2ZRNA 1RE0A 3IO3A 2GJAA 1Z08A 4QKQA 2OBLA 2JIZA 4MKGA 4RFVA 3VU9A 4URVR 3UMRA 4JT2A 2N42A 4N3NA 1IQPA 2GAOA 4XJXA 3WP0A 1Q20A 1XPRA 2QE7A 2R6CA 2YWHA 4Q48A 1AIPA 4Q1CA 3EPLA 2R8RA 4GRAA 2GNOA 4Q4JB 2WOJA 1MOZA 4QGGA 3GFPA 2ZIAA 2KE5A 3NDBB 2GXQA 5TV2A 4M9SA 2QA5A 4PAMA 2X19A 3FHTA 2P2LA 5C1BA 1SKQA 4D4MA 1F6BA 3VKWA 2Q9CA 3CNNA 1KNXA 3DOEA 4Q9HA 2V54A 1US8A 5CIWA 4TYYA 3GFOA 1GNQA 2JLSA 3RSOA 5EXXA 4EDHA 3RNLA 2VA8A 2WJJA 1IM2A 5J4YA 2KBEA 1NLYA 1TF2A 3LW8A 5G3ZA 2GCPA 1YR7A 5LB2A 1Q0UA 1OH7A 5F2EA 1AKEA 3WXMA 4DDTA 3B13B 3CBQA 1FNMA 3ZQJA 2F1RA 2RHMA 3FFAA 5JFGA 4IXNA 3B1YA 5AUNB 1XEWY 1ONBA 2A9KA 4A6XA 4C2UA 3VKGA 421PA 4OHVA 3TAHA 4U00A 4JBXA 1S96A 3KQHA 4Q7JB 4KO8A 2QZ4A 3FFBA 4B44A 4AURA 5JBQA 1WP9A 3CX8A 4E5UA 2VHTA 2QM8A 5CK5A 5E7IA 3X1ZA 4LY6A 4H1VA 4PPFA 2WVJA 2G1JA 3LQRA 4OHXA 3TH5A 1PUIA 3IPXA 1E96A 4OI4A 2VEDA 4IDPA 1RYFA 1Z3IX 4RZ2A 4HAWA 1N6IA 5AJZA 3RLFA 3QBVA 3MRSA 2ZRPA 4QGHA 1TL7C 2VSXA 1IN8A 4JLKA 2I3BA 3U7GA 5JJLA 1TU3A 4X8MA 3CR7A 3W3ZB 3PXGA 1IXRC 2N1BA 4AG5A 1R8SA 1S9DA 3PEVA 3MJHA 4HAVA 1OIVA 1SKYE 3K9NA 3Q3JB 4HZUA 2UVQA 3MMPA 1KI2A 4IXMA 4OJKA 5BN4A 4ACBA 3FKSA 4PC2A 2VP9A 1HT1E 1JR3E 2OSBA 3J81k 4JLJA 1S1CA 5LD2C 3SHWA 1VYVA 2HF9A 1D6JA 4B47A 2NMVA 3H86A 3QPUA 1UAAA 4CEIA 2IS1A 1D2NA 3DPUA 2CVFA 1ZM4A 3MFYA 4DUGA 2P0EA 3CNLA 3ZVNA 3R9XA 3TQCA 1WRBA 5FUWA 3PR1A 1XXHB 2IYSA 4JKIA 2ZYTX 2BCJQ 3OEED 4UXIA 4O0MA 5EXPA 3ADCA 2ZUCA 3EWSA 1F2UA 3GEEA 5JZVA 4TLBA 5SZKB 4Q4AB 3G5UA 2DHRA 3GMTA 1DS6A 4V0KA 3MLEA 3SBDA 4B43A 3U61B 1BO6A 1Z6AA 1MO5A 2NTYC 2WJHA 2FZLA 2XX3A 3FMPB 3SFVA 3TK1A 2A7QA 3AF2A 1YJ5A 2ATXA 4URZR 1XD9A 5CJPA 1CLUA 3A4NA 1G4AE 4QHYA 2QT1A 3ZVMA 4DWJA 3TR0A 5B64A 2AWOA 4ASUA 4M8NE 3GD7A 5TARA 2QT0A 3WNCA 1KMHA 4D4JA 4ZPXA 1WCV1 1HA3A 3VX3A 1II0A 2F43B 4Y0AA 2WIBA 2QG6A 4XVQA 3I8SA 4AYTA 3AF4A 3CONA 3SJAA 1G41A 2V4ZA 2ZS7A 3P20A 1OJLA 3K09C 2ECKA 1QG4A 3CPHA 1G17A 4P4UA 2IK8A 3RS5A 4EPVA 5CM9C 2QAGC 4EJSB 2J0QA 1JPJA 2YHSA 1T9HA 1J8MF 5J47A 5JJKA 2Q3MA 4H1UA 2LWIA 5FTMA 2J9RA 3NHBA 3A4LA 1MABB 4TQUS 1DO2A 5KNBA 1D9XA 1II8B 1UKYA 1DE0A 1DAFA 4TMKA 1GIAA 3B9QA 4JLDA 2IYVA 2KBFA 2F9MA 2BV3A 5L8VA 1W47A 1ZBDA 1Z8FA 3HR8A 1EWQA 1OXSC 1E6CA 1JQJC 5BXQC 4NH0A 1YRAA 1OIXA 5GJWC 2VBCA 4PANA 2TMKA 1M7GA 1MH1A 2KI5A 4P31A 2CLCX 5JSZA 1XCMA 4OYHA 3NBFA 1U2RA 3SJCA 2EFHB 2FPKA 2ZRBA 5C46F 4X8LA 5HE8A 2B21A 3ZQ6A 4A8JB 2IYLD 3L0OA 1CJVC 3AVPA 1I4TD 4EPYA 5CITA 4URXR 2RGCA 4E09A 1XTQA 3I4LA 1TMKA 4IDQA 4QBHA 3AKDA 1FMJA 1OFTA 1UEJA 3EIHA 1W4AA 4QBFA 1NMXA 2QPTA 3AUYA 3LW7A 4A15A 3GFTA 3BH0A 4JLAA 2IXGA 3W5IA 2HCJB 1U0HC 3QF4A 1GITA 4DLYA 5L3QA 1SHZA 3HPQA 5EP2A 2Q3FA 3I8XA 4NMMA 3I5XA 2DWQA 4M9ZA 4B71A 1Q1QA 2ASEA 2BMFA 5C4MA 2MSCB 1IAQA 1H8HA 3KFXA 3DEFA 2IYXA 1JB1A 3B60A 4JBYA 3ZYCA 4TMZA 1E2QA 4LSGA 3GEHA 1GSIA 3CH4B 4GNKA 1PV4A 5LBIA 1WDTA 1KO5A 4DB4A 4MYUA 1R0XA 1DAKA 2OESA 2QMHA 1E1QA 1E79D 2ZR9A 3RABA 2EFCB 1R6BX 2QY9A 5CYPA 4L8GA 1Z0FA 2FPLA 3RANA 4GZLA 4JLMA 1UKEA 1H8EA 3NBZC 4MDEA 2FV8A 3SJZA 5IHPA 3U5ZB 3B1VA 2C98A 1KI4A 3PVSA 4GMDA 1QHHA 1S1MA 4PPGA 2NZJA 2DWOA 1E9FA 3N2EA 4GDFA 1S9HA 2R62A 4HATA 1HQCA 3K09A 5CB8A 1ZJ6A 1KZGB 4TL6A 2DFKB 5KYKA 3KQUA 1YZKA 4C7OA 1GUAA 2H5EA 2YNMA 5E95A 3TUIC 2O8DB 3IBYA 2RGXA 1PZNA 3E2IA 4AY2A 1KK3A 4TT3D 4JLVA 1Z5ZA 3K0EA 5DN6D 1OKKA 1KOFA 4LRWA 2XXAB 1XJCA 1Z2CA 1Z22A 2ZROA 1B0UA 4JLPA 4MRNA 4K8OA 4LHYA 2GKSA 2KSQA 3L0PA 4IOMA 3IILA 5JS8A 1RZ3A 2RGNC 4LBZA 2QMUA 1FZQA 4MRPA 1X86B 2XOKD 4RJLA 1YZTA 3GJ8A 5DO9A 4DRZA 2QN6A 4HYYA 4M9XA 2G3YA 4IOKA 2FU5C 1FOEB 1CRPA 2DB3A 3AF0A 1PJRA 1EX7A 5KDDA 3HU3A 4I1VA 2AKYA 4FMCF 4OI1A 4RD3A 2JDID 4Q4JA 4NCIA 1PLLA 3MAAC 1EXMA 1BYUA 2P5SA 3ADBA 1E9DA 4OL0A 4D6PA 2CL0X 4NPHA 3X1XA 1UADA 2G9NA 4LJ6A 3NKVA 2JIZD 1FUKA 2R6FA 4PSAA 4JVSB 2BBSA 2J3EA 4L16A 4C0HA 1AA9A 2QE7D 5SZJA 2QP4A 1W7AA 4KI0A 3EZ7A 3K0AA 5FUYA 4TZ6A 2H18A 2CK3A 3R8FA 521PA 3ADDA 2PT7A 1PUJA 2O8FB 1SULA 3A8TA 1US8B 3A6PC 3SOPA 2QMEA 4KU4A 2ZAOA 1UJ2A 2D3WA 2WWIA 3I3SR 3WHKA 1XPUA 2BKEA 5C2JB 3QKRA 3EIQA 1YR9A 1NVXQ 4UNNA 1Z6XA 5AJYA 4P32A 3Q7QA 4ZDJA 3OAAA 2IF0A 2WKQA 4BLQA 4WOPA 3KJHA 2PLRA 1TQ6A 2C5LA 3QUSA 3VR2A 2OEPA 3GJ0A 4DKXA 2VP6A 4JLBA 1JR6A 3DMNA 2BBTA 1N0VC 4EJSC 3O8DA 2J0VA 4OQNA 1CJMA 3PCRB 2KWIA 221PA 3QXCA 1IONA 1X1SA 1BS1A 1IN7A 3V4RA 4FCWA 2ZRCA 3LBNA 1Z29A 5DE3A 2OFXA 3TW4A 2ZAMA 2ZYUX 2XGJA 3IDQA 4TTRA 2BM0A 2GVZC 1QHYA 2GCOB 5TMPA 1XEXA 2BJWA 1BMFA 2CHVA 1XTKA 1JALA 3EASA 2NZ8A 3RAPR 1VCMA 3SN6A 1G64A 2DYKA 3GLGE 2EFDB 2WSMA 2HXYA 2GILA 1SXJB 5IRCD 3P4XA 2ZI7A 3K0FB 4D81A 1E9AA 5J5CA 4N0DA 5G40A 4DLXA 1ZNZA 1E2DA 2FSFA 4LUCA 4A8JC 4OK3A 2ZI5A 3DM9B 3QKTA 1F60A 1NP6A 1UPTA 2PZFA 3LDAA 3IIMA 4JJKA 5KPDA 3GCGA 3K0CC 2RGNA 4LC0A 5KSOA 3KQKA 3KTAB 1ZM2A 3UG6A 2EFEB 4B2LA 3X1WA 2D7CA 1RRFA 4PFSA 4G5SA 3RS3A 1CJTC 2ZRDA 4HZUB 1K5GA 3B9PA 1WE2A 3HU2A 4P0TA 1GTVA 4A0GA 1E9CA 3NTUA 1E32A 2PMKA 1XXHA 1G8HA 3BIFA 4TWZA 2CCGA 3U3KA 4AG6A 1P72A 1XJ0A 3ZD6A 2CXXA 3FKSD 3VHXA 4CF7A 1J2JA 3RRMA 2ODWA 1NJGA 2O8BA 2W6IA 5IDVA 4WBSA 4NL4H 3V4FA 1VCNA 1AGRA 2FZ4A 4LOAA 4Q4AA 3EWAA 2C9CA 3KUCA 3LWNA 2C95A 5EXTA 3ZS8A 3WRYC 1D2EA 4DUGD 1YVDA 4U02A 1R2QA 1WB9A 3WYFA 4V0OA 3C14C 4YMUA 2REOA 3H4MA 3QEJA 4PO8A 1E0SA 3ZS9A 4TLEA 5IK2A 5D3QA 1P9RA 3QIAA 3NEJA 5EE3A 1G8PA 1AN0A 1M7HA 4HI0E 1HY3A 3ASYA 3ICEA 3T5DA 2PX3A 3H0KA 2ZITA 1ZVQA 3B5JA 2PJZA 4DSTA 2F43A 4WXPA 4DLVA 1MT0A 2ODEA 5FPTA 3VR3A 4D4LA 3IHLA 2VH5R 5FBWB 4HEJA 3AVQA 2FF7A 2VTKA 3PUZA 1IHUA 1R0WA 4L5BA 5BYKA 4LHXA 4MGKR 4ZCMA 2GWHA 2XNSA 1W44A 3VR4A 1XWIA 3A58B 4U7DA 4ASUD 1S3SA 5EE5B 2OCBA 3QKSB 5AJXA 4RCYA 2IF2A 4Q18A 3U3MA 2CDNA 4ZO4A 2F7SA 3KQLA 2UZ3A 2G77B 4DHEA 2V7QA 1RFLA 2EQBA 4NU0A 4Q4LA 1OV4A 4G01B 1J90A 4LJ4A 3OFNA 1II8A 1G8FA 3NH6A 2J0SA 2WJYA 4L15A 1KAOA 1XFAA 2ZI9A 2GXUA 4N0EA 1AKYA 3M4YA 1YZLA 2HV8A 4EIWA 3THOA 1JBKA 4ITRC 1GNPA 1XMIA 1XRJA 4JVMA 4NYJR 4XSGA 4BZXA 2C96A 4Z1MD 3MWKA 2A5DA 4LHZA 2ZRLA 2BMDA 1YZUA 3IEUA 4O3MA 2FGJA 4RKFA 4LJ8A 4C0QC 1YZQA 1MRSA 4M2LA 5KHOC 4BFWA 2RKOA 2QL6A 3IIJA 4IVRA 2VSOA 1W49A 4OQXA 1EX6A 1KY3A 4LGMA 4LYHA 4OKSA 5LB4A 4A8JA 5JSZB 4Q4HB 3GLIB 2GEDA 2RGGA 4I4LA 1Z0DA 2FG5A 3K0CA 1ZNYA 2H16A 2ZRIA 4GP7A 4TMTA 2ZSBA 2NIPA 3KJEA 5ANRB 5E7MA 4PR0A 4HB4A 2IUTA 2XB2A 3A1VA 3X1DA 5J40A 5HKKA 1W4RA 5JS7A 5IF9A 3BE4A 3SQXA 1DAEA 1D5CA 4NCNA 4CYMA 2Q9AA 2VF7A 1FX0A 3NBYC 3PJRA 1E94E 4JBWA 3NVAA 1ZYUA 1U98A 3QXHA 4P4SB 1NN1A 2F9LA 2I1QA 3U7EB 1IN6A 3GPLA 2ANCA 2QU8A 4EPRA 4WZBE 4M1MA 3W6PA 3IBGA 2WV9A 4BLSA 2ORIA 1GL6A 2F1HA 2XSZA 1R5BA 4NYMR 3DHWC 5FFMA 3D6TB 4JLOA 2WJGA 4Q47A 1TUIA 1H8HD 2X2FA 4M1TA 1CKEA 2E9SA 2AXPA 2BVNA 1E2KA 1VYUA 4QHSA 3C16C 1KDPA 3G0HA 4TSFD 4WIAA 2BBWA 2D7DA 2B6HA 1HQYE 2WSSA 3AKEA 4R2HA 2V9PA 3DKPA 1FMLA 1G7RA 4O2LA 4JL5A 4F4CA 4GOJA 4RD1A 1E1QD 1JECA 2IYYA 1NVVQ 1NNEA 2OFOA 2FFQA 2ZJYA 3ZZTA 2BM1A 1LNZA 1NG9A 3TQFA 2XJ4A 1W0JA 3NEYA 2RHDA 2I4IA 2KB0A 2WMOB 1H8ED 5FPYA 4JSYA 2O8DA 5DHFA 3NC1C 3F0TA 1DAHA 1OW3B 5KNDA 3O8BA 3VR1A 4DIEA 1IJFA 3TR5A 4JVNA 3SNHA 1XTIA 3QQ5A 3ZLJA 3BFXA 5JWHA 2X77A 4DEYA 1U8YA 3B1XA 4Q21A 4PHFA 3WP1B 1G20E 1DBSA 1TU4A 2HCBA 4NONA 2WWXA 4IFBA 1E9EA 5FI0B 4A0FA 2GAAA 1NN0A 2W58A 3BFKA 1OKKD 2AD5A 1BYIA 2MSDB 4KV9A 1KTVA 1CR4A 1Q44A 2QGNA 4HLDA 1WQ1R 5KSPA 5FR2A 3C5HA 1U8ZA 5CDFE 3OEHD 3PIRA 3ICQB 3L43A 1E69A 4RZUA 1XP8A 1EFHA 1TX4B 1UBGA 4US0R 4B48A 1ELOA 1E9SA 3AF1A 4LJ5A 3GLFB 1EG7A 4TN1A 4V0ME 1EESA 3TSOA 3CRVA 1QHXA 1EFTA 1N0WA 4D26A 3SYLA 2VYFA 2FEOA 2BEJA 3TLXA 4PHTA 3RRYA 4RCZA 2D06A 4PC3A 3B8HA 4KLNA 3UG7A 2X2EA 4XD7A 1M7BA 1QRAA 2O8FA 3LX5A 1OXUA 5FTKA 3REGA 4ARZA 3W8RA 3K0AB 3U44B 1GFIA 3P32A 4QBGB 4DSUA 4GFDA 3T5GA 4TYQA 1UBCA 1TQ4A 5JRJA 1AS0A 1XX6A 2GEVA 3BFVA 1NVWQ 2Z4SA 5DLQC 2CK3D 4QM7A 3QKRB 1COWA 1LF5A 1ZUNB 4F92B 3VFDA 4GPTA 4QNRA 3WNDA 3CM0A 4L9SA 1U99A 2IYWA 3GEIA 3AM1A 4NBSA 3U3RA 1E2IA 1GRNA 2YOGA 3P4YA 4CEJA 2GETA 1CR0A 3EZ2A 3GJ4A 1E1RA 3QKUA 4KYIB 2C78A 2C9YA 2GCOA 2FFBA 4I81A 2YC4C 1CULC 3W8NA 1FP6A 5HTKA 4B6EA 3FPAA 4QNMA 3I73A 2V55B 4DEXA 5FTLA 2X1VA 4LJ7A 3WHLA 2QBYB 1MR3F 4TMWA 4A6PA 1XEXB 4Q1BA 1UDXA 4OI0A 1SXJA 3FMIA 2JJ1A 4MKFA 1R5OA 3K0FA 5J4HA 4Z51A 4WXRA 3R7WA 3ASZA 5JMTA 2EU8A 4ILEA 4NKRA 2Y8EA 1LW7A 1Q21A 1BMFD 4RZXA 1OHHA 5J4LA 2WKPA 4B35A 4V0LA 3WMFA 1RRPA 1YHNA 3IO5A 1DELA 2ZEJA 2OILA 1MO3A 3KKPA 2NO0A 1W48A 4IVQA 3KTAA 3RS4A 2AWNA 5KSYA 4Q02A 2REXB 3EX7C 2ZR7A 4KBFA 3U4QA 4S2EA 3AVVA 2VPPA 1E4YA 2GJ8A 4OHYA 4CDGA 4GBMA 2HDNB 4AIIA 5GJBA 1E0AA 5FL3A 3UKDA 1E9BA 4B74A 3B85A 3QPWA 5CM8B 2IEZA 1NG1A 4BZQA 3O47A 1G3RA 2AKAB 2ZJZA 1KO4A 1OXVA 3B1ZA 3OZXA 3MG9A 2O0JA 3KDSE 3PUXA 4CVNA 2JCSA 3CH5A 4JIMA 4JKYA 2O8BB 1BOFA 3HJNA 4WVFA 2JJ2D 5FBQB 4N1AA 2Q21A 1HURA 4ACAA 4ESVA 4F7WA 1RYHA 4DLZA 4XWKA 1A2BA 2OCAA 1I4LD 5G53C 4JL6A 2A5JA 1P9WA 4C0AC 2JLQA 2VHCA 2W6ID 3B78A 4JT4A 2ZVQX 3U7HB 3W34A 3UIEA 2UZIR 1P5ZB 2XEXA 2AD1A 3TRFA 1NLZA 1W5SA 2ZUBA 4OQFA 3TVTA 3FOZA 3VNVA 5BQ5A 5EE0A 3EC1A 2OAP1 2V6IA 4A4DA 2FFAA 5M04A 1OYWA 2OBNA 5IK2D 3L0IB 4B3CA 1VG0B 5GADl 4L4UA 2CNWA 3QENA 5TY0A 3QKSA 2ZI3A 3EZ6A 1IXZA 2B8TA 4F93B 1RPZA 4JZKA 3GQBA 4B33A 3GJ7A 3C4JA 3EA0A 4HUQA 3Q8XB 1Q57A 2CHGA 1NMYA 3ZIAA 2D74A 2ZSDA 3LBHA 3T1TA 4XH9B 3WBJA 1CEEA 4A1FA 1XPOA 2JEOA 4ZDKA 2ZE5A 2NO6A 1T4GA 3RS7A 2V8OA 4LZZA 1EWRA 3HPRA 2YJTD 4RD0A 1R7RA 3U3OA 3UMSA 4DCUA 5EE9A 3ONWA 1AQYA 4Z54A 4TMXA 3QEOA 4HAZA 4KXFB 2WIAA 3NC0C 5CIQA 4LYFA 3L2OB 1P9NA 1UKVY 5GJCA 2GJKA 2GVDC 2NG1A 1UM8A 4Q4HA 5C18A 4IDHA 1H65A 3GLIA 1F48A 4AWXA 1OPXA 3WYGA 2A5FA 5DI9A 1U0LA 3U7FB 2OXCA 1Z0KA 5FL7A 2HF8A 1RVDA 2AFIE 4LJYA 4YMWA 3WYAA 2J59A 1MKYA 4DLWA 2ERXA 3NG1A 5FUVA 1W46A 4BFSA 1DPFA 1RC8A 2Q3HA 3CPJB 4M1KA 1NJFA 4NCHA 4BFTA 1W0KA 4B3XA 4CT4B 2J46A 2F3RA 1JAHA 5J4KA 2YWGA 3SE0A 3T61A 2P6NA 3IHWA 3FMOB 4YDSA 4YQFA 2JLXA 4Q5IA 1Z0IA 2ORWA 3JVVA 4P4SA 2CL6X 3LO5A 1SVSA 3BRWD 1JNYA 4KFSA 2FFHA 1FX0B 3EIEA 3GLHB 2F6RA 4MITA 4I1OA 1NSFA 3PFIA 1ODFA 5HKKD 4US2R 1CJKC 1D8TA 3JZAA 1ZNWA 4MUAA 4Q7LA 1OB5A 1IXSB 4NYIQ 4C9BA 1P7CA 1ZAKA 1ZW6A 4LBWA 2HEIA 3IUYA 3U6BA 4QGFA 4LV8B 4XOIA 4Q9IA 2OBMA 1ZC3A 2QM7A 3CRMA 5DIFA 5H1YA 5SZHB 1T3HA 4ZI2A 2ODNA 1P2SA 2GDJA 1T5LA 3L0SA 3ND9A 4RFSA 2Q0HA 1CR2A 1UF9A 2P5TB 5LPNA 2QROA 1LY1A 2XSZD 3AVWA 3EARA 3IPYA 2JLUA 121PA 5FTJA 1VKJA 4DLSA 4KVGA 1QHGA 3JZMA 1J7KA 1R0YA 2F3TA 2R6GA 1KKLA 2BDTA 1XB2A 2VF8A 3EG5A 4NZYA 3TGPA 4R98A 4EQ6B 4RZ3A 1SVKA 2OM2A 4FWIB 2REBA 2MSEB 3I5YA 5KPJA 1F2TA 4YDHB 4ZDWA 1ZM3A 2WSSD 3EPHA 1P61B 2ZRMA 4PPNA 5CJ2A 5B2ZA 1P6XA 1DAGA 3CW2A 1UDWA 1NKTA 1N6OA 1XD2A 2VLIA 3FKQA 1DG1G 1N25A 1P2UA 3KKNA 4R2IA 5AUOB 3W5JA 4YMVA 1W0JD 2V6JA 1Z6GA 4TZ0A 1KSFX 2ZRHA 4XVRA 2QENA 3FTQA 1T5IA 4JJZA 4EUNA 4UJ3A 5P21A 1K5DA 1P75A 2DPXA 2P6UA 3AV0B 1R10A 4QXAA 4C2TA 1G3IA 4ZKEA 4RD4A 3SS8A 3CF6R 2D2FA 4PC6A 4RY2A 3GJ6A 4FCTA 4OI2A 4YMSA 2WICA 2WPDA 3N70A 2H92A 3CIOA 5DHAA 4DDVA 1SHKA 2DR3A 1JJ7A 4CEHB 2AR7A 1SVOA 2C03A 2C9OA 5JEDA 1Q1ZA 2RAPA 5L3SB 5FOSA 2ZTSA 4BEJA 1HT2E 1OFIA 1NL3A 4C30A 3SZRA 3V9PA 2DFNA 4BQSA 2YYZA 1V5WA 1GRQA 5G3YA 5K8LA 4K46A 4HB3A 1IY2A 4PPQA 4DLRA 2QPAA 1E2EA 1T3SA 2VP2A 3GLFA 4WZ6A 2GEUA 1NIPA 5JRZA 1A4RA 1XJQA 2IYRA 1VYTA 1ZUHA 2CLSA 4FN5A 3QBTA 1KSJA 1GM5A 5E4FA 1E3MA 2QEQA 3ZH9B 1K6MA 1KI3A 3OESA 4GZMA 1VG9B 3UATA 4HLCA 1UBFA 4KSBA 3CX7A 4LK2A 1WBDA 3U44A 3TNFA 2R9VA 1NY5A 3B7GA 2QSZA 1A2KC 2DFLA 1LF0A 2QNRA 1XCPA 1JAIA 1ZCBA 4LYJA 1SKYB 1XZQA 3QSYA 2CMKA 4IKEA 4PHHA 4Q1AA 2GZAA 3OE7A 3T1QA 2VHQA 4ARZB 2A2ZA 2IYTA 2YOHA 2ZANA 2VP4A 1OE0A 3K1JA 2Q9BA 3PUVA 1CJUC 2GJ9A 4TL7A 3HU1A 4NTZA 4XD7D 2P6RA 3K9GA 2P3SA 2OLJA 4LDJA 1T0HB 3I61A 3BH7A 3LAWA 1BIFA 2ZE7A 3DDCA 1N5KA 2OE2A 4FMCB 1E2JA 3O8CA 4TLAA 1OF1A 2NPIA 3BBPA 1TQ2A 4OK6A 1AM4D 2EFGA 1IJEA 2FA9A 4J0QA 4QM6A 2VHJA 3LD9A 3FDIA 5DI3A 4MA4A 3SJBA 1YR6A 3AP2A 1OT3A 4KCGA 1COWD 4M9QA 1RJ9A 3THWA 4B3GA 721PA 4C4PA 1KGDA 4LPSA 5HZKA 4CEJB 3FMFA 1QVRA 3BC1A 4IRUB 4DSNA 1E2MA 4YLGA 2C2HA 1XNJA 2WTUA 2ZXUA 1RRCA 3LBIA 2QBYA 1KI9A 2GZDA 3OF5A 5DYGA 8OHMA 4DLUA 4KJZA 1VPLA 4AYXA 4AKIA 5AWFC 2HUPA 1G9XA 2OAQ1 2J7KA 4KAXA 4PC1A 3UANA 5KUTA 4URYR 2I1VB 3VTKA 2AK2A 1Z6YA 4CW7A 4URUR 3U60B 4BLPA 1GKIA 1X6VA 2ZRFA 3D3QA 3LFUA 3R7WB 3EXAA 3DMDA 3WRXC 2J5XA 3MUFA 1NVVR 4OBEA 2O0HA 2RH5A 3OIUA 1SXJD 2GF0A 2OV2A 3AGQA 3QXSA 4MGYR 2JJ1D 4WA7A 1CR1A 1RIFA 3PENA 1EGAA 2FMXA 3KKOA 4TQ9A 1Z0AA 4G5RA 3NHAA 3BD9A 1OHHD 2PLFA 4DSOA 1T0JB 1S0UA 2B7BA 5CK4A 1DO0A 3QG5A 4TYPA 1ZM9A 2BIFA 2YV5A 3U4QB 5CB6A 1J8YF 2HT1A 3H84A 3ZZUA 3LVQE 5JI3E 3FWYA 3SFZA 3W3AA 1N6LA
chains in the Genus database with same CATH superfamily
3C8ZA 5ALQA 4JEHA 3H1EA 3RVRA 4DIBA 4DT1B 2FDCA 4C07A 3FY4A 4EY8A 1JSCA 4M3NA 2UXDB 2R6AA 3BIJA 4M37A 1J2UA 1C41A 3B3AA 2AXEA 3T7KA 2RGDA 4X85A 1ZZEA 3WL4A 1WR8A 3P0RA 2P2NA 2C77A 3LG2A 6NULA 3PCXA 9GPBA 2FDXA 1QIKA 2ZS8A 1NDHA 1NX9A 4CHTA 1NQOA 3GFVA 4TWAA 3USES 3FBGA 4RD6A 1WCWA 1HE8B 2JD0A 3D6VA 4XIGS 2J67A 3CE6A 5LQNA 1TO6A 3AG6A 2GTPA 3C8MA 5AKLA 1D6NA 2E5FA 3UPDA 3JY6A 4N8DA 1ZJYA 1W2GA 2RIPA 2R11A 3G3EA 3U7IA 3QW2A 4TX1A 1K3FA 5IDWA 3F3YA 3K0HA 3B7PA 1FPMA 4TTJA 1E2PA 1RDFA 1EE1A 1TUEA 1W5AA 3B2NA 3D7MA 4ANFA 3H1BA 4C6RA 2AG5A 3L8ZA 4YRTA 3V8EA 3I1FA 1U0TA 3WKAA 1OX5A 4V0RA 4XDYA 2ZJBA 3W6OA 3X2SA 3HVUA 4Y1FA 3DC7A 3OZAA 5E9AA 3Q8MA 1V3VA 1QH1A 3UHAA 2R5FA 3MCZA 4ZAZA 1GPUA 4F3NA 1K4KA 1Q0PA 3DOHA 1JPUA 1YU6A 4WERA 2WKWA 3KHKA 1QYDA 1ZOOA 2PD4A 4LYDA 3AKYA 3PFKA 1PK8A 3QXGA 4YAFA 1EB8A 1CVLA 3ZV5A 4PVCA 1O58A 5HSGA 1TUGA 2MU1A 3BWMA 4WLOA 4FBMA 1I9GA 3KTDA 3GQBB 1MV5A 3STXA 2JJ8A 4CF4A 4HUQB 1T5BA 3I2JA 4AUNA 4MHOA 4DDTA 1GDTA 4HX9A 3RH0A 2JLZA 4J9VA 3VDXA 2O3JA 3PXCX 2CFOA 4HNUA 1M2HA 1LB1B 1NVBA 4P93A 3VU0A 4QG3A 4FMBB 1U1FA 3CMMA 2J9XB 3WB0A 3HXOA 3TXYA 1G6OA 3S7TA 4RABA 1RHQA 2AUMA 3PJEA 5F3DA 3PVZA 1KAMA 1OFUX 4UNQA 2MYTA 4TXHA 2ZAIA 2QUIA 1R8QA 3ETLA 2ONJA 5AVRA 5I7OA 5L3VA 2D1SA 3FPEA 2X0RA 2Z98A 3D8BA 2AG6A 1GL3A 1H5NA 4XJSA 3SI7A 3WYBA 5KNBD 3RS8A 1CP3A 1RI3A 1QMGA 4C0BA 1N5LA 4BLOA 4RMHA 4KQ9A 4UTNA 4R2WA 4I46A 5ALLA 1X7XB 2XI4A 3NPMA 2Q27A 1AV7A 5CLJA 5DLPA 3IP9A 3FPJA 4RDIA 3ZDXB 5KNCA 3TEFA 4JI2B 4LMAA 3DBIA 1DZIA 3R7NA 1V1JA 2R96A 2WB4A 4BMCA 3GJTA 4G0VA 3I6IA 5DM4A 4JQYA 2WWHA 3AESB 5TVKA 1E3QA 1L8QA 4WACA 2CJWB 1T29A 4GSKA 1PDVA 4N6OA 5D6OA 4OQPA 1N2CB 2JFOA 1KE1A 2OXIA 2RH4A 4QJBA 2IP4A 5JDCA 4PZZA 3ZHQA 2NV6A 2HXGA 2RI0A 2VQSA 2GBLA 4QU8A 2GA8A 5F2OA 4AP5A 5ECWA 3UK1A 1X7ZB 1DIGA 4YDQA 2J4DA 4YAKA 5AVQA 5LMUB 2E85A 4GI3A 1DC7A 4ED9A 4EY3A 1J70A 1E66A 1O54A 4R83A 3QV1A 2Q5OA 4PAGA 4ZO9A 5A3JA 4M38A 1ZMOA 2HYDA 5ENDA 1M2GA 2OGWA 2PIDA 3ESCA 5CDHA 1U90A 1D03A 4BPRA 2WUWE 3T5AA 3EVAA 5IAKA 4E03A 4CN8A 3AW8A 3M6XA 4RNDB 3K5IA 3M5WA 3WYNA 3SF8B 4EA9A 3TL3A 1XHFA 3UXYA 5JJIA 2DFTA 4J76A 4G8BA 1XQ6A 4WY8A 5DEIA 1HYQA 1QHFA 3B52X 5CGZA 5JLJA 2IS4A 1QWSA 3IB6A 4WOBA 4YASA 1DIOB 3SMQA 2X8AA 4GOXA 4CKEB 3T7DA 4YCLA 3KKLA 3PEUA 3T7IA 3K3PA 1FUYB 3PC2A 3K70B 2RH9B 2ZU0C 2WJZB 4EQ6A 1DAMA 1ZW1A 2QD4A 5CLLA 1FSFA 1T36A 2EBWA 2NSHA 3WMEA 2GQ0A 1R27A 2G04A 1Y63A 4DTCA 4G09A 2GYWA 4ZVQA 2CFTA 1E6WA 3L18A 4ZQHA 1VL2A 1ZRSA 4BO5A 1VZ3A 2XUPA 1QFMA 5A4JA 5MN6A 2EKPA 3ORQA 1U81A 5F21A 5K99A 3E9CA 1T2VA 4WI1A 5LP6A 4D8YA 4U4AA 3VJLA 4R1NA 1JLRA 4FN4A 1T4BA 1IBSA 2WZCA 2RCYA 4QOSA 1NYRA 2VZ0A 3N1UA 2X8WA 3W8FA 2RHLA 3ZZNA 2GF9A 2NUBA 4Z4CA 1PJ3A 4BO2A 1YRBA 4OBXA 1SUBA 3HKDB 1KK2A 3K9BA 2OAEA 4GR5A 1Q1GA 2QOEA 2JGDA 2QJTA 3AEKA 1UC5B 1WBJB 3DJFA 3H2JA 4DEVA 3QE0A 1X94A 1ZD4A 3W6ZA 5L9AA 3I23A 4IMPA 4QRDA 1UBKS 2VJOA 3S1AA 4EEXA 4CEHA 3KJGA 2GZHA 2AOVA 4FW9A 3ZY2A 4AROA 5CA1B 2EZUA 1L9XA 3T3IA 2QLNA 3WRWA 1OYOA 1VLQA 1SB9A 1U9IC 3HV0A 1ORRA 3LXRA 4OMCA 5JZBA 5LNK1 1HXHA 2JASA 4RESA 5FF9A 1EXDA 4B3HA 2Z43A 2CDRA 3MCVA 5KVQA 5KYGA 2M98A 2DTXA 1WUJS 1N3BA 2X6QA 1TIKA 3JAWA 4FNMA 2WIGA 3SXPA 1U6JA 2I7XA 2LP4Y 2J85A 4DVGA 2W6OA 3VH3A 3N59A 2AJBA 4BRWA 3EPKA 1GRCA 3LT5A 3ST7A 3KSDO 2J7PA 4UTVA 1NC1A 3RBXA 3UJHA 3M6VA 1Q3HA 1YO6A 4O6VA 3RSSA 5K0FA 4KIUA 1FQJA 4J0EA 1N5JA 4G1FA 1QFJA 1WXHA 1MRNA 2R47A 4GIBA 1ZKDA 3Q3EA 1PJAA 1WW3A 4HAIA 2PVCA 3CIFA 3NOOA 2GO7A 3ZLTA 4MB2A 1ZD9A 3EBPA 3EGWA 4BU0A 4WBNF 3HB9A 3N8IA 4GPZA 1NY6A 4GVPA 4FI3C 3A9RA 3H5NA 3KDAA 3NAQA 1Q3TA 1BVUA 3G82C 1XVVA 3S2ZA 3OCVA 4LX0A 2E1RA 1D3AA 1GCAA 1ZA2A 1SOVA 4JLWA 1U7TA 5G0SA 3RBAA 3ZWYA 4KITB 3I9KA 4ZICA 5JAUA 4L2IB 4A6EA 2GH1A 1PT8A 1XK7A 3H6GA 4DCVA 4TKZA 4LX8A 4D82A 1VMKA 5C3MA 2IYZA 4MW2A 1H9AA 1G3QA 1KY2A 3BAFA 4DZZA 1TB4A 3AVUA 4UC0A 1HETA 2VVTA 1HNNA 3AJRA 3CO0S 2JATA 3LFTA 3PFGA 4TZKA 3AB7A 4KSCA 1A9OA 2WJ6A 3NFYA 1GEGA 1PQ4A 2ONKA 2JAQA 2XKJE 1AA6A 4F5YA 1XDWA 2GZ3A 3OAAD 3GFSA 4Z0TA 1P6UA 2HSDA 2QTMA 3WLFA 5M2QA 3ZDDA 3AH8A 3JR7A 2ZBQA 1I2MA 2ODAA 1P2VA 1E7YA 1RJ9B 4I8IA 4J0GA 4KXYA 3IAUA 4FGZA 3U17A 4GNRA 5ITZA 3GCDA 2KHZA 4FD2A 4BLUA 3DHYA 1JIQA 1I13A 3KHSA 4IICA 5LMNB 3WWCA 3HUTA 4QWWA 4LEIA 4TLDA 5B1HA 2R8YA 3BXPA 4CTOA 1LCIA 1YL5A 3UF0A 1YD7A 3I01M 5ADWA 1G63A 1XWFA 2H5IA 4UBNA 1GA4A 2WAXA 4PHCA 5TB5A 3X2EA 5CDGA 4DMFA 4FINA 4GD3Q 5F78A 3CYFA 4EGFA 5I4IA 5ICSA 1ZN2A 3P9NA 2EBHX 1AZWA 3ECSA 3ODGA 4PX9A 1V8FA 5FAKA 4EX6A 1A9XB 4I36A 4O2AB 3MINA 3KSUA 4NZNA 4H0CA 4F4JA 2E4ZA 4Z4FA 3O4FA 1HE4A 1GL7A 3OPYB 4HQ6A 2BBOA 1BVHA 3W5DA 2JNWA 3I2KA 4PINA 1I3NA 5AK4A 4E1AA 2HHHB 2X5NA 3HV2A 1OUMA 2FI1A 5HF6A 3CWCA 5C5EA 3M1AA 4BBJA 2OCKA 3GY0A 3KKZA 2VL7A 4BXOB 2D8AA 2PBFA 4UEQA 4BECA 1ONPA 1ZU4A 3DF9A 2R7KA 3D6MA 1C1HA 2NVUA 4CDRA 1DHTA 1UXHA 1A50B 5BYBA 3S2SA 1A8UA 2V7PA 1YOBA 4MQ6A 4MUYA 2PUJA 4R9VA 1SB8A 1T1IA 2I1WA 3AR6A 3P2IA 4J2TA 1Z0UA 2N3ZA 1KFEB 2OD2A 3LT0A 4IDCA 4YAJA 5AD1A 4KNYA 3KWLA 2ACVA 4JC4A 3ETEA 3ICOA 1S2GA 4DLAA 1OTYA 4OQEA 3WGHA 1YFJA 4G9GA 2IOQA 2V7TA 4OXRA 1MEJA 1N5OX 3AGPA 3ZDEA 3PX2A 5F7ZA 3JD2A 3N87A 2IC5A 4YXWA 5KDLA 2XRYA 1QHSA 3PC7A 3RREA 2IKSA 1YI0A 3D54D 3OA0A 5C32A 3AVTA 3ZXIA 1DKUA 1KSHA 5DTJA 4YXFA 5ALYA 2CHQA 1P7VA 1UPCA 4RLSA 5ALWA 1B93A 2M6SA 3G8CA 4INZA 4LSMA 1UMBA 2A30A 4Y0NA 4IGEA 4IWYA 4NI5A 4U5XA 4DY6A 3CZRA 1OI2A 4I9HA 1U5BA 4ALLA 4KMMA 3LLMA 4DLTA 1HKUA 3JSXA 5DBEX 5FNVA 3K70C 1RD4A 2QTVB 3RKSA 3E9MA 2W2OA 1FNBA 4PNHA 2J5RA 2TMGA 3RTAA 2BC9A 3UY4A 1SU4A 2W00A 3GT3A 2AEMA 3DF7A 4DYHA 3GJZA 3T99A 4C76A 5AHWA 2IYAA 5EWMB 4DG5A 4DV6B 3PWKA 3QVVA 4O25A 5IH3A 1JF8A 3X3HA 4X3CA 2VQ6A 2QDKA 3I1JA 2JK0A 3AOGA 1UKAA 3ZY6A 1DAOA 3VR6A 5K2OA 1GZ6A 3WLQA 1IB6A 2RHWA 3VR3D 2QKYA 1KI6A 4R9UC 4DLPA 4YN3A 2F1IA 2ADOA 2H4XA 1S2DA 1UBNA 1AZSC 1TMOA 2OHFA 4GXTA 6Q21A 4AN0A 1X8JA 3I2FA 4H0NA 4FOSA 4KAFA 1D6MA 1T8UA 3M5CA 3T7SA 1KMCA 1ESMA 4AXXA 2QAJA 4EY7A 3MZ0A 1AGXA 3CE9A 4G85A 4M0CA 1R18A 1Z17A 1U28C 2V7QD 4W9NA 1E9RA 2G4LA 4FFBB 5EI5A 3H5OA 2AQHA 4RTMA 2ZRAA 3IP3A 4NYJQ 5H4HA 4HVAA 2H1VA 3KHTA 3E5NA 3V2IA 4MYHA 4YRIA 3ZD7A 4G0QA 4CUZA 4MVXA 2D2EA 2OBYA 1E1MA 5KDOA 2P6PA 4UVHA 4W7SA 4CU2A 1YA4A 2WJ4A 4P5DA 1PT5A 3JALB 4RTSA 5DMXA 4CGZA 3IPCA 1AJEA 4HN9A 4ZQBA 3WGIA 1G59A 3P26A 1NQWA 4M1WA 5BRAA 1ZICA 1N1GA 3BGSA 2I22A 4CNQA 1A1SA 1KKMA 1E3SA 3BMOB 3QPCA 4MW1A 3ONFA 2VJLA 2W2VA 1PYDA 5JCZA 3H8JA 5IEBA 4CFSA 5AMXA 1EA7A 4TYNA 2MJLA 3JARA 3VDQA 2E89A 4DQDA 4EGAA 1AQLA 4UBOA 3A2NA 1BKDR 3OD5A 1P3JA 4M0LA 3IERA 4RE6A 4OAQA 3IQXA 4TL9A 2V0CA 2O5CA 4HKTA 1FDUA 1TVKB 2WJ3A 1G20B 2NOAA 4B3RB 3QPVA 1RWOA 3K9FC 1RQXA 1JT2A 1XEWX 2CL5A 3LRTA 4ZCLA 1IJBA 3F2IA 5DM60 1COZA 1M1NB 3A32A 3H5LA 4G1BA 2W11A 4TXMA 2P90A 1CUYA 2VPTA 4A2WA 1NBMD 3THYB 1KEEA 4DMMA 1NIJA 2ZI6A 3LSYA 4ZREA 3EEFA 5AW1A 3KSRA 3GZJA 1DTEA 4IQ4A 3T4PA 4EUSA 3R6WA 1PJQA 3BTSA 4WZZA 3GEPA 4BMOB 1RMQA 2P1DA 3KG2A 2J3JA 2NX2A 5JNRA 2FN3A 2GPJA 1ACMA 2R86A 1BVYF 3WQRA 1XYYA 1RJDA 2XDYA 1I5RA 2YXDA 2VT3A 3KJXA 3NC4A 3OKPA 4NE2A 4BL5A 4CMCA 4JI6B 3UGTA 3D4OA 5T67A 4I99A 3GUHA 4PPYA 4Q9NA 1KK1A 5EZ5A 3ZU2A 4LF8B 3ZVLA 2R6R1 2WD7A 1D4OA 6PFKA 1KGSA 2MMCA 1KJ8A 3OZRA 4BFYA 1QM5A 5BV8A 5JNLA 3UCEA 3N0WA 2Z58A 1RJWA 3TE7A 1W4CA 1QVAA 1RLUA 2RGEA 4O2RA 4W5WA 4F6CA 5B30A 1A77A 1N6NA 3WIUA 4CN9A 4UM9B 3EC2A 5L95A 4BLRA 2XNDA 5AXBA 1R3UA 1XTJA 3Q3CA 1BX0A 2F1JA 3U40A 1FSGA 5HCNA 3SR0A 3V1YA 2OUKA 1ZH0A 1BC5A 2PT5A 4HS4A 1U7ZA 4DCMA 3CRRA 3LYAA 4EABA 4CKZA 3A1FA 2B4RO 3H6HA 1PX0A 4ZVTA 5HKLA 5BN3A 1C0PA 2OL4A 2ZJOA 2J0UB 1AK9A 3SCZA 1QU3A 5B1EA 3SWWA 5J23A 4FC7A 3AP3A 5HIMA 2C8VA 2RB4A 5CVUA 3QNUA 2C1EA 4GYYA 4TXLA 4YJ3B 2X76A 5ILOA 1KJYA 1MO6A 1QDUA 3GL9A 3E8XA 4IGIA 4OMDA 4E15A 4EDFA 5B3JA 2O0KA 5K3BA 1T8TA 4LVCA 2WZBA 1KIAA 4PSVA 3BUSA 3QMVA 4GE0A 4KNWA 4RV9A 4K9RA 3HVHA 8ABPA 1OLXB 4BBAA 2DBYA 3LDFA 3MWYW 4V24A 4AS3A 3BREA 2ZYWX 3IVCA 3GT7A 5HZHA 5HNKA 1KF0A 2PXHA 1FF9A 1IY1A 3P9SA 5FB3A 4QAQA 3FNEA 1YS2X 5E6SB 2ZM5A 2NZXA 4O2BA 3V7FA 3NT4A 1SCUA 1Q1EA 5EKUA 3V1KA 3I0ZA 3M81A 4CQMB 5F77A 2X9GA 4ZV4A 4DXAA 3DEIA 1H2BA 3NQ41 4QJ4A 4ARAA 4HY3A 1SCJA 4L28A 4YCSA 2JGNA 2FFJA 2J9YB 3CT4A 4WXMA 4ZVPA 4QFMA 1V3QE 3LUBA 3W2HA 2FE4A 5AI6A 4ARBA 1Y9ZA 1UXJA 1N2CE 4I4TB 2IBMA 3Q0EA 4LRYA 2BE9A 3RVNA 3D1VA 4R3NA 4YO7A 2OY0A 3ZN2A 4RV4A 1X8LA 3F5QA 4WKBA 4CCAA 2LKCA 1ZK4A 3OIYA 3IX7A 5C8YF 4EF5A 1NBHA 3PEYA 1D1PA 4ARCA 4IKOA 2Q4DA 3N6XA 3SXUB 1BFKA 1IMOA 1UK7A 1X1RA 2FMHA 3IQGX 5H70A 3ZZ0A 4DCTA 5JWOA 1R88A 1IBMB 3E0QA 3EZLA 2GN0A 5CGQB 3D0OA 2CNBA 3RPEA 5IJ9B 3OOSA 4EZEA 4EHKA 5CB4B 1OZFA 3L6CA 3LCCA 1PNTA 3P9CA 5K8TA 3RVKA 4MP6A 3AZQA 3TDNA 3PQFA 4G36A 4PX2A 5AIAA 3PTZA 3SR4A 5EYPA 2HDHA 1Z82A 1HTBA 2OMEA 1CRWG 1Y9AA 3G2QA 4OSOA 1WHSB 4XDZA 1A72A 1U8FO 1CDOA 1UMCA 2LKDA 4NNOA 5JO9A 2EHJA 3GGSA 3PDJA 2FGKA 2ZBGA 1V96A 3PC8A 1D7AA 3N0RA 2H00A 3VNAA 3HYCA 2WTBA 4BFCA 3VNBA 1FRVA 2P4HX 1RQLA 2Y66A 3QY0A 4M1YA 5FO0A 4BRUA 4II7A 1MTZA 3L40A 5HK8A 1FNNA 1P1JA 1TT5A 1WY7A 3OY2A 5A62A 4AY6A 1ULSA 1XTUA 2AN1A 5INTA 3BXXA 4KDRA 1LFDB 2OHVA 2VWPA 4IG4A 2XAUA 2PRJA 1HLFA 3S2UA 5CCEA 3VO2A 2PMBA 3L7KA 3KR9A 5F1PA 2PM8A 3WNBA 2XKBA 2XUOA 2VT7A 4F8EA 1M0SA 1YVRA 3BICA 1PS0A 2YFKA 5IAGA 2QTGA 5LP1A 3BWDD 1Q5PA 4IVNA 4WBNA 5FOVA 5I47A 2HA6A 3OU6A 5MGNA 2JGEA 4PU0A 1U2GC 1NXVA 5BQFA 1DEKA 1SBIA 2V45A 2FX5A 3KKQA 1HFEL 4AS2A 4D92A 4DDWA 1H5UA 3KQOA 3O8RA 2A9RA 2AA3A 2E87A 3A1WA 3DAOA 1EYZA 4JBGA 2QXUA 1E1RD 2BGNA 4LNAA 1VPVA 1BJTA 3S8MA 1PQPA 4ZRMA 3MMNA 2P9TA 1KQGA 1KZ1A 1M5UA 2GCGA 2I4OA 2X9NA 1TI7A 4P81A 4PHGA 3RYIB 2JHAA 4YJ2B 4BB9A 1BX3A 1MJ5A 2VWHA 2ZIGA 2MIIA 5JAIA 3MHPA 1NVDA 3BWVA 1T3LA 2Z8YA 5M3BA 1L7DA 4N40A 4RMIA 4MWZA 3AFGA 3LCRA 3W5SA 3PNPA 4PGMA 1NN3A 2NT4A 4DSAA 4W7HA 1U0JA 3NAZA 1C8KA 4IL5A 2GMWA 4IIJB 4K87A 3RWBA 1T43A 1G291 4IJUA 2K2WA 2ORVA 3GRUA 4IILA 2R5NA 3CRQA 2B82A 3R3WA 1QCCA 2R48A 2ZR0A 1C1YA 1RLIA 2I8CA 2VNIA 3GB9A 4L7VA 3E1GA 1LA2A 2JC3A 1CIPA 1N8TA 2P8JA 2VSNA 1L7BA 3GLFE 4KXLA 5B4VA 1E2NA 1LPMA 3CB4A 1RQGA 4ZU3A 2GESA 2D62A 3EF3A 3RS2A 4U6NA 5FPHA 5D3ZA 1NAHA 2C2WA 1V43A 2VHZA 1IE3A 2WAYA 3S27A 5I7UA 2BR5A 1W5BA 3MJDA 1D9ZA 3R8XA 4P5EA 1VJ0A 1BQ4A 3FSRA 1NKVA 3UA4A 4W5HA 1SBZA 1Q74A 4R41A 3V3TA 1Z16A 3EDQA 3WKEA 1CS0B 1KIFA 4CKWA 2I8LA 1AVTA 3FNQA 1ZIDA 1VQ1A 3QKIA 4ZU1X 1PT9A 4EKGA 2YHIA 1P2FA 2PUTA 2BHNA 3OEEA 1FUEA 2HMSA 3MUEA 5KIAA 1G6KA 4WXEA 4FSDA 1E3DA 3LRPA 2AZMA 3SYTA 2IZ6A 5AK3A 4HLUC 2JLRA 2W42A 1GG2A 5UKDA 3V7YA 3QLJA 4FYWA 4MPDA 2FP4B 4GBED 1R0ZA 2LCFA 2JBHA 2O7QA 2Q4EA 2HCRA 2UKDA 3DR5A 1IVSA 2ERYA 4EKNB 1F2UB 1OXXK 4DR6B 2NADA 1X7HA 3R7LA 1Y6QA 3I9V6 1RABA 2I99A 3G17A 3IUPA 1PRYA 3DUWA 4CKBB 2EFYA 2XZLA 2QQGA 4D25A 1LLUA 4GSYA 3UWKA 1AXRA 4Z53A 4MQLA 1NP7A 3GK3A 2XMQA 3K7EA 1VE3A 4GPBA 3OIWA 1I2ZA 3JS5A 1V2GA 4YRJA 1F9AA 4RZHA 2MTBA 5DYTA 3QFCA 5KKNB 2W2QA 3PF8A 1J0AA 2AG8A 3CLSC 3ET5A 3RSQA 3TM4A 1Q12A 4JYMA 2GCEA 2OO7A 4MUXA 4FS8A 3YASA 4NR0A 1EM6A 2J9ZB 3IR6A 4Q66C 1IDOA 3WIVA 4DJTA 2CCJA 4IDEA 5KQRA 3I6MA 5CFZA 5T7BA 1CZHA 3WRVA 1W1WA 2GF2A 2NU7A 3CLHA 4P8RA 3LLUA 1LBSA 2DHCA 2VI5A 3ZK7A 2H4ZA 1Q15A 4ZI7B 1V4NA 1N7IA 2D1TA 3H0EA 1DVRA 4P33A 3UENA 4DBLC 1QRTA 1VZ2A 4P3XA 1F5SA 1XAJA 1RMYA 5FQOA 5H02A 1SURA 3HP1A 1U8TA 5AI9A 5CDYA 2EJCA 3BB3A 2V7UA 3WA6A 4OHWA 1AZLA 3Q98A 2ORED 3GGCA 1OFVA 3Q87B 1JEEA 1QLHA 4DIOA 2AHOA 4XUDA 2XIJA 2IS6A 2XCSB 1ISPA 1KDRA 3IESA 1OXBB 1NFQA 3CO5A 3DGFC 4UPVA 3TW8B 4G1EB 2Z8XA 3T95A 3IP5A 5BW8A 4EI7A 3B2EA 3RVPA 3V2GA 2IQ5A 2IPAB 2OQ2A 4MVJP 4B1FA 4BUJA 3GIWA 5JEEA 5A0TA 2EF1A 1SZPA 5CW1A 1TM2A 2DWPA 4LZWA 3ZLUA 3KELA 1LS1A 2WVHA 3FDZB 3I72A 3O1JC 3OCYA 4A8HA 4DARA 5CAEB 1NAIA 4YJGB 2JB9A 2VBGA 1M8FA 3LX8A 3TTWA 1EUDB 4G3XA 4BO9A 1GR0A 3RHSA 3ZHOA 3PG5A 4C2AA 4AMBA 4MTCA 4PC7A 1YHYA 1KVTA 5CLQA 5K51A 2FZEA 1TVCA 3JVUA 4FFVA 5ED4A 3DV0A 4AN1A 1QBGA 4BOYA 4ZAVA 2H17A 2QXTA 1YJQA 3H1TA 1OWPA 2PCJA 2VYNA 2XTMA 3GEBA 5CX1A 4YONB 4B80A 2HYIC 3LXMA 3E18A 1E61A 3LYUA 4L75A 1AUXA 1DB3A 4ND3A 2OCYC 1SUAA 4TS9A 1FYDA 1OAOC 4EG7A 4WSOA 1K3UB 1EFRD 3ZE6A 2FQ1A 2DP4E 3AM3A 3HBMA 3HSYA 3LPLA 5AM1A 4PTYA 3AXSA 3IEKA 4FCVA 4NBTA 5B57C 4KVAA 3O9VA 1CBUA 1KJZA 2I2DA 2YBDA 4KXXA 2WIJA 5LD2B 4F96A 3RWMB 2AI2A 4U0KA 3P1JA 3G8BA 3J7TA 3GLVA 4MGIR 3ROPA 1ZCAA 4G1MB 3DUFA 1LBIA 3E22A 1T2NA 1PFKA 5L3QB 5DH9A 1CQXA 3K53A 4NS4A 4FB5A 4GOKA 2GBCA 4IVPA 3A4MA 4O4LB 2WWWA 3WLLA 2YICA 5DX8A 3PX7A 3SZMA 3TOVA 5HQ3A 4QVKA 2M6LA 3VNSA 2ZB8A 1ILEA 4U2BA 1XKTA 3RJZA 3AF6A 4MQEA 1X8KA 2G88A 1QQTA 2COEA 1NDQA 1SY7A 2J87A 4OU5A 5HF8A 3H13A 3K70D 1NM5C 2Y93A 1WY5A 3VJKA 4OHZA 4ZJUA 5DXAA 5ARBA 1JKJB 1KP9A 3MTAA 3OUZA 1Z0SA 1GPWB 2FMKA 2DQYA 4MYTA 1JJVA 1QGZA 1U0GA 1XKQA 1Z68A 2ZBUA 1VL5A 2K2QB 2JK1A 4MB6A 4YJHA 4F11A 4OI0A 4BO3A 3SXJA 3B9RA 4LZPA 3GAZA 2JFPA 3PDIA 1YAHA 3A1NA 1QHHB 4L8YA 4FDUA 3P2KA 1VIVA 5LOVB 1A4IA 4B6GA 2PJRA 1VLLA 4U2FA 1KWKA 3D31A 1GARA 4YACA 3MIIA 1ZBQA 2X0JA 1FYVA 2DX7A 3RNOA 1YR1A 4LHVA 1JYEA 3HCRA 1KP3A 1RR6A 2ZFUA 3EZNA 1JSLA 4M98A 5EP3A 1SNYA 4C7OB 1W1IA 3MTIA 2QAGB 2UYCA 4Z1OA 2XXAA 5DB4A 2BJVA 3N2ZB 4F2WA 2XOKA 2QD2A 4PQFA 3PGJA 4EGJA 4D9HA 2Z83A 4UW9A 1THMA 5BW6B 3IEIA 1VJRA 1Q6ZA 4OQ4A 3GT4A 1A97A 3PC3A 5DTIA 3GPBA 4R71A 4HNQA 1DEXA 5H82A 4X6YA 621PA 1I3OA 2NTVA 1A7UA 1JJBA 2JDIA 3AQ4A 3PDHA 4EELA 2IU6A 5EPUA 5FV7A 3N2IA 3D8SA 3ZV7A 1B0ZA 4Z3OA 3GLHE 5HF9A 1F17A 5A5FA 2X4LA 2F59A 3CR3C 1NSTA 1L7XA 1DL5A 3D1LA 7GPBA 1B6SA 1C7IA 2Q3EA 2Y2VA 1FU7A 2PGNA 4F2DA 4QKQA 2YWRA 5HFAA 4RHEA 1SBCA 2Q4OA 3UMRA 3RVLA 3KHUA 2OORA 1IQPA 1GGFA 2QWXA 4CQJA 4RDHA 1XPRA 3O21A 2QE7A 2R6CA 1AIPA 1XZDA 3A6HA 2NYUA 5B58T 5TF4A 3S99A 3TTSA 2NAPA 3RFTA 4F85A 3JV7A 3KT3A 2C7OA 4Z4EA 1B3BA 1MOZA 4OBWA 2HMTA 2O2XA 1RWMA 1WNFA 2GXQA 5TV2A 4M9SA 4WUTA 3ZDRA 4EO9A 1KXZA 2P4SA 4FW8A 3UC9A 5JPDA 5BSTA 1Z5GA 5JYDA 2TRSB 1QZ3A 5EJIA 5C1BA 3FHTA 1V5IA 3EXEA 4OQDA 1F6BA 3GNSA 5ELLA 3E53A 4RW0A 1FBTA 5C8YA 5I7RA 1J4AA 1F6WA 1AN9A 2ZIXA 3HCDA 2OGSA 4NBWA 4NZMA 5AP9A 2DAPA 4TYYA 2AUNA 3MXTA 3VNRA 2D2VA 2OCGA 2DLCX 4NU5A 3JD0A 3AHEA 3RSOA 1LLFA 1RM5A 2YZMA 3NP7A 4MVCA 4JY7A 3ESXA 4I5GA 5E1DA 4CDMA 4BV9A 4EVSA 4V1CA 3F73A 3PIIA 5CHYA 2UYOA 3ZCTA 2WM3A 3ET4A 2VDMB 2VJBA 3JQQA 1U6KA 4HTAA 4F1KA 1NYQA 5K2MA 3OTGA 2GRUA 4ZZ2A 2BZ1A 2WU0A 3IR7A 1KBOA 3C70A 1TZKA 3CBQA 4F6RA 1I01A 2A33A 2Q4BA 3FFAA 1TZMA 3RVOA 4IXNA 2YY5A 1XOIA 2HF7A 3T3MB 1RQ2A 2DFDA 2A9KA 3PQ8A 5AUNB 4GKJB 3SZLA 1RCUA 4DUPA 4X61A 2AXQA 4QUHA 3DMTC 2BI7A 3R6GA 5JCXA 1PEDA 2WYVA 1HDGO 3O4JA 2CXOA 1S96A 3ETHA 5BSFA 3KXDA 1UXIA 4YUVA 4EJ0A 2IIBA 3KQHA 1SBNE 2PUAA 4GZ5A 3UMYA 1T5TA 4ZI5A 5JBQA 5PNTA 1HYBA 2OPBA 5JQWA 1CUDA 2QM8A 3GQVA 4L3OA 1PVDA 5E7IA 3X1ZA 1ZGAA 2BKXA 3DTYA 5DRYA 1VJDA 1CZOA 2C2YA 2G1JA 1Y48E 2ONCA 1QP7A 4UASA 4MI9A 3GVXA 1PHRA 3DONA 2FUKA 3EH1A 1E96A 4XW2A 3H4VA 3HCFA 2ROQA 4L51A 3NORA 2JCGA 2YJ5A 2X58A 3RAJA 1PL7A 1XKLA 3FFXA 4LHEA 3KU4A 5B53A 1YDFA 4IS2A 2PQMA 4QGHA 2UDPA 5GZ1A 4PS1A 4AECA 3RF7A 5JJLA 1L4FA 3NHSA 5HILA 2R1TA 2GASA 1HRKA 3NT2A 3W3ZB 3WLRA 1Z8NA 4AX4A 4OAPA 3W8DA 4ZO8A 2N1BA 2FPPA 1GPAA 3K30A 3ZIDA 4AF6A 1R8SA 4WDQA 3S1LA 2WDZA 4HAVA 3Q3JB 4BB5A 2LIVA 1KI2A 3E3OA 5BN4A 2VRCD 3A6KA 4GAEA 4XSVA 2OYRA 4PC2A 4LISA 3C4QA 1YA8A 1JR3E 3F4BA 2JHPA 2XWPA 2OSBA 1EK5A 2A59A 1NVGA 2BHTA 2ZIWB 2BONA 3DNMA 3MGKA 2P1ZA 3OQ1A 3L6BA 3OTOB 3SHWA 5LD2C 5A02A 1VYVA 4B47A 3JATB 4CQNA 5E9QA 5F33A 4IRXA 2IS1A 3DPUA 3ZVNA 5BVHB 2ATIA 3TQCA 4Y2GA 4YYZA 2Z1DA 2DHEA 2EGUA 2NTNA 3NHMA 1B2RA 4LZNA 1H85A 1FY2A 2IYSA 4UU7A 3T9EA 2ZYTX 4U7DA 2OHOA 1GQYA 4N3GA 4UXIA 3ZEAA 3VHXB 3VJMA 5IZ4A 2ZUCA 3OI7A 4MIKA 4MR9B 4Z0HO 1BWQA 4AUEA 3ROTA 3S8EA 3N5KA 2QX6A 2MSWA 4UUOA 4WFIA 1IH8A 5BORA 2Q6IA 1XA4A 1U7PA 2DRIA 4B43A 3NB0A 2NXWA 5CXXA 2EP5A 4JHLA 1F4VA 1UH5A 1P1RA 1IM8A 4FYMA 3DDOA 3MAJA 4E4RA 3CLKA 1T3GA 1L6IA 2HK7A 3GVHA 1C7FA 3ZI4A 5AKIA 2NXJA 3UV3A 1G4AE 3NBMA 3EMDA 3EEBA 4KXMA 2QT1A 4RBNA 3ZVMA 1MDFA 4DWJA 3P2MA 1QIMA 4YCBA 4M8NE 5AKJA 3Q6IA 5IYZB 2C0CA 1PDOA 3DBHB 3KZKA 1H4QA 3LX6A 2I9PA 2ZK7A 4HYEA 1ISFA 3NYWA 4AYTA 1T1GA 1WB5A 2NXEA 3MT8A 4GS5A 3KVVA 3CONA 4XXHA 2FZVA 3B53X 5DYWA 1KOJA 2X0FA 1JIUA 5BT9A 3PUKA 1YQWA 2ECKA 3DE1X 3PBKA 1G17A 2IEIA 1Y4UA 3O2NA 1H2AS 1MPTA 2D7JA 2IK8A 3EJ6A 1Y1SA 1ZPDA 3IAM6 3RS5A 3KNZA 5K20A 2QAGC 5DM70 2A1TS 1JPJA 1YULA 1OILA 1X9HA 4HDKB 1NXTA 1J8MF 5J47A 1G42A 4H1UA 3GEGA 2LWIA 2PPLA 4XVCA 1QRSA 2IRWA 3KLOA 3V2HA 5DT9A 1VLVA 2GPWA 2OHJA 3QWAA 3WYDA 2QU7A 4CMIA 3NHRA 3PL1A 1LKZA 2H7YA 4ERXA 3BGIA 1KYWA 4KXNA 1FXUA 2JI4A 2YZGA 5C80A 2MINB 1DE0A 1OY1A 2Z8ZA 2CMFA 3QTLA 1U7DA 1O8CA 4UHEA 4WN9A 5FRDA 4Y2XA 2B8EA 3Q7EA 4C43A 5K0NA 1YL7A 4JLDA 1NOIA 1GR1A 1JAZA 2QRVB 1EVKA 2IYVA 3MJSA 5GM1A 4AJIA 3HUEA 3OX2A 1A9RA 4C6TB 2XGSA 3COVA 1N33B 3UJDA 5BXQC 5A6SA 4MS4B 4C5AA 1FLDA 1CY7A 2VBCA 2QN8A 2TMKA 3AY0A 5I9MA 5C1OA 1EVJA 1T0BA 4FQ8A 5JSZA 1RYZA 4FHZA 4K0RA 1KJQA 1H0KA 2JFBA 3SJCA 3WHIA 4BC1A 1A5BB 4E70A 1P4RA 2ZRBA 2JVIA 1LBTA 2B21A 1R0SA 4INOA 4KWTA 1YJ8A 1CJVC 1MN6A 3AVPA 4XQEA 4URXR 3IDAA 4YBZA 4PONA 3C5VA 4HPWA 3DZKA 4R51A 1RRCA 1LVUA 3HJCA 3AUYA 1V35A 4XARA 2CLMB 3BH0A 4JLAA 2IXGA 4C4OA 4Y9SA 3T7AA 2B6NA 3SD7A 3WK6A 3O3OB 1SHZA 1IYZA 1LX6A 1S8NA 2IELA 2NV2B 3AEUB 5EP2A 4H0FA 1Q1QA 1EU1A 1NV9A 2G5TA 5IJAA 5TT1A 4N5IX 5C4MA 2C20A 3R3JA 3DHEA 3VZSA 3VYVA 2QJWA 2V7GA 4JBYA 1JB1A 3ZYCA 4PX5A 5ADVA 2HSJA 4N5HX 1E2QA 1GSIA 3IP7A 4GNKA 4OB7A 3NHPA 2BJHA 2OB2A 5D00A 4M36A 1WDTA 2OHXA 1KO5A 3JQ6A 1OWNA 1ZCJA 2RHRA 1BX1A 4UM9D 1GPH1 1E1QA 3QLVA 3RABA 2QRMA 1PJCA 5A5EA 4AWBA 3D7LA 2FP3A 1LFAA 3NJRA 3NAMA 2BMAA 3EQ7A 1EBFA 3RANA 3PLAE 3C1AA 1UKEA 2MOKA 3NTXA 3KETA 3KQYA 1I1HA 4MDEA 2F8SA 3B1VA 5BNTA 3U4GA 5KYXB 4GMDA 4TTVA 3GI1A 2JGKA 1CUJA 1UBUS 2FUNB 2ZQYA 3IEPA 6REQA