1XTIA

Structure of wildtype human uap56
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
381
structure length
381
Chain Sequence
GFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Probable ATP-dependent RNA helicase p47
total genus 128
structure length 381
sequence length 381
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtiA02
1IN7A 1S0UA 1GRQA 1ZINA 2IYVA 3IQXA 2WWXA 2CVFA 4CEHA 3WHLA 2PJRA 1SVLA 4C2TA 1E6CA 1YVDA 2ZE5A 2PLFA 4HDCA 4TT3A 1TQ4A 1FX0A 2WICA 4PR0A 4PPGA 5AK0A 1KOFA 2A9KA 2FSGA 2O8DA 1XD2B 2RGEA 2YC4C 2P6RA 4WW0A 3L8YA 3THWA 3RRYA 4NP6A 1M2OB 4E07A 1G8FA 1YR7A 2W6JA 1X86B 2C96A 1UF9A 3LVRE 4HAWA 1LB1B 4JBXA 4L9SA 4MKGA 3K0CC 4TL6A 5LD2B 2MSCB 2GXAA 4M0LA 3SBDA 4KVGA 1DAGA 521PA 1UJ2A 2ECKA 3GLGE 2HYIC 3KUCA 4DDVA 2D06A 4RVCA 1VG8A 1XEFA 2V9PA 3K0AB 5GJVC 4BRUA 1E1RD 1SVKA 3DO6A 2PMKA 2W0SA 3KFVA 4II7A 3AGPA 2ZR9A 3QKSA 4GSYA 2XXAA 2VP9A 3KKQA 4JLJA 3VHXA 1A2BA 3VX4A 3AVPA 3EZFA 1G6OA 5CLQA 1P4SA 2V7QA 4DEXA 2AK3A 2RKOA 1GVNB 1M34E 2C9CA 3PUYA 3MMPA 4M2LA 2JLVA 2ZJAA 1VCMA 2GAOA 3IBYA 1ZM2A 3CF2A 1W0JD 1JB1A 3OIWA 2QI9C 2CNWA 5GJBA 4Q7MB 5FL3A 2CL7X 4DCVA 1BMFA 2CL6X 3CR8A 1QG2A 1OXVA 1II8B 2V7QD 4MRNA 1W49A 2QA5A 4AC9A 3CW2A 1OH7A 2XX3A 3PUWA 2H8KA 4TMTA 1N5LA 3U60B 2OLKA 1ZUIA 2HUPA 4NYMR 3GJ3A 3ZJYA 1IBRA 4LJ4A 4EPRA 2CE2X 3W6PA 2YINC 4G01B 1P3JA 4US0R 3B1XA 4MGIR 4PPFA 2BC9A 3DKVA 1KK0A 2KE5A 3DPUA 2DHRA 4Q4HB 3X1ZA 3OIYA 3X2SA 3U6KA 3WRYC 1T0HB 3FOZA 4C0AC 4F91B 1RJ9A 4IFEA 3EZ6A 5GVSA 2BJWA 3BGWA 2J0UB 2GWHA 3QOFA 1RJ9B 4PHTA 1J99A 4EQ6B 2B8TA 4B32A 4TYYA 4G5SA 1KI3A 3RHFA 3LDAA 5C18A 821PA 1E99A 5CYPA 3SN6A 1W46A 2VP0A 2Q0HA 5JMTA 4PO1A 2IW3A 1P2UA 3EG5A 3GJ0A 2CBZA 4Q47A 2EFCB 4XWOA 2OE2A 1E1QA 1P72A 3D31A 5FI1B 4WZ6A 3TQFA 4HATA 4YXWD 3V00A 4DDTA 1ZU5A 1OE0A 2FFBA 1FQKA 1QHGA 1Q1BA 5FTKA 4JLDA 4M1SA 1PJRA 2ZRJA 5E7MA 5H70A 1JNYA 4W5HA 4HZUA 4UNPA 5CK5A 1KAGA 2OFOA 4M9QA 4TTPA 4BFTA 1NN1A 3PFIA 4B3FX 2ZEJA 2GDJA 2ZS7A 2ZI9A 2WWWA 5TVKA 1T5IA 3TSWA 2JLWA 4ZCMA 2O8EB 4HDQB 2X2EA 4CRWB 4A0FA 1R7RA 2OBMA 2YHSA 3BJIC 4HDOB 1NKSA 1N0UA 1XTIA 4JVNA 4A1FA 3K1JA 2Z6VA 5TXGA 3HR7A 1T4GA 2X8AA 3PEYA 1L4YA 3OFND 4Q48A 3GQBA 4D81A 3NEJA 1QDEA 2W6IA 2PMDA 4EKDA 5FOSA 3WYFA 1TTTA 3FHOA 3WMFA 5DN6D 3ZZTA 1XPUA 3U3KA 3KXKA 4GPTA 1W36B 3TQCA 5CLLA 4LJYA 5HCNA 1N0VC 3I4LA 2YV5A 1AZSC 5AJVB 2BV3A 2GRJA 2ZRHA 1ZCBA 4TSFA 1XXHA 4BZQA 3EPLA 5F9HA 1DS6A 2G3YA 4QBHA 1IN5A 1AK2A 1TX4B 3TUIC 3VTKA 1US8B 4LGMA 1QHSA 2VRWA 1SXJA 3C41J 4I4LA 4B2PA 4B74A 3DZDA 1CR4A 4N0DA 3EPJA 1W5SA 3QKUA 4MQBA 4RD1A 3K9LA 1NNEA 3HYRA 1SVWA 4L15A 4NE2A 5CITA 4B6FA 3FE2A 3C16C 2ZVPX 3UMFA 5JJIA 3VU9A 3QXHA 1E9CA 3WYAA 5E95A 3RRZA 1RYFA 2ORWA 2CEAA 3LX8A 2ZUCA 3AKEA 1ZM4A 1AKEA 2HLDA 1BS1A 5CM8B 2FFQA 2GEUA 2XITA 3BORA 4UNQA 2CLDX 3V4FA 3AF2A 1CS4C 2OHFA 4L8GA 4FMBB 2JJ8A 4B2IA 2Z83A 4G5QA 2IYYA 1AGRA 4F38A 1YZGA 2WVJA 4TLCA 2KJQA 1D2NA 1DG1G 2QT1A 1F6BA 4OBEA 4TL8A 3OEHA 3ZH9B 1VYVA 4TYPA 3I32A 4KSCA 1UADA 5LDDC 4PO9A 4LHYA 4IXNA 5JLJA 3KJEA 5JECA 3GLGA 2HYDA 2JJ1A 2A3RA 4QJ3A 2F1JA 1P5ZB 2H57A 4TTQA 3I8XA 3O47A 1P2SA 3BB3A 4V0KA 1FZQA 2I4IA 2ZRGA 4F92B 2WM9B 2NZJA 3NG1A 2V6JA 1Z6XA 1PLJA 3QIAA 1RVDA 4DLTA 5TY0A 1T0JB 1A4RA 3QENA 4WZBE 5FFMA 4CT5A 2AWNA 2R2AA 1W0KA 3CZQA 1KSFX 4OHYA 1ZIOA 1UDXA 1NG9A 3QEOA 1OH6A 3KX2A 2N1BA 2G0TA 2YYZA 4BLPA 3SHWA 4D4MA 5HR5A 3R20A 4R71A 3TK1A 4MRSA 4DZZA 2C78A 1TUEA 4Q03A 2PL3A 4LDJA 4MUAA 3SBEA 5JSZB 1RKBA 1N2CE 3H2YA 1OFUX 1JEEA 2DFTA 2IYRA 1W4AA 3U3OA 5JCZA 4LHWA 3SFZA 4OQFA 4C2UA 1NVXQ 1YJ5A 4QGHA 3RLFA 2E1RA 1TF5A 1KZGB 1F2TA 1WQ1R 4NHOA 4JIMA 1BMFD 2JEOA 4DXAA 4OQNA 4RD4A 1P9WA 3SFVA 1RRFA 5FUVA 1S9DA 1IY0A 5ANRB 2DPXA 1XJQA 4TYWA 3R9XA 2YWEA 2VSXA 2YOGA 1CJUC 2ZREA 2GKSA 2FSIA 1FUUA 1EESA 2V6IA 1D5CA 1TL7C 3UMSA 3H84A 3TMKA 1BO6A 2JA1A 3KTAB 2JJ2A 2BCGY 4C4PA 3RAPR 1MABA 1W0KD 2V3CC 4FN5A 5H68A 1UKYA 1WXQA 2WV9A 4P3YA 1CJTC 4ASUD 1E0AA 4QJ4A 1YR6A 3THXB 4JMPA 5E4FA 4TQ9A 3KL4A 3D6TB 4DLXA 1KJYA 1XZQA 5EZ6B 3O8CA 4QJ5A 3EZ2A 3W34A 5GJWC 1RYHA 1Z28A 4ON9A 3LNCA 2EYQA 1S2MA 1OXSC 1WF3A 1U8YA 5J40A 4KFUA 1HYQA 1JQJC 3I62A 1E2GA 4W7SA 1CEEA 3GJ5A 1Q1EA 1YZUA 1JBKA 3FHTA 4L5BA 1T3LA 3PG5A 3V9PA 1AS0A 1KO1A 1ESNA 4ARZA 1GNRA 1ZRHA 121PA 1KK2A 3AQ4A 3BE4A 3FFAA 4ZKDA 3GPLA 1BYIA 4DSNA 3W3ZB 1E69A 2K5UA 2J9RA 3HU2A 1N3BA 1HV8A 2VSFA 2IL1A 3W9YA 1ZM7A 4B71A 4PHGA 4D6PA 1DBSA 3EAQA 2RCNA 3L8ZA 4RFVA 3DEFA 1U0HC 1EX7A 2E87A 1XNJA 4JLAA 5FBLB 4IFBA 4D4JA 3UG7A 4AWXA 3UANA 5FL7D 1Z0KA 5SZJA 3BFXA 1YZKA 2YNMA 4DLVA 3I8SA 2ZVQX 1E9FA 5D3QA 1BH2A 3CZPA 4M1WA 5B58C 2ZETA 2WKPA 4B3BA 1ZNWA 1LNZA 3K0AA 2G1JA 3TR0A 1W36C 3GJ7A 4TLDA 4C7OA 2D7CA 4PHFA 1D2EA 4Q4AA 3SQXA 3AKYA 1GL9B 4M22A 1WBBA 3BFVA 2R6CA 3U44A 1KI7A 4ZIRA 4OI0A 3AKCA 2G9NA 4ILEA 4URYR 4XVRA 3ADKA 3P26A 2ZI3A 5KUTA 5EE1A 3PUVA 1UEJA 2W2VA 4IXMA 4B3XA 5JSZA 5HCIA 5FPHA 2IYZA 5L3VA 1UDWA 2VH5R 1N5JA 3DM5A 3GLIB 1UBEA 4IOMA 1HQCA 3EX7C 2WAXA 1VMAA 3X1YA 2IF2A 4M9SA 3TH5A 3KKOA 4ZI3A 2ERXA 4TQUS 1MABB 4NCHA 4UXJA 1XXHE 4NYIQ 1Z0AA 2AFHE 3B82A 2HV8A 3R9WA 3ADBA 1HE8B 2KI5A 3SQWA 2GF0A 1LTQA 2BKEA 1QG4A 4JLPA 1RZ3A 4B44A 4CF7A 5JBQA 4N0EA 1H8HD 3PXGA 4PQRA 721PA 4BE7B 1GDDA 4LSGA 5FH9A 1YZTA 2FNAA 3U7HB 2XSZA 2LKDA 3L0PA 3HWSA 3KTAA 1OB5A 3RS4A 2IC5A 3EZ9A 1GKIA 1SXJC 4NCNA 1QVRA 1I2DA 5EZ5A 4AI6A 1KMHB 4XSHA 3ZS9A 3ICQB 2NOAA 4QC2A 1GSIA 4AKHA 3SC3A 5P21A 3I72A 4URZR 3UG6A 3MJRA 3GFTA 2QRZA 2KWIA 3F8TA 3ZVMA 1J2JA 2BMDA 3WBJA 2BBTA 5B64A 2C04A 4AKIA 2WJIA 4LYAA 4CYMA 2VA8A 1K8RA 1FMLA 2IYXA 2ZE6A 1W44A 1MH1A 5CIQA 5SZKB 3RSLA 2FX3A 3VNVA 1U8AA 4M21A 3ADDA 4IOLA 3DVLA 4IKEA 1DADA 4UXIA 4NMMA 1VIYA 1OIWA 2ORVA 1XMVA 5TMPA 4QOSA 4I1OA 1Q20A 1US8A 4QGAA 3ND8A 1G20E 4P31A 1NSFA 3QXJA 1SVIA 2GXQA 1YZQA 3QUSA 1U0JA 4HAXA 5BYJA 3AP2A 2QTHA 1XFAA 4L16A 3SEAA 4ZDIA 5A5GA 1ZNZA 5E3HA 2FFHA 2NO6A 2O8BA 4B43A 2WOOA 2PT7A 1CU1A 2GZAA 3LW8A 3QPWA 4C30A 3NXSA 4DHEA 3D7MA 5L3QB 4Q19A 2J46A 4PZLA 4QXAA 3VMFA 1Z47A 1BYUA 3QXXA 1LS1A 4DB2A 1J8MF 3HDTA 4LHXA 3PEWA 2V8OA 5KOYA 2B7CA 4HB0A 2AK2A 2LCFA 3CB4A 4DSUA 4NYJQ 1ZD9A 4EUNA 1GNQA 1L7VC 2WSSD 4EPWA 3QKTA 1QHIA 2D2FA 2WWGA 3LBIA 1G3UA 4MGKR 5J4LA 2ORIA 2Z4SA 5HE8A 1U8ZA 2VBCA 2Y8EA 5J4HA 2B6HA 2QM7A 3ZLJA 2R6DA 5AJZA 5AUOB 5FR2A 4CT4B 4CEJB 2ZYTX 2QSZA 4AIIA 4PX9A 3A37A 1S4QA 4BFXA 4D2IA 4CGZA 5F98A 4GBMA 2JLYA 1L2TA 4V0MA 2HEIA 3I92A 5HE9A 2IS4A 2GJ8A 2I1VB 3RDPA 1E79D 1G5PA 2V4ZA 3T5GA 4DLSA 4ZDKA 3TUJC 3EC2A 1UPTA 3UWOA 2PBRA 1MT0A 3IBGA 4C0SA 2C2HA 2KBFA 2EFGA 2ZUDA 4US1R 3LX5A 3KZ1E 4ZPXA 4ZCLA 3B1WA 3EWSA 4MRVA 2ZS8A 1IM2A 3T61A 4A9AA 3KJIA 3OIUA 1ZJ6A 2YKGA 1YR8A 2BVNA 4OK6A 1H8ED 4JLNA 2GBLC 1N0WA 3Q72A 4JYCA 2NO7A 1TPZA 4YLGA 1CP2A 1E9DA 2GZHA 4EFLA 1KNXA 3M0EA 4HB2A 5BW8A 1M74A 3WNCA 4E09A 1Z07A 3TSZA 2PEYA 3EARA 4QHTA 1MO5A 3NC0C 3WBKA 3K0SA 2FSHA 4X8HA 1DELA 2MSDB 1NBME 1SHKA 2J5XA 2CNWD 5JCPA 1ONBA 1PLLA 4HUQB 4Z8XA 2KBEA 2WIAA 2WKRA 2NO9A 1N25A 4MDEA 2HCJB 2JJ2D 4QG7A 2J0UA 2VHJA 4PC3A 5F3WB 2IS1A 2WMNB 3LBHA 4A8JC 4OI2A 4A6PA 1OV4A 1II0A 4H1UA 4LBZA 1CJMA 1P73A 1GAJA 1UBCA 3FDIA 3NHBA 1T9HA 3NWJA 4WAUA 4GOJA 3TRFA 1OIVA 1XB2A 4FMDF 1XMJA 2QROA 2ZQ5A 1T91A 5DGXA 2QPTA 3PCRB 2ZJOA 4MKFA 2W2TA 1P60A 4NCIA 5B57C 4IVQA 3AP1A 3B13B 1X1SA 4BLRA 4RJLA 2OM2A 4LWZA 4HUTA 2IUTA 3I61A 2ZR7A 1G6HA 2OILA 2A5GA 3DDCA 4MRPA 2IXGA 2QQ0A 3JVUA 3Q85A 5BN5A 2D74A 4CW7A 3B1YA 1KK1A 4HSEA 3BK7A 4NYMQ 3U3JA 4FCWA 2GJSA 4QHYA 1TQDA 1E2FA 3FYHA 3KDSE 4US2R 2RGBA 3W3AA 1OFHA 1Z22A 2IEZA 5BXQC 3LAWA 3QF4B 4PQFA 4D26A 3KUDA 1XEXB 3AF4A 1W5TA 3CRVA 4QNMA 1ZMXA 3GJ8A 3PVSA 1CJKC 2RMKA 3GJ4A 1E2IA 4MYTA 1U9IA 3H0KA 2AN9A 3W5IA 2JGNA 2O0HA 1XEWY 3B1ZA 3NH6A 221PA 4OHVA 3AVTA 1MO4A 2REBA 5KTYA 5DHAA 5SZHB 1VYUA 4KSBA 3T5DA 3REFA 3ECCA 4URWR 2A78A 4LBYA 1NP6A 4QM6A 3SE0A 3SI7A 4FWTA 2GXUA 3CBQA 2ZJBA 3PEUA 2Q21A 4DSTA 2ZR0A 3W6NA 4DVGA 2E9SA 1C1YA 1P6XA 2GEDA 2ZI7A 4B75A 3IUYA 2QBYA 1ZAKA 2NIPA 1W36D 3T35A 2VPPA 5DI3B 5KO2A 3BBPA 4NCKA 1OFTA 421PA 1IAQA 2GNOA 2F7SA 1EG7A 2A5FA 3T15A 1FP6A 4RD2A 1RIFA 4ERNA 4PAMA 3LH5A 3DM9B 4A2PA 3WMEA 2XAUA 5DHFA 1NBMA 2NQ2C 4FCTA 1E32A 3FFBA 4M1OA 5HKKD 4GFDA 2A5JA 2F55A 1ZD8A 1LFDB 1S1CA 4ABYA 1OPXA 5K8TA 2QP9X 3T06B 1VG1A 4D0LB 3CUEF 4ACAA 4HEJA 3E1SA 3FHCB 4FMDB 4FMCF 3T12A 4URXR 2J0QA 3B6EA 2ZJ5A 4PSAA 4P4SA 4EFMA 1UAAA 3NKVA 2CLSA 2CLCX 5FPTA 1NMYA 4V0NA 5F9FA 1NG1A 4BFYA 4V0OA 1Z29A 2CHGA 2ATVA 4JJZA 4Q7KA 3Q5EA 1EXMA 5EUQB 5UKDA 4QBFA 4PAQA 3TSOA 3VR6A 1OFIA 4NZYA 1CBUA 2J3EA 2GCOA 1MRNA 4KYIB 5FI0B 4FI3C 1B0UA 1N6KA 3LLMA 3TW4A 2ZXUA 5L3SA 3QF7A 1G4UR 2P5SA 1G291 4A0RA 4MKIA 1HEIA 2EFEB 2IYTA 4DIEA 1OH5A 1UBFA 1SZPA 1NL3A 4HAVA 1SVMA 3OEED 1TF2A 3VFDA 1Z0JA 1SULA 4BGDA 1V5WA 2NO0A 2HT1A 1R0WA 2IWRA 1KO7A 3THYA 2VHTA 4OQXA 5EXXA 5C4MA 1FNNA 3HP1A 2F1RA 5DIFA 4GT1A 4PFSA 5LD2C 3THWB 1FL9A 3D3QA 2JIZD 1EFRA 3G0HA 1XRJA 3C14C 5LBIA 3R8CA 3JZAA 3QKRA 4BFZA 3MUFA 1NLFA 3DMNA 3FKSD 1XX6A 1P2TA 2BMJA 3TVDA 1EGAA 2OLJA 5BQ5A 4EJSC 3AV0B 3P1JA 1N6NA 2GCPA 3NBZC 2OCYC 1I2MA 2MSEB 4G3XA 3IEUA 3JVVA 3QVVA 2HJVA 2Z4RA 1JR3E 3NEYA 3TR5A 1J90A 4C9BA 4DWJA 4M1TA 1U2RA 1NY5A 2WMOB 2YWGA 2AL7A 3A1UA 4RZXA 2KB0A 2D4HA 1OSNA 1LY1A 1R5NA 2G83A 3MWLA 3ZDQA 4DLYA 1X6VA 4OHXA 4RD6A 3OHMA 1ZM3A 5J4VA 1G7SA 2BWJA 2ZRBA 4KBFA 2XGJA 1FP7A 1WCV1 3BH0A 2W83A 2J41A 1I4LD 2RHDA 2XEXA 2ZITA 4FMCB 4N3NA 4Q7JB 4A2WA 2EFDB 3WNBA 1AS3A 3K70D 3U3MA 4Q9LA 4LJ6A 4DKXA 1XDBA 3KQLA 3PENA 1KDPA 1C4OA 2NPFA 2ONJA 3H4MA 1KKMA 3HPRA 4B3GA 1K5DA 3SNHA 1XPOA 5IHPA 2CHQA 5LPNA 2ZI4A 1NIPA 2BMEA 4R9UC 1HUQA 2P2LA 4K81B 4WBSA 2AHOA 3CKLA 2R6GA 5A4JA 2OEPA 3IKJA 1KYIA 5EJEA 1GP2A 1G3RA 2IEYA 4LY6A 2WKQA 5G53C 1BIFA 4FWIB 2WWYA 2Z5FA 1E1RA 4M9ZA 1XJ0A 2OCBA 4AD8A 3QJYA 4GOKA 2FV8A 1X8JA 3SHFA 3MWJA 2ZJYA 3T34A 5C2JB 4IDQA 3EC1A 3Q9LA 2IBMA 4UJ3A 3UMRA 1V43A 1DG3A 4C0KA 1TADA 4Q1FA 1QHXA 4V03A 4OI1A 4ARZB 3AVXA 3TUZC 5DYGA 1H8HA 2Q6TA 1YHNA 2FH5B 2FFAA 5D3MB 2OBLA 2OUKA 4LX0A 2P67A 3OAAD 2ERYA 4KLZA 1NRJB 1GRRA 4U02A 4KLNA 1Q1QA 1XJCA 3WMGA 4Y0AA 2XTNA 5KHOC 2L0XA 4HB4A 1GKUB 4IEEA 5EXTA 1ZVQA 4YMWA 3ICEA 4O2RA 2QAGB 1TEVA 2H18A 2ZM5A 3I73A 4N1AA 1WRBA 1OH8A 1LVGA 3B78A 4O3MA 1M7GA 4H1VA 1GOTA 2O8CB 2QENA 5JZVA 3SJAA 1VHLA 3X1XA 5JEEA 3FVQA 3CNNA 4PC6A 4AKEA 4TYQA 1HE1C 4OJQA 4E22A 1G17A 2B7BA 3CPEA 4A8JA 3GLFB 2F3TA 3RVBA 4QFMA 4M4SA 3RYTC 3I5XA 4J0QA 1E0JA 2VL7A 1GG2A 2XNDD 1S96A 4G0NA 5IK2A 2YWHA 4PZYA 4YMVA 1ZYUA 2ODNA 4XOIA 3DOEA 3THXA 1P7CA 4YMSA 1Z63A 2ZRNA 1KI8A 1QHYA 3H86A 4X8MA 3W8RA 3HPQA 3OIVA 1HT1E 2ZSDA 3B5JA 4BLQA 1G5TA 4NU0A 4AY2A 2Q9BA 4GP7A 4XTRA 2ODEA 2D62A 4LPSA 5FL7A 2ZRMA 2QAGA 2Q9AA 1AJEA 1DVRA 1Z6GA 2QE7A 5EP4A 1AN0A 5CK4A 1QVAA 1QRAA 5EE0A 4HLUC 4L4UA 4GMDA 1R6BX 4C0LA 3BWDD 1VCNA 1II8A 3IPXA 3QXSA 4R7ZA 3R7WB 4CDGA 1F2UA 4BFVA 2ZI6A 2F3RA 1CIPA 4G5GA 2ZYVX 2JATA 1CLUA 1U0LA 2REOA 1KK3A 1CTQA 4P32A 3OE7A 2OZEA 3Q8XB 4P0TA 3T1TA 4DLUA 1KI6B 5CB8A 3FGNA 2OO7A 1JEDA 4A6XA 4IOKA 1MO3A 2F1IA 4HLDA 2GJKA 1OKKD 3QPVA 5KNCA 3K70B 1GUAA 4KFTA 2Z0MA 1RC8A 5CJ2A 4W9MC 2WJYA 3UWKA 4TL9A 1GWNA 1R0ZA 5DSZA 1CR2A 2PCLA 4IEIA 1E98A 3KXIA 2R9VA 3WRXC 1G3QA 2OAP1 4LJAA 2IS2A 1E2LA 3IIMA 4LJ5A 2DYKA 3NBXX 2XJ9A 1SKQA 2V1UA 1WB9A 3L0OA 1IXRC 2GJAA 2J87A 2XZPA 4B48A 2J45A 5J4KA 1OJLA 2WOJA 4K8OA 1HY3A 4NPHA 4EAQA 1XCGB 1EFRD 4MH0R 3RABA 5KNBA 3A8TA 3K9HA 1CRPA 2AD5A 2GJ9A 3CH4B 3U6BA 2VSOA 1IJEA 3BIFA 4E03A 1EFUA 1U98A 5B30A 3AVUA 2EYUA 1Q12A 1E9BA 2FG5A 3NDPA 4EFNA 2C98A 4LJ9A 1IN4A 3EXAA 4Z54A 3B85A 1ZUHA 3HU3A 1CR1A 3DL0A 2EW1A 1UBGA 1AM4D 5IDVA 3B60A 3GEEA 2ZANA 5TARA 1XD2A 3PIRA 5BWMA 2FSFA 3IDQA 2NPIA 3O8BA 1KJZA 3GP8A 1U99A 2VHCA 2FA9A 1OXXK 2RAPA 3K0CA 3Q7QA 4GZLA 4LCBA 4Q4JA 4UKDA 2HF8A 5CDFE 5JS8A 2N46A 3AUYA 3TE6A 1XXHB 4Q7LA 4I99A 5KDLA 3CM0A 4QBGB 4F4JA 4Z1MA 2EFHB 5CIWA 2NG1A 1QHNA 3EPHA 2FMXA 3PR1A 1ZC4A 3L43A 3PUXA 4LV8B 3TIFA 4O2LA 5FBRB 2JLSA 4OHWA 3Q5DA 1F3OA 2KSQA 1G7TA 1X8KA 2QTVB 2VHUA 3CIOA 4LHVA 5G3ZA 3UIEA 4EJSB 2J7PA 3C5HA 4AG6A 1K5GA 2TMKA 5ELXA 3K9GA 1RRGA 2H5EA 5F2EA 3C15C 5DH9A 3BB4A 4CEIA 1R0XA 2ZJZA 1J70A 3WP0A 3FMOB 3ONWA 4A92A 3NC1C 1QZXA 3GLIA 2HLDD 2W0MA 3SR0A 4HLCA 1XD8A 4JVSB 5FUYA 5FOWA 3W90A 3RC8A 3LBNA 2A2ZA 2RGAA 3CRRA 2G77B 5FOXA 4TLAA 4M1YA 4JBYA 5JFGA 5J47A 3ZZ0A 1HT2E 4M9XA 2QRNA 3B9QA 3FTQA 3CLVA 2G88A 3IO5A 1KY3A 1Z6YA 1FW6A 3AVVA 2R6AA 4PSVA 3SYLA 2ODWA 3P20A 4DDUA 2OCAA 3N2IA 2C8VA 1COWA 1Y3AA 2X1VA 4KAXA 1WDTA 1KI4A 5AUNB 1W4RA 2AWOA 1RRPA 4JJKA 2ZRFA 2ZRPA 2ZI5A 1Z5ZA 1DARA 2YVUA 2VP2A 5AR1A 1ZM9A 4DSOA 3I5YA 4OHZA 3E5HA 3O8DA 3VNUA 3FKQA 2IYUA 1NVVQ 1UKVY 2H16A 3MSXA 3R8FA 4IDNA 3NBFA 1A2KC 2FDCA 3ZD6A 3T1QA 1TU3A 4DBLC 3RS5A 1ESMA 3VR4A 4F7WA 2DWOA 1IQPA 1YZNA 3AH8A 1SXJE 1LF5A 2H92A 4C7OB 4NKRA 2UZ3A 3HU1A 4FW9A 3RRMA 3BB1A 2R44A 4DEYA 3TBKA 1F60A 3PV0A 1NLYA 5DYIA 5BN4A 3A6PC 2WBLC 4DJTA 2ATXA 1VCOA 4LK2A 3ASYA 2QAJA 3KKPA 2QPOA 1TUIA 3K53A 1R2QA 4IVPA 4LOAA 3O8RA 3FMPB 4YMUA 4Q4LA 3SU8A 5KSYA 3MWKA 1XTJA 4KYUA 5GADl 2OESA 3ND9A 2FGKA 2ZJ2A 2BHRA 1DEKA 1QHHB 4FIDA 3F5FA 5HPYB 4RZ2A 4HLUA 1M1YE 1KSJA 1AQYA 2C99A 1W0JA 2WZQA 2LKCA 2BCJQ 3WXMA 4B34A 4TLEA 4JLMA 4NL4H 2QN6A 4XWKA 4V02A 4QBIA 4YMTA 1E0KA 1NLZA 4A0GA 1JAIA 2N42A 3LLUA 2F6RA 4XTCS 1ANKA 2DB3A 2ZIAA 4FINA 3QG1A 3EWAA 2D7DA 2OSBA 4U5XA 2VO1A 4LRWA 4YXWA 4P4TA 4NYJR 4F4IA 4W5JA 2IXEA 1KHTA 3U7EB 1PVOA 2JDIA 3LQRA 2G6BA 1NF3A 4LV6A 1D9ZA 4DCTA 4YQFA 2XB2A 2VP6A 4R2IA 4BFSA 2YOFA 2DWPA 3T1OA 3LRPA 3RS2A 3VX3A 3K8YA 2ZSAA 3AVOA 5JI3E 1ETUA 5JRZA 1SXJD 4DLWA 1L4UA 3KQKA 4BFWA 3N2EA 1G1MA 4HUQA 1EWQA 4GRAA 4TMKA 1E9AA 1E9SA 1BOFA 2VTKA 1T3HA 1LF0A 3BXZA 3GJ6A 4OI4A 4C0BA 4HYYA 4KODA 1ELOA 1VG9B 5G3YA 1H8EA 1OF1A 1T8TA 4WZAE 4AYXA 2DBYA 3W6OA 2QMUA 2F1HA 1W7AA 1G64A 2YC2C 4LYJA 3CNOA 1NN3A 4ZI2A 2ZAMA 3ZVRA 3CPJB 4FD2A 5GVRA 4RFSA 3THOA 1JJ7A 1G41A 2WPDA 2YJTD 1RPZA 3C5CA 4LYFA 1OXUA 3N70A 3VKGA 4ZKEA 4DDWA 1S8FA 1CR0A 1ZP6A 3MRSA 1KO8A 1FPMA 2WJGA 3RANA 1GL7A 3FMIA 3VKWA 1AIPA 5EP3A 2Q3HA 4GNKA 6Q21A 4A2QA 4KVAA 2XNDA 2RH5A 3CX7A 3TAUA 2HDNB 4PC1A 1NIJA 5KDOA 2PT5A 2VF8A 3L2OB 1P62B 4I81A 3P4YA 5E7IA 1OHHA 1T6NA 4P4SB 3SJBA 1YRBA 4QRHA 4BFUA 4XD7D 3B8HA 3GLGB 2QNRA 4TZ6A 1Z2CA 2BBSA 1NMXA 4TT3D 1G16A 1G9XA 2OXRA 5DO9A 3WHKA 5DNYB 3SOPA 4B35A 2ONKA 1JQLB 1X1RA 1Z6AA 2FPKA 1LS6A 2CJWB 2ZE7A 2PCJA 3LXXA 2BJVA 1GZSA 1SHZA 4GI7A 4WXRA 1W48A 4QGGA 3J81k 1IN8A 1FMJA 4G1UC 3NH9A 3B7GA 3ZGXA 2AFIE 2ZYUX 2EQBA 3I1FA 2QORA 1PV4A 1O3YA 3EIQA 3BFKA 3G82C 3QPUA 4TLBA 1JR3D 4BQSA 1KAOA 2J0VA 1Q3TA 1NN5A 1W1WA 2RHMA 3QE0A 4TN1A 4QM7A 2RB4A 4M1KA 4BRWA 5K8IA 3KFXA 1G3IA 3LVQE 1GTVA 3TKLA 1CULC 3UXMA 5KPDA 1DO0A 2FEOA 1AGPA 1GL6A 4DLZA 2IS6A 1E94E 1NJFA 1DO2A 5L8VA 1MO6A 1G3MA 2WSSA 2FZLA 4NTZA 3GJXC 1XTKA 1KKLA 5AJWA 4AURA 8OHMA 3RS7A 1R4AA 1JAHA 2X19A 1XP8A 3TNFA 4DLRA 5FTLA 3MAAC 1DAKA 3PQCA 2IHYA 4RD0A 4NDZA 3SZRA 4HAUA 4DT1B 2B92A 2BM1A 1KI6A 3D8BA 1OW3B 4LBVA 2QBYB 3LXRA 4MUBA 3SYKA 3FMFA 5L3SB 5LB2A 4KITB 2QG6A 1E4YA 4LZZA 3HR8A 5C4GB 2QMOA 3VU9B 3HYTA 3AF1A 1E0SA 4I1UA 4ZDWA 1Q1ZA 3MG9A 5EQTA 4B76A 1LV7A 4NONA 3GMTA 4OYHA 1N5IA 4RFSB 4AG5A 4W5WA 3WYGA 2GVDC 3RRNA 1XPRA 5CDFA 2RGCA 3TAHA 4D82A 3LY5A 4R2HA 2QT0A 3IO3A 4A8JB 3GLFA 3P27A 4ZV4A 1Z06A 2CHVA 1FFHA 1P9NA 2NTYC 3CONA 2J7PD 4Q00A 5KYKA 1A1VA 2AD1A 3QY0A 4EPYA 4CIDA 1TF7A 1PZNA 4D0NA 4KBGA 5JRJA 3IHWA 1DPFA 3LO5A 4KHZA 2OT3B 1CRQA 1JECA 1SXJB 2A30A 3F0TA 3K09C 3NVAA 4GOXA 3SDZA 2QMHA 4JL6A 2OAQ1 3M1IA 2IYLD 2ZU0C 3B2EA 1D6JA 2QL6A 1OB2A 3A1TA 1E9EA 4DIDA 4B2LA 5K8LA 2A7QA 3ZVLA 3LV8A 5H1YA 3MJHA 4Q4HA 1XCMA 4MGZR 2PLRA 5EE5B 3KJGA 3EZ7A 3WY9A 2QSYA 2AR7A 1QF9A 4Q4AB 4LV5B 4ASUA 1IHUA 1N6RA 5G41A 4Q5IA 1XMIA 2IYWA 3SJZA 3OF5A 4PANA 3R7WA 5FUWA 1R10A 4XVQA 4EQ6A 1Z0IA 1IJFA 2GXSA 1OIXA 2IT1A 4RZ3A 2J59A 4V0ME 1DE0A 1NVUQ 5EP2A 4IDPA 4DC9A 4Q9HA 4RCZA 1FTNA 4JZKA 2YWFA 1I4TD 1T3SA 4IDOA 3GEHA 1PUJA 1S3GA 5B2ZA 3W8NA 3ZYCA 3LW7A 4WA7A 2J7KA 2HJGA 1XZPA 5D3MA 2A5YB 2I3BA 3CF0A 1G18A 1VIAA 1GIAA 2H7VA 2D2EA 4B3DA 1NJGA 1XWIA 2DR3A 2HF9A 3ZQJA 4I1SA 3VHLB 2BEJA 2FE4A 3AEZA 4UNRA 3EPKA 4PPQA 3MGCA 2HCBA 3EA5A 3KXLA 4I1VA 2P3SA 5FUXA 1N5KA 1YE8A 3DMDA 2P5TB 2ZRCA 3AB3A 1U94A 4F93B 2P6UA 2ODBA 4NBSA 1F48A 3F3YA 3P4XA 3PUZA 1TQ6A 1Z2AA 4HAYA 1KSHA 1E96A 1ZNYA 1C9KA 3CX8A 2GAAA 4C0QC 2MMGA 4QGFA 1M8PA 1FQJA 2AXPA 1KI2A 2NMVA 3ZVNA 1OT3A 4DCUA 2C9OA 1YU9A 1E2DA 1P61B 1F2TB 3L0SA 4PXAA 4JSYA 1JPJA 3AVQA 2GZDA 4RSGA 1WP9A 1XCPA 4C3ZA 1Q21A 4JSTA 3MFYA 4LJ8A 4JS0A 4UNNA 1XTSA 2GILA 2ZU6A 4ITRC 1E2NA 3BH7A 3TVTA 2C03A 3OFNA 1DAMA 1F5NA 4OQLA 3RWOA 1VCIA 3LA6A 2GVZC 2WHXA 4MKHA 3CH5A 3GLIE 1ZD1A 1XF9A 1KI9A 1YR9A 4PSKA 1E2PA 1GRNA 1R8QA 4JT2A 4MDFA 2O8FB 3PEVA 5EE3A 2IK8A 4F4CA 3E70C 2FU5C 1A7JA 3JZMA 1IY2A 4JL5A 2F43B 3UPUA 2ZJ8A 1E2QA 4Q21A 3VR2A 4URVR 3MLEA 3KQUA 4LC0A 3K70C 2RGXA 5FPYA 3REGA 2WPDD 3THYB 1WMSA 4A82A 4OK5A 3OE7D 3U2QA 2G1KA 1E4VA 1VYTA 5LB4A 1W4BA 2HT6A 1HH4A 4KFSA 1M7BA 4DB4A 1FNMA 3A1SA 4O0MA 1A5TA 4Z8YA 2O5VA 4MGYR 1ZIPA 3QNUA 1TMKA 2X77A 5KU1A 1JJVA 4YC7A 4XH9B 2PZGA 3VR1A 3GEIA 5FOTA 4JVLA 1FOEB 1OKKA 3GLFE 3BS4A 3RC3A 1JR6A 3A36A 3KKMA 1M6NA 3GLHA 2IF0A 2ZSEA 5EXSA 4KFRA 4JLBA 4LC1A 2B8WA 1Z83A 4CEHB 4JKYA 4KJZA 4CZ2A 1S1MA 4L9WA 3EIHA 1N6OA 2W58A 1LW7A 4KV9A 5BYKA 5JWRA 1N6LA 3N5CA 4AK9A 3U7GA 1KZ7B 4NYIR 4DT1A 4G5OA 5IK2D 4Q1DA 2VYFA 3GLHB 1Z6TA 4Z1MD 4PO8A 5JJLA 3RS0A 2WAYA 4IOJA 1O87A 5A0FA 2XZLA 1D9XA 1Z3IX 2ANCA 1IONA 1EFHA 1HURA 2UZIR 2VLIA 3H1TA 4PPNA 5JI2E 1UKEA 1DAHA 1NKTA 3CO5A 3KJHA 1GITA 5GJCA 2J1LA 4HLQB 1WA5A 3ZD7A 4LI0A 4BLSA 1ZUNB 2CJWA 3ASZA 4M8NE 5FPSA 3K0FA 3RS3A 5KNDA 3BAFA 2EWVA 1PLKA 4D4LA 5IT5A 2O8BB 4TZ0A 3A4MA 5M04A 2GCOB 3BRWD 4CVNA 2IYQA 4WOPA 2Q3MA 2ZPTX 4WVFA 5CYOA 3VR5A 4QNRA 1ZNXA 3M6AA 1P2VA 3QBTA 3NIBA 4JL8A 3CPHA 4JLKA 5DE3A 5G40A 4DUGD 2JLZA 4A15A 2OCPA 3DOFA 1S3SA 3MWYW 4PTLA 4XWAA 2JLUA 1DTSA 2HXSA 5FTJA 4LUCA 5SZIA 2O8FA 2REXB 3K09A 2O8EA 1SKYE 4YDSA 1XD9A 1E3MA 2PJZA 5TDHA 5EE9A 4H9GA 3CNLA 2FN4A 4MYUA 1XBTA 4OL0A 1QBKC 1GILA 1UKZA 2ZRLA 1AS2A 4UNSA 3IIKA 1NMZA 2CCJA 4BUJA 1Q0UA 2NO1A 3IIJA 3DZ8A 3IILA 3CRW1 2R62A 2ZSFA 4PAOA 1OLOA 4TMWA 5J4YA 4Q1AA 5EP1A 4G5RA 2AKAB 3B9PA 5FOVA 2ZRDA 2BBOA 2PX0A 4JYBA 1OXTA 1E2KA 2CCGA 1TU4A 2V54A 3OEHD 2W6JD 1AQUA 3EASA 5DN6A 5CJPA 4V0LA 2Q3FA 1U90A 4KI0A 2IXFA 4GMXA 4KU4A 1R0YA 1W2GA 1E79A 1TEXA 2CCKA 4TMVA 2R65A 3AKDA 2WTUA 3PJRA 1GM5A 4WXPA 2DCUA 4TMXA 5JHGB 4D80A 1DAEA 1ZC3A 4LBWA 4HZIA 3ETLA 4TWZA 1UFQA 1NY6A 1HQYE 1MRSA 2BOVA 2MMCA 4IVRA 1IXSB 3OAAA 4X8LA 4ESHA 3IHLA 1TNDA 2JDID 2WJJA 4PC7A 2GBLA 3SYNA 2D3WA 5FBQB 4B3CA 4EPVA 2OFXA 3UKDA 1F2UB 1W2HA 2IA5A 3IPYA 3LWNA 4EPTA 5C46F 4ACBA 3DKPA 4YONB 2JAQA 2F9LA 1Z0DA 4RZUA 5J5CA 5E7JA 1MOZA 2V55B 2ZRKA 4DRZA 4B33A 2PX3A 1EFTA 1KTVA 2ZS9A 1R5BA 1R5OA 4U00A 3NDBB 4RKEA 2BBWA 2H17A 3QG5A 1SGWA 1EK0A 4BPBA 2GHIA 1VTKA 3RNLA 4Z51A 4UQOA 1ODFA 3TLXA 5TB5A 2O8CA 3M4YA 1TAGA 3V4RA 2O0JA 2EU8A 4K46A 2XJ4A 4RD3A 4O25A 4ZCIA 3CWQA 3OEEA 5C1BA 3Q3JB 2RGDA 3C4JA 1H65A 3QKSB 3EA0A 4AYTA 3UATA 1U9IC 2QEQA 4D0GA 5KSOA 4TTRA 4JVMA 4EIWA 2ZYWX 1E2JA 2O0KA 1AA9A 2VP4A 1RRCA 3CR7A 1G7RA 2JASA 2VHQA 4Q9JA 1GKYA 1VHTA 3X1WA 1G5RA 2H1LA 5CM9C 5FPKA 4WIAA 4BEBA 3U7FB 2RGGA 3L82B 5IF9A 1KIMA 5JHHB 3U5ZB 1EX6A 1XMSA 2Z43A 4FCVA 1SKYB 4POAA 3QI2A 3SJCA 4YDHB 2BIFA 1ZW6A 2FOLA 1EFCA 1YRAA 3RWMB 1R8SA 1UEIA 1NBMD 3HJNA 5HKKA 1G8YA 2WWFA 5TV2A 4S35A 1COWD 2YZ2A 3QVUA 2XSZD 4KXFB 4CEJA 4Y0VA 1A82A 4A4DA 3NBYC 2IUUA 5FOUA 4HI0E 5KDDA 4PHHA 2DFKB 5AJXA 2C95A 5DISB 4TL7A 2QP3A 5BN3A 1ZBDA 2IX3A 2GTPA 3G5UA 3ZIAD 1E2EA 1YZLA 4HAZA 3BD9A 3IEVA 2SHKA 1X3SA 4Q9KA 1N6HA 4GL2A 5JEDA 2QZ4A 2DY1A 4Q4JB 5EUMA 4ESVA 1JR3A 4DUGA 2I1QA 1W47A 2WWIA 1M7HA 2QE7D 2QY9A 3FPAA 3AGQA 2QGZA 4QHSA 1Z0FA 4IJMA 4MRRA 4DCSA 2QU8A 4M1MA 3TJZA 1VG0B 2JLXA 1D8TA 3IGFA 3RSOA 1DAIA 4B47A 1KMQA 2O8DB 4M53A 2PZFA 1YKSA 2BM0A 3QBVA 4LPKA 4EJSA 2BMFA 2W6ID 3U61B 4QL3A 2QP4A 2QPAA 3WP1B 5HZHA 4ZO4A 1B23P 4E5UA 4TMZA 3A1VA 1VECA 1SVSA 5K8UA 1E9RA 3FKSA 5L3RA 4BZPA 3X1DA 1VKJA 4QKQA 3R9IA 4C0HA 1II9A 3TW8B 3FWYA 3KB1A 4OJKA 2QTFA 3A4LA 2ANBA 2O52A 4MYCA 2B21A 4IHQA 2DFNA 4DCNA 5CB6A 2WWHA 3IQWA 1NI3A 2DWQA 2CVHA 4PQYA 1JI0A 5HTKA 1CJVC 3KB2A 3VR3A 3U3RA 2XTZA 3BH6A 2FJUA 4ZDJA 4D25A 3VQTA 2X2FA 4PZZA 1UM8A 2EVWX 4S2EA 3WNDA 3U4QB 3TGPA 1G8PA 4BEJA 3AM1A 5IRCD 4OK3A 1Z08A 2G0NA 2J0SA 4OKSA 3GFOA 1P75A 3U44B 2FZ4A 1XEXA 1BKDR 4TSFD 2VP5A 2XOKD 2GCNA 2ZRIA 4B73A 2YOHA 3VKHA 3K0EA 1NVVR 1KJWA 4HZUB 1MV5A 2JJ1D 1GNPA 2ZTSA 2XZOA 2VF7A 1HA3A 1RFLA 1IN6A 621PA 5FTNA 2GF9A 1G4AE 1CF4A 1MR3F 3NTUA 1KMHA 3BERA 4BWYA 4JLOA 2IYSA 3K9NA 5JWHA 3ZS8A 2IHBA 3OZXA 2AX4A 2ZAOA 4RCYA 3FB4A 4ZIRB 1G7CA 2GK6A 4LHZA 2VQSA 2GETA 2W2XA 1P9RA 2UVQA 4JT4A 1TQ2A 1I4DD 1D2MA 1VPLA 3C7KA 2XNSA 5KSZA 5JWOA 2VEDA 4P4UA 2BKUA 1QHHA 4XSGA 2ZSBA 4Q01A 4Q9IA 4AYWA 2FWRA 4MA4A 1N6IA 5AWFC 2VIIA 2GK7A 3BOSA 5DLQC 2PZEA 1FTSA 2OV2A 2C5LA 4IW3B 4R98A 3S1AA 2UKDA 4LYHA 1FUKA 5KSPA 1G8HA 5FBVB 1OHHD 2BEKA 1JALA 1MKYA 1S9HA 3P32A 2IWHA 2WJVA 4MITA 4Q1CA 1KSGA 3AF0A 3AVYA 1AZTA 2R8RA 5AJYA 5DI9A 3QEJA 3E2IA 1T8UA 1Z8FA 1IY1A 1E2MA 4XJXA 1T5LA 3AF3A 2FPLA 4Q02A 3QQ5A 5AUPB 2NGRA 3KQHA 2IUSA 1ZCAA 3PITA 4NH0A 1VDZA 2RGNC 4XIGS 3UK6A 5JS7A 3VAAA 1KY2A 5EXPA 2GESA 1KDOA 4A0HA 4A36A 4BASA 2CXXA 2EWWA 2GEVA 2ZROA 2ZRAA 2GA8A 3GD7A 4BECA 3S1AB 3T1VA 2ZUBA 1SQ5A 3QF4A 3KQNA 5JJKA 1DAFA 3BC1A 4UJ5A 4Q1BA 2FGJA 4FXPA 1Q3HA 5FR1A 1NVWQ 2OFWA 3C8UA 1W4CA 4JBWA 4Q66C 2P65A 3I3SR 4RY2A 3LFUA 3Q7PA 4BLTA 1JXOA 4TQAA 1NSTA 2CK3A 1KGDA 2PEZA 1KDTA 3CWZA 3LD9A 1KO4A 4EPXA 4JLVA 4LJ7A 1XU4A 1RW4A 2CDNA 4PC2A 2QM8A 5HZKA 2F9MA 4AKGA 4P33A 1Y63A 3DHWC 4RKFA 2CMKA 1EWRA 2FF7A 1J8YF 4BZXA 4JKIA 1DOAA 1Q57A 1G8GA 3ZQ6A 4KCGA 2WSMA 2HXYA 3CX6A 3MD0A 4GDFA 1OYWA 3B1VA 2CE7A 5AUQA 2CK3D 2R6FA 2P0EA 1WBDA 1GFIA 4X8OA 3QXCA 1E1QD 2CL0X 4HB3A 3EW9A 5KPJA 2FEMA 1G21E 3A4NA 2DFLA 4Q18A 1XTRA 2JIZA 2WJHA 2QAGC 3LQQA 4Q1EA 3CRQA 5L3QA 1G19A 5FBWB 3SS8A 1WE2A 1K6MA 2QMEA 1IOZA 5H8WA 3W5JA 5FTMA 4BLOA 3QSYA 1RE0A 4KO8A 2LWIA 2C77A 4IDHA 3EIEA 1CKEA 4GZMA 2JLRA 1FX0B 2OG2A 4OQMA 2A5DA 4IRUB 3ADCA 1L8QA 2XTMA 1OYYA 4MYHA 1KNQA 3ZZUA 1CXZA 1AKYA 2OBNA 4XVUA 3GLHE 2AKYA 2JCSA 1XEWX 2ZE8A 1JPNA 2V1XA 2JLQA 4B6EA 2FPMA 3QKRB 1XTQA 1KO5A 2QQEA 2Q9CA 1U81A 3A58B 4CEIB 3A1WA 2PH1A 4C0JA 4U7DA 2OXCA 2BDTA 3GFPA 2XXAB 2C9YA 1KI1A 2NZ8A 4EDHA 3ZIAA 1HTWA 3AUXA 1X8LA 2W00A 2P6NA 2WIBA 4NCJA 1JXMA 1NN0A 2AXNA 3GCGA 3CRMA 4XD7A 2QGNA 3AP3A 1YQTA 1KDRA 2RGNA 2QUZA 3AVWA 2ASEA 1IXZA 1PUIA 1E2HA 1SVOA 3K0FB 3MCAA 4D4KA 1Q44A 1N6PA 4URUR 1Q22A 3NHAA 3U4QA 3L0IB 4TYNA 3CF6R 2XOKA 2F43A 4GP6A 5DI3A 4UXHA 3OESA 1J7KA 2XB4A 3KKNA 1ZU4A
chains in the Genus database with same CATH superfamily
2IYOA 3AESB 1T3ZA 1CDEA 4M38A 4PGMA 2GHTA 1GPJA 1H2XA 1I1NA 1UT6A 1GCIA 4FDMA 2CVFA 2MR6A 5FWXB 4CEHA 3GFVA 5MN4A 3Q3GE 4I5EA 4LJSA 3RBXA 1RHUA 1HYGA 4BNFA 5K0SA 3VO2A 1TQ4A 2XMZA 1T1JA 4RKYA 1IG3A 1TZKA 3GXOA 3HABA 4PPGA 1M5UA 3ZE8A 2A9KA 4GW3A 3RV3A 2O8DA 1XD2B 1MF7A 1OFGA 2YC4C 3E48A 2DSNA 3NKFA 4M36A 4UATA 3UMJA 2ZXEA 3VV2A 2P6RA 4E07A 4WK4B 3GFGA 1TCUA 4C6HA 4L9SA 4PIPA 3FYSA 3RODA 1LB1B 2IPMA 4RENA 4TL6A 3K0CC 5G1NA 3RARA 4OOFA 5JW6A 1QGAA 2I71A 3AR6A 3WIUA 4ZI7B 2PY6A 4M0LA 5G1OA 1KYTA 3EYAA 3NWPA 3ZCPA 2D06A 3BTSA 1S01A 1VG8A 1XEFA 4OAOA 3WWPA 5DTRA 5BSEA 1RYBA 2PMKA 3E3LA 2O3RA 3DHEA 1DKOA 3QKSA 4GSYA 4D9HA 1CY6A 1LKZA 4J7CA 5K0FA 2ARKA 3KKQA 1JJIA 2IVZA 1G6OA 5CLQA 4BTVA 1OTHA 2V7QA 4QAJA 4YRAA 1KS9A 3QP9A 2PKWA 1M34E 4R0NA 3I8OA 1UWCA 4MMXB 1DC7A 1TM5E 3VU0A 1RAAA 3DEAA 3DFUA 3A1NA 4HO1X 2GAOA 3WLSA 1ZM2A 3CF2A 4R2JA 1DBPA 5LMCA 3G0GA 2J3MA 3H99A 4LXHA 3WAKA 1ODCA 2Y2VA 5GJBA 5E4YA 2VXBA 5FKJA 2CL7X 3CO0S 2Y0EA 1BMFA 4M37A 4MVWA 3T7KA 1IQ0A 1II8B 4WINA 4KXMA 3K96A 3WOHA 2QA5A 4XWGA 2X2OA 1D1SA 3P71T 3BWMA 4IIEA 3U60B 1O6FA 1X70A 2OLKA 3O3NB 3ZH2A 5A1JA 1CCWA 4ZQCB 1GL3A 5CT5A 5BWBA 3FKJA 3ZJYA 1IBRA 4AY4A 5K0EA 2FOXA 2CE2X 4CIXA 5E1MA 4EPRA 3UHJA 3UB2A 4Z1OA 2ZTMA 6REQB 2VAXA 4IJ5A 4LVUA 3AR8A 2ZFUA 3QUAA 4MGIR 1E6WA 1KK0A 5JCOC 2PK3A 3I76A 1OYVA 1AVTA 1Y33E 3ST7A 3GLTA 4PNEA 3FOZA 1R4NA 1TM3E 1HFJA 3B5IA 3EZ6A 5HNKA 2HSGA 2V65A 5GVSA 3W4IA 3MJ4A 2FSSA 5LXTB 2XF8A 1FFAA 3WK8A 3QOFA 3VZCA 2IHNA 1J99A 4YREA 2QN9A 2JFQA 1L5MA 1PQYA 4YN3A 3RHFA 3LDAA 4DE5A 1E99A 2XV1A 3SN6A 1W46A 3NYWA 4CLOB 1M1NB 3SJUA 1EGVB 1O03A 4PO1A 1A9ZA 1P2UA 1MX9A 2GN4A 2XVAA 3GRFA 1CDDA 3WLJA 4L3WA 4WBNA 5I9NA 2EFCB 4P34A 4QBTA 1P72A 3ZLVA 3D31A 5FI1B 4Z7JA 1KOLA 2W6ZA 3PX2A 4HATA 3TQFA 3E35A 3EFOB 3GL9A 1J0AA 3AUSA 1O97D 3NVKI 3FCUB 2WA1A 1FQKA 1LLQA 4BC1A 4W5OA 3ZU2A 1D03A 4JLDA 2YMPA 5FTKA 4AMYA 1PJRA 4DABA 3DONA 5IAJA 2ZRJA 5E7MA 4F3RA 4GGMX 4Y2GA 5LQSA 1MRZA 2VKTA 4LXQA 1MJ5A 2EXXA 2AMLA 5HSGA 2CZGA 3A6ZA 4DN6A 4D41A 5HOEA 4RDCA 2E85A 4BFTA 1GPYA 1UDCA 4KRGA 3KOUA 1BDMA 3NTVA 3GXBA 5CX1B 4B3FX 1Z4JA 2GZRA 4BNWA 5CA0F 1BCRB 2WWWA 5DLPA 3TSWA 3H0CA 3LDFA 2B8JA 5BSVA 4A0FA 1R7RA 2J9YB 5ERGB 1QTQA 2P0AA 1NKSA 3HZOA 4XUDA 4DM3A 1AKTA 2AGVA 1VL2A 5TXGA 3HR7A 3RRXA 2X8AA 1N8KA 4Z6KA 4RO0A 4Q48A 1U4SA 4D79A 4G0QA 3NEJA 2OSVA 3BK1A 4ZQFA 3JQDA 4EKDA 3THSA 2IHZA 5FOSA 3WYFA 1TTTA 3FAZA 3DDUA 5CLHA 5D5PA 5DN6D 1MEEA 2RBEA 3OJFA 3ZZTA 1ADFA 4OJMX 2XT6A 3OJCA 4ZP1A 4V3BA 4GPTA 4Z4FA 5DXAA 2J3JA 6REQA 5HCNA 3SF8A 1XCLA 2QNIA 3GEGA 2QTWB 2YV5A 4H7IA 4MQFA 3EDRA 3EQ2A 4LXTA 3CJRA 5AJVB 1AH2A 3FWNA 1XXHA 3PS9A 5DYYA 3EPLA 3DP7A 8ADHA 3STHA 3ZEIA 2B8EA 4RAQA 4CN9A 5G0UA 1PGJA 4QBHA 1AK2A 1TX4B 2NVOA 4GRIA 4MWTA 2WJWA 3M3PA 3E82A 4FHCA 3KZNA 4G0MA 1US8B 4IWXA 3A9CA 4I4LA 2LCIA 3ZWPA 4B2PA 1CJCA 2FG6C 4MLZA 4OAQA 3F2VA 3EPJA 3GPBA 4RH0A 3E5RA 1V5FA 3HYRA 5K4GA 5KTRA 3FCAA 3NTRA 1GQ2A 3FE2A 1EU1A 4E88A 5CEJA 2HPVA 4HLNA 3VKFA 3CBGA 5E95A 3WYAA 2CEAA 4HWRA 3GHYA 1GYPA 3AKEA 1UP4A 1AKEA 3STYA 5G0SA 2FFQA 4NU8X 1OFVA 1OVMA 2TMYA 5B1SA 2NM0A 5KQPA 2GEUA 2XITA 3K9WA 1PP4A 3DP9A 2CLDX 3EEOA 1CS4C 1MIOA 1PNOA 1GCAA 2OHFA 4RJJA 1KDYA 4L8GA 2A14A 2XQKA 1TXGA 2Z83A 4G5QA 2Q2WA 4Q9NA 4TWIA 4ENTA 1RXEA 3FN4A 4F38A 1T2NA 4WLFA 1EHCA 4DIMA 2IIPA 1IATA 1F6BA 3S44A 2YIJA 2FPXA 4J4HA 1JMVA 1O6ZA 1UADA 5FRDA 4TMYA 4PO9A 1N92A 2WHQA 3KJEA 2HYDA 1JN0A 2AFRA 1XHEA 2JJ1A 2V6BA 2XUGA 2A3RA 1OJ7A 3CUVA 5KTTA 2F1JA 2ODPA 1WKCA 3GUUA 3RFFA 3ZLTA 3O47A 4HYEA 4CR8A 1P2SA 1GKKA 1U7ZA 3BB3A 5JADA 1U0NA 5B12A 1CHDA 1JI3A 1PZFA 3EDMA 1PLJA 3C3CA 4AM8A 1Y3HA 4N7BA 4UBJA 2P1DA 1RVDA 5SYNA 4PWZA 4DCCA 4DLTA 4OMUA 5FFMA 4BMDA 1UJCA 1QU2A 2FP3A 2DUJA 1UMDB 3AFIA 1EHIA 1LD3A 4R1OA 4AJ9A 1ZIOA 1Q74A 3LBFA 1M67A 2C5SA 5M3BA 5L6LB 4EX7A 3DEHA 4KDEA 4BLPA 1E3DA 4ID3A 4MQ6A 5DLDA 3SHWA 2V0GA 3R20A 1JF8A 4R71A 1W0CA 2YXBA 4Z5XA 4J16A 2C78A 4K2AA 1P6UA 4LDJA 3H2YA 1XQ9A 2GYUA 4MWZA 2VK1A 3TOVA 2VNAA 2J67A 2W2NA 3H5TA 1D07A 3D6UA 1GGVA 1NVXQ 1NRIA 2JFXA 3B7WA 3PWSA 4QAQA 3V6MA 3WGLA 5FYQA 3RLFA 1QO9A 3N58A 2CZCA 2E1RA 4M8IA 1SG0A 1WD5A 3RLIA 1MJGM 1M2VA 4L9AA 4NHOA 4WNCA 3UKOA 1H0RA 1QOZA 7YASA 4MA5A 2VZ8A 1JW9B 1MLDA 4G09A 3L1VA 2I1WA 4EVQA 5FUVA 1DG9A 3A70A 1XJQA 2HGZA 3ECAA 4ILKA 2YWEA 2PIAA 2VSXA 2BY4A 1U2GC 2NXEA 2ZREA 5HJEA 1TOAA 2FSIA 4CLRB 2QJFA 5IS2A 1DDIA 1KR2A 4UMDA 3GFRA 4CDRA 1ZH0A 3HB5X 3GNSA 2JA1A 4M7RA 2HGSA 4F72A 3JQBC 3UMMA 4M98A 4CETA 3SC2A 1N2BA 4C2BA 4MQ4A 1VHQA 4OIMA 4EHNA 1LGYA 3BD7A 3NNSA 5H68A 4C3OB 4EL0A 2WINI 2WV9A 2BR3A 3B3GA 1FUYB 2VUUA 1E0AA 1Z4IA 2FW0A 4RGYA 4RK7A 3R7AA 2G5PA 4HNUA 3WB1A 4TQ9A 1H9CA 4TS4A 3D6TB 1K7YA 5A5EA 5LZ7A 4YP5A 2P6OA 2G70A 3G6KA 1K0FA 2VPWA 3EVBA 3O8CA 4QJ5A 3ZJVA 4F9EA 5GJWC 1U04A 1RWWA 1XVUA 3SZOA 3LNCA 4QDZA 4KDFA 1OXSC 2FKAA 2QLMA 2FN7A 1WF3A 1X8XA 2IH4A 1U8YA 7ADHA 3IDAA 3EMVA 1V8BA 4U6NA 1VBMA 3T3OA 3ANSA 3CUSA 4RF4A 1E2GA 3KU4A 4M60A 3KIPA 3KQVA 4D43A 1TW3A 4H2DA 3QSGA 5JS6A 2F8SA 5K8CA 4WRRA 1P8JA 1AS0A 1G98A 2OCXA 3QWAA 3RTCA 1GNRA 3AQ4A 121PA 3BE4A 3IUQA 3N53A 4XIIA 3ZNOA 3IAM6 2ES4A 2VNHA 4RVGA 4UNIA 3G2OA 4OKIA 5K0ZA 5ED0A 1JHDA 1ZOIA 2RSLA 1B14A 1PK8A 2Q5OA 3PWZA 1XLTA 4JB2A 4EFDA 1LX7A 4QTTB 1N7GA 4PHGA 1W8IA 3BRCA 1DBSA 5CNMA 3EAQA 1NJSA 2RCNA 2I2FA 4RFVA 4XUEA 3TD6A 2Q3BA 5T8KA 5DHPA 4F86A 5JE8A 4PRYA 4EK9A 2L19A 1ITZA 1XNJA 4JLAA 1XZHA 4RK6A 4IFBA 2ZM6B 2C1EA 2JAHA 4D4JA 4URFA 1HM5A 1SQ6A 3UG7A 2QMZA 1WD7A 5CT4A 4OXRA 2W2KA 5CPBA 3BFXA 3LC0A 1NM5C 1UBUS 1A69A 3HO1A 1JIVA 3E9QA 4U3JB 1FUIA 2B1JA 4NFHA 2YNMA 5ESRA 3H5OA 4CF3A 4Z9YA 4BTLA 2NXNA 3OQMA 3OE4A 3B70A 4TSKA 3OKCA 4N41A 5CFMA 5D3QA 1KQFA 3ZHYA 2OFPA 2G40A 3CZPA 4AS2A 1EP2B 3GYBA 4FJ1A 2ZETA 3F9RA 5B58C 1Y6FA 1ZLXA 5CIYA 2OOKA 1BRTA 1HORA 2WQZA 1WDMA 4TXJA 4YMHA 2JHPA 1VFPA 2D7CA 2YWBA 1D2EA 4PHFA 4YA6A 3R7FA 3VZSA 1L7DA 4M22A 3D2AA 3BFVA 4WN9B 3IS3A 5COAA 1H1DA 4DXHA 4ZIRA 3Q6NA 3U44A 1TB4A 3AKCA 5F4ZA 3X1MA 1MFZA 5K3DA 6GPBA 3PSAA 4TUYB 2C2OA 4PZAA 1DINA 5KUTA 1Z15A 4JCOA 2Q1XA 3PUVA 1UEJA 2W2VA 2RC6A 5B1YA 4IXMA 3LA8A 3D2CA 4EUEA 4BWVA 2FETA 5AVVA 1N5JA 3CY6A 3BREA 3OVMA 4O02B 3U62A 1TUBA 1YCGA 3ME5A 2PM8A 3ZWCA 5IKMA 2EQ5A 3EX7C 4LOKA 3X1YA 2IF2A 4M9SA 4MUYA 1CEXA 1MPXA 3CC8A 3KKOA 5C8DA 1AC5A 3BAZA 4RGVA 1KE2A 1WXFA 4N40A 1YAHA 3K5IA 5JZSA 1GNTA 2D8AA 3HA7A 4IJ6A 3OTHA 3R9WA 5CFLA 4K9MA 3ADBA 3C3XA 2K2WA 2V3VA 1CQIB 2PD6A 4JLPA 3E58A 1G5FA 3LUAA 4RJKA 2XKAA 1YVUA 1QRUA 4CF7A 4ZV7A 2ZJ6A 4RVOA 2XECA 4DV4B 5A3QA 1G21B 1XZFA 4HX9A 4GMGA 4PONA 4Z4CA 2V5AA 3RHSA 2B98A 4O2BB 3IIIA 5BT8A 3FNBA 1NW4A 1ZJJA 3VSAA 5KHAA 5A03A 1D2CA 1JHOA 1LC0A 2YJZA 3BMCB 3KEMA 5FH9A 2A59A 1R0LA 1YZTA 2IKSA 3BWYA 4MB6A 4MHTA 2LKDA 3MCUA 1H9AA 3S27A 3ZXUB 2RAFA 1ZK0A 2H52A 2IUEA 3HWSA 2I80A 3LVFO 4RZSA 4ZVQA 2IC5A 3EZ9A 4L9RA 1GKIA 5B36A 2OPBA 4IDCA 2ZIEA 5DU2A 4NJOA 4KDRA 4YR7A 5FNVB 3ICQB 2NOAA 2O5EA 2Q5QA 3ZOKA 1WXXA 3UG6A 3O1HB 2JI8A 4URZR 5L51A 1TT7A 2HMVA 3D6VA 3DZBA 3F8TA 2YVKA 1IQRA 1UC4B 3I34X 5CRIA 1W94A 1Y48E 3H05A 2BBTA 1NRWA 3USZA 4A0QA 3UPTA 3RVJA 3IQZA 4CYMA 3QELB 1UCFA 1O97C 2C5FA 1FMLA 5DXFA 2FQ1A 2YVQA 3L79A 5CIQA 2H51A 5K3BA 2Y77A 3RJZA 2CFIA 3RSLA 5A6VA 1QPZA 1EUYA 3VNVA 4BUCA 4IOLA 3DVLA 4FYHA 3KETA 2JGKA 2PRZA 2ZIGA 2HRRA 1H22A 5EIWA 3F3MA 2ORVA 3HCCA 1YA4A 3IAHA 4I1OA 5TMPA 1US8A 2BFEB 1G20E 4G0OA 1MB2A 2CFSA 4M88A 1RM0A 5ILQA 5U4QA 2Y99A 2JRLA 1JXQA 1YZQA 3ZV4A 4ZDIA 5LQUA 1QHFA 3KR2A 4IH1A 5A5GA 1FXWF 1W8DA 3OLQA 1ZNZA 2FEWB 4ZTZB 3B2NA 1DJNA 2NO6A 1C1DA 4RQAA 3IBTA 2PT7A 2GZAA 1JIQA 5FWNA 1UZUA 3T9DA 3FETA 1EAYA 3PF8A 1VKZA 1VA4A 1XDUA 1ZZEA 3D7MA 4DHEA 2J46A 1JAXA 2C2ZA 2G5TA 4PZLA 4PYNA 3QXXA 5ADVA 4DB2A 5A0VA 1J8MF 1YQGA 3TMAA 1N8SA 3F5SA 4FYYA 2DM6A 4HB0A 4DSUA 2LCFA 2AMVA 3UFBA 2AYZA 4MWGA 4NYJQ 4PAWA 1HQDA 4OP3A 3EGVA 5EJ4A 2EZTA 1SKBA 3M4ZA 3OTOB 2D2FA 2Y92A 5CTAA 1OBFO 1G3UA 2NLOA 4MGKR 1BX3A 1WXWA 4E5MA 1B2LA 1WU7A 4FCCA 1IIRA 1P44A 2Z4SA 1U8ZA 3BWCA 5J4HA 4CG0A 3UJ3X 1LQ2A 1D1PA 4XQCA 3ZLJA 4REMA 3G1UA 3GIWA 3ZY3A 3OZCA 5FR2A 3R0XA 1LDYA 4CT4B 1FEZA 2ZYTX 2QSZA 2BKAA 3C5VA 4K03A 4EEZA 1SUEA 3SZLA 5KNCD 5F98A 4CM8A 1BXGA 2WWRA 3GOQA 1F0KA 3OE1A 1P0QA 2IW1A 2OXTA 1SNYA 5HE9A 2IS4A 1KYVA 5KINB 2GJ8A 2I1VB 2VPZA 5IJXA 4YCNA 4HDKB 3VO9A 1JKMA 2N47A 4DLSA 4MQMA 1HG0A 5H59A 3EC2A 2VT2A 4L85A 5AJHA 3HV0A 3UWOA 1H2WA 1E92A 1F6WA 6ABPA 4UHFA 1PYDA 3EXEB 2AOTA 1V25A 4GXNA 2VJNA 2UYQA 2WUEA 2B83A 2G5GX 5AK3A 3O4RA 2CUTA 1E3JA 4KRYA 4Q3BA 3IDOA 4YBRA 5C7LO 4BQNA 1XLUA 2NSLA 5ICSA 4DS3A 1V11B 4C89A 4NAHA 4P92A 4P5EA 1YXMA 4W5NA 4KZKA 4BAZA 3A3NA 1YFJA 3SYMA 2CY0A 4OK6A 1ORWA 1QYVA 2GBLC 4J0KA 3UHFA 3EBLA 1QKJA 1QQTA 4ZALA 1ICIA 2CV1A 4EFLA 3I64A 4Q39A 1UWKA 3PEEA 3OM9A 4W6ZA 2PO7A 4E09A 3CF4A 4ED9A 2K4MA 4TKVB 3TSZA 4E46A 2QRHA 1W5BA 4H17A 4TOIA 1Q0HA 3WBKA 3NOXA 3W2HA 4MUNA 2W4QA 1SCKA 5F52A 1CY8A 2FSHA 1PT8A 4TTIA 4X8HA 1NBME 4N49A 3R24A 1PJ2A 3FUUA 1X15A 3ZU6A 1M0WA 1RM4A 1PLLA 2PWBA 1QCDA 4HUQB 4Z8XA 1LTKA 2WKRA 3AO0B 3GJQA 2XXBA 3FUWA 3N8IA 4MDEA 1GUFA 5EYPB 4N48A 1GT6A 2NTVA 1PL0A 1QOPB 4M7PA 1SH7A 3STWA 5JTUA 4WFJA 4H7HA 1KAMA 1Z75A 3FPSA 5HTOA 1YF3A 2WM2A 4WJLA 1PJ4A 4JUBA 1JG2A 1U5BA 5FCDA 1E6UA 1M6EX 1QE0A 3IHTA 3E7WA 4ZJPA 4HWPA 2M6KA 3VM6A 1JHQA 3SM9A 1GAJA 1UBCA 3NHBA 5IH7A 2G8NA 2GUWA 5ARCA 2QROA 4N0QA 4BV2A 3L5KA 2QG9A 3PCRB 2ZJOA 4YB8A 5EGSA 5F5NA 2W2TA 1Q77A 2H1HA 4IVQA 2XE8A 3AP1A 4WT7A 5CP8A 3VDXA 5CT9A 3I39X 4RJLA 3WA7A 1SXPA 3C3MA 2OM2A 3W7VA 4MCIA 3EXIB 1FVXA 2IUTA 4R5HA 1JE0A 2ZR7A 2PIDA 4LDNA 1SC1A 5M5BA 4X3OA 5K4AA 2RHLA 2VSQA 1IRXA 2HHHB 3ZE2B 3B1YA 1KK1A 3REOA 2B2NA 2XMRA 1BFDA 4OGFA 3BICA 3H6GA 4L0CA 1NX6A 4FCWA 4NYMQ 4OHUA 3U3JA 3TTYA 4BKUA 3DF7A 4Q3AA 3FYHA 3P5BA 4B83A 3EQ8A 1B1AA 4LIPD 1OFHA 1XDDA 1EXVA 1JEJA 1ULUA 4QJIA 1DRUA 3UWMA 4Y2RA 3KUDA 1UC8A 2E4ZA 1XJWA 2AEFA 3AF4A 3GLRA 3GJ8A 4JHLA 4QNMA 3T5MA 1HZZA 1DRKA 4D5GA 4DG8A 1T2VA 4LG1A 1QR6A 2JGNA 2O0HA 4L5AA 4TXHA 4EJ6A 1U3FA 4G4SO 1XEWY 3AETB 4ZT6A 3FDXA 1YJQA 1V8ZA 2M6LA 3WE7A 1W19A 2BZGA 3FOWA 1ZK3A 4ZVSA 4J7XA 3WYCA 3CNEA 3REFA 1OFUA 3EHEA 2WNIA 1KY5A 1IHOA 4WGFA 3SI7A 4Z9FA 4FWTA 4DSTA 2EJVA 2Q21A 4OQYA 3MIZA 4U2BA 1WCYA 2E9SA 3PGLA 4C7MA 3FTEA 4C0XA 2GEDA 1G0OA 2UYOA 4B75A 3S81A 5C9ZA 4M89A 1K86A 4EB3A 3C3KA 2XWSA 4UTNA 2VRCA 4HMPA 1PT9A 1JEQB 3LF1A 3BBPA 3TRIA 4BLUA 5KO2A 4QTXA 1O08A 2NZUG 2VPIA 2F7SA 1QGYA 4OV6B 1EG7A 1W4LA 1P77A 1YVEI 1YOBA 4PAMA 3SKVA 1RPTA 2VJDA 5CTJA 1XRNA 4PO3X 2M98A 4MW1A 2UXBB 5DHFA 1NBMA 5HKKD 1E32A 4M1ZA 2B4TO 1N2GA 4GFDA 5IVPA 2A5JA 4NCAA 3QHAA 3PFHA 3U7RA 3L4JA 1CYDA 3VZPA 2QP9X 2AG1A 2BEWB 3KUUA 4HQRA 3RWBA 1I30A 3VSDA 3VR0A 2RD2A 5AH0A 2LGJA 5C1IA 3PGXA 4FMDB 4LF5B 3T12A 2J0QA 1V7ZA 2J3IA 3L1JA 4N3CA 2EV9A 3E1KA 3JQGA 1PL8A 1LPPA 3NKVA 2CLSA 3JAWB 2CLCX 4IILA 4P4SA 5FPTA 3VHXB 4WHMA 4V0NA 3VPBA 1XTZA 4FC6A 1NG1A 4V0OA 4Q7KA 1JHZA 1QFJA 2ATVA 3P19A 3Q5EA 3ZK9A 2IDZA 5CDYA 5EUQB 3IJ5A 1M75A 4PAQA 3VR6A 1XZLA 2O2ZA 1SUAA 3FTPA 4Q3CA 4RNDB 1XKXA 4HADA 4G0VA 4MVJH 1RPJA 2QV0A 4KIWA 2VDKB 3PTAA 3GMSA 3NIGB 2Y9MB 3TW4A 4DSZA 1VOTA 3H3JA 3OPVA 4JA0A 3S4YA 1G4UR 2ZT6A 1JGTA 3ORSA 4K9SA 3UKJA 4OY3A 2H54A 3AESA 1HEIA 1U2TA 2EFEB 2H00A 2IYTA 5FADA 4CQLA 4DIEA 1BH6A 4YRGA 5COQA 4XIYA 4HAVA 3OEED 2GHQA 1Z0JA 4AJOA 3BZUA 4HDNA 3OPYB 1UMBB 1R0WA 3JQ9C 2IWRA 4HRAA 4DA7A 2QX7A 2VHTA 3FA2A 3H5LA 3THYA 2R6HA 2E37A 2X9VA 4OQXA 1FNNA 1ULSA 2GHRA 4IGEA 4L3VA 1U5AA 4PFSA 1PL7A 1NHWA 3THWB 4G56A 1JLLA 1TZ2A 4RH1A 3D3QA 2JIZD 1EFRA 2PZKA 4XI9A 3G0HA 2WT8A 5K3SA 2RHCA 4K1LA 5LBIA 2F64A 3BXGA 4J0CA 3R8CA 2JKZA 3DDWA 1NLFA 5AKZA 4YCSA 2OWDA 5K05A 4JXZA 1GNVA 3PX3A 1NBAA 2O7NA 4RQBA 3WLKX 2RI1A 4U2DA 2GCPA 2RGWA 1V7PC 2WUVA 2OCYC 2Q2NA 3Q1KA 4WDRA 3SHOA 1RAIA 5I7AA 3QVVA 5T64A 2C3OA 2Z4RA 5CEEA 2LIPA 3PR3A 2WSIA 3E27A 1NMSA 3ZKWA 5T4HA 4INPA 4CMCA 1RRKA 2NQ8A 2BFWA 2NUAA 1RD4A 3LVBA 2Y1KA 1U2RA 2WMOB 1XYVA 5F12A 4YAIA 2A8YA 2AL7A 1QP4A 3GW8A 5JYEA 1OSNA 3F7MA 3O8LA 4NMHA 2G83A 4M0DA 3ZDQA 4DLYA 1KORA 1T5HX 1KWGA 3OCXA 1PL6A 2FB9A 3IAM1 4KBYA 3FPFA 2HSEA 5HF9A 3RUCA 6ADHA 1E7RA 5E9WA 2CSXA 4KBFA 2D0IA 3FPKA 3BH0A 2IZ7A 3ENKA 2Q2VA 1OYOA 1F4PA 3MMXA 3VOTA 1BDIA 1I4LD 2RHDA 3R3SA 4FMCB 4MVJG 4Q7JB 4EM6A 3WXBA 4JI8B 3WNBA 3V2UA 1AS3A 2KW5A 3MJCA 1BS9A 2DPHA 4DKXA 5KWJA 3MC1A 4WSOA 3C48A 1Z33A 1C4OA 3PENA 2YVAA 2ONJA 2I91A 3H4MA 4IGAA 5D84A 2HOQA 1MQ9A 1XQYA 4E5DA 1JWAB 3HXLA 3I2KA 1KKMA 4F6RA 4H1WA 2GNAA 2WSYB 1DAPA 3ZWNA 3BPSA 3C5EA 4F8YA 1XPOA 1VLMA 2ZI4A 2BMEA 3P0FA 1RQ7A 5AJTA 3RT9A 2VZLA 2WJZB 2GLTA 2P2LA 4TXLA 5HJ5A 5A4JA 3N05A 3HJBA 3W6ZA 5AW0A 5KQRA 3WKCA 3IKJA 4CTNA 2YV1A 5KZMB 3BX1A 1P9LA 4GR5A 1FP4A 2WKQA 2Z95A 3S68A 1H4TA 2WWYA 3ZX4A 2Z5FA 3ORFA 3OOJA 4M9ZA 2I67A 1KFKB 2OYSA 1E5VA 3P9RA 3SHFA 5JO0A 1BFKA 3MWJA 1DP4A 4IDQA 2RKBA 4UZSA 3QEBZ 4RA6A 4LKRA 4KVZA 3OF3A 1WWKA 4II2A 4V03A 5ALOA 5EESA 3I04A 3Q7RA 1A9SA 5FJJA 3AVXA 4J1TC 1H8HA 4FFBB 1YHNA 5AI5A 4AY3A 2FFAA 3B1KA 5D3MB 2EARA 3WJ1A 3JQAB 4R1PA 3TJRA 4CXMA 4P4LA 4Y2JA 1M6WA 2AG5A 1E58A 2QN3A 4RF5A 1GRRA 4ZEWA 3MQ4A 2FPWA 4C6TA 1IE3A 2BFBA 1V9LA 4EGAA 3E7FA 1PJ8A 3ZOZA 1GKUB 4YUZA 2YUTA 4YHBA 4MV6A 1YD7A 3EXIA 3IV9A 4JUCA 1TJPB 4C5CA 5DCLA 2PXCA 1TEVA 2H18A 3HVHA 4IXTA 4N1AA 2Q6IA 2NO5A 3HKCB 1I7DA 2PUVA 3DTTA 4J4BA 4KQWA 4Z0NA 1GOTA 5D1NA 5CB4F 2YRXA 4KH1A 1VHLA 1ZOLA 4NG4A 4NENA 2Q4TA 1I1QB 4XW2A 4YJDA 2ZUTA 2OKGA 4KQXA 4E22A 4FGSA 5DZSA 1G17A 2WTXA 3ORYA 2B7BA 3VVCA 1XELA 2AUTA 3GLFB 4WUVA 4O4HA 2DF8A 3VDQA 1UJ4A 4M4SA 4YEDA 3I5XA 1E0JA 2RGRA 1GG2A 4G0NA 1S96A 2YRWA 4JJFA 4WLNA 5IK2A 2ZXFA 3HKDA 3ZW8A 4PZYA 1GR0A 2X3YA 1ZYUA 4X20A 4YRPA 3DOEA 3WDKA 2JGJA 1PEKE 3H17A 4GPIB 5K2OA 4OU4A 4PLVA 4YMSA 3WKEA 2JKYA 3H86A 4GM4A 2OO3A 1VIDA 5J3JA 3AY7A 5A6SB 1G5TA 1XZKA 2Q9BA 2I6QA 4AY2A 2VAMA 3R4VA 3LUBA 4GP7A 1V2GA 4F5ZA 2YHUA 4YRSA 5IG2A 1PT7A 3G5AA 5FL7A 2JFZA 1WP4A 2PT6A 1AJEA 1E2BA 1DVRA 1QVAA 1KZHA 2RJOA 2LBPA 3B3AA 5I01A 3CG4A 1GPLA 2EZUA 3G0CA 2GARA 3MWEA 2OBYA 2HHLA 2V58A 2JFFA 1VCNA 3BWDD 1BJTA 5BW5A 3J7AC 4R7ZA 3WR5A 1FXUA 4ZJUA 4AG3A 2ECPA 3TL2A 3C6BA 3VHQA 2JATA 2EP8A 3DVSX 1U0LA 3NWBA 1I3NA 1O95C 3D8HA 1UOEA 3QE4A 5C32A 3HGMA 4K6HA 4P32A 4CFYA 4EOGA 2I4RA 3T1TA 2FZVA 2Q27A 3GELA 5M29A 3A04A 1GXSA 2FFRA 3HNOA 1LUAA 4PXSA 3NHUA 3FGNA 3C8ZA 1JEDA 1NXOA 3RU7A 3ZC3A 3BA6A 3ZIDA 1P1BA 4IOKA 2RI0A 3IV7A 3SY8A 4D45A 1UQRA 1U6KA 2XHEA 5J2TA 3I83A 1YFKA 3TVYA 3F3KA 2Z0MA 2IIVA 5CJ2A 3GR6A 2MSKA 1JG4A 2CN1A 5AICA 1GWNA 3A6DA 1E98A 2I9PA 4U6QA 2IH5A 1YQDA 3TG8A 1G3QA 1QO0A 3OZUA 1T24A 4QOFA 1E2LA 4HR7A 1SCAA 3QLVA 4X97A 4EYQA 4FDAA 3ITDA 3HUDA 2ZPUA 1PNVA 2RHWA 3D64A 1GGHA 2VYQA 5ALGA 1TCCA 3L0OA 3LYUA 4IV5A 5LIRA 4IJQA 4RS3A 1UXJA 1WLYA 1PGPA 2WYOA 2C94A 3LRTA 4HDMA 5JXWA 4MULA 3I9JA 3CGGA 5J4KA 2EKBA 4K8OA 4O08A 1X7DA 4EAQA 4I8XA 1XCGB 2GKOA 3GRKA 3R7NA 3K9HA 2AD5A 4JWTA 3U6BA 3PFBA 4EL5A 5JARA 3MYRA 4HYTA 1E89A 1SCUB 1DRWA 3QVSA 5AKJA 1RU3A 4MVCA 3RGWS 3M6IA 4GKAA 3GG2A 1C7FA 3BJEA 2P4QA 4YRLA 5LM3A 4E32A 1NVMB 4CKWA 3HN7A 3PGA1 4G1MB 3SYTA 1SIWA 1W5EA 3B85A 2HDOA 4ER0A 4RWZA 3DL0A 4KB5A 5IDVA 3QVGA 4U1RA 1XD2A 4G0PA 3G88A 3TLGA 4IIXA 1N7JA 3GP8A 3K0CA 1QFZA 3O3CA 1OXXK 2PJDA 3P2YA 4LCBA 4FSHA 4RV5A 1CQIA 5FD8A 1FNCA 1AMOA 5B1DA 4M9RA 2L18A 2FMHA 4QGBA 2N46A 4C5BA 1VPEA 2L17A 3BQMB 2PNJA 2EBWA 4I99A 4DJDC 3D4IA 2JCGA 4FD3A 4PYRA 4QBGB 3VAYA 3UC9A 2PVCA 4CM3A 4CQMA 3PHLA 4F9FA 3NRJA 1KZ6A 2EFHB 5CIWA 3QW4B 2QRJA 1YUNA 1PFKA 3TRHA 2H48A 3L43A 1MQ8B 4FGZA 3PUXA 4ME6A 3W1VA 3R0QA 1E1CB 3T7JA 3W05A 3Q8WA 4FONA 5FBRB 3N3BC 3KV3O 1Z56C 1G7TA 1X8KA 2QTVB 3KEFA 4IXDA 4WOCA 5G3ZA 2I76A 3OQHA 4YQYA 1RHJA 5K51A 4AG6A 1B93A 5ELXA 3K9GA 1VB3A 5JVDA 1GQYA 4F3TA 4P36A 5DH9A 5AVRA 2WQ6A 3F6YA 2BGRA 3O7MA 3WP0A 3PDHA 3I9NA 1E4OA 2JEZA 2VDQB 4GVPA 5JQGA 1GUDA 2HLDD 2ZUVA 4HQLA 3MT7A 5H3CA 5FOWA 1R0BA 4KE6A 4UE6A 3RC8A 3LBNA 2AJDA 2A2ZA 4WQMA 5JMPA 1I1OA 4TLAA 3T9BA 2O2CA 4M9XA 4F5WA 3ILYA 4DA4A 1E3QA 3GGSA 3SX4A 5JATA 1FTQA 3RVQA 5K03A 2OHXA 4PTYA 2P4SA 1KY3A 3IO5A 1N77A 3ITEA 1XEAA 5BQFA 1Z7YA 3TECE 1ZCFA 3N8NA 2Y1LA 3CLTD 4ZGGA 2OCAA 1FFBA 2P6PA 4UPDA 1UPCA 5A4MS 3N2IA 4JR1A 5JC8A 1Y3AA 2EDCA 4KAXA 3MGKA 4CFZA 3RYIB 2AWOA 1PX2A 1JA0A 2Y0BA 4ZO9A 4QUIA 3KJFA 2ZRFA 2ZLBA 4TV8F 5IW8A 4AXXA 1VGRA 1QBGA 3SK0A 1J5EB 1KMMA 4IRMA 2ZI5A 3R6WA 5GM1A 1QE5A 4PTZA 1SOUA 2E4AA 3IOMA 1E1NA 1ZM9A 3LDUA 5IKOA 4D6XA 3DT9A 4QYIA 3E5HA 3O8DA 1VLLA 4OHZA 3WL5A 3FKQA 3VNUA 3A3KA 3BMOA 1T4MA 2H16A 3AJDA 3OZGA 4QO8A 3MSXA 3AIOA 3ED1A 3KC2A 1FYFA 5EP1A 5L7YA 4FR5A 4BKPA 3BHJA 4AZSA 4CG2A 1TU3A 3GEPA 2JFGA 3PLRA 1NI4A 1Q50A 2DWOA 1VJRA 2CXQA 2M6RA 3G2PA 1SXJE 1TE2A 1LF5A 2COKA 4K86A 2UZ3A 3HU1A 4JFRA 5FYDA 2Q7XA 4PBRA 4DEYA 1QK3A 1IYZA 3JVEA 2UDPA 3PCTA 1NLYA 3A6PC 3QRWA 1I4EB 2ATXA 3JQPA 3MAGA 2AIRA 2JL1A 3TTVA 1GFWA 1XROA 2IUYA 4IVPA 3O8RA 3FVRA 3FMPB 1GV1A 4UREA 2DE0X 1BVHA 1GQRA 1MJFA 1XTJA 4LOIA 2G4LA 1G2IA 3MQFA 1RYYA 2VT6A 1IRIA 3A4VA 3F5DA 4KZPA 4CMEC 4KQFA 5HF6A 3C4QA 3Q0TA 4V1CB 4RZ2A 3RTEA 1KSJA 1AQYA 5IYZB 1Y8RB 2PL9A 1W0JA 2WZQA 4MW5A 1W52X 2BCJQ 2LKCA 3EGXB 5CT6A 3HDHA 3U39A 3WLMA 5TRTA 3WXMA 2DUNA 1Z2NX 2QVCA 4JLMA 4XWKA 4V02A 4Q3NA 3VH3A 4DREA 4QBIA 4GOOD 4YMTA 1YK0A 1E0KA 1Q0PA 2DJ5A 4JP2A 3PTZA 4A0GA 3TW6A 1Y7HA 4BO4A 1UWLA 3NM5A 5ESXA 2WR8A 5FX2A 3DXXA 4NFSA 5J43A 3TTXA 2XZTA 4LECA 1YVPA 3DDSA 5AK5A 5I6DA 2QUJA 1DFIA 3CT4A 1JA1A 2QLJA 4XTCS 4H16A 1VE9A 4KXQA 3TQIA 1VSTA 1NR5A 3OMLA 4LRWA 4EI8A 2IYFA 3L6BA 3K5HA 3L0CA 4JC8A 4MWSA 3SOZA 4W5JA 4F4IA 1KHTA 1QYWA 1PVOA 3K35A 1UANA 4DUYB 2X0FA 3BCHA 1A8UA 2VP6A 4R2IA 4BFSA 1JG1A 2W37A 2XRFA 3FJOA 3VX3A 2GM4A 5EQDA 1ECFA 4XM1A 2A9QA 1P17A 1Z16A 2HV9A 3ZWWA 5JI3E 1ETUA 2VQ3A 2XE6A 1BEEA 2BKVA 1QK5A 4YJ2F 2E3JA 3ULKA 3FCYA 4Y9UA 3Q9UA 1NW9B 3U13A 2PPLA 2PUJA 1G1MA