1XTJA

Structure of human uap56 in complex with adp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
379
structure length
374
Chain Sequence
b'SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
molecule tags Gene regulation
source organism Homo sapiens
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
total genus 114
structure length 374
sequence length 379
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA02
2GJ9A 3QBTA 1SVWA 4F91B 4BLTA 3NEYA 4AWXA 2OXRA 1IY1A 2CLCX 3QNUA 4OBEA 3SJCA 1X6VA 3AVOA 3ECCA 1G16A 3RS5A 4RZUA 5IDVA 2JLRA 4LPSA 2VHJA 4RCYA 4HAWA 2BBWA 1Z07A 4BFYA 2D7CA 2A5DA 3EA5A 3B60A 4Q4HB 2R62A 3SBEA 4KFRA 5CB8A 1RW4A 2NQ2C 3MWLA 2WJIA 2EFDB 4Y0VA 1E0JA 2E87A 1PLLA 3AUYA 2RGXA 3THWA 5JHHB 3QSYA 1E9EA 1AZSC 1IM2A 3EZ2A 4B75A 1II8A 2EFHB 1PLJA 2XZOA 2R6DA 2RB4A 2X19A 1F3OA 2Q9CA 4UJ5A 3RRNA 3SHFA 2IL1A 2GHIA 3LLMA 2BM1A 1Q22A 4L5BA 3RRMA 5IT5A 1ZVQA 5HKKD 1SHKA 2ZR0A 4WZAE 3IHLA 4ARZA 4TLDA 4XWOA 5EZ6B 3KXLA 1YZLA 5J4HA 3FHCB 4GI7A 4TMXA 3K9HA 2JASA 4HYYA 4LHYA 3RS0A 4P3YA 3SE0A 5AJYA 2OM2A 5L3QA 2OBMA 1GNQA 2AWOA 1XX6A 4D25A 4GP6A 2IF2A 3KB2A 2D3WA 2A30A 4ESVA 4CEJA 2QU8A 3ZZ0A 2B8TA 2GILA 4G01B 3TSWA 3IUYA 3K70C 3B2EA 2YWFA 4D4MA 1CRPA 2DCUA 2QG6A 3EAQA 2E9SA 4D2IA 1SZPA 2GJKA 4JBYA 3CRMA 3WMGA 4MDFA 3SS8A 1T4GA 3SYKA 2VP2A 4FMDB 4QGHA 1AN0A 1M2OB 3L2OB 1G3UA 2NTYC 2WWGA 3PQCA 4K46A 4OQNA 4US0R 3CNOA 4KAXA 1G3QA 1E9BA 5DYGA 4DUGA 5AUOB 4MGIR 3VR2A 3FKQA 1XTRA 5AUNB 5JZVA 3H86A 4LYHA 4LV6A 4HUTA 2PJRA 3MRSA 3EW9A 1IJFA 2IK8A 1UKEA 1KO5A 5TY0A 2G88A 1Z2AA 3B1YA 4KVAA 3R9XA 5JSZB 3BXZA 4UXJA 4IEIA 5DHFA 3W3AA 5AJVB 4ITRC 4TQAA 2Q9BA 3OZXA 3EPLA 3KTAA 3K09A 3D8BA 1PVOA 2GF9A 2QP4A 2C9YA 1K5DA 1Q57A 2ORIA 5L3SB 1KO7A 4RY2A 5DE3A 4YDHB 1AS0A 3DMDA 4KV9A 1E2JA 3DM9B 4LDJA 1DS6A 1LVGA 4PC3A 2NO0A 4Z8XA 4Q4AA 1OFHA 1CIPA 1G1MA 3G0HA 1XMIA 3BFKA 3D7MA 3KQUA 4ZI3A 2MSDB 1X8LA 2XNDD 4GRAA 3DPUA 3ASYA 3DKPA 2A3RA 3CONA 1H8HA 2OESA 2ZUCA 5EE9A 2PX0A 4MKIA 3T12A 5J4YA 3CUEF 3T15A 4ASUD 1CR4A 3KUCA 2CE2X 4OHWA 2XJ4A 4JJZA 2F7SA 3KKQA 4A82A 4DJTA 4DSUA 4X8LA 5H1YA 2ZUDA 1XDBA 4W7SA 3TVTA 1M34E 4V0KA 2JGNA 4URXR 4Q4LA 3N2IA 4M1MA 1HYQA 2W6JD 5CYPA 1M7HA 5EXTA 5JJIA 3CX8A 1VKJA 2ZITA 4PSAA 1QHYA 1HE8B 3I92A 2XJ9A 4TYYA 1SHZA 1ZD8A 5C1BA 1A2KC 4WW0A 3EXAA 1UKYA 3GMTA 3LWNA 3UK6A 2ECKA 2XAUA 4BLQA 3QEOA 2JATA 2I1QA 1MABB 3KUDA 1J99A 1YVDA 3K0AB 5EXSA 3AM1A 1H65A 4A2QA 1S96A 1YE8A 4PAQA 1XTQA 1J8YF 2AFHE 4LJAA 3FMPB 1DBSA 4DVGA 2CCJA 2VP0A 1KI3A 2FPLA 3OFNA 4LC1A 4X8HA 2A78A 2WV9A 4IOMA 2JLZA 4A2PA 1RRGA 3B85A 1W2HA 3CPEA 3NHAA 3QKUA 1ZW6A 4PQRA 1SVLA 5FPKA 4I1OA 5FTMA 2P6NA 4EPXA 2GA8A 2K5UA 2NG1A 3B78A 3AVPA 2AXPA 4GOKA 4LJ4A 3CR8A 4XJXA 1OLOA 5FTKA 1KJZA 1UFQA 2BBOA 1F5NA 2LCFA 2QL6A 4JYCA 4B76A 4P4SB 3DZDA 5FL7D 2QMEA 4C4PA 4DCUA 1KNXA 3B1WA 2CE7A 3I8XA 4Z51A 2I4IA 1NVWQ 1P2TA 4D82A 2V55B 3EZFA 1E9SA 4PC6A 4PSKA 1YR6A 2C98A 4LHVA 5EUQB 1VYVA 1NG9A 2V7QA 2A5GA 1NBMA 2BEKA 4HLCA 5F3WB 2MMGA 4JLNA 1N6OA 2CLSA 3M1IA 4RFSB 1XWIA 4RSGA 3V4FA 1II9A 2ZRIA 2J41A 4J0QA 1OFIA 1T0JB 3VNUA 3KJGA 4RZ2A 3BRWD 2V3CC 1QVRA 4MYTA 3BAFA 4RD1A 2Q3HA 1ZBDA 4BZQA 1FOEB 1LF5A 5DN6D 1KK2A 3MJHA 2G9NA 1ZJ6A 3FVQA 4LJ7A 3AKEA 2A5JA 4Q4JB 2ZRNA 3CWQA 2ZRFA 2Y8EA 4QJ3A 1RFLA 3VR6A 3GJ4A 5FPHA 1FQJA 3SBDA 3EIHA 1G18A 5DIFA 4Q9KA 4H1UA 2ZI4A 3MG9A 4DIEA 4TL8A 4UNPA 5FUVA 1ZYUA 1CTQA 3RYTC 3C7KA 2IEZA 2C8VA 4Q7KA 1U99A 1KK3A 3IHWA 3U3JA 2XTNA 1E3MA 2RGEA 3CF6R 3AVXA 4D0NA 4BECA 4K8OA 3OFND 2O8CB 4A6XA 3Q7PA 1Y3AA 4PC1A 2BC9A 3EWAA 2JIZA 4NP6A 3W90A 2HUPA 3FFBA 3GQBA 3GP8A 2N46A 1D6JA 4LZZA 1XJCA 2RCNA 2IS4A 4R98A 3MSXA 5DSZA 1T5IA 5JI3E 3I3SR 3GJ5A 4JLAA 2VQSA 4E09A 1PV4A 4DDUA 3LDAA 4NTZA 1SVKA 2QPTA 3DEFA 3THWB 5FUYA 1X3SA 5EXPA 2ZYUX 4FW9A 1KI4A 1R4AA 2ZRBA 3OAAD 2C03A 2CVHA 1E2DA 1KKMA 4QHSA 1GRNA 1PUIA 5KSPA 4BFXA 1J90A 3C15C 2B6HA 2FH5B 3NG1A 5LD2B 1NNEA 1OXUA 2R6FA 4LBVA 4URVR 2FE4A 2R2AA 3CX7A 5DI9A 2G83A 2OILA 4KFTA 3RC8A 1KI6A 2ZR9A 4ZDKA 4V0NA 4A8JB 5IRCD 1OH6A 5E7IA 2JJ8A 4WZ6A 5JJKA 3LBIA 2VP4A 3A58B 1H8EA 3SDZA 2A2ZA 1IXRC 1G8HA 4XVUA 4F4CA 3P4XA 4CW7A 5JSZA 2GESA 2DB3A 1MR3F 2C99A 3VMFA 4AG6A 2W2XA 1GUAA 4DDTA 4PHTA 4L9WA 1OT3A 3D31A 2NMVA 2ZE5A 4IDQA 2E1RA 2ODBA 3VQTA 1ZD1A 4HLDA 2FX3A 1CF4A 1VIYA 2WPDD 3OEEA 2NIPA 4PX9A 4MA4A 1S9HA 2PZEA 3WNCA 2HYIC 3QUSA 2XOKA 4F38A 3PR1A 3NC0C 1JR3E 3FPAA 1Z2CA 1PLKA 3A8TA 2QTVB 1M7GA 2BKUA 2QGNA 4BLRA 1UPTA 621PA 2IC5A 1Q44A 4CEIB 1WXQA 2GCNA 3WP1B 1FPMA 4C0SA 1NMYA 2GEVA 3QJYA 5C2JB 1JR3A 3GLHB 2H92A 1JJVA 4P4TA 3ADKA 3ZDQA 4NHOA 3X1WA 1FX0B 3ADCA 3TAUA 2CMKA 1P9NA 1XXHB 1G7TA 2W83A 4M9ZA 3A1VA 4V0OA 2AXNA 4V0MA 4B33A 2AX4A 2EWVA 3QIAA 4URWR 1L7VC 1K8RA 3AKCA 2NGRA 2A5FA 3QF4B 5KUTA 1M74A 2G6BA 2QSYA 5CK4A 4Y0AA 2QTFA 3IGFA 2EFGA 3GJXC 4MDEA 2PEZA 2IYLD 2ZRLA 1UBCA 2WJVA 2VP9A 3MJRA 3BE4A 2LKCA 3G5UA 3SJBA 1VG1A 3NVAA 3UG7A 3VU9A 1JNYA 4TLCA 2OO7A 3U4QB 3JVUA 4PANA 2ODWA 2BHRA 2G0NA 1DAHA 1NRJB 3IPYA 4PAOA 4NONA 3ZZTA 5DH9A 1JXMA 2GCOA 1ZCAA 2DFTA 2XZPA 2ZU0C 2JAQA 4HSEA 5UKDA 5ANRB 5GVRA 4QJ5A 5CK5A 2F55A 3WHKA 1ZM7A 4JVMA 3CWZA 1KY3A 1JQJC 2WWHA 4B3GA 1KNQA 1COWD 4MH0R 1ZUNB 1QG2A 4TLAA 5HE8A 1EFUA 2GCPA 2MSEB 4P4UA 5AR1A 3W34A 2O8FA 1E0AA 4HLQB 4NYJR 5EJEA 3DO6A 2IWHA 2J87A 2ZAOA 3VHXA 4JLDA 2AR7A 1DADA 3EA0A 1GL6A 2ZE7A 2Q21A 1U98A 3NBYC 3NBZC 1WRBA 4M53A 3KJIA 3S1AA 3WRYC 1WB9A 3QKSA 5DISB 5G53C 5C46F 5FR2A 2JLSA 1E32A 4Q4AB 1E69A 3I1FA 4IHQA 4N3NA 2ORVA 1QRAA 4LHWA 2RGDA 4PHFA 5E7MA 1OB5A 1QHHA 3WHLA 4EFLA 3C5CA 2JCSA 4I4LA 2ZSBA 1YR9A 2F9LA 2QORA 4DEXA 3SU8A 2XTMA 1S8FA 3GJ3A 3QKSB 3TKLA 1N6NA 4TTPA 4KITB 3KQNA 2Q3MA 2CK3A 5KSZA 4AD8A 5JBQA 1ZU4A 2OHFA 3MUFA 3A4LA 4DLTA 3CZQA 3LW7A 3K0SA 2GK6A 1J2JA 2PLFA 1KDRA 2BIFA 4M2LA 2CBZA 2FEMA 2GAAA 1EGAA 1P61B 5JECA 1E2EA 1P75A 4GPTA 1Z47A 4KCGA 3LW8A 5K8TA 2O8BA 3PCRB 3DVLA 4HDOB 1AGRA 4QGFA 2BV3A 2P2LA 5BN3A 3GLIA 5AK0A 5F98A 4JVLA 1GKYA 1VPLA 1Z6TA 4OJQA 4NYIQ 1BYIA 4BZXA 4JVNA 4NYJQ 4IOKA 2QA5A 1HA3A 1XD8A 1UKZA 2IUSA 3ZS9A 4AKEA 4MGZR 1G8GA 1VCOA 4LV8B 5G3ZA 2GRJA 5HR5A 1EXMA 3BOSA 2ZRDA 4YMWA 5EP4A 4MKGA 4BLOA 2A5YB 4LYJA 5AUQA 2ZJAA 1P9RA 4IOLA 4GSYA 4NCIA 1VCMA 2DBYA 1W2GA 2GBLA 1DO0A 1IN4A 1CKEA 2VL7A 2P67A 4HUQA 4KXFB 1LTQA 1Q1EA 2V6IA 1E1QA 2PCLA 2ZS8A 4A0GA 3FMFA 3OIUA 5A4JA 1ZNXA 1VHTA 1E1RD 1ANKA 2IYRA 4HB4A 3TNFA 5GJWC 5DN6A 1Q20A 1GM5A 1G3MA 1CBUA 1XPRA 1RYHA 1VYUA 1ZMXA 4PO9A 4XOIA 4E5UA 2XB4A 4ILEA 4TT3D 2OG2A 4R71A 2UZIR 4JBWA 1LY1A 2BM0A 4LY6A 2REOA 1EX7A 1KHTA 2YWEA 4TYPA 1NMXA 4LJ6A 1XEFA 2GF0A 2OLKA 1DAIA 1U81A 3U2QA 4ERNA 5LPNA 3ZD6A 2RGCA 4BRWA 1T8TA 1UBGA 4BFWA 2VLIA 1ZUIA 3K0CA 1LV7A 3EIEA 2C2HA 4RD2A 2F3RA 5FL7A 1NI3A 3RSOA 2OFXA 4BFZA 5B30A 2YOHA 1JR6A 1N6KA 2QPAA 1DEKA 2CCKA 3CO5A 1SVSA 3OE7D 4O0MA 4GMDA 1NN1A 1G20E 2ORWA 2Z4SA 4KVGA 1W4CA 3PEYA 1XEWY 2DR3A 3QF7A 2WBLC 3PV0A 1WP9A 3B8HA 1RJ9A 1GKUB 5DI3A 3I5YA 1LS1A 2FF7A 2J45A 3QI2A 1VG8A 4FINA 4XH9B 4MKFA 1TUIA 4NCNA 2RMKA 3ND8A 5KPJA 1R5BA 5L8VA 2ONKA 1K5GA 2C5LA 3RDPA 1R0XA 1P62B 1P9WA 3C4JA 4PHHA 1Z0JA 4DZZA 3U44B 3T1VA 3E2IA 2SHKA 1SXJC 2IXGA 3TQCA 2YKGA 4M21A 4D4JA 3EC1A 1IJEA 4IVPA 1GDDA 4JMPA 1M8PA 4BUJA 5BN5A 5KDOA 1MO5A 2BOVA 2OFWA 1HT1E 4IVRA 4PZYA 3WYAA 5CB6A 1B23P 1SXJD 2ZUBA 5CM8B 1CXZA 1R8SA 4OQMA 3V4RA 1XP8A 3F0TA 2OCPA 2OZEA 1ESNA 2CJWB 2WJJA 2XITA 2O8EA 3T34A 4C2UA 2PT7A 4X8OA 2WTUA 2QRZA 2ASEA 4NU0A 2DWPA 3AF3A 2FFAA 3PFIA 4F93B 1KO4A 2IWRA 1OH7A 1FUUA 1N25A 1AGPA 4HATA 4BEBA 3GLFB 1RE0A 5CYOA 4DSNA 2GZHA 2OCYC 4F4JA 1FP6A 3L0PA 4F4IA 1KKLA 2ZRJA 1FUKA 4A0HA 3R7WB 3I61A 2VEDA 2V54A 4A4DA 2KBFA 3MCAA 1OIVA 1EFHA 3QF4A 3U3RA 3WXMA 5KDLA 2P6RA 2WAXA 2OT3B 4WXPA 3PVSA 3V9PA 2G1KA 2ZSAA 4WOPA 1IONA 4Z1MD 4QM6A 3QXCA 2ZETA 2ZJZA 1X1RA 3PG5A 3TBKA 3TW8B 3WNBA 3K0AA 2H5EA 3ADBA 2VIIA 1KI7A 1QG4A 4Z54A 2WWXA 4P32A 3Q5DA 1I4LD 4TMWA 3T06B 3N70A 5EE3A 4ASUA 2QMHA 2WJGA 4S35A 3SR0A 4AURA 3HPRA 5CLLA 3R20A 4MUAA 3AP1A 5FFMA 1HQCA 2EVWX 1XMVA 5G40A 4DB2A 1EG7A 3ETLA 4ZKDA 4D80A 4FMDF 1E4VA 3ICQB 1G6HA 1W5TA 2QM8A 4B44A 2KWIA 1FMJA 5HCIA 2FFBA 4YMTA 2XX3A 1JXOA 2QMUA 1KDOA 1P3JA 2DWOA 4OK6A 1E9FA 5E7JA 2PT5A 4EJSA 4Q1FA 1C4OA 3QG1A 3ND9A 1AQUA 2ZI7A 2GVDC 4M8NE 5IHPA 5KOYA 1A5TA 3RABA 1PUJA 2CL6X 3QKRB 3NH9A 2PEYA 5CDFE 2PMKA 3Q72A 1S4QA 2VHUA 3K9GA 3U7FB 4G3XA 4BZPA 4C0JA 1D8TA 2ZYVX 3UMSA 4BPBA 3FWYA 2QAGA 2ODNA 3DL0A 2ZJ2A 5JLJA 4TYWA 5G3YA 1TEXA 2V1XA 3SEAA 3DOFA 2JJ1A 5DLQC 4NCJA 3DMNA 4OI1A 1XD2A 1UBFA 3CNLA 3ZH9B 1BH2A 5FTNA 5HZHA 1U90A 2C9CA 5JCPA 4FCTA 4W5JA 2JJ2D 4AI6A 2F1RA 1Z0IA 1ZD9A 1NY5A 1W4RA 4M1TA 1O3YA 4EPTA 1G8FA 4O25A 3PENA 4NL4H 2FEOA 3CW2A 3GFTA 1G41A 1D5CA 4BEJA 2VTKA 1RRFA 3A1SA 4RZXA 4LJ5A 1N6HA 3A4MA 3I72A 1E96A 4Q7JB 1JQLB 4C0BA 4KU4A 1GNPA 2O0JA 1TF7A 3VR3A 2W6IA 3H2YA 1NN5A 4F92B 5JS7A 1KYIA 2HT1A 4DLRA 2WWFA 1XBTA 1JR3D 1OFUX 3SJZA 2O0HA 4FIDA 3B1ZA 3THYB 2CHQA 3A6PC 2GEUA 2NO1A 2Z0MA 1Q1BA 2W6ID 1AA9A 2JA1A 2Q3FA 4NYIR 1NSTA 2J7PD 4GFDA 2FSHA 2OCAA 1W0KA 3Q8XB 1D2NA 1ZC4A 2W6JA 1S3SA 3THXA 2Z6VA 2BJWA 2ZRKA 1NBME 3BGWA 4TT3A 4NBSA 4OK3A 1YZKA 2ZRAA 3HJNA 4AYTA 1YHNA 1XJQA 3LLUA 1FQKA 1E6CA 5K8LA 3TUJC 3W8NA 3QG5A 1BIFA 2PH1A 2CNWD 3C8UA 3GPLA 1O87A 1KI1A 4MGYR 1Z63A 3KJHA 4QKQA 3GLHE 4HAVA 4KFSA 2FDCA 4V0LA 4CIDA 4F7WA 3ZLJA 4TZ6A 3HU1A 3LAWA 1SKQA 2GXQA 1XCGB 5JHGB 3EPJA 2O52A 3RRYA 1KOFA 1Z3IX 2OE2A 1L2TA 3CRRA 1SQ5A 2NO6A 3ICEA 1DVRA 4RFVA 1IN8A 1WBDA 4AY2A 3B1VA 2WKRA 3I32A 1AKYA 3QXXA 5E4FA 4JKIA 1Z0DA 1CRQA 2CXXA 2CEAA 5IK2A 3I73A 4HB2A 2DFKB 2GWHA 3IEUA 1OH8A 1E1RA 4GZLA 3G82C 2Q6TA 4RD6A 1QHGA 1GILA 4S2EA 1SXJE 5DHAA 2FPKA 4EKDA 3C41J 3K0EA 4M9SA 1WMSA 2R6GA 1R2QA 3QE0A 1KZGB 4PC2A 5TDHA 3TSZA 2CLDX 3QVVA 3RNLA 5JEEA 3U4QA 4B3DA 3IKJA 4XWKA 4EFMA 1XFAA 2JLQA 1CJTC 2BDTA 3LO5A 2KBEA 4RJLA 3T61A 2VH5R 4TYNA 2FFHA 5CLQA 2QAJA 3OEED 1KAGA 3SQXA 3U6BA 4CEIA 1R0WA 1YJ5A 2YOFA 3WNDA 4B73A 5LBIA 4EPVA 1G21E 2F43B 3ZJYA 2J1LA 1QVAA 2PCJA 4HLUA 4Z1MA 5E95A 4A15A 1W36C 1G6OA 3CR7A 1PJRA 4IJMA 1DTSA 3A4NA 3AVVA 2WJYA 3KQKA 4TLBA 5KTYA 1DAEA 4KHZA 1J70A 3AVQA 4A36A 2G0TA 1MABA 3LNCA 5FTLA 3BB3A 1BS1A 3HDTA 4HEJA 2J7KA 2UVQA 4QOSA 4W5WA 2HXYA 3RWOA 4UNSA 3HU3A 3U3MA 4JT2A 4LHZA 4ZIRA 1XD2B 4OI2A 2LWIA 2F1HA 1AZTA 3ZVRA 5JWOA 5B58C 3GLGA 2GZAA 3I62A 3SZRA 2QE7A 1R8QA 1GSIA 1J7KA 3RC3A 4A8JA 4MYUA 4G5RA 5FBRB 1XTJA 4C30A 3IDQA 4O2RA 4HI0E 4RD0A 5KU1A 5J40A 4QG7A 2B92A 3A1WA 3IBYA 5J4LA 3IIKA 1VTKA 1EESA 4JLKA 4MYCA 1NKTA 4ZDJA 4O2LA 4LYFA 4MRRA 3AF0A 2FNAA 3KTAB 3RHFA 1AJEA 3QOFA 1OYWA 4TMKA 2YVUA 2YJTD 3NBXX 2HYDA 3GLIB 1E9CA 2AL7A 1IBRA 4YXWD 2TMKA 2QZ4A 2XGJA 5KNDA 1KY2A 4BLSA 2IHYA 3UG6A 1BO6A 2RGAA 5ELXA 2XOKD 3AH8A 3SJAA 3ZQ6A 1N0VC 1OXXK 5KHOC 121PA 1S0UA 2C9OA 3D6TB 3PUYA 4A0RA 4KO8A 2J5XA 1ETUA 2OAP1 1GFIA 3OIVA 1R6BX 1RRPA 1XNJA 1DELA 1US8A 5J4VA 2GJ8A 4ON9A 4OQLA 1GP2A 4C7OB 2R65A 3R7WA 2CJWA 3C14C 2GJAA 1X1SA 1HT2E 1E2KA 3GEEA 3PUWA 4FMCB 1XD9A 3LXRA 4ZKEA 5AJZA 1YZNA 3AVUA 1OSNA 4B2IA 2EFCB 1UAAA 4HDQB 2YC2C 3EC2A 3ZS8A 4C0KA 1F2UB 3RS3A 1Z6GA 4IRUB 3M6AA 1KGDA 4RVCA 1E2GA 3KXKA 4KJZA 1DOAA 1W5SA 4CEHB 3A1TA 2P0EA 2WSMA 4Q5IA 5JRJA 2V4ZA 3D3QA 4ZCMA 4C0AC 4CEJB 1LF0A 5LB4A 4WVFA 1XF9A 2DFLA 2YOGA 4JZKA 2BKEA 1RZ3A 3PUZA 4IFEA 1UADA 4DCNA 2W0MA 2WMOB 1N5KA 3IIMA 4ZDWA 2NPIA 1CS4C 4I99A 1H8HD 3ZVMA 1P7CA 4CDGA 4KI0A 1GG2A 4AC9A 3RSLA 1XB2A 2X77A 4YMSA 1W0JD 2H8KA 1EFTA 2QY9A 1CR0A 2EQBA 3T5DA 2YYZA 1L8QA 2QPOA 3DHWC 5FOUA 2FG5A 1E4YA 4TQ9A 4TLEA 4E22A 3A36A 4OHXA 821PA 3AP2A 4MUBA 3I5XA 3ADDA 2OBLA 4MQBA 1MV5A 4G5SA 1ZRHA 2IXEA 4PHGA 1ZM4A 3H0KA 1XTKA 3HYRA 4R9UC 5BQ5A 4UJ3A 1XTSA 3AVYA 1F60A 1A82A 4UNQA 1Z83A 3CRVA 1G5PA 5AWFC 3VKGA 5JEDA 3VKWA 2J59A 3AF4A 1TQ4A 5KNCA 5CIWA 3OHMA 1ZIOA 3BC1A 2B7CA 3L8YA 3ZQJA 2F9MA 5C18A 2F6RA 1AM4D 1XMJA 4GBMA 1FNMA 1KMQA 4BASA 5SZJA 3W6NA 3RAPR 1NJGA 5KPDA 1IHUA 4JSTA 4CEHA 4G0NA 1OF1A 3QY0A 1V43A 3THOA 3DKVA 3EZ6A 4L9SA 1W46A 1EX6A 3B13B 3W5JA 5DI3B 4FWTA 3RS7A 2XNSA 4DEYA 2PLRA 3VHLB 4MRNA 3ZIAA 3OAAA 4D81A 2JDIA 2B8WA 4JIMA 1M6NA 3VFDA 3NBFA 1NVVQ 1TF5A 2GDJA 4C9BA 2YHSA 4XIGS 2IW3A 3I4LA 3TMKA 4ZIRB 1JB1A 2BVNA 3BJIC 4K81B 1XEXA 2VF7A 3BIFA 3LD9A 4LHXA 2IS1A 3T1TA 1NF3A 4JL5A 4QRHA 3LV8A 3UWOA 3PIRA 3HYTA 2ZJBA 5E3HA 2ZJ5A 2J0UA 1KSJA 1YR8A 2D2FA 3IQWA 2HF9A 1SVOA 4LJ8A 1NSFA 1GTVA 1UDXA 3CH5A 3QEJA 5FPYA 1SXJA 1FFHA 4LOAA 4Q1EA 4B74A 1NVXQ 1U8ZA 3VU9B 1LW7A 1JEDA 4V02A 1QHIA 3K70D 3W5IA 1NLFA 3IO5A 4Q47A 1QHXA 2V7QD 4CT5A 3B7GA 3GJ0A 4JLVA 4KFUA 3KXIA 1BMFD 1E2LA 1E1QD 4TSFA 1XCPA 1Q0UA 4PPQA 5IF9A 1EFRD 1TUEA 4TYQA 5LD2C 2RKOA 2ANBA 4EQ6A 2XSZA 4V0ME 4ACAA 3JVVA 5FH9A 2GXSA 2WKPA 2C77A 2ZSEA 2ZS9A 3EPKA 5HZKA 1XJ0A 4HAUA 2C95A 3DDCA 4M22A 1UJ2A 2J0UB 1NG1A 3EZ7A 4DLYA 2Z4RA 1G5TA 5BXQC 2O8CA 1DAMA 1ELOA 5EXXA 1DAKA 5FI1B 1OIWA 4NDZA 3FKSA 2OSBA 2WSSA 1YQTA 4RZ3A 1W7AA 4O3MA 1NBMD 5J47A 3VNVA 4U7DA 1OB2A 4DLXA 4Q1AA 4ACBA 1Z0AA 1IXZA 3VTKA 4IKEA 2YNMA 2ZEJA 2IYWA 1T9HA 2WAYA 3L0IB 3X1YA 1OH5A 2OCBA 3F3YA 4W9MC 1K6MA 1F6BA 3H84A 4RKFA 5CIQA 1GL7A 3TUZC 3K70B 1G3IA 4ZDIA 4BFVA 1YR7A 3NH6A 3WBJA 3TRFA 4HLUC 1WBBA 4Q01A 4RCZA 2D74A 3F8TA 1G17A 4JT4A 2ZI6A 4MRPA 1TPZA 4BRUA 4TMVA 2FV8A 3LQRA 4UNNA 5CJ2A 4RFSA 2C04A 4IFBA 4Q48A 2BBTA 1NLZA 2PBRA 2GJSA 4LJ9A 5L3VA 2ZU6A 3CZPA 1TQ6A 4XWAA 3KL4A 3HWSA 4A9AA 4CYMA 3KQHA 3AVWA 1Z0KA 4OYHA 1NKSA 2MMCA 3X1XA 3QPVA 1EWRA 3K1JA 2GCOB 4Q9HA 3VR5A 3WY9A 4LK2A 3K0FA 1BMFA 1SKYE 4URYR 4NYMR 2H57A 2QBYB 4FWIB 1KSFX 4HZIA 2JIZD 3BWDD 4B35A 2G77B 3CBQA 3Q7QA 2OEPA 4PPNA 2BEJA 2IUUA 3RVBA 2I3BA 2WPDA 4DUGD 3KB1A 4I81A 1YZUA 4LX0A 3DM5A 4Q02A 3U61B 4QBHA 1E2MA 3IEVA 1F48A 1I2MA 1OIXA 4KYUA 2ZYTX 5B57C 721PA 4YC7A 4JL6A 5BYJA 1N3BA 1AKEA 2BCJQ 4H1VA 1P73A 5HPYB 1XTIA 5GADl 1P2UA 4H9GA 1SVIA 2C78A 1Q3HA 1TU4A 2HCJB 2CL0X 4D0GA 1E2HA 3CX6A 1N6LA 3BFVA 2KB0A 4M1KA 1NIJA 2BMEA 3FFAA 1MKYA 1IAQA 3CPHA 4PSVA 5EUMA 3CKLA 2WIBA 4GOJA 1KJYA 1Z0FA 2YV5A 2HT6A 3AKDA 1ZC3A 1KDPA 2I1VB 4LCBA 2LKDA 2QT1A 3B5JA 2IBMA 2J3EA 2X2EA 3GLFA 4DSOA 1LB1B 3SFZA 3WRXC 1ZM2A 2QRNA 2VSXA 3B9QA 4EUNA 4M1OA 1FL9A 3X2SA 1KI2A 2PL3A 3HPQA 5DGXA 2OV2A 1RC8A 4PR0A 1FTNA 1W4AA 3OF5A 1XEXB 3TR5A 1YKSA 2NO9A 5CITA 1D9XA 2AD5A 4QBIA 1S1CA 2QUZA 3GLFE 2FU5C 3BBPA 5TMPA 4QL3A 4JLPA 2IYYA 2ONJA 1FP7A 2OLJA 1ZINA 1DG1G 2GVZC 4EPRA 3IIJA 4IEEA 3U44A 2VSOA 4PFSA 3MWYW 4L16A 4PXAA 4TMTA 3QENA 1GKIA 2R44A 3LVRE 4JS0A 2PZGA 2ZANA 4R2IA 1N5JA 1Z6XA 1N6RA 2PZFA 2ODEA 2AFIE 2DHRA 5EP1A 4NCKA 2A7QA 3E1SA 2H17A 2QGZA 1E2FA 3MWKA 4G5GA 3U3OA 3K09C 2P3SA 2WMNB 4OKSA 4B3BA 3OEHD 3HR8A 5L3SA 1OKKA 1MO3A 1COWA 4BLPA 1I4TD 2R9VA 1NIPA 1Q12A 4NKRA 5L3QB 4HZUA 2VHCA 4OK5A 1NP6A 5TB5A 1W49A 3AUXA 1ZUHA 2WOOA 4ZO4A 1IOZA 3VR4A 2ERXA 2FGJA 3T5GA 3DZ8A 1WQ1R 4BWYA 2QAGC 2MSCB 4W5HA 4MGKR 1QHHB 2JEOA 3TLXA 3B6EA 3FHTA 5AUPB 1YRBA 1FMLA 1U94A 3GJ6A 3T1OA 2P5SA 3SOPA 3GCGA 3ZYCA 3Q85A 2HF8A 2ATXA 3UKDA 5J5CA 1HY3A 1FW6A 4N0EA 1SXJB 3TE6A 5FUXA 3NDPA 3PUXA 4TQUS 1T8UA 2QENA 4KODA 5KO2A 2CCGA 2F1JA 3R8CA 4UXIA 5JCZA 2W0SA 4Q18A 3GD7A 5DYIA 2O0KA 5TV2A 4EIWA 2A9KA 4V03A 1TADA 5CJPA 1Q1ZA 4LRWA 2R6AA 1GVNB 4DSTA 4B48A 1XXHE 3QQ5A 3BH7A 1JI0A 4GMXA 4UQOA 3IILA 1CJMA 1MO6A 3FDIA 2IXFA 3R9WA 2EYQA 4UXHA 5FOWA 1JPJA 2ERYA 1MOZA 3FB4A 2BCGY 1MRSA 1R5NA 5P21A 3BD9A 1W47A 2FPMA 2GBLC 4HDCA 2JLXA 3M0EA 4AYXA 3ZVNA 4FI3C 1GZSA 2ZPTX 2ZS7A 4US1R 2IYTA 4QBGB 1T3LA 1QHSA 2C96A 2HDNB 5CDFA 2ZRMA 4M9XA 4HAZA 1WF3A 3B82A 4EPYA 1RJ9B 5SZKB 3WMEA 3U6KA 1G7RA 1N5LA 1T6NA 2QP9X 4JBXA 3SC3A 2RGGA 2ZRHA 3W8RA 4YXWA 1NVUQ 1RPZA 1XU4A 3LH5A 2IEYA 1Q1QA 2XXAB 3W6PA 1CLUA 3KQLA 5FBWB 5F9HA 5FBLB 3S1AB 2FSIA 3CF2A 4D0LB 3X1DA 3ASZA 4D4LA 3MMPA 1DPFA 1UEJA 1WE2A 2NOAA 3AV0B 5JFGA 4Q7LA 3QVUA 3TJZA 1G5RA 1KO8A 2WICA 1AK2A 1G9XA 2XEXA 4DKXA 2D4HA 2V6JA 1UEIA 2ZVQX 4A2WA 4BFUA 4XTCS 3L0SA 4OQFA 1G7CA 4P33A 3H1TA 3UMFA 5L3RA 4MYHA 5BYKA 1QDEA 3U5ZB 1KJWA 4KBGA 4P4SA 1IXSB 4PQFA 1S9DA 1I2DA 4UNRA 2HJGA 3FE2A 3GLIE 4P31A 1ZAKA 2IYSA 2NPFA 1PZNA 4EPWA 1ZNWA 1YZQA 1JALA 1UF9A 4B2PA 5GJBA 1R0ZA 2IYZA 1OHHA 4PC7A 2WOJA 4NMMA 2AKYA 5EQTA 3PEUA 2IYXA 4RD4A 1XPUA 2XXAA 2EFEB 1DG3A 4QBFA 1CR1A 2HCBA 4PO1A 1YZTA 2IYUA 3T1QA 2DFNA 4LPKA 3QXHA 4TZ0A 1JAHA 2ZIAA 4GL2A 1E2NA 4DXAA 5K8UA 1GRQA 2AN9A 3ZZUA 3PEWA 4IDHA 3AB3A 3LBNA 3L8ZA 1KI9A 3BERA 3O8CA 3THXB 1E98A 5H8WA 4C0HA 1OXSC 3AGQA 1ZM3A 3KFXA 5J4KA 2O8BB 5FUWA 1G8PA 2BWJA 4M9QA 3LVQE 1A2BA 4TTRA 1G4UR 2QEQA 2AHOA 4Q00A 1GRRA 2O8DA 1XCMA 3W9YA 3SNHA 2JJ1D 1VCNA 1D2MA 1N5IA 4TSFD 5C4GB 1S2MA 2RAPA 2YWGA 2R8RA 3L0OA 3EPHA 2IHBA 3NKVA 2VP5A 2QROA 2XNDA 5FOSA 3BB1A 1CJUC 4TMZA 4C0QC 1E79D 1VMAA 2ZI3A 1AQYA 1MO4A 3CIOA 1G4AE 3UWKA 1L4YA 3EASA 1GWNA 3LXXA 2RGNC 1HURA 1HTWA 4PPFA 4PQYA 1R5OA 2CHGA 4I1SA 4M1WA 5TVKA 1Z6AA 4G5QA 4LBYA 1IN7A 5FOXA 4LV5B 2X2FA 2ANCA 2VYFA 5A5GA 1DAFA 2ZR7A 2D7DA 4Q9IA 5JI2E 1ZM9A 3UATA 3K9NA 3ZD7A 1A7JA 5JWRA 1W36D 4NE2A 3LY5A 3M4YA 3IBGA 1SKYB 3NDBB 1Z29A 1GL9B 4LBWA 4Q19A 3PITA 1ESMA 3B9PA 4OI4A 1IY0A 4NCHA 4OL0A 2OFOA 2IYVA 3WP0A 2RGNA 4Q7MB 3AKYA 4PTLA 3HP1A 5AJWA 1E94E 1A1VA 4I1UA 4DCVA 4YLGA 2IS2A 1ONBA 4C3ZA 1T91A 4EFNA 4ESHA 5K8IA 1X86B 4DB4A 3OIWA 4DLUA 1FZQA 2WHXA 4JYBA 2QT0A 1OKKD 2YWHA 4JSYA 4MRVA 1VYTA 3TR0A 2ZE6A 5FOVA 1OJLA 3IQXA 3VAAA 4II7A 1EFCA 4C7OA 2QMOA 1NVVR 3KJEA 3LX8A 4DLVA 1GOTA 4E03A 3OIYA 4BFSA 1F2TB 3HR7A 1W0JA 5GJCA 4PZZA 1Q21A 5HTKA 3OE7A 3MGCA 5H68A 4I1VA 4HAYA 4IXNA 1NL3A 2UZ3A 1TNDA 2AK2A 2IUTA 5FI0B 8OHMA 2F3TA 4JLJA 4E07A 1OXTA 1ZU5A 3KKPA 4B34A 1G291 3PEVA 3LFUA 4XSHA 2QSZA 5BW8A 3U60B 4TN1A 3A1UA 1FTSA 3MLEA 1JEEA 4NZYA 5HE9A 2GEDA 3FMIA 4C0LA 4DCTA 5KDDA 2GK7A 1AIPA 2WIAA 2J0VA 3UIEA 2FA9A 2DWQA 1L4UA 3BFXA 1NN0A 1IQPA 2BMFA 5G41A 4R2HA 3IPXA 2AD1A 2HLDD 5SZIA 2OAQ1 2UKDA 2AKAB 4KLZA 4OHZA 1R0YA 1XEWX 2QP3A 3ONWA 1B0UA 1P2SA 1N0UA 1OXVA 1SULA 1UKVY 2JJ2A 3VKHA 4A1FA 3QKTA 2V1UA 1AS2A 1TF2A 4KSBA 1XMSA 4B3FX 1XXHA 1C1YA 5GJVC 3MAAC 1F2TA 3UMRA 3V00A 2HEIA 3DOEA 1DAGA 1P60A 5JS8A 3GFPA 1W36B 3SHWA 3PXGA 3KKOA 4HAXA 4FCWA 3RWMB 2WVJA 1Z06A 4ARZB 3FOZA 2IYQA 1TQDA 3NXSA 1VHLA 2VO1A 1OW3B 1DARA 4DLZA 5JMTA 4JJKA 1E2QA 1II8B 2REBA 2GKSA 4QNMA 1T5LA 4LC0A 4L8GA 3RRZA 3RLFA 2VF8A 4LWZA 3P4YA 1VECA 4GOXA 4Q9LA 2WWYA 2GXAA 3UPUA 2GNOA 1KK0A 4QGGA 4YMUA 1YRAA 2ZE8A 1KTVA 1W48A 1KIMA 2QNRA 4HUQB 2XSZD 1G64A 1IN5A 2CL7X 2PJZA 4B6FA 1ODFA 2BMJA 3BORA 1D9ZA 1Z08A 1TL7C 1HE1C 2FN4A 4C2TA 2O8DB 5EP2A 5M04A 2RH5A 1T3SA 2BJVA 4RKEA 4QJ4A 3SI7A 3GJ8A 1QF9A 2B7BA 2BBSA 1BOFA 2NO7A 4GZMA 4TL7A 2N1BA 4WXRA 4B71A 3GLGB 5KNBA 2QQEA 4QFMA 4DCSA 4DDVA 3CNNA 3CRQA 4N1AA 3EZ9A 4CGZA 2QTHA 2DY1A 2QAGB 4LSGA 1OFTA 4B3XA 1U9IC 4CVNA 5IK2D 3H4MA 4G1UC 2D2EA 3WYGA 1R10A 3JZAA 3LRPA 4EAQA 4B32A 6Q21A 4L4UA 1II0A 3TGPA 1XZQA 2WJHA 2O8FB 2EYUA 1M7BA 2VP6A 3CH4B 2W58A 2WM9B 3TSOA 1OHHD 2HV8A 2Z83A 3VX3A 2RHDA 2EWWA 4FCVA 3ZGXA 4A92A 4DRZA 2QBYA 1JJ7A 3LBHA 2J0QA 2HJVA 2F43A 5TXGA 3AF1A 3NIBA 1NY6A 1G3RA 1IN6A 4XTRA 4LUCA 3MFYA 4MKHA 4X8MA 1N6IA 4AKGA 1CP2A 3RANA 2JLUA 2VRWA 4R7ZA 3SFVA 4AIIA 4CZ2A 2QI9C 2CVFA 2ZJ8A 1KSHA 4DT1A 4DLSA 3TW4A 3I8SA 1YZGA 2CK3D 2EU8A 1D2EA 3JZMA 5SZHB 3TVDA 4DHEA 1HQYE 4Q21A 1TQ2A 1U8AA 1A4RA 1U2RA 1TTTA 1W0KD 2ZI5A 4MITA 2DYKA 2FFQA 2FSGA 2ZM5A 3REGA 1X8KA 3IO3A 3GJ7A 4URZR 5KYKA 4NH0A 3FYHA 1FNNA 4GDFA 2J0SA 1NN3A 5FL3A 3R9IA 3U7GA 4DT1B 4FN5A 1WDTA 2VHQA 3LX5A 1SGWA 4G5OA 2REXB 2CNWA 2H1LA 5CM9C 3R8FA 2ZROA 2ZSFA 2YC4C 3GLHA 3TH5A 4UKDA 4LJYA 1QZXA 3FKSD 3N5CA 3L82B 1N6PA 3Q3JB 1Z22A 1VG0B 3FHOA 1XZPA 4POAA 5KSOA 1E0KA 4FMCF 2KJQA 3KFVA 4IW3B 4IXMA 1KZ7B 3MWJA 4XD7A 1S1MA 2QE7D 3QBVA 2IF0A 3C16C 5HCNA 3KDSE 3CM0A 4QXAA 2ZXUA 4TWZA 4A6PA 3O47A 4CF7A 1VG9B 2J9RA 3QPUA 1JPNA 3QXSA 4U5XA 1JBKA 3O8DA 2P65A 2HXSA 3TUIC 5LB2A 4WIAA 2ZREA 3PUVA 2OBNA 3FMOB 4IVQA 4M0LA 3F5FA 3KX2A 5LDDC 2JLVA 1NMZA 4PAMA 1KAOA 1T0HB 1U8YA 4LI0A 5DNYB 2ZVPX 1MRNA 5EE1A 3KKNA 1HUQA 4QC2A 1U0LA 4D26A 2JDID 1T3HA 2WZQA 2FOLA 3QXJA 3AEZA 4Q9JA 1E9DA 1RRCA 3T35A 1P6XA 1NLYA 3THYA 4XVQA 5FR1A 1CJKC 4FXPA 2HLDA 2RGBA 4WZBE 4HZUB 3BH0A 1E2PA 2GZDA 4BE7B 4URUR 1P4SA 4OI0A 221PA 2QM7A 4JLMA 1CR2A 3K9LA 4L15A 1F2UA 1SVMA 4Q1CA 5FTJA 4NPHA 4KLNA 2RHMA 3GLGE 3PJRA 2WKQA 3TAHA 3UANA 3N2EA 2XTZA 4PPGA 1US8B 4DLWA 2ZSDA 2FGKA 3CB4A 1TAGA 4Q66C 5EZ5A 2ZAMA 5DO9A 5F2EA 2KSQA 1XPOA 3AQ4A 1P5ZB 2Q0HA 3E5HA 2ZQ5A 3AF2A 4IDNA 1KO1A 1TEVA 1RIFA 4ZPXA 4AK9A 1YU9A 2YINC 4JVSB 1ZIPA 2DPXA 1X8JA 3W3ZB 2J46A 1U9IA 3P32A 4B2LA 1R7RA 3NC1C 3TQFA 3ZIAD 4OHYA 2GAOA 4DBLC 1P72A 2QQ0A 1ZP6A 3AP3A 4IDOA 1GIAA 4M1SA 5TARA 3K53A 4BQSA 5FPTA 4BGDA 2VBCA 4Q03A 1GITA 4D4KA 1WCV1 1JAIA 4KSCA 1VDZA 3EARA 1RYFA 3GEIA 2KI5A 2V9PA 1W1WA 2IT1A 1KK1A 4XSGA 1KSGA 2FZ4A 2PX3A 4DDWA 4A0FA 5FPSA 3BH6A 1KI6B 1M1YE 3BB4A 3WBKA 3CF0A 2WWIA 3LA6A 5EE0A 1UM8A 4FD2A 2H18A 3P1JA 3WMFA 3REFA 2O8EB 1CULC 3RS2A 2ZI9A 1E9RA 3SQWA 5D3MA 3CRW1 1HEIA 5KSYA 3EX7C 4LBZA 1RKBA 4JL8A 1OE0A 4WA7A 3EIQA 3L43A 3A37A 4YQFA 5C4MA 1EWQA 2VSFA 2IA5A 1E79A 3Q5EA 4KBFA 4YMVA 4ZCIA 1Z8FA 1E2IA 4QHTA 4PO8A 4JKYA 1E0SA 1G8YA 1FX0A 1LS6A 1WA5A 3GFOA 3KZ1E 4RD3A 3AVTA 2VA8A 4TL9A 1CJVC 1Z6YA 4FMBB 2Z43A 3UXMA 4US2R 3P20A 4Q1BA 4MRSA 1CU1A 1OPXA 1S3GA 1EFRA 4B3CA 2X8AA 1XRJA 1BYUA 1C9KA 2ZTSA 2IX3A 3OESA 1KDTA 4M1YA 3OEHA 4GNKA 4Q1DA 4OHVA 1HV8A 2FSFA 4ABYA 1AS3A 2ATVA 2ZRGA 4WBSA 2D06A 4HB0A 4XVRA 3NWJA 4QM7A 2IS6A 1Z28A 1W44A 5D3MB 2GETA 3RS4A 4OJKA 2CDNA 4GT1A 1OV4A 2GXUA 2Q9AA 2CHVA 1JECA 2P5TB 1TX4B 2NZ8A 2J7PA 3P26A 4TTQA 4WAUA 3EWSA 4QHYA 1CEEA 1OYYA 3SN6A 1J8MF 3E70C 4N0DA 2WWWA 1DO2A 2P6UA 2R6CA 3SYLA 4LGMA 2AK3A 3EG5A 3BS4A 4B47A 2V8OA 4DIDA 2AWNA 5D3QA 1GNRA 2FJUA 2ZRPA 3GEHA 2OXCA 3VX4A 2H7VA 3KKMA 3AGPA 2KE5A 2H16A 4NYMQ 1MT0A 2FZLA 3O8BA 4B6EA 1MH1A 5JJLA 2W2VA 3LQQA 1KI8A 5EP3A 2OUKA 421PA 4AYWA 2YZ2A 3NEJA 2VHTA 4DC9A 1VIAA 4YONB 2F1IA 3BK7A 5BWMA 3HU2A 4A8JC 1W4BA 2O5VA 3MD0A 4D6PA 1G7SA 1IY2A 1TMKA 3O8RA 5FOTA 1GAJA 4YDSA 2FWRA 2EW1A 3K0FB 4AKHA 2ZJOA 4DWJA 3J81k 2G1JA 3NHBA 3K0CC 5H70A 5JWHA 1QBKC 2G3YA 3FGNA 3U7HB 1Z5ZA 3ZVLA 1N0WA 4EQ6B 1ZNZA 1E9AA 4Q4HA 2JLWA 1DE0A 4JLOA 3FTQA 4JLBA 4AG5A 4XD7D 2QN6A 2ZRCA 1Y63A 5HKKA 3U3KA 2W2TA 3U7EB 2D62A 3Q9LA 4HB3A 3QKRA 4ZCLA 4M4SA 4IOJA 1RVDA 4Q4JA 1LFDB 4LYAA 4B43A 3TIFA 1V5WA 3W6OA 5FBQB 1G19A 2GTPA 1ZCBA 2X1VA 4AKIA 2W00A 5F9FA 2ZJYA 1BKDR 2N42A 1P2VA 1UBEA 1KMHA 4Z8YA 5BN4A 1ZNYA 2JLYA 4OQXA 2FMXA 2BMDA 1Q3TA 4ZV4A 3X1ZA 4EJSC 1UDWA 5B64A 4IDPA 3SYNA 1U0JA 1N2CE 3NTUA 1EK0A 4P0TA 5AJXA 5EE5B 521PA 1QHNA 5JRZA 2XB2A 1VCIA 3CLVA 2NZJA 2Z5FA 2WSSD 2L0XA 3B1XA 4EJSB 4U02A 4U00A 5FBVB 2ZYWX 3C5HA 4QNRA 1HH4A 1TU3A 4PZLA 5GVSA 3TK1A 3WYFA 2XZLA 3P27A 4CT4B 1NJFA 3K8YA 1I4DD 4BFTA 4CRWB 2VPPA 2PMDA 4GP7A 4EDHA 1E99A 5B2ZA 3QPWA 1H8ED 1LNZA 4TL6A 4ZI2A 3CPJB 4KYIB 5A0FA 1KMHB 3VR1A 4QGAA 1U0HC 2B21A
chains in the Genus database with same CATH superfamily
4NAUA 5FPPA 1E6KA 3O4GA 4TXNA 4L2IB 4H4CA 1NUUA 4FYMA 5F7XA 2ECFA 3MTDA 2BW0A 4AWXA 1KYYA 3QV2A 3NT4A 4GR4A 3PGLA 2IGBA 1DGQA 2CB0A 3OZGA 3M6MD 5CB0A 2YV3A 2SCUA 3KLMX 1X6VA 2XBMA 4A73A 1J22A 5L7TA 1A04A 1D0SA 1K8YB 2FR8C 1RKUA 1XMPA 2OAGA 3DBHB 4FOOA 4LPSA 4G0WA 2BBWA 1Z07A 3BHIA 4XR9A 5BSRA 1H9CA 3KUUA 1Z2NX 1QANA 2YYSA 1TJYA 2R62A 4IR7A 2Y66A 4Q4HB 1Z45A 3SBEA 2G8LA 1F9EA 3I9V6 4KX3A 1NJSA 4MB0A 2R8YA 4B2YA 2VF2A 4OMFG 5EZSA 2WJIA 1TZ2A 1NVAA 3TD6A 2IEIA 4N41A 2RGXA 4OGGA 4V1CB 3C70A 3DYBA 1NPTO 2CUKA 3EZ2A 3B2QA 1II8A 1BHQ1 5ESXA 1O57A 1PLJA 4BV3A 3JQAD 1ULAA 2JS7A 2R6DA 1L1FA 3A9CA 3WR5A 4BMZA 1F3OA 2Q9CA 2HREA 3RRNA 3SHFA 4CTOA 1JV2B 2CN1A 2GHIA 3B3QA 3LLMA 1YS1X 2FEKA 2OWDA 2R86A 3L8HA 5D3ZA 4L5BA 5PNTA 2P5UA 1ZVQA 3RRMA 5HKKD 3E18A 1BRTA 3ROGA 4ARZA 1G59A 3KT0A 5EZ6B 3DAGA 3AHHA 3KR1A 1QB7A 1NW4A 2BEWA 2DBRA 3D6FA 4GI7A 1RRKA 1U9ZA 1VP9A 5DLYA 1KOJA 1X7YA 5DRYA 4UAJA 5DVZA 4DIFA 4HYYA 2FX2A 4LHYA 4MS4B 4MJ7A 1D4FA 2ZBEA 5CAEB 1UK7A 5L3QA 2OM2A 1RJGA 1Y1RA 1JBQA 2ESRA 1IEQA 5K4HA 2FG7C 4HO1X 4ZVNA 2ZAIA 2H52A 4D46A 3S2FA 2G9UA 3CMCO 3ZH2A 4H18A 1S7GA 4ESVA 4WK0B 4BNUA 3E5NA 1ZN7A 4IXDA 2V5AA 2R3SA 3BE6A 3IMKA 3ITKA 3TSWA 5HHTA 4KGVA 1QUEA 3PDHA 3VHQA 4C7KA 5G1OA 3VPDA 3K70C 2ZBUA 2X8LA 1E64A 5EWJB 2X5XA 4F4DA 4WXMA 1XTUA 1DG9A 1UIRA 3F46A 4KNYA 2DCUA 4DIKA 1DDIA 1K8QA 2GJKA 2YWXA 3C3KA 4R51A 4ARBA 5K01A 1MF7A 4GXRA 1HGXA 3I2HA 4JELA 5TPWA 3SYKA 1WXGA 2BI4A 3TSCA 1E1CB 5AW1A 3C4VA 4QGHA 2FPGA 1AN0A 4IHJF 1WKCA 3FAZA 1G3UA 2NTYC 4OA5A 4OQNA 4O4JB 3LUAA 1JF8A 2H59A 2H1CA 2GZ3A 2EBFX 2G25A 1NRIA 1XTRA 3VR2A 2ID4A 3H86A 5J9FA 3NOOA 4BQRA 5AUNB 2PJRA 2B3TA 3TPZA 3UJ3X 2PAFA 5BMVB 1UKEA 2V5UA 2XD4A 3GWZA 1KO5A 3CUUA 3I01A 4GMHA 5LA6F 4KOAA 3H5NA 3HDQA 4EGSA 1C50A 1KKUA 2G88A 3R9XA 4B80A 3NYIA 16PKA 3ISJA 5HRCA 3NIDB 4R7TA 1KWKA 2YQ5A 2Q9BA 2X1HA 3DEZA 3OZXA 4MI1A 4XAQA 4HVLA 1USUA 3H6KA 4GGMX 2JAXA 3RIXA 4D9GA 1RMQA 3QEMA 1J4AA 1I2ZA 1XT6A 2C9YA 3R75A 5L3SB 5ED0A 1J0AA 2UYGA 3BD6A 5DE3A 4KV9A 2DQ4A 4LDJA 5CLHA 1JSLA 1LVGA 1M1YB 1DJMA 4B6PA 1I3LA 5L95A 2AZDA 1OFHA 3K2QA 4MJ3A 3MGKA 1CIPA 1UMDA 4GKJB 2C3MA 4QJBA 3KQUA 3QVGA 5AM3A 4ZI3A 2ZVDA 1X8LA 1GA6A 3AOEA 1FJGB 1ZHFA 4ZOBA 2QTWB 2ZIFA 1L9XA 4DGQA 4GRAA 3TL3A 4PHCA 3DPUA 4QUIA 4FFNA 3ENVA 1BZYA 3VPBA 2ZUCA 2OESA 3AIMA 4NU5A 4ZYLA 2ZBFA 1ZCFA 5KWIA 3HN2A 2G5GX 3TZHA 1J5XA 1K7CA 4ASUD 2X40A 3VR0A 2GN4A 3WGLA 2FYTA 4RKWA 4V2UA 3TL6A 4X8LA 1R8XA 5H1YA 2GR9A 3AEQA 4KMSA 2WTAA 4FFDA 3UMJA 4DREA 4B09A 5FX2A 3GZTB 1TGVA 3LHSA 4IWXA 4URXR 1NATA 3R0ZA 3N2IA 4RIIA 1BFUA 4EA6A 3QFFA 1MQ8B 1HYQA 2W6JD 3EEIA 1QQ6A 3L7DA 5AJUA 5AM4A 3TLGA 3RFVA 2VPZA 4D3YA 3EPLA 3FCUB 3VPHA 5JAMA 1H5NA 2Z3ZA 2IZ0A 4FILA 4GPBA 5C1BA 4WW0A 3UJ8A 3OPQA 3V8NA 3N2KA 5LP1A 1Z4NA 1W9HA 2EL9A 4I3GA 1L5GB 4Q6WA 2HPAA 4BLQA 1ZR2A 2JATA 4QFCA 5EXSA 1K66A 1DC4A 5JUWA 3E3OA 2V7GA 2WVAA 4TUYB 4A2QA 3E7DA 2RG1A 1XJ5A 3QNMA 4HDMB 1TD1A 2DR0A 1JFSA 1Z39A 1DBSA 1C7RA 3FMPB 4FQ5A 4OFWA 2CCJA 2VP0A 2FPLA 3CCFA 3ZJ5A 1TJ4A 1K6XA 2WV9A 2JLZA 2VBFA 3V34A 3B85A 1W2HA 4E4YA 2GBFA 3LA8A 2HSZA 3QKUA 3QNWA 4IQ4A 4O02B 4G86A 4I1OA 4Y6PA 3JAMA 3U7QA 2P6NA 1KZ6A 2DOKA 4K2AA 4K6HA 3LP5A 3C1OA 3MYYA 5JAQA 5DK4A 4CR6A 1TC1A 4A6DA 3TB6A 4N3GA 4GOKA 4LJ4A 3S2UA 2XVXA 4XJXA 4I7EA 3IXQA 4I9HA 4WUVA 2R25B 2A57A 3QEMB 3AHFA 2F00A 1KJZA 2GEJA 1F5NA 5AVZA 5AHXA 4NABA 2UZAA 3DZDA 1ZITA 4OMCA 2PUBA 5KYYB 2I4IA 1A9YA 1NVWQ 1P2TA 3H99A 1T36B 4PC6A 3EZFA 2JPDA 4RMHA 4QGBA 1A7UA 4RUKA 3UUWA 1VYVA 2OHJA 2Q7XA 3KHSA 2ZKIA 2VCHA 2BEKA 5MN5A 4OLBA 4M0PA 2WUGA 2BFOA 2C4KA 1A4UA 3UGQA 1I2CA 2IZ7A 1XZGA 1VYHA 4JY7A 2RD2A 4NV1A 2X4GA 4LYYA 3GBPA 2ZRIA 3GN2A 4KQ1A 2HMAA 1OFIA 1T0JB 1USKA 2I54A 2VCEA 1JUDA 1KGSA 4YI5A 3ER9A 2ROQA 1HDRA 2UXBB 1U11A 3WI7A 1QVRA 1SVUA 2H00A 4MP8A 3BAFA 4E14A 4EMSA 2CF5A 3GMDA 1MC5A 5DM70 1ZBDA 1IHOA 4PYRA 2G9NA 1QV6A 3PXAA 1M1ZA 1Z4LA 3FVQA 4LJKA 5DNDA 1IATA 2D8MA 1VKRA 1NQUA 3RJTA 3W8FA 5IF3A 4X45A 2GM4A 2HW8A 2PUDA 2QUBA 3DFMA 1RFLA 2PGXA 3D6VA 3MWDB 4LJSA 3N8IA 5FPHA 1FQJA 1VOTA 5SYNA 3WLQA 4E5UA 3OQVA 1ZAYA 1T1RA 2OKCA 1GEGA 5DIFA 4KK4A 3H3FA 2Y0DA 2OXEA 2GTHA 2P8SA 1CQJB 5DM2A 4EY3A 1WXDA 4DAOA 4H1UA 3AFHA 4DIEA 4QGSA 2Z08A 5FUVA 4UNPA 2FW7A 2EHDA 2I9KA 1SC3A 3C7KA 4JLSA 5A9RA 2C8VA 3KLOA 3GCDA 4Q7KA 1WDWB 1KK3A 2II6A 1TK2A 2HU5A 4WK4B 4ZU6X 3WFIA 4AY6A 1C0KA 3PZRA 3RHSA 1TYZA 4PFQA 1ZK4A 1X2EA 4A6XA 1TK9A 2YMPA 1QIDA 4HCJA 3AC0A 4KN8A 4ZWNA 4HWSA 5AVXA 1H9AA 2BC9A 3EWAA 3MTIA 5IUKC 4AX4A 4K6MA 1D6JA 5KSWB 2IS4A 1NDHA 2XZTA 1U3DA 3QUAA 5DSZA 5ADWA 2VNIA 1HE4A 1NW3A 4W8OA 4RK6A 3P2OA 5FPQA 2QIPA 2QTVA 3EYWA 3WJ2A 6LDHA 3SKYA 2O1XA 3AM5A 5I7RA 1YRQA 2HV9A 1A97A 3LDAA 5BR7A 1B41A 3F97A 1RS0A 3QX8A 5FUYA 5IZ4A 2GRAA 2JD0A 2ZYUX 4TS3A 2X5OA 4PWZA 4BMOB 2RGYA 1K4YA 4KWCA 1KKMA 1GZUA 4LWPA 5CA1F 1B6GA 1WO8A 5IZCA 3JYQA 5KSPA 1J90A 3OLZA 3C15C 2VDLB 2FH5B 3JV7A 2Q5JA 5KVVA 3NG1A 3Q3EA 1OXUA 2CDBA 3NAGA 3AJDA 1Z56C 1YB5A 3MINA 2O3TA 5B3JC 3IQEA 3KOXA 5DI9A 4URVR 5A3QA 3DBLA 3VO2A 2PWAA 1E1MA 1VL1A 2DGDA 4IIJB 1B0ZA 2FK8A 2W2PA 3V7YA 3C8MA 4TRJA 1TYCA 1DIRA 3ZGLA 4F86A 2LD4A 1F2DA 1OILA 2DPHA 3F6BX 4EQ6B 5C53B 2Q5EA 4UMDA 5I8ZA 3G88A 3IVAA 4JMLA 3UGKA 1Y5MA 4D9JA 3T4XA 4DARA 1YS4A 5D1HA 4WTOA 3WRWA 4KRFA 3NHYA 4D1YA 2VT7A 1G8HA 3NWBA 2C88A 4F4CA 1TVCA 2OR3A 4CW7A 1MQSA 2V0GA 1ZY2A 1M1NB 3ZE8A 1VRCA 4JC8A 3VMFA 2C99A 3GT0A 3TGLA 3PQ5A 3OOWA 5M5BA 1IH8A 1OT3A 3VYWA 4HQKA 5KTNA 5EXEA 1Z2PX 3AXTA 3JARA 1K3TA 1Z6ZA 4HLDA 4MR7A 3IP9A 2X0DA 1YDGA 3H17A 4YJHB 4HK4A 1O0BA 1BS9A 3E61A 4MA4A 2PZEA 2ZWVA 3N6VA 3WK6A 1ZOOA 5C8VA 5DT9A 3Q3GE 1M8KA 4WGGA 2UYOA 4B6OA 4F5YA 2EKQA 4G0YA 1H2ZA 1HNNA 3TG2A 3A8TA 1OU4A 3DZCA 4BLRA 5IN4A 4L3OA 2AMJA 5GV7A 3O75A 3HB7A 4DGSA 1WXQA 2GNAA 1Y8RB 4JEIA 1LVHA 1KJ8A 5TGDA 5C2JB 3CW9A 1HG1A 4PLGA 4NHOA 4HP8A 1RWMA 4W1PA 1P9NA 3PL1A 3GJTA 3HVIA 2YXNA 4FR2A 2AXNA 4Q6BA 4V0MA 4BKQA 4DV6B 4LDNA 4WLFA 2O3QA 4URWR 4ZO9A 1BVUA 5G4KA 1NM5C 3SWWA 3EVAA 5BWBA 5KUTA 1FYEA 3BTOA 1M74A 1L7NA 2DQKA 3WHIA 1AK9A 2EKDA 2DTDA 2HCFA 2QTFA 2ZDQA 3H5IA 3IEXA 3TE7A 4KKXB 3R6LA 4JJ7A 3ZTWA 1K3UB 2VKTA 3GB9A 3IAXA 5GV8A 3C5VA 5HZGA 1KQFA 4MDEA 3A1FA 2IYLD 3OJCA 4N5MA 3HXOA 1RMTA 4RXTA 3EMKA 4G5HA 5DM0A 5TSDA 1TUGA 4FGUA 5I7WA 5HJEA 3BE4A 3SJBA 5T4BA 3DS8A 1GNVA 2NSYA 1JNYA 3IVGA 1ZWKA 2EGGA 3EHEA 3GFGA 4KP7A 1O95A 4YLEA 2UYCA 4PANA 3VH1A 2ODWA 1V1MB 2F2TA 3DD1A 5BRNA 3TTVA 4JCOA 3O8LA 3WRVA 5KTOA 1INLA 1JXMA 3H9BA 2NUBA 3ZWNA 1T4DA 4HSEA 1XZFA 5ANRB 4MB2A 1XIVA 5CK5A 5GVRA 1N36B 1X1BA 4OYYA 1ESZA 2FWAA 1QQ7A 1Y4AE 4B7CA 1LZKA 1B4DA 1CC1S 4JU9A 1I3OA 5EPUA 5JNLA 5HE8A 4DMLA 3QVMA 1J0CA 3IERA 3EXG2 4M0MA 4BO8A 2QF7A 4I9NA 5EUBA 5ALTA 1PR5A 3GROA 1IZ7A 2V96A 1N5MA 5AKHA 3RVJA 4H7HA 4HXYA 5BUZA 1E0AA 2ZSKA 1G42A 3DO6A 2J87A 3MJDA 4B6JA 3VM6A 3K5PA 2AR7A 1F38A 1Y34E 3EA0A 2GK3A 4G0MA 4G24A 3W9SA 5FBHA 4KR2A 4N03A 2ZE7A 1GPLA 2YHIB 3ZDAA 5JCJD 3GT7A 3UGTA 1ZK2A 1WRBA 4UD6A 3KJIA 3S1AA 1ZUWA 1OX5A 3FPBA 4IWNA 3U4MA 2IU6A 4CM7A 1KORA 3GUVA 1JLHA 5DGTA 5C46F 1AK1A 1UH5A 4PF1A 1C29B 1RQRA 1E32A 1QAOA 4MYDA 2WU3A 1H22A 1CUUA 2VSNA 2WF7A 1CK4A 4Q4DA 1JFTA 2ZRQA 1QBGA 3ASUA 2CD9A 1T2EA 2RGDA 4HWOA 1DU4A 5E7MA 2Q7OE 3ROXA 3AHEA 3WHLA 4Q3CA 4AZ0B 2RGWA 2C4VA 2QTNA 2JCSA 3NX4A 4DEXA 1ORWA 5CA1B 1AH2A 2CSUA 1V2GA 3MB8A 1S8FA 3DQPA 5ALXA 3GJ3A 1PS0A 3ODPA 3CKMA 3KQNA 5KOJB 2WHYA 2R751 1HETA 2CK3A 5JBQA 4HWKA 3ETDA 2P75A 3MUFA 4I14A 4F21A 3A4LA 2B5OA 2Q99A 5LXTA 1J2JA 4L1KA 2PLFA 3K0SA 2CBZA 3PQ7A 2E4ZA 3ZWWA 3BWEA 2FG6C 1E2EA 4RGBA 4DADA 3NBUA 1O4VA 2X8JB 1TKAA 4RNDB 2M32A 3LP8A 4U7FA 3LW8A 4AZ3A 5CDUA 2V9ZA 3C5EA 1GUFA 2AN5A 3FYUB 1FUEA 5CT8A 5AW5A 4KTTE 1AGRA 3DZFA 4QGFA 4F84A 3GLIA 2H1OA 3G23A 1KR2A 3DMYA 2VR1A 3OJWA 4JVLA 4O63O 4DLBA 3WK4A 4R1NA 1TCAA 4U2DA 3PE4A 4NYIQ 3CF4G 4BNTA 1P4AA 1GAWA 2OC4A 3IURA 4FFPA 1FMTA 2ZKLA 3FZQA 2A9QA 4HHEA 5L53A 2ZWIA 2UZ1A 4IOKA 3NALA 3D7RA 2I4RA 1DIOB 3F7NA 5AHOA 3WK5A 3K1YA 5B3LA 4Y2VA 1XD8A 1M2VB 2CLOB 2CZCA 1NRXA 2IUSA 5AKGA 1SOWA 3LXUX 4KEAA 3OZRA 5BORA 4D74A 4MI3A 1SRRA 2O5EA 1Y4DE 2P27A 3U3ZA 4YMWA 1ZICA 1ZJ4A 2XDAA 4F11A 4UTNA 4H1TA 3X2EA 2VJNA 5IARA 3V2UA 2ZJAA 3DLHA 1C8BA 1MX3A 1P9RA 1J2RA 3QVXA 4ND3A 5AKZA 5K3FB 3U0VA 2CLMB 4G1CA 1VCMA 1H4TA 1ZUD1 3AUUA 3OP1A 3AHJA 1PEKE 2QN7A 2D5LA 2FW1A 2P67A 4H60A 1LTQA 4MUJA 2EZ9A 3FMFA 1QRRA 1TA0A 3Q1LA 4PLHA 2ZIEA 1ANKA 4MUIA 4HB4A 4QT0A 5IKXA 3TNFA 3KV3O 1MNQA 2XKAA 2ZUVA 3KE8A 4J1TA 3RUEA 4C7VA 5K6AA 2PZMA 1GM5A 1C3OA 5M04A 2J3IA 4DC0A 1ADBA 1JDSA 2E37A 1CF2O 1RYHA 2PSSA 3EQ9A 4L51A 4ML3A 1ZMXA 4PO9A 4XOIA 4LYGA 1X8XA 2ID7A 1CY6A 2XB4A 3E9YA 4ILEA 4ODIA 4YQYA 4BNGA 2D1YA 4TT3D 4JBWA 5HCUA 2P41A 4QDTA 1T35A 2BM0A 1PJSA 4RH0A 3VKVA 1DHRA 1EX7A 1LSSA 4BB0A 5CEJA 3ABRB 4H31A 1NKVA 1ST2A 5T67A 3VC1A 4NS1A 2RK3A 2WYOA 2O54A 3ZD8A 1UOPA 3ZD6A 2RGCA 1X7ZB 2PR2A 2QWXA 1T8TA 3BF8A 4BRWA 3EFBA 3OMLA 4R9RA 5TIIA 4RQTA 3R3WA 2IHNA 3TRHA 3TZLA 1FLAA 4DG5A 4C20A 5KVAA 4C08A 1DOHA 1GZVA 1QUFA 2VPQA 3U9SA 4BFWA 1U31A 2B2NA 1KPIA 4XGRA 1LV7A 2C2HA 2XUIA 7MHTA 4GNRA 4AMYA 1KU0A 3CO5A 3MT0A 1NU8A 1SVSA 1QV7A 3X2FA 3V4VB 1PJQA 1ZK0A 2G07A 1CB7A 2AG5A 3PEYA 3L1IA 1C0IA 4JC0A 1RBYA 3WSWA 1WB4A 2XA2A 3K4HA 4V3CA 3UXYA 5COBA 3TXAA 2NW6A 2JAHA 4EJ2A 1CNEA 1UMKA 2EFJA 2J45A 3VH3A 3NWEA 1M2WA 2XB8A 4FFOA 4W5OA 3DBLB 4HGOA 4RGYA 4FINA 2P91A 3PPVA 2VJKA 3NNSA 5B6JA 1W85A 4U5QA 3UQZA 1TUIA 4NCNA 3OTOB 2G1AA 3ND8A 3NW9A 2ONKA 4HGNA 2C5LA 1WIWA 4PHHA 1GTG1 3U44B 2QRHA 1BDBA 1PR6A 1G38A 3I76A 3DE2X 2HA4A 3LOUA 3IXMA 3K9BA 1IQRA 1T6XA 1WUIS 5ICCA 2O4UX 2NU7A 1SXJC 1RP1A 2IXGA 1FYDA 4C89A 1Z4KA 3O8OA 4IVPA 4D3FA 3H8SA 1H94A 4A5SA 2WQZA 2BOVA 1FFWA 4RU1A 3RKSA 1WXWA 1HQKA 4FHGA 4LVCA 4PZYA 4W8GA 1BHJA 2ZUBA 4ARSA 4DIBA 1I5EA 2C3OA 4KZKA 1NYQA 2FQ1A 2W6NA 1XP8A 4UHJA 2OZEA 3RREA 1WR8A 3Q4GA 1ZOLA 2FWBA 3EHDA 4JV5B 3G0IA 3T34A 2HJWA 1R66A 3GRZA 4TSRA 1NVKA 1PGQA 2PT7A 1PL8A 4J9VA 4C2UA 1TZJA 1R37A 1EGQA 2GDZA 2CWWA 3B53X 4NU0A 1CFJA 3AF3A 5IAJA 4CKYA 3PFIA 4OB7A 1G6KA 3R5XA 1KO4A 4B0OA 1OH7A 1FUUA 4QTZA 5EZYF 3ONEA 5BSKA 1YOBA 1BQ3A 4IEFB 4NG4A 4PE5B 2OCYC 3ND6A 4X90A 4MOWA 5JAIA 1K08A 4FZJA 1P0IA 2YS7A 3WGYA 3NHUA 4A0HA 1BX1A 3JSAA 2HLNA 1U28A 2VEDA 3BMXA 1DBQA 3M5WA 4XYBA 2V54A 4QYIB 1XQXA 1QFYA 4A4DA 1OIVA 1EFHA 1ESCA 1NW9B 5KDLA 3ZV6A 4BVBA 4IJVA 1YS6A 1FXSA 4GXQA 4WXPA 2FTKE 2G1KA 3B8EA 4WNIA 3JASA 3V9PA 2B6NA 4WOPA 1E77A 4GE3A 1QIHA 2OORA 4RXMA 4QM6A 3PG5A 3TW8B 1P1FA 3KKEA 2ZULA 2H5EA 5IX8A 1AV7A 2VIIA 2DWUA 1PP4A 3LC1O 3D6NB 1MW8X 2Z6AA 3MS7A 1I4LD 1QHEA 2JIRA 4MSUA 3F78A 3N70A 5EE3A 1T8WA 1Q3KA 2QMHA 2YS6A 4S35A 2ZB4A 1SUIA 4TKUB 3SR0A 4KQ2A 3G0DA 4AURA 2WFLB 4MUAA 5CA0F 5G40A 1HQCA 2EVWX 1XMVA 4GP9A 4EGJA 1GPJA 2PGOA 2VSYA 4IRMA 3MVEA 4KXXA 3MLAA 3ROPA 3BD7A 1G1AA 3DC7A 1N8TA 1E4VA 1CIJA 2I8AA 2QM8A 1XTBA 2PZKA 2KWIA 3GLRA 4BJ6A 3P96A 1DAPA 4FDLA 1IZ9A 1QIGA 1RWQA 3BCHA 4CU2A 1JXAA 1RQNA 1T9KA 2C1XA 2QMUA 1NP7A 2I4OA 3EXHA 3HNRA 3FA2A 4OK6A 2FN8A 1ETHA 4TRMA 1JIUA 1U7OA 4AECA 4F2PA 3QG1A 3OJ0A 4RY9A 3SC2B 3ND9A 1AXEA 1RXYA 3DUWA 1KYZA 1Q2UA 2BFEA 1ZSYA 2YN0A 3NUQA 2PRSA 4UHCA 2CL6X 1I7DA 3NH9A 2PEYA 3SZUA 4GKAA 4DJFC 2WB4A 2VHUA 4H4DA 3T9AA 3U7FB 4G3XA 1D8TA 2Z2ZA 3COYA 2WWTA 4DV1B 4BPBA 4X1IB 3RAGA 1E3TA 2BTOA 2QS9A 4B8YA 4CIAA 1V3TA 1CY0A 4IL5A 5AXBA 3V55A 2C92A 3SEAA 5AKJA 1W73A 2JJ1A 4MKRA 3F5MA 5DLQC 5LN1A 1MZVA 1V0JA 3OLWA 4B3IA 2AV6A 1BH2A 1HL7A 5BSWA 2G8NA 1JPVA 3S29A 3DBVO 3DMTA 2CHEA 3CXRA 2ZBDA 3AI1A 3NP7A 1H2RS 1Z0IA 4C7MA 3NETA 1RJWA 3CS3A 3QVTA 2Y76A 3GDOA 1CE8A 3PENA 3PF9A 1TPYA 3CW2A 3FBGA 4J90A 5CA0B 1Y9EA 2VTKA 1W75A 3ZHXA 4LJ5A 1C9YA 4G1BA 4MLZA 3DF9A 4Q7JB 5EQJB 1T0UA 1J8DA 1WY5A 5U4QA 4C0BA 4KU4A 4Y2UA 2O0JA 1TF7A 1UBJS 1JPUA 5GMOA 3JWEA 4R4JA 1NLMA 3TLMA 3KYBA 2JI9A 4IGKA 2O0HA 4W7IA 5AJHA 4EHDA 1TAUA 3THYB 3A6PC 4XUCA 3W2HA 2GEUA 4P3PA 3ZQ4A 5DNCA 4LYEA 1WUHS 1V3VA 4YUZA 1S02A 4NAVA 2H9IA 1QIFA 1NPYA 2J7PD 3RUCA 4CUZA 3DWGA 3W5AA 1OGJA 3OTWA 1W0KA 2R87A 2PKEA 1AZLA 1YOVB 3THXA 5FT9A 4NBSA 1NZDA 1DB3A 2UUOA 4DNPA 4RTNA 2CUNA 2YY7A 2R8BA 5G1PA 4I50B 2GNPA 1YZKA 1JT2A 4I55A 4O2BB 3T7AA 4PSDA 1XJQA 2YRWA 2HNAA 4NV3A 3DHYA 4L4RA 1SEVA 1T1IA 4YBRA 2PH1A 2BZ1A 4YH1A 3HDHA 3R3XA 4N01A 3GPLA 4GPZA 2QN2A 3KJHA 4KPUA 2B83A 3GLHE 4HAVA 4WLVA 3LHFA 4C4OA 4KFSA 3HVKA 4DIUA 1VI2A 4DS3A 5HGXA 1I3MA 5INTA 1H85A 3T3HA 3KETA 2XCRB 1QQTA 2QL9A 3LAWA 2PS1A 4TZ6A 2GXQA 2WI8A 2PS9A 3ROMA 5JHGB 2GHRA 1W8IA 3UTCA 3LSYA 2FUCA 2O52A 3I9V1 3RRYA 1RABA 2OE2A 3KE9A 3T5TA 4DA6A 2VK2A 2X9NA 2Z2IA 9ATCA 2Y6VA 2K7ZA 1TVEA 4MKXA 2VDWB 2W48A 5E4FA 1H4SA 3OCWA 4RDIA 2CEAA 5DHTA 1FLDA 1FNCA 1UT6A 2YFKA 3ZVKA 3IEUA 4XA8A 4F8JA 4RW0A 1QE0A 4W5RA 4FW8A 1TYDE 2JEZA 4PG7A 4FLMA 4RD6A 3DBOB 3L7LA 4KE6A 2Q62A 3R6DA 4LZNA 4S2EA 5DHAA 4YRNA 4YIKA 3EDOA 4TTIA 2R6GA 1ABEA 1R2QA 2RHTA 1Y3IA 3KAKA 1TKBA 4JA2A 1KZGB 4PC2A 3TSZA 5CGQB 2CLDX 5JEEA 1YQWA 3N7AA 5HFAA 5H80A 5FWYB 2FSVC 1ADJA 5E1MA 4JQSA 3CZCA 1C7EA 2BDTA 1T2VA 3WC4A 1EPUA 1VGRA 2QNBA 3H4TA 1EM8A 3LO5A 2ECOA 4FHDA 4KVZA 4OJMX 4XUGB 1QCYA 5CLQA 5JLAA 4BS9A 1LSJA 2F64A 1KAGA 2Q4OA 5HOQA 4LJRA 4HRYA 3U6BA 1R0WA 1YJ5A 2YOFA 2FZ5A 2AIRA 2VDKB 4FS8A 4W7HA 4X6YA 5LBIA 3TMYA 4Q34A 3ACDA 4ZVTA 2OLEA 5CAEA 1BDIA 1QVAA 3EEQA 3PQDA 5D86A 3RIEA 2H4YA 3CR7A 1B3RA 3N8KA 2OSVA 2Z3VA 3G5TA 1TW3A 3JWJA 4A5OA 3P9SA 5KTYA 1GZDA 2P9ZA 3AVQA 4FEEA 1MABA 3VPSA 4YV0A 2YXDA 2PS0A 2UVPA 3K4QA 3PYMA 5E6SB 2J7KA 4IWYA 5T3UA 4YALA 3NOVA 3OU2A 1CT9A 4EATA 1UMCA 2XUFA 2HPVA 1KPGA 3MT7A 5BT8A 4E21A 7REQB 2IUFA 1VMDA 1EBFA 4BBJA 2AZXA 4LHZA 4CMJA 4ZIRA 1XD2B 2C5GA 4OI2A 1PWHA 3G2KA 2F1HA 1NMQA 1GU7A 2DUJA 2D1TA 2P4EA 2PUWA 3ICPA 4P98A 5JWOA 4LK3A 3SZRA 2QE7A 3CEPB 1R8QA 2R00A 1OBVA 1SOAA 4GM4A 2HZ7A 3HVUA 3R7NA 3L7JA 3QI7A 3FR8A 4MYUA 4IX9A 1Y8ZA 3G9XA 1XTJA 1SCUB 5A5VA 3GAZA 1NSYA 3IDQA 1CJCA 1BSVA 3SYRA 2H5LA 4RXUA 5J4LA 2WP0A 3IIKA 3OLCX 3VC3A 1HDIA 2C5SA 4HDAA 5BSMA 3ZY3A 4JLKA 3JQGA 4F6RA 3ZI7A 5B3KA 2BZ0A 1EESA 4J2OA 1P0PA 1I4WA 3TWOA 2C2WA 3I0NA 3DPSA 2PKQP 3ZU5A 2MOKA 4L78A 2KQUA 3LPLA 5DDIP 3DD5A 1NZJA 4RVHA 4FM9A 1O9GA 4TV9F 5FO1A 3K73O 5H9WA 3KXPA 1WD7A 2FB9A 4BYMA 1Z35A 1Y3DE 3GLIB 4YXWD 2TMKA 5IH3A 3UMMA 1EAYA 3VHRA 1QF6A 2H7CA 2YMQA 2ZUTA 2EJUA 4GUAA 2IZ1A 4BLSA 3UG6A 2IP4A 3IESA 2QRUA 3LZCA 5DEOA 4XGNA 5CLJA 2OKGA 4O4HA 4FYJA 1OXXK 1LQTA 3UFBA 2J5XA 1ETUA 1WVIA 3PD7A 2OAP1 4Y6OA 1JHYA 3KSBC 1ZESA 3OIVA 3WB0A 5KEIA 1XNJA 1B1CA 3EZLA 5J4VA 1N2XA 2GJ8A 2XE4A 3OSUA 1GP2A 3R3YA 4ND8A 2R65A 3KUXA 3T3MB 4C7OB 3C14C 2GJAA 1XL0A 4QAQA 4RK0A 2Y99A 1OZ0A 2ATEA 4FMCB 5F78A 1N9KA 3B1JA 4ZKEA 3AVUA 3A4YA 3P52A 1A5ZA 3RYIA 3D3WB 1J0XO 2EFCB 1UAAA 3ZS8A 3EC2A 5YASA 1QO9A 3BHMA 4UE2A 2PSFA 2AFVA 4UFNA 4I6EA 4WKBA 3RS3A 4TTSA 2DXIA 3IR6A 2ILTA 4IZOA 3QWFA 1VJCA 4IV8A 3HB0A 3L9XA 3MMSA 1FMFA 1UJCA 3T1YB 2MCFA 4XCVA 1KAHA 3VXKA 4HPWA 2Z3WA 2WSMA 1L5RA 1PFUA 4Q5IA 3WLFA 4M7OA 4ZFNA 1LF0A 1PSWA 4WVFA 1ZQ1A 4ZEMA 1RZ3A 3CYFA 4IFEA 3TINA 2YIVX 3OD1A 3PUKA 4JJFA 3W05A 3OQOA 2HHJA 2F8MA 1CS4C 1BN7A 2WG1A 1P7CA 4UM9D 3DNPA 3PFKA 5JNTA 2JL1A 4PU0A 4K9NA 5FKJA 5M3BA 4W9NA 1JIVA 1JG6A 3O4RA 5DXJA 4YMSA 2QJOA 4NK5A 4J07A 1TZKA 4RV9A 1TUBA 4P2BA 4GLJA 3HCFA 4B5KA 2EQBA 3ZN2A 4YRAA 3JPWA 4R9SA 4OQQA 1HMPA 1E4YA 1V1MA 1XRPA 2FG5A 4MR9A 3U9LA 4TLEA 2YZKA 4E22A 1RWXA 2J5KA 1YR1A 5L51A 4MUBA 1IM5A 3HHEA 1R4NA 1RM5A 1YIAA 3OT1A 1XKTA 4NNOA 1QO7A 1I2AA 3T5CA 1ZRHA 3EH1A 1ZM4A 4PHGA 5BQ5A 3RT7A 4J16A 1Z83A 4DCMA 1G5PA 3N87A 3PU6A 3VKWA 2J59A 1XA4A 1W581 3ZDZB 1ZEMA 2VSQA 4JWTA 1QFJA 1AGXA 2B7CA 1WCIA 1OV6A 3LUFA 1KRXA 3L8YA 3SQNA 3N0TA 1TECE 4YDRA 1OXBB 4B9AA 2YR0A 2BGRA 1GZ3A 1DWQA 1UXJA 4YP5A 3Q9UA 4LGCA 2WINI 4BCDA 5JH7A 4QATA 2ES4A 1JIXA 1N7JA 2BJHA 2AOWA 1WZCA 3HYNA 4JSTA 5FWXA 4JP2A 2B2XA 4PRLA 4JP5A 1EX6A 3G49A 3AY3A 5CNJA 5DI3B 2IEAA 4R1SA 3VI4B 2C58A 4FYWA 5E9JA 5I7FA 3LTEA 2JJQA 4O4IB 3VHLB 4NR0A 3FR7A 4P3OA 3RC9A 3STTA 3G8AA 1I4EB 2P6OA 5KX5F 1JU9A 1M6NA 5NULA 2XCOA 3EVDA 4ND6A 2G7ZA 4UU0A 2ZJ3A 3ZCXA 5KKNB 4RHEA 1YACA 1TF5A 4QQRA 4OP1A 2YHSA 4TTVA 2B0CA 1NHGA 1U8XX 4DAEA 4G37A 2JNWA 1KR5A 2BVNA 1GEEA 2PG3A 1CY1A 1XEXA 2VF7A 2XIJA 2YXPX 3LD9A 4QA9A 1X7HA 2B9EA 3I9JA 3KG2A 4H7IA 4B17A 2UZ1B 4QRHA 2HK6A 3LV8A 2O2DA 3UWOA 1TMYA 3MIZA 3IUJA 4FONA 4RVSA 4AZTA 2ZJBA 5BWOA 2Z4TA 5E3HA 2J0UA 1SBYA 2GFQA 4PSCA 3FPCA 1KSJA 2BFDA 3E05A 3WFJA 2HF9A 1SVOA 2H1FA 2IXBA 2LPMA 4GAEA 6CHYA 3DAHA 3RFUA 1OLSA 4Q1EA 1NVXQ 3NP9A 3IPLA 2WP8J 3KPVA 3RG8A 5AHWA 2A0FA 4ROTA 4F5WA 1DXOA 3MINB 4LQLA 5KNBD 4NNPA 2ATIA 2AMLA 4YRGA 4DM7A 2C4HA 4HTFA 3BWCA 3OMWA 5JZ9A 3H13A 3OG9A 1G66A 3B7GA 3DDOA 5EMJA 5WRFA 4DRZA 4QYXA 2W6OA 4I5EA 4M54A 4Q4CA 1BMFD 4PPQA 5IF9A 4J9UE 5GOTA 4J0JA 2HU8A 4J7AA 4JI8B 2GM5A 2VNHA 4GF5A 4CN9A 2RKOA 5F1PA 5CG2A 1GZHB 2REQB 4HDNA 4O2AF 2QW0X 3UYKA 5KJEA 4D6YA 3SEFA 2MSNA 2Z04A 2NQ8A 3L7IA 1LRLA 4RA6B 4ZJYA 4DZZA 3VHXB 3EPKA 2EBWA 1GPMA 5FV4A 3FJYA 1NPDA 3T3GA 2J0UB 3EZ7A 4DLYA 1J5EB 4KQMA 4RLFA 5KYVA 1K9SA 1WEHA 2B36A 3F1KA 3LVFO 1G5TA 1J8VA 1ELOA 1M75A 2NV0A 1DAKA 1P7PA 3DHVA 3L1UA 3DTYA 1PQPA 5EXXA 3SD7A 1YE3A 4C14A 2Q41A 1U2PA 2WSSA 1R6XA 5KVSA 4LOJA 7MDHA 4C21A 1NBMD 4QG3A 2NO4A 2OHHA 4KQKA 1E3SA 3WO0A 1OB2A 2ZVJA 4RPJA 3ZHYA 1X2BA 1SHUX 3E7XA 1EM8B 3VDRA 3MS4A 3WWOA 1E1LA 1N9GB 1EVLA 5HRUA 1J0BA 2P9JA 4WOCA 3LBAA 2WAYA 1GNTA 2PXCA 2VWHA 4DBVO 5TF4A 1F6BA 4J3JA 1N2OA 3KAJA 1E1KA 3LM8A 4ZDIA 1FFGA 2IOFA 3ZIUA 3UT0A 5F21A 1VI6A 2DUNA 4IDCA 5E6RB 1TEZA 4EI7A 5HYVA 2IBSA 1G17A 2BGKA 1JB9A 1SOVA 5KYNA 1Z4IA 3LOPA 4EZIA 3K6SA 2FV8A 4RH1A 2RHJA 2DPGA 3IDAA 3KVNA 3ZV3A 1NTOA 1WPQA 1J33A 2BBTA 4UBNA 2IQ5A 2P68A 3UM9A 5EMHA 1W6RA 4IHAA 4LJ9A 1JH8A 3PHJA 3CZPA 4C0WA 5U4XA 2BGGA 5E4JA 4TWJA 1A5BB 4OSPA 2EGHA 4P7JA 1CUEA 4ADSG 1IUOA 3IUNA 4XQ0A 4I19A 1T36A 2OCGA 1NKSA 2MMCA 4OYHA