1XTJA

Structure of human uap56 in complex with adp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
379
structure length
374
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 114
structure length 374
sequence length 379
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA02
1SVSA 2ANBA 2DFKB 2NQ2C 4TT3A 2VP6A 5FUXA 4QGFA 2VP4A 1GZSA 1VIYA 4XJXA 4TYYA 1NVVQ 1WB9A 5IK2A 5KUTA 1WMSA 4LYHA 4XWAA 1CF4A 3WNDA 1L2TA 1Q21A 4UNSA 2JJ1A 4II7A 4WZAE 3GLFE 5JWRA 5EP4A 3OZXA 3VR3A 3B9QA 2EFEB 2XZLA 4BFTA 3IPXA 2WWIA 3MRSA 4P4SB 4TZ6A 4NYMR 2YOHA 4DLXA 1P73A 4DDTA 1NN5A 2F9LA 4I1OA 4Q9JA 3SJAA 1X1SA 5LB4A 4ABYA 3U7HB 1BYIA 1E99A 3L0OA 4D4JA 3LVRE 3KQNA 4QJ3A 3U4QA 1PUJA 2ZRFA 5JS7A 3ZLJA 5LD2C 3TK1A 3I72A 1MOZA 5CYPA 1PZNA 2VBCA 4TZ0A 2HF8A 2F1HA 4GZMA 3ZVMA 4XH9B 3A1SA 4TMKA 3RDPA 4NONA 2ANCA 4L9SA 3IIKA 1KOFA 3CNNA 3NEYA 1SKYE 5FOWA 2RKOA 5C4GB 1ZIPA 4M9ZA 1KAOA 1KO7A 2ZI4A 1IJEA 3GLHB 2QM7A 4M1YA 1TUEA 1NNEA 1QRAA 1ZM3A 3K0EA 5FL7D 2WOOA 4P4SA 2PEYA 4RCZA 4JSYA 3QKRB 3MJRA 4IHQA 4BZXA 4XTRA 3QUSA 1X8JA 1ZRHA 4MDEA 1RKBA 4N1AA 1XPUA 3CIOA 3B2EA 4HYYA 4UJ3A 5HPYB 3NH9A 721PA 2ZRCA 2C9OA 1FP6A 3R9IA 1NF3A 3WP1B 4X8HA 1AIPA 3GJ6A 4DRZA 2ODWA 2XNDD 4PSKA 2FZ4A 2YC4C 2WWHA 4G5RA 4J0QA 1D2NA 3KXKA 1IOZA 3WYAA 2XX3A 1KDOA 4LJYA 3U3OA 1G7CA 4HAZA 5C4MA 2N46A 2IYVA 5FPHA 5C1BA 4JLMA 2KB0A 2ZS8A 4KJZA 4ZKEA 5KPDA 2ONJA 4HAYA 1E0JA 4OQNA 1ZU4A 2P2LA 2G0TA 1XEFA 2QNRA 1Z29A 3TW8B 2VSFA 4XOIA 2ZRHA 4F4IA 2A3RA 4DDWA 3EA0A 1ZM7A 4WZ6A 4XWKA 3NDPA 2KWIA 4LUCA 2HCBA 4M9XA 2QZ4A 3EXAA 2YWHA 3BC1A 4HB3A 1OXXK 1KJZA 5FBRB 5HKKA 2CL7X 5KNDA 1E9DA 5CK4A 5J4HA 2C2HA 3ZVNA 3CX6A 3MJHA 4DBLC 4IOKA 1X1RA 1GNQA 1NN3A 1SQ5A 2C96A 5EXPA 4YXWD 5FBVB 4O2LA 5EP3A 3CR7A 4QHTA 3PEWA 1OH6A 5EQTA 4P33A 1E2QA 2YHSA 4A82A 2WM9B 3KKQA 1N6PA 1U81A 1AZSC 3K53A 3QXSA 1E2KA 1VDZA 1OYWA 3OIVA 4MH0R 3RS2A 3ICEA 1XBTA 3QXCA 3DOFA 2J7KA 3GJ8A 2VRWA 4Q1FA 1NMZA 1IN4A 4TL9A 1LF0A 4O0MA 4Q9IA 3C15C 5E3HA 1DAEA 2G6BA 1IAQA 2QORA 3NC1C 2F3RA 4HAUA 3FYHA 4M1OA 3B1VA 1ZC3A 1S4QA 2R6AA 1XCPA 1NSTA 2A5FA 4DEYA 1XPOA 3OEEA 3JVUA 3FPAA 4UNRA 2B6HA 1XF9A 1SKQA 3GMTA 1DARA 2OUKA 4MRNA 2CHVA 1QF9A 1WF3A 2V9PA 3EC1A 5JRZA 2IXEA 1W48A 4WBSA 4C7OA 3V00A 2JCSA 4MRPA 2AK2A 3NKVA 2NO7A 1V5WA 1RJ9B 5B57C 5CM8B 1ZU5A 2VIIA 2O52A 3W6OA 2FSIA 4MRVA 2C8VA 3A8TA 3UMSA 3CF6R 3B1YA 1UAAA 4G5GA 1YZTA 1VG0B 2Q9CA 4U00A 3TW4A 1OFTA 3O8BA 1M7HA 4WIAA 3VFDA 2BM0A 3C41J 3H0KA 2IA5A 3T1QA 1G19A 2WWGA 1VKJA 3V9PA 3SI7A 4PC3A 2QM8A 2OBNA 3PCRB 5H70A 1T5IA 2WICA 3AEZA 3EIQA 1YE8A 1U0LA 1XTRA 1Z0JA 4ACAA 2Z4RA 4KHZA 1D5CA 1FUKA 2GK6A 4LCBA 4Y0AA 1FL9A 4PO8A 2OBLA 3NBYC 1ZMXA 1J7KA 4G01B 4HZUB 4IXNA 1RJ9A 3R20A 5HCNA 4B3BA 1E2MA 3PV0A 5J4VA 5G40A 1VCMA 2ATXA 5TVKA 5DI3B 2V6JA 1NBMA 3BB1A 3BFKA 4ASUD 3X1YA 4EDHA 1F3OA 1KO5A 2FE4A 2ZUDA 4Q4HB 2FFQA 2CLDX 2NG1A 2XNSA 3SQXA 1ZCAA 1GVNB 2YKGA 4Q18A 4NYMQ 4M1MA 4EKDA 4A92A 4H1VA 1Z0IA 2WSSD 2ZVQX 3I5XA 4LYJA 2R6DA 4XSGA 1KSHA 3AQ4A 3PUZA 3KL4A 1ZUNB 4AY2A 4Z1MD 1KK3A 4KYUA 1W36B 1ZAKA 2CHQA 1J99A 5EE5B 3QKUA 5JI3E 4HAWA 5EP2A 3MLEA 2BBSA 4LJ4A 2HF9A 1S9DA 3WMEA 1G3RA 3DPUA 4DLZA 2O8DB 4A6XA 2HYDA 5DI3A 3BAFA 1F2TB 2IL1A 3FGNA 5HZHA 4JLAA 1R4AA 3OE7D 4TTPA 2AFHE 4EPXA 4TLCA 4Z51A 2QSYA 3HR7A 1XEXA 3CH4B 5K8IA 3EPHA 2BMEA 4US0R 3SZRA 5JSZB 2VHTA 4IOMA 1W4BA 1IXZA 2FEOA 5FL3A 3Q85A 2A5JA 3EZ9A 2BOVA 4JSTA 2ZR0A 1JQJC 2B92A 1QHXA 1XCMA 4TMXA 1KI4A 3CRVA 3CB4A 2GF0A 3LWNA 1OHHD 1XRJA 2OCBA 4XIGS 5AUNB 2QUZA 3THXA 1XMSA 2ZJOA 1HQCA 1NI3A 1ZNZA 3K09C 5DH9A 5K8TA 2NZJA 1KI6B 1Z2AA 1NP6A 3EASA 2V55B 2HUPA 2W00A 4L4UA 4MYUA 4Q00A 2IWHA 1ZIOA 2O8DA 1FNMA 2YWGA 1F2TA 1UBCA 2FPKA 4LJ5A 4Q21A 2SHKA 3TLXA 2JEOA 2H16A 3GLGB 1SVMA 3HYRA 2HDNB 4A0RA 3VX3A 4DIEA 1OE0A 3DZDA 3RSOA 1VIAA 4IDPA 3B1WA 3MAAC 4OHWA 1P4SA 3AVQA 2V54A 1OYYA 3BFXA 4C0HA 5JCPA 4Q1AA 5FFMA 2J5XA 1S3SA 2BMDA 2DPXA 2EFHB 3EIEA 3AKCA 4IEEA 4R71A 5JZVA 2ERYA 3U44A 4ZCLA 4IOLA 1XMVA 2NPFA 2BIFA 2GAOA 2QT0A 1YKSA 1VYUA 2I1QA 3CNOA 3PUXA 4RD2A 4BE7B 3T5DA 3PJRA 4ZI2A 2XAUA 3IEVA 3W9YA 1T3HA 3SJZA 3R9WA 1KI6A 4Q4AB 3CONA 2QU8A 5F9FA 3L0SA 2NOAA 3FMIA 4FWTA 1NJGA 4BLQA 4OQLA 2IYUA 4US2R 1J2JA 4BFXA 3IKJA 1R6BX 1S1CA 3DOEA 3NH6A 1QVRA 4KU4A 4LDJA 3B1ZA 5JHHB 3EA5A 5KPJA 4HAVA 2EU8A 2FFHA 2OESA 4W7SA 3EX7C 4GP6A 5CLLA 1E2DA 1NVUQ 2A30A 2XGJA 4BASA 1G8HA 1P62B 1IQPA 4AIIA 4PC1A 2HJVA 2UVQA 1W36C 2ZREA 2PT7A 2ZI6A 1DO0A 4A8JB 5AWFC 5JJKA 4QC2A 4WA7A 2QP3A 4Q4AA 5DN6D 2ZE5A 1UKZA 4Q7KA 8OHMA 1COWA 2ZROA 4ACBA 2JGNA 2ERXA 4DB2A 1W4RA 4LSGA 5FBQB 2D3WA 4FW9A 3V4FA 4MDFA 4RFVA 5EUMA 2C99A 3OF5A 4LC1A 3KFXA 4IVPA 2D74A 4A1FA 1RIFA 4BZQA 3THWA 3G0HA 4MGZR 2G77B 3LY5A 2BV3A 3BBPA 4PC7A 3SC3A 2CHGA 2JDID 2ZEJA 3NWJA 2R62A 4W5WA 2WJJA 2GXAA 2NMVA 4QBFA 1XD9A 3W6PA 1G64A 4Q19A 4S2EA 4CT5A 3UG6A 3AKEA 4M21A 3GEHA 1E98A 5HE8A 1AKEA 4JKYA 2BMFA 2A9KA 1U8AA 2NGRA 4NMMA 4A8JA 4BGDA 2D2EA 2ZQ5A 3LAWA 3QIAA 3TRFA 2DCUA 1VCOA 3BERA 2W6JA 4FCTA 1C9KA 1E2PA 4AD8A 2ZXUA 1D9ZA 4DLVA 2ZI7A 1N5LA 2F1RA 3GLHE 1ZUHA 1YZNA 2FEMA 3LVQE 4PPNA 3U5ZB 3GFOA 3IIMA 4KFUA 1Y3AA 2VHUA 4AI6A 1OF1A 2XTMA 4MQBA 4S35A 4CZ2A 1K6MA 1NRJB 2WIAA 4KV9A 4AURA 3C4JA 3B7GA 3K0CC 3MSXA 1OXTA 2FSGA 2IYXA 3NVAA 4HDQB 4BFYA 1IN8A 3DMNA 1II0A 2ECKA 2OV2A 4M4SA 1SXJD 3K0AB 4B32A 2O8FA 1HTWA 4BLRA 2GHIA 4D4LA 1JALA 4A36A 3Q7QA 3PITA 1MRSA 2QT1A 4KFTA 4K46A 2FNAA 4W5JA 3NEJA 2CVHA 4DKXA 3HR8A 3VU9A 1HH4A 2RGGA 3LXRA 4KBGA 4B47A 1SXJC 4RFSB 1EG7A 4JS0A 2KBEA 4LJ7A 3U2QA 3D3QA 1KYIA 3B9PA 3T1TA 2YVUA 1E2NA 3EZ2A 2OFWA 3IQXA 5IHPA 1N6HA 1YVDA 5BN4A 3RAPR 4LBWA 1M7BA 3SJCA 1F60A 3NBZC 1G41A 5FI1B 3CRQA 4B3XA 2XXAA 4B2IA 2X77A 2BKUA 4GZLA 1Z0AA 3OEHD 3VHLB 3K0AA 2MSCB 4PO9A 3B8HA 1E0SA 2C95A 4CEHA 3DO6A 4JLNA 2ZRGA 1KI3A 5B58C 4A8JC 1GKUB 2D4HA 4PX9A 4R98A 5L3SA 4FXPA 4M22A 3KJEA 1CRPA 2PH1A 3DM9B 1WXQA 2D7DA 3HU3A 2WHXA 4IFEA 1E1RD 1W7AA 2OXCA 4HDOB 2QE7D 4MKIA 4RFSA 1XDBA 4Q9HA 2NTYC 3KXIA 4NDZA 4L9WA 3AKDA 3Q8XB 1UM8A 3CX8A 1CR1A 1W49A 3I92A 1G4UR 1D2MA 2GBLA 3D31A 3F0TA 1CLUA 1R7RA 3VR5A 1Z0KA 2DYKA 3OFND 3SYLA 2VHCA 2WWYA 3LDAA 5BXQC 4BUJA 2ZUBA 3LV8A 2BCJQ 1HUQA 4MKHA 2VQSA 3KX2A 3TE6A 3TVDA 3RS5A 2OM2A 1XX6A 4QBGB 4B3CA 4XD7D 5GJVC 1E2GA 1OFHA 1W47A 3BB4A 4QNMA 5IT5A 1TEVA 3LX8A 2AN9A 3SQWA 2O0KA 3RYTC 3ZVRA 2WJVA 4LBVA 4DLTA 1PLLA 3LA6A 1ELOA 1UDXA 2OAP1 2W6IA 1G3IA 1H8ED 3BH7A 1ZP6A 2V1XA 1U2RA 4IDOA 4RD1A 1E79A 1Q3HA 3CWQA 5JBQA 2PMKA 1CEEA 4WXPA 5FBLB 1DAMA 3A4LA 1MRNA 5JWHA 2VP9A 2QAJA 6Q21A 1E4YA 2H7VA 4HUTA 4TN1A 2CK3D 1EFTA 2J0VA 4IDNA 3U60B 2WKQA 2YYZA 3AF4A 3VR2A 1JPJA 2C78A 1ZBDA 3X2SA 2ZYVX 2J7PD 4C0QC 2CE7A 4CEIB 2PZFA 3ZH9B 2JA1A 1L7VC 2JLZA 3EW9A 4JMPA 3FVQA 1KSFX 3VHXA 4QXAA 1PLKA 3MWYW 4HLQB 3TGPA 1G8YA 4F93B 1HT2E 2OXRA 2HCJB 2E87A 4DZZA 1KKLA 3I73A 1LVGA 1H8HA 2QA5A 2IK8A 4PFSA 2WKPA 3CRMA 4HDCA 2F9MA 4L8GA 4AYXA 4DCSA 1KI2A 4Q66C 2BEJA 5SZIA 3R7WA 4D0GA 1EWQA 1NN0A 2ONKA 2OAQ1 2OEPA 5D3MA 1RYFA 2W0SA 5KDLA 2O8BA 4ZDJA 2VEDA 2FA9A 1EXMA 3Q72A 5C46F 1GRRA 1L4YA 3NXSA 4CEIA 2ZJBA 2PCJA 3TR0A 1ZCBA 4DCTA 1SVIA 5FUWA 4C9BA 2GILA 2W2VA 1JXOA 3IEUA 4GP7A 4NCHA 1BYUA 2H1LA 1KK2A 1FP7A 1VMAA 4P3YA 2H17A 4FD2A 1KJYA 2LKCA 4KVGA 1J90A 1LW7A 4JLKA 4LOAA 1EFUA 4OBEA 1UDWA 1G4AE 2BKEA 2PBRA 1JAHA 3WYFA 2GZHA 4C0JA 2OBMA 1ZW6A 5L3QA 2WKRA 4LV6A 4PTLA 4AG5A 2AK3A 4B3FX 4DSTA 2GESA 3NG1A 4XWOA 4ESVA 1W5TA 2EFDB 1OW3B 2FPMA 4MRRA 5TARA 2HXSA 1CS4C 1G1MA 1KK1A 4F38A 5DI9A 3U3JA 4QKQA 4EQ6B 1PJRA 1R10A 4A0GA 1DAHA 2RGXA 4PHFA 1OV4A 5DHAA 3MGCA 4PC2A 2DB3A 1WCV1 5J47A 3VNUA 1G5PA 2OFOA 3EPLA 1HV8A 3NBFA 1FX0B 2GCOB 2IF2A 2ORWA 2ZS9A 3I5YA 1C1YA 1ZVQA 3TAHA 4H1UA 1N6KA 2NIPA 3UANA 1ESMA 4TL6A 1S2MA 5KSYA 5AJXA 4EFNA 5FL7A 4WZBE 4P0TA 4YMWA 4BZPA 2AXPA 3AVWA 3GLGE 3UMRA 4ZIRB 3KQUA 3K0FB 4RKFA 1GSIA 4C0BA 4YMTA 1Z2CA 2CLCX 3EARA 3M4YA 4Q1CA 4EPTA 4ZI3A 1R8QA 1YQTA 3T61A 3K9LA 1P3JA 1YRBA 4KAXA 4Y0VA 1EWRA 2NO6A 2RGNC 1G8GA 1S9HA 4C2UA 5HE9A 2FDCA 2XNDA 1G9XA 2ZYUX 2H8KA 1HT1E 4C0LA 4YC7A 2PJZA 4E07A 3FOZA 1KDRA 1W0JD 3EPKA 4N3NA 4JVNA 1FX0A 2GCOA 1R2QA 4URVR 2BBWA 3AH8A 1NMYA 2HEIA 3PUWA 1G3MA 4LK2A 5FBWB 3MCAA 4I99A 1SHKA 2FFBA 1II9A 1N0WA 1XCGB 4JVMA 3WMFA 4DDUA 4QM7A 1UBFA 1P2VA 1SXJE 2W2TA 4RCYA 2CVFA 2E9SA 3LRPA 4KFRA 2FJUA 4YDSA 4ZIRA 1KI7A 2IYYA 3RRMA 2CCGA 1MO6A 4HZIA 3NTUA 4B75A 4EPVA 3I32A 2IS2A 3I8SA 4QNRA 3REGA 1NN1A 1Z07A 3RABA 5AJWA 5DISB 5IDVA 3E2IA 1VYVA 2ZRNA 4JVLA 1NVXQ 2B8WA 4BECA 1VG8A 2IYZA 3BJIC 2QMUA 4KI0A 1JXMA 4OK6A 1PV4A 2FWRA 3LBNA 2WOJA 4D80A 1XTJA 4NL4H 1JEEA 2EYUA 5F2EA 3A6PC 1TF5A 2QQ0A 3GD7A 5EE1A 1P2SA 1F48A 1VHLA 5J4KA 3U7FB 3T1VA 1LS6A 2GNOA 3SYKA 3JZAA 2GJSA 4TYQA 1P9WA 1G18A 3ZDQA 2PLFA 3GJ0A 3PEYA 2O8CB 4DSOA 4Z8XA 2OLKA 1XU4A 2BCGY 1GNRA 3AGPA 5C2JB 1O87A 1EESA 2ODBA 3ZQ6A 3GLHA 1W5SA 2IUUA 2JLXA 2GF9A 4TTRA 3W3ZB 4B3GA 3FKSD 3IHLA 2VF7A 4LX0A 121PA 2J0UB 3QKRA 4PHGA 1XD8A 2HXYA 2XB4A 2ZRJA 5FOUA 4F91B 5E7MA 4K8OA 3X1ZA 1TU4A 1ZC4A 4ZDWA 4TMTA 2OCYC 1BMFD 2HJGA 4V03A 5LPNA 1E1QD 4YMSA 2C03A 5B64A 2QPTA 4QBHA 3KQLA 1ETUA 2GVDC 4B73A 1DBSA 3TSWA 1GP2A 4KSCA 2FG5A 5DSZA 3QSYA 1YR7A 4RD0A 4Q9KA 2ZAMA 3LD9A 2WWXA 1JR3D 2JAQA 2P67A 3O47A 3B60A 3AVTA 1W4AA 3SBEA 4W5HA 3K9NA 1DO2A 4O2RA 4OJKA 3FHOA 1GNPA 2J0UA 3WBJA 4Z54A 2FN4A 1AS2A 2AKAB 3AVYA 2AKYA 3UPUA 1E32A 4BFSA 2ZU6A 1LV7A 1HURA 4DUGA 1H65A 3HYTA 1VTKA 4HUQB 3THYB 1E2EA 1JR6A 1WA5A 3FE2A 3PEUA 821PA 5K8UA 1QG2A 4ASUA 3T1OA 2RGDA 4IDQA 2EW1A 4Q47A 4TL7A 1F2UB 1MH1A 4CGZA 3A1WA 1IJFA 3L0PA 4UXIA 2QN6A 4C0AC 1MR3F 4DCNA 3IQWA 2BJVA 2WSSA 5KSOA 2ZPTX 1W2GA 1QDEA 3UG7A 2AD5A 1CR0A 3G82C 2CNWD 3LO5A 1QVAA 4Z1MA 1XD2B 1U94A 4FI3C 1P61B 1P2TA 3GLIB 3ZGXA 2I4IA 3FWYA 3MUFA 1KGDA 4UXHA 2Z6VA 1WQ1R 4WW0A 3HU1A 3U7EB 5KOYA 4LYAA 2WMOB 3OESA 2HLDD 5M04A 1US8B 1E0AA 4HUQA 2XTZA 3VNVA 3ZVLA 4PAMA 2CJWB 4TLAA 4B74A 3GPLA 2DWPA 3C16C 1GL6A 1QHIA 3WYGA 2OZEA 2YWEA 2QTFA 3EAQA 4JJKA 5KSZA 4IVRA 1CRQA 4CIDA 3K09A 4NH0A 2BJWA 3BXZA 1K8RA 1N6RA 1N6OA 4DCVA 2R6FA 4Q4JB 5KU1A 1AA9A 3PFIA 2D06A 3RS4A 3U3MA 2ATVA 2BWJA 3F3YA 2IS4A 2MMCA 1OHHA 1XFAA 1J8YF 4EPRA 3TUZC 4TLBA 2OO7A 4LHVA 2A5DA 3QXHA 4BLTA 4M2LA 3IO5A 1TQ2A 4AWXA 1RYHA 2XZPA 2X2EA 3QJYA 1RRFA 1X6VA 1US8A 4MRSA 4B44A 2UZIR 1M1YE 5FI0B 5JFGA 3BK7A 2WPDD 4GI7A 4A0FA 4FMDB 1G8FA 1G3UA 1QHHB 2GKSA 3NHBA 1KO8A 3MWKA 4NE2A 5D3QA 2W58A 2FGJA 3RWMB 3X1DA 2IS1A 2WVJA 1MO3A 2DFLA 3P4YA 1O3YA 1Z6TA 4TMWA 4BQSA 2R6CA 3C14C 4HZUA 1TNDA 1Z08A 4RZXA 2QTHA 4DT1B 3WRXC 4PHHA 3ASYA 4JKIA 3X1WA 1MO4A 1N5KA 3KKNA 4OI2A 4IJMA 4CF7A 4Q4HA 1XJCA 2JJ2A 4C2TA 2GXQA 2OILA 3B78A 3CH5A 3OIWA 3F8TA 4PHTA 621PA 2ZJ8A 3THOA 5J4YA 4D4MA 3X1XA 5HR5A 1UEIA 4QBIA 3H4MA 2P3SA 1N0UA 5DHFA 1NSFA 4K81B 2R6GA 4DDVA 1OH7A 3QNUA 1YZUA 3U7GA 5C18A 4TWZA 3L43A 4R7ZA 5KTYA 3KJHA 2FV8A 2VF8A 2IHBA 2OCAA 4M9QA 5JEDA 4F92B 2G1KA 2WIBA 1UBEA 1AK2A 3HPQA 2YC2C 1R0WA 5EXTA 1Q20A 4UQOA 4KVAA 4Q4LA 4QRHA 2P0EA 4C0KA 2ZITA 4BLPA 2AWNA 2TMKA 3ZIAD 1KO1A 4JBXA 2NO1A 2ZYWX 4HATA 1KMQA 1NBMD 4Q9LA 4DHEA 2GJ8A 5JS8A 1JNYA 3O8CA 4FMCF 1OFIA 5JSZA 2D2FA 3QG1A 4UKDA 5DN6A 2KBFA 1BS1A 4XVRA 5E95A 4JBYA 3R8CA 1FPMA 2RGCA 4BRWA 1JECA 1QHNA 2I1VB 4IVQA 2WWFA 4QHYA 2MSDB 5GJCA 1YU9A 2VYFA 3LLMA 3WHKA 1TQ4A 4CEJB 3AV0B 1KY3A 4PQRA 2Q3HA 1G6HA 3DKPA 4AK9A 1Z5ZA 3R8FA 1XWIA 3KQHA 2DBYA 4V0KA 1K5GA 3K9HA 2GEDA 3GFTA 4NCJA 2JDIA 2ZIAA 1PUIA 1WRBA 5DLQC 2VHJA 1AJEA 1S1MA 3CX7A 1SXJB 1DOAA 2C77A 1GM5A 3GLGA 1AQYA 1A7JA 2QRNA 4I4LA 2XOKD 2IXGA 5JMTA 3KZ1E 4Q7JB 1QZXA 3W34A 1Q1ZA 1SGWA 1G7TA 2QGZA 3FMPB 2VA8A 4IRUB 4LPSA 4U02A 3K0CA 2ZSAA 3SR0A 1M34E 2B21A 4D2IA 5AUPB 1N2CE 1U9IA 1QG4A 4MKFA 5H68A 4YONB 1XPRA 2O8EB 3FDIA 1OKKA 2EWWA 4CEJA 2UZ3A 4PR0A 3UIEA 1NJFA 5KNBA 3RSLA 1Z47A 2JATA 2R44A 2ZSDA 1NVWQ 1I2MA 1KMHB 1CJUC 1Q57A 1W0KD 3DZ8A 3I62A 4M8NE 2C04A 5H1YA 1N5JA 5A4JA 3CPHA 1EX7A 1GITA 4YDHB 4ZCIA 2AR7A 1SXJA 4LZZA 4FCWA 3U3KA 3OAAD 5L3VA 4M53A 2C98A 4PZYA 1L8QA 3CLVA 5H8WA 1VCNA 2RH5A 3TUJC 1L4UA 1P7CA 4TL8A 4EIWA 1GKIA 2C9YA 4N0DA 2GJKA 4B35A 2CDNA 1TAGA 2XJ4A 1IY1A 3U6BA 4GNKA 4D0LB 3WP0A 3KDSE 4D4KA 4BEBA 2GCPA 3QPWA 5HTKA 3WXMA 2O8EA 3W5IA 2ZU0C 1JR3E 3CF0A 2GDJA 4G1UC 3T5GA 1UEJA 3F5FA 4KODA 2QRZA 5FTKA 1KMHA 2J1LA 4HLCA 1G5RA 3P1JA 5B30A 4OQMA 1FW6A 2F7SA 4RD6A 4OHVA 2NPIA 1GL7A 1A5TA 3BORA 1SVLA 4LJ6A 4D26A 1X3SA 2AL7A 4GL2A 1A1VA 2QY9A 2WBLC 4PAOA 4XSHA 3KKPA 1E9SA 1FFHA 3OEHA 4KO8A 1TX4B 5EE9A 2DWOA 3ND9A 4TYWA 2DFNA 4BEJA 1MKYA 2Q3MA 1QHYA 1U98A 3FFAA 3WMGA 1W44A 2YOFA 1E9AA 3A1VA 5J5CA 5FTJA 3B6EA 4HLDA 5DGXA 4AG6A 5JRJA 1S96A 3V4RA 4RY2A 1J8MF 2V1UA 4JLBA 4URZR 2V6IA 3W8NA 4ESHA 3AVVA 1N6NA 4QGGA 1E1RA 1R8SA 1U9IC 3PUVA 3SJBA 2QE7A 4A0HA 1RE0A 1T91A 1TQDA 2D7CA 2ZR9A 3H2YA 5B2ZA 4EJSC 1IN5A 2WJIA 4TLDA 1T0JB 3SN6A 2IS6A 4LC0A 4A2QA 4V02A 3BWDD 4CYMA 4EAQA 2EFGA 2PT5A 4BWYA 4LGMA 1E3MA 1Z0DA 3OFNA 3OIYA 4Q5IA 4I81A 4DB4A 3E1SA 1I4DD 4FN5A 4MYTA 4Q48A 4MGYR 4LHYA 5KHOC 1Z83A 3PVSA 1YR8A 1DE0A 3A1TA 2Q21A 3QOFA 2QG6A 4LYFA 4QJ5A 1GOTA 3TUIC 4XD7A 4MITA 3AVXA 1MABB 1T8UA 1OB5A 2GEUA 4OYHA 2ZI5A 2EQBA 2MMGA 3IIJA 1R0ZA 3KKMA 4A9AA 5EP1A 1TF2A 4U5XA 5CIWA 2EWVA 2GJAA 2AX4A 2IYSA 3L82B 3TKLA 4B6FA 1XZPA 1Z63A 4GOXA 5ELXA 1NKTA 1H8EA 3L2OB 5BW8A 1S3GA 1SHZA 2QENA 2ZJ2A 3H84A 3BE4A 1XTKA 1P2UA 3KTAB 3SNHA 3TQCA 1YZLA 3QBVA 1R5BA 4QG7A 4CDGA 1G7RA 2QPOA 1CR4A 2VLIA 1G21E 2XSZD 2WMNB 1UADA 4TSFD 2AHOA 3QI2A 4M1SA 2AXNA 1FQJA 5DIFA 3SE0A 2R2AA 3UMFA 1KI8A 1CJKC 2CK3A 2FOLA 3LQQA 3UWKA 2Q9BA 3DDCA 5CK5A 5FOVA 4C3ZA 3ZD7A 3ADDA 2ZE6A 1BOFA 1MABA 1T4GA 2J7PA 5CITA 4RKEA 3QBTA 1AQUA 5HCIA 1GIAA 2C9CA 3AGQA 1FTSA 1HQYE 4TTQA 4GOJA 4FWIB 1YRAA 3S1AB 4BRUA 1RFLA 5FTNA 2XEXA 2EFCB 2EVWX 3B82A 2X1VA 1AGPA 2ZE8A 5J4LA 1B0UA 4JT2A 1SVOA 1G291 3DHWC 4OQFA 4B2PA 3KTAA 3AF1A 5JLJA 1Z6XA 2YINC 1IXSB 1NIPA 5KSPA 4F4JA 4PAQA 1Z3IX 1E96A 2IF0A 5BN3A 4E22A 1AGRA 4NCIA 2REXB 4RZ2A 2REOA 4L5BA 4YMVA 1NG9A 3I4LA 3ND8A 1E2JA 2IW3A 3CF2A 2WV9A 2YNMA 4URYR 3TJZA 3C8UA 5FR1A 4YQFA 1AS3A 1FQKA 3UATA 1G17A 2AWOA 3IPYA 2OE2A 3B5JA 1ODFA 3I61A 1FMJA 4JYCA 2OCPA 4ITRC 1EFRD 3ZS9A 3GLIE 3S1AA 2GCNA 4M0LA 3U6KA 4PPFA 3OIUA 3BB3A 5BYKA 3FB4A 2ZR7A 4URUR 1E2HA 5SZJA 4LHXA 4PZLA 3FMFA 5FOTA 2QI9C 1XXHB 2N1BA 3VR4A 2Z43A 3DVLA 4DIDA 4D6PA 2PLRA 4LHWA 4IKEA 1KAGA 5FR2A 4NHOA 3DEFA 1JJVA 4XTCS 2QROA 1DAKA 2ZI9A 3B1XA 1JAIA 4HI0E 3LW8A 4BFUA 1YZKA 3IILA 2REBA 4X8MA 3SU8A 3A1UA 4V0LA 4QGAA 1G16A 1E2IA 4M1KA 3JVVA 3ETLA 4I1VA 1NL3A 3ZYCA 2IEZA 4OI4A 3VKWA 4R2HA 2NO9A 1SULA 3SHWA 3QXXA 4C4PA 3I1FA 5AK0A 4AKGA 1OB2A 1CJTC 2RGNA 1W46A 1FNNA 4HSEA 2RHMA 2PZGA 3QENA 2Z83A 1DTSA 4PC6A 1HY3A 4MUBA 3SEAA 3D6TB 2OLJA 1XTIA 4YMUA 2PMDA 3HJNA 3RNLA 3K9GA 3LNCA 3VAAA 1VHTA 3KUDA 3L0IB 1SVWA 4OHXA 2BC9A 4A6PA 1W2HA 3B85A 4UJ5A 3IBYA 1E9RA 3P27A 1XTQA 4OQXA 2DY1A 4BFVA 4LV8B 4JVSB 2BBTA 2GRJA 2J41A 2ZRMA 4OI1A 1N3BA 1W0JA 3P4XA 4ZV4A 3H1TA 1KK0A 3HDTA 3TVTA 3UK6A 1A4RA 4LBYA 1N0VC 4NYIQ 4PSAA 1J70A 1X8LA 3NBXX 3GP8A 2G1JA 2Y8EA 3NDBB 2G9NA 1QHSA 4LI0A 3AF2A 1Q1EA 3WNCA 4UXJA 3DKVA 4P32A 2AD1A 1DAIA 1UKVY 2RGBA 1ZYUA 4BFZA 1T0HB 3VKGA 2V3CC 5ANRB 2YWFA 4GDFA 2OT3B 4BLSA 5FPKA 1G3QA 1HYQA 3PR1A 4JL5A 1N5IA 1M8PA 1XEWY 4W9MC 2VTKA 2WJHA 3QPUA 5FPSA 5KNCA 5FUYA 1YHNA 1FUUA 1YJ5A 2PX0A 5AUQA 2P5TB 3IUYA 3QKSB 1Z8FA 3QY0A 4B71A 4HAXA 1GTVA 2F6RA 1G7SA 5CLQA 2EYQA 4EQ6A 3ICQB 1T9HA 2ODEA 3H86A 1DELA 4JLOA 3QVUA 2CL6X 5BWMA 2XJ9A 3U4QB 1Z0FA 3LX5A 1ANKA 1KNXA 4G3XA 4FMCB 3T12A 2XB2A 4B43A 4OL0A 1S8FA 2ZSEA 4ZKDA 2QL6A 3GFPA 3N5CA 1OT3A 1LTQA 2JIZD 2J3EA 4TQAA 3DMDA 1QHGA 1KNQA 4PPQA 5E7IA 3FKSA 1YZGA 3M1IA 5EE0A 2VP0A 2Z5FA 1XTSA 5EZ6B 1NLYA 5KDDA 1AN0A 3K0FA 1CP2A 2ZM5A 1XEWX 3VTKA 4EUNA 5F98A 3QKSA 2WJYA 3SS8A 3RANA 2V7QD 1CR2A 4RJLA 2GAAA 1G6OA 1BMFA 2F55A 1E2FA 1VECA 2CLSA 2O0JA 4DLYA 5TDHA 3ECCA 1Q0UA 1E1QA 1ZNXA 2RAPA 2ZI3A 4DXAA 3ASZA 5SZKB 3FKQA 4UNNA 4HLUA 2O0HA 2KI5A 4JL8A 1TU3A 5JJIA 2YOGA 5CM9C 3ZZ0A 5CDFE 3FTQA 4YXWA 4EFMA 1M6NA 4ILEA 1LS1A 5GADl 2W83A 4G5QA 1CU1A 3AVOA 2BBOA 2ZRIA 5G3ZA 1EX6A 1MO5A 3ADBA 1W4CA 3PUYA 4DEXA 1JR3A 4TLEA 2HT1A 2OHFA 3O8DA 2C5LA 4Q1BA 3BD9A 5GJWC 3KJIA 4EPWA 2F1JA 3QG5A 2QGNA 2ZRKA 1MT0A 1GDDA 3M0EA 3IGFA 4DCUA 3EWAA 4TT3D 1KIMA 4LJ8A 2OG2A 3EIHA 2RB4A 4NZYA 5IK2D 3C5HA 2GZAA 4NP6A 1Z28A 1KZ7B 1NY6A 4GFDA 4DLRA 4CRWB 2JJ1D 1ZJ6A 2FPLA 1QBKC 5G41A 4HB4A 3C7KA 2IWRA 3WNBA 2R8RA 1VPLA 4PANA 3EWSA 5AUOB 4FCVA 4PQYA 4DC9A 4UNQA 3QF7A 1GKYA 4NU0A 4OK3A 1CIPA 2H57A 4OHYA 3NHAA 5A0FA 3QVVA 1X86B 1FMLA 3IHWA 4V0ME 3QE0A 5GVSA 2CNWA 5FTMA 3BS4A 3KKOA 4E03A 1T3LA 1W1WA 3M6AA 5FPTA 1GRQA 1TMKA 4MYHA 4CVNA 2O8CA 2PEZA 1AS0A 2B8TA 2CMKA 4LRWA 2FX3A 2HLDA 3REFA 3MG9A 1X8KA 4C0SA 1I4TD 2IT1A 2FMXA 4PZZA 2ZAOA 5J40A 1TF7A 2PL3A 1KSGA 1U8YA 1VYTA 2X19A 3WBKA 4DWJA 3A37A 3U61B 4HLUC 3RS0A 2HYIC 1P9NA 2LCFA 3AVPA 4TMZA 5TY0A 4NTZA 1RVDA 1E4VA 4BPBA 3W6NA 1DG1G 4NBSA 2A2ZA 4RSGA 2ZRLA 4RD3A 1D6JA 2WZQA 2IHYA 1IN7A 4DLSA 4C7OB 2WAXA 4GRAA 1M74A 1OH5A 3GQBA 2ZTSA 2QEQA 5CB8A 1M7GA 1CJVC 1GFIA 1LFDB 2BDTA 1Z22A 1RRGA 2WSMA 3A4NA 3AF0A 3AF3A 1OLOA 2X8AA 3CNLA 2IUTA 1JQLB 3LLUA 1FZQA 1CBUA 4ON9A 2WPDA 3GJ7A 2GWHA 1ZD9A 4P4TA 1N6IA 2BHRA 4QJ4A 4DSUA 5FH9A 4IOJA 1AKYA 2P5SA 3GCGA 3NC0C 4ZCMA 1N25A 1IXRC 2ZVPX 2IUSA 2P6UA 2D62A 1OPXA 5AJVB 2ZYTX 3TMKA 1XJQA 3KQKA 1JBKA 2OFXA 3N70A 2JLSA 3K0SA 1RRCA 3THYA 1KY2A 5E7JA 3NIBA 2ORIA 3RS3A 3CPEA 4ZO4A 2LWIA 5HKKD 4NYJQ 3OE7A 3SHFA 3EZ6A 2GZDA 1E9BA 1DADA 1F2UA 4KSBA 3A36A 3I8XA 2BVNA 5EXXA 3O8RA 5DE3A 2FF7A 2QMHA 4QL3A 5IRCD 2QP9X 3QQ5A 4LBZA 3SOPA 5K8LA 2YJTD 2PJRA 1U8ZA 2GA8A 2IBMA 3LH5A 4FIDA 1XD2A 1DPFA 4C30A 3T06B 4I1UA 3GLIA 2QQEA 1VG1A 3LXXA 4JLVA 2A78A 4A4DA 5EUQB 4B6EA 4OHZA 4MKGA 2RGEA 2CJWA 4DUGD 1GUAA 5DYIA 3ZIAA 1KO4A 4Q1EA 4Q1DA 1P75A 3QKTA 3WRYC 3OEED 1XZQA 1RRPA 1EFHA 2G83A 3QEOA 4M1WA 4FMBB 4AKHA 5A5GA 1RW4A 2RGAA 5LB2A 2G3YA 5JJLA 4Q4JA 1XEXB 2Q6TA 3EC2A 5UKDA 1WE2A 1UFQA 3CW2A 2BMJA 3CR8A 2IYTA 3L8ZA 2PX3A 1U0JA 1XXHE 3LBIA 4PXAA 4RZ3A 2VSOA 2P6NA 4Q03A 1OXSC 4N0EA 4X8OA 2ZSFA 1IM2A 2K5UA 2DWQA 1TPZA 2QAGB 4AYWA 1U90A 1XMJA 4G0NA 3THXB 3ADKA 1Q44A 2XITA 3K1JA 3Q5DA 1DAFA 1JB1A 4WXRA 3RVBA 4KXFB 1U0HC 2DHRA 5KYKA 3J81k 1QHHA 2ZRBA 5TMPA 5P21A 5TV2A 2R9VA 4TYPA 3KB2A 4IDHA 1ONBA 2XOKA 4DLWA 4F7WA 2ZJYA 1U99A 4OI0A 3CO5A 1R5OA 4DT1A 2ZS7A 2CCKA 5JECA 3RHFA 1UJ2A 1SZPA 1UPTA 2R65A 4V0OA 2QSZA 1KJWA 5FUVA 4AYTA 4JYBA 3U44B 3Q3JB 3WY9A 4JIMA 3PENA 1E9FA 221PA 1A2BA 1Q3TA 1ZM9A 1D8TA 1LNZA 1M2OB 1W0KA 1ZNWA 2QAGA 3PG5A 1SVKA 2A7QA 1IONA 4PQFA 3PEVA 4QGHA 4MA4A 1JEDA 3ZQJA 2G88A 3LW7A 3OAAA 2FH5B 2F43B 5F9HA 1ZINA 2J87A 4Q02A 4EJSB 2ZRAA 1Q12A 1YZQA 2QTVB 1KSJA 2JJ8A 1E9EA 2VL7A 4ARZB 1FOEB 4QM6A 1F5NA 2OSBA 1B23P 2KE5A 1ESNA 1DEKA 2ZANA 3IBGA 3AB3A 3SFVA 2B7BA 3LFUA 3TBKA 2IC5A 4Q7MB 4LPKA 2E1RA 1E2LA 1UKEA 1NLFA 1BO6A 2JASA 2G0NA 1AZTA 1GG2A 3GLFB 4KBFA 3D7MA 2FFAA 4IXMA 2GVZC 3CUEF 3RC8A 2Q9AA 1F6BA 2QMOA 3C5CA 2JJ2D 2IEYA 3G5UA 1P60A 2ASEA 4MGKR 4F4CA 1NKSA 1KHTA 4L16A 5CJPA 2CL0X 2F43A 5CJ2A 4EJSA 2IX3A 1HA3A 1P72A 3RLFA 3UKDA 3L8YA 2ZJZA 2WWWA 4ARZA 4NPHA 3BIFA 4H9GA 5LBIA 3QEJA 4CT4B 4XVUA 3EPJA 1W36D 1E94E 4WAUA 4UNPA 1P9RA 3THWB 1ZNYA 3K70B 4CW7A 1OJLA 4TMVA 1WBBA 1SKYB 4DJTA 2ORVA 3CZPA 5EXSA 3I3SR 4KLNA 3GLFA 1Z6YA 4ZPXA 1RPZA 2IYRA 421PA 2QAGC 3E5HA 2J45A 4US1R 2JLRA 1GWNA 1DG3A 4D25A 2J0QA 2VP5A 2VSXA 3VKHA 4NCKA 2H92A 3ADCA 1KTVA 3TAUA 1R0XA 3KB1A 5L8VA 4R9UC 4P4UA 4JJZA 4JBWA 5EJEA 5CDFA 1T3SA 4M1TA 5CB6A 3AKYA 4MUAA 2BM1A 2QPAA 1NLZA 3T15A 5EE3A 3UXMA 3EZFA 1TL7C 3SBDA 1LF5A 1HE1C 5TB5A 3SDZA 3VQTA 5KO2A 3GJ5A 4I1SA 5KDOA 3ZZTA 3PXGA 1BIFA 2QBYB 2J46A 4EFLA 1EK0A 2CCJA 5FPYA 4GMDA 3ZZUA 5JI2E 4NCNA 1NMXA 2GEVA 3CWZA 2XSZA 4TSFA 3GEEA 2O8FB 2ZRDA 1DS6A 4POAA 3TH5A 3W5JA 2WJGA 1XNJA 1PLJA 1VG9B 2B7CA 4NYIR 3VX4A 3B13B 4D82A 2H18A 1YR9A 1XMIA 2N42A 1OIXA 2FSHA 4B76A 1IY2A 3MFYA 3PIRA 3VU9B 1Z6GA 3CRRA 4KFSA 1TUIA 5G3YA 1ZUIA 2KSQA 1OKKD 3RS7A 3TR5A 1P6XA 2JLYA 1MV5A 1ZM4A 3LQRA 3D8BA 3BH6A 1OFUX 4URWR 2PZEA 4KCGA 2AFIE 3N2IA 4V0MA 4ZDIA 2QBYA 2XXAB 1COWD 3FHTA 2ZETA 3TIFA 1I2DA 3GJXC 3UWOA 2NZ8A 2J9RA 1R0YA 2DFTA 2BEKA 3CZQA 4CEHB 4BLOA 2XTNA 2GXSA 3KFVA 5L3SB 1GL9B 2MSEB 3K70D 4YLGA 1OH8A 3HWSA 4MYCA 3A58B 3MD0A 2VPPA 1Q1QA 4JZKA 1G8PA 1AM4D 2HV8A 1E9CA 2W2XA 4D0NA 5AR1A 3AM1A 1ZD1A 5F3WB 2V8OA 1EFRA 1D9XA 4TQUS 1KZGB 1NVVR 3QPVA 2Z4SA 2RMKA 3BOSA 4QOSA 3K70C 4IEIA 1UBGA 1CXZA 1T6NA 3CRW1 3ZS8A 1LY1A 3T34A 2X2FA 4WVFA 5AJZA 3HP1A 5E4FA 1KI9A 1OIWA 1UF9A 3KJGA 1RC8A 4BFWA 3FHCB 3R9XA 1HE8B 2W6JD 4RZUA 5LDDC 4B3DA 2LKDA 4HB2A 1IN6A 2GK7A 1NG1A 4V0NA 3RC3A 4A2PA 3SYNA 5JEEA 1IBRA 1GRNA 4ZDKA 1N6LA 2V4ZA 2QP4A 1KDPA 2KJQA 1II8B 3WHLA 3E70C 1OIVA 3IDQA 5G53C 1CULC 2H5EA 2YV5A 2WTUA 1RZ3A 3BFVA 1BH2A 5CYOA 3TQFA 2IYWA 3QXJA 4KLZA 4LY6A 2CXXA 4G5SA 4IFBA 4Z8YA 4DVGA 4EPYA 3OHMA 2A5GA 3W3AA 4R2IA 5HZKA 1LB1B 5DNYB 3DM5A 1KDTA 4L15A 2VHQA 1FTNA 4GOKA 3BH0A 2ZJ5A 1XB2A 1DAGA 1E0KA 1GAJA 4DLUA 1K5DA 4JT4A 4JLDA 5JWOA 1D2EA 1YR6A 3Q9LA 1OSNA 4FMDF 4IW3B 1Y63A 2IXFA 2JLWA 3AP3A 1II8A 3K8YA 4OJQA 4GPTA 3W90A 3HU2A 3HPRA 4URXR 4JL6A 1R5NA 3VR1A 2CEAA 1CTQA 2ZSBA 4LJAA 2RCNA 5JHGB 4QHSA 4RD4A 1V43A 2ZJAA 1CKEA 5JCZA 5DYGA 2F3TA 4WOPA 4O3MA 2Z0MA 1E6CA 2FGKA 4GT1A 1NBME 3CM0A 5CIQA 2CE2X 1Q22A 4AKIA 1JJ7A 1Q1BA 2ZUCA 2IYLD 3CKLA 3QF4B 1KI1A 4QFMA 4A15A 1XP8A 1EGAA 3RRZA 1A2KC 3R7WB 3ZJYA 5BYJA 5D3MB 1Z6AA 2Q3FA 1NY5A 2CBZA 1C4OA 2O8BB 4MGIR 1WDTA 2ODNA 4GSYA 5FTLA 1OXUA 2W0MA 3PQCA 3A4MA 1GILA 4HEJA 4LJ9A 521PA 1G20E 4JLJA 5DO9A 4M9SA 3KXLA 4HB0A 3ZD6A 2I3BA 3AP1A 3N2EA 4XVQA 1CJMA 3TSOA 2XZOA 3AP2A 1PVOA 4AC9A 1XXHA 4PO1A 3JZMA 1T5LA 1JI0A 3P26A 4NKRA 3RRNA 3P32A 4GMXA 4JLPA 5LD2B 4OKSA 2GBLC 2GJ9A 3KUCA 5L3QB 5FOSA 3QF4A 4B2LA 3LBHA 3DL0A 4B34A 2P6RA 4OK5A 2RHDA 2GTPA 1ZD8A 4LHZA 5TXGA 2FZLA 3MWJA 4PPGA 3FMOB 1WBDA 5BN5A 4Q01A 1P5ZB 3SFZA 2W6ID 3RRYA 4B48A 4LV5B 4B33A 1NIJA 3MMPA 2QMEA 2GXUA 1E79D 1TADA 2F1IA 3FFBA 4G5OA 2WAYA 1ZM2A 2JIZA 5L3RA 2VP2A 3BRWD 2PCLA 2YZ2A 2ZRPA 3RWOA 1IY0A 2NO0A 3P20A 3BGWA 1UKYA 1HEIA 2FU5C 3AUXA 3TSZA 1TTTA 5IF9A 2VH5R 3EZ7A 3VMFA 4AKEA 5GVRA 3CPJB 1JPNA 1DVRA 1VCIA 2IYQA 2DR3A 4KYIB 4X8LA 5EZ5A 3W8RA 1Z06A 4D81A 4ERNA 3GEIA 3TNFA 2V7QA 1XJ0A 1E69A 3GJ3A 1IHUA 4FINA 3Q7PA 4NYJR 1A82A 4Q7LA 3ONWA 1BKDR 2GETA 3EG5A 1EFCA 2JLVA 3VR6A 3AUYA 3IO3A 1G5TA 5BQ5A 4E5UA 2A5YB 2UKDA 4PSVA 4U7DA 1OXVA 3MWLA 4LWZA 4TQ9A 3GJ4A 4E09A 5AJYA 2ZE7A 4O25A 5FOXA 2HT6A 1H8HD 1WP9A 3T35A 2JLQA 2J0SA 3U3RA 1TEXA 5GJBA 1T8TA 1TQ6A 3AVUA 1KKMA 4TYNA 2O5VA 1I4LD 3CBQA 4P31A 4A2WA 2J59A 4GBMA 4DSNA 5SZHB 2L0XA 4KITB 4RVCA 3Q5EA 2Q0HA 2JLUA 2P65A 1S0UA 2VO1A 2FSFA
chains in the Genus database with same CATH superfamily
3RYFA 1C3EA 1IVNA 3PVCA 1INLA 2NQ2C 2JGRA 2XMGA 3WVNA 4QGFA 4F0JA 4QVIA 3DW1X 3QGMA 1T0PA 4O3FA 4PZCA 1WB9A 4G8JA 2PGDA 4PLVA 3ACCA 5LOVA 5LQDA 3UHPA 1L2TA 4OQZA 4UD2A 4LFBB 4C76A 2WHQA 3PDIA 5AIAA 4A0QA 3CVWA 1C7EA 5EYPB 2JJ1A 4II7A 5BW4A 4B79A 5JWRA 1F6WA 4DQLA 3P0RA 3UT5A 2R6HA 1DC3A 4RLQA 3OURA 1PR3A 3K0KA 1R9MA 3ZWOA 3IOMA 3IPXA 1NONA 3GFQA 3JQQA 3MRSA 4AJJA 4DLXA 2I9KA 1GGHA 2VJLA 3EFOB 1THMA 5HMMA 2F9LA 1O4WA 3UUEA 1BYIA 1NLMA 2OV8A 2P1ZA 3JZFA 3L0OA 4IINA 4D9GA 3LVRE 1DBIA 4EATA 3U4QA 2FX2A 2QLTA 1B6TA 3L7OA 1MT3A 4LVOA 1WNTA 2R11A 3B70A 4HC4A 1IG3A 4JB2A 1KRWA 1PWXA 1MOZA 3U4CA 4TT8A 5CYPA 5HIKA 2ORYA 4XQGA 3GELA 2X40A 3WZLA 5TRTA 2EKZA 2I8LA 4XH9B 1JLSA 2CKDA 2C2YA 4YASA 4JP1A 1PQ4A 1OFVA 1SK9A 4NS1A 3ZJTA 2ZBRA 3IIKA 1EVIA 1L7XA 1H0RA 1QJ4A 1XAJA 4LOHA 4BS9A 2IY8A 2Y66A 2FRDA 3NEYA 1DZ3A 4HXEB 4RKQA 5FOWA 3RS8A 1YKFA 4L8YA 1EK5A 1KO7A 1QMGA 1PCXA 5EYPA 2OXIA 1ZHOA 2B20A 2QM7A 2VK4A 1TUEA 4UPEA 1NNEA 4NABA 2OKCA 1RE1A 3K0EA 3KAKA 3DOIA 3HS3A 2RI6A 1VL0A 4CMEA 3EDMA 2ST1A 2PEYA 2XRYA 4RCZA 1GQRA 2Q3EA 5EHNA 1XAIA 1T9GR 3MJRA 4NPAA 2WHRA 1FP4B 2HK9A 2BTQB 3LP8A 3J81A 3LCRA 5ICMA 1XPUA 3CIOA 2M2IA 3R77A 1X1QA 3NAMA 5JNRA 1EGMB 3H5NA 1JE0A 4PNZA 3CZ9A 4U2FA 1N92A 3SXPA 2ZBEA 2O8VA 3KL2A 4WNAB 4YO7A 5CEEA 2HHJA 3GJ6A 2ODWA 4F1KA 3FMGA 1K06A 4C3OB 3BL5A 5CH5A 5F2NA 2YC4C 3TZ6A 1IB6A 4AJPA 1DIBA 1OAAA 4GP9A 3K7EA 3HNRA 1KDOA 3CSDA 1TT5B 5FPHA 5P8WA 1GU7A 2ZS8A 3JAKB 4OVKA 1HEUA 1E0JA 3AFOA 3X1KA 3F2IA 1ZU4A 3MSCA 3P9YA 4OQNA 4CL2A 1Z29A 2VSFA 4OAQA 5DNEA 3WB9A 5FI3A 3D8UA 2QX9A 2JS7A 3H7IA 2WFZA 1W5FA 1EVYA 4NJMA 1NXVA 2HCBA 1WS6A 2G04A 1FP4A 1JIVA 3UOGA 2YWHA 4BB6A 3ZE1B 3G2PA 4CF6A 1KJZA 4MVXA 3C7AA 2CL7X 3H1PA 1QCZA 1ZCFA 1C9NA 4KGDA 3FZEA 5CK4A 2AG6A 2VRBA 3NT5A 1YR2A 3ZVNA 1HNWB 1LK0A 4GH5A 4LVCA 4D41A 2GKGA 4DBLC 4LGCA 2VRCD 1HT3A 1UDBA 1UXGA 1Y5MA 1GNQA 1KP2A 1NN3A 1SQ5A 2D54A 2Q3LA 1ETHA 4TS1A 2C31A 4JXJA 4XOUA 1W8IA 2H65A 4JD5A 4LCEA 3ST7A 3PEWA 3JAKA 4Q39A 1R6UA 3IAUA 4EG5A 1FDUA 5KNCH 3GVCA 3K5WA 5BVGA 3I39X 1JSRA 4HXYA 3I4FA 5KTRA 3RAJA 1RMQA 3QXSA 1E2KA 4UUBA 4DVJA 4INPA 3UJ8A 4BVHA 3ICEA 3LQ2A 3QXCA 3Q8WA 1F1JA 3QM1A 3EK2A 1QCYA 1NMZA 1N7HA 2O23A 2LDBA 3BXOA 3GGOA 3H2ZA 3C15C 4C2BA 5E3HA 3BILA 1DAEA 2G6BA 4JCOA 5CT8A 1M54A 3NC1C 3NTXA 2OGZA 3MTQA 4HAUA 4B9EA 4EMSA 1Y89A 2PMFA 2PX6A 3SR4A 1XCPA 2ZJ3A 4DEYA 4RTPA 3S2GA 4UNRA 3GMTA 1DARA 1OREA 3EEIA 3E81A 4K1LA 4DJEC 1GADO 1B8OA 4CQJA 2OYSA 5JRZA 4LMBA 5C8DA 3DLAA 3MINA 3V00A 2JCSA 2H4WA 4B81A 1BWSA 5LUAA 4XFJA 4G07A 4IV8A 1WW3A 4JGIA 4FB4A 4IG9A 2DHEA 2R1VB 4OJNA 4BMDA 4BVGA 4MJ7A 3W7VA 2O52A 3LI2A 2OCDA 3WB0A 1WDKA 4FX2A 3SC2A 3B1YA 3LWBA 4EO4A 3DAFA 2BYTA 4WIAA 3VFDA 2FK7A 1T9DA 4IZ6A 2IA5A 3RV4A 1YDHA 4OJYA 5J63A 4WY8A 5EKXA 1VKJA 3V9PA 1SCJA 3MTAA 4TYMA 4XGIA 2HC9A 3SI7A 2YWXA 5HTOA 2J3JA 2OBNA 3PCRB 4I2NA 3MMSA 4WASA 5H70A 4E30A 4EKNB 5IABA 1U0LA 1U3TA 1XTRA 3AJEA 3M9LA 5BSUA 2AVDA 4MO2A 3ZY5A 2GAJA 4JI4B 1FL9A 4DS3A 5EHZA 3IEXA 1RC1A 3EA4A 2OBLA 3NBYC 1RFGE 3O2SB 4LRSB 3WGQA 2C4HA 4B3BA 3LC2O 3L93A 1BN6A 1Y3HA 2C58A 2XUAA 2R1VA 4V39A 5DI3B 2V6JA 1NBMA 2XCLA 3P9KA 2HLNA 2P78A 1F3OA 5TJ9A 2JI9A 1CPYA 3OO1A 5NULA 2PLAA 4Q4HB 2JIPA 3WI7A 2BL4A 2CLDX 1WV0A 1HOXA 2V5VA 3FAZA 5A9RA 3V3TA 1KYQA 3KYCB 1ZCAA 1U8FO 2XCRB 1VSVA 2PYZA 1MBZA 5CU7A 3GNSA 3DC7A 4FLEA 4WCVA 3OH8A 4BQPA 1OC2A 1KKUA 4OXYA 3PD0A 3I5XA 3GN2A 3UPDA 1QO0A 1T1GA 4JOQA 5DHQA 1XDGA 1SUFA 1N2HA 3G2JA 1FNCA 2YWBA 4Z1MD 5IP5A 1HYBA 1W36B 5ECGC 3MQ2A 4B0PA 3FOEC 4L5AA 5GM1A 2VXCA 3PRHA 3BHIA 4O59O 3HKEB 3MLEA 3ELUA 5ALPA 4N41A 4W8GA 4E1AA 2PSFA 1LBTA 4DLZA 5CEFA 1O5IA 5DI3A 1BXGB 2X14A 1Z15A 3AK4A 3KYDB 3BAFA 3R5FA 4NBNA 5C1IA 4E5NA 1YK1A 2HRBA 2AFHE 2LRHA 4MUYA 4MYDA 4TLCA 4EPXA 1VLVA 4NX2A 3FYSA 3BMNB 3HR7A 1TW3A 3GRRA 4CM3A 5K8IA 4D3ZA 3SZRA 2VHTA 2FKAA 1JW9B 1C9YA 2BGRA 3DP7A 4G9BA 2P77A 4ZVQA 2WWTA 5FL3A 3DLBA 4Z7OB 2P3LA 4O4IB 4AW9A 2FEWB 3R7LA 1XYYA 4FTWA 2QMZA 3CSSA 3BK2A 1XCMA 3MF4A 4P4GA 1KI4A 4M99A 5E6SB 5JV5A 1P6QA 4P8RA 3CB4A 4BP3A 3OLYA 1YNOA 3NOQA 5AUNB 5ALNA 2C00A 3SEZA 1B4DA 5EC8A 2HRDA 1QDUA 3MS2A 3Q3EA 3GZNB 1EXWA 1Q16A 3GJTA 4XUGB 3ZY2A 3GLSA 4D6PA 4ER5A 2V55B 3C43A 3P96A 1ZIOA 3M4NA 3VSBA 1BXGA 3KYDA 2FPKA 1UBCA 1J9ZA 4LJ5A 4CV1A 4WZBB 2WNHA 3PTLA 2GF2A 4YAOA 2PUCA 1U0TA 1R6VA 4I9FA 2G9VA 4WQMA 1XUOA 1CR6A 1H2RS 4N40A 4A0RA 4NV1A 4EG4A 1OE0A 1JX6A 2C2XA 3BMNA 3RSOA 1GG9A 2MU1A 3GF4A 4IDPA 4PBTA 4M1ZA 4JUCA 1AKWA 5BMOA 5FFMA 2J5XA 2WTAA 2BMDA 3TDKA 2EFHB 3EIEA 4QPCA 4DV7B 5HRAA 3U44A 2N47A 4KWHA 3I6ZA 1Z56C 5E6SA 1UANA 3EWNA 1YKSA 2CJFA 1IB0A 1NX9A 1KHHA 2C4MA 5HKBA 3PUXA 1B43A 5K5EA 4BE7B 5U9CA 2WU1A 2WKWA 1WXEA 2QVCA 4KO2S 1TUBA 1ZLYA 1T3HA 2H51A 1M1UA 1A9OA 3HJAA 3EQZA 3R9WA 3I04M 5C7OO 1IC6A 3D4IA 1XU7A 3GO4A 2QU8A 2XXBA 2QN7A 4Y6QA 4BBZA 4ZAZA 5B2FA 3MZ0A 4X95A 2QUAA 1NJGA 4BLQA 1XZEA 1P4GA 1P4AA 1GPKA 2IYUA 3EUAA 3HDHA 1P0QA 4N48A 4PG5A 4CM4A 1S8AA 4YYZA 4M7WA 3AMVA 3LGAA 4H0NA 1WUIS 5AM5A 5JHHB 1J42A 2CD7A 3W2IA 2OESA 3HDVA 2FHPA 4W7SA 1Y8RA 3G23A 4NBUA 4NIMA 3OF2A 4XWWA 3TMAA 4BASA 1G8HA 3K32A 1E5XA 2Z58A 3CEAA 3IFSA 4OHBA 4II2A 1U3WA 1YS2X 5EKDA 4AIIA 2ZK7A 1VLHA 2I6SA 2IZ5A 2FMKA 3LUHA 1O96A 4LHSA 5CLGA 2ODPA 4FJ2A 2ZREA 1PL6A 1LVHA 2JCGA 4OQDA 2AV6A 1N75A 2G76A 1YXMA 4HD8A 5BRNA 2WUVA 1KQNA 1ZI9A 3C24A 3FLAA 1RD4A 1UKZA 4Q7KA 3VNUA 3KM0A 3NM6B 4KXMA 1AURA 4ACBA 4JIGA 1YDMA 3CV3A 4G0VA 4DB2A 3HBJA 3NORA 2Z30A 5TSDA 1C0LA 1YRYE 4IIHA 2PMCA 3BX1A 1A9QA 1RTTA 1QV7A 3BULA 1BROA 1E63A 1I9GA 1BX0A 1ZGJA 2GUGA 3KFXA 5FPPA 1LV8A 5J1TB 2D0PB 4NCAA 2VZLA 3FUWA 2IHNA 2PWPA 2QSUA 4PC7A 3IC5A 4MS4B 1JR2A 5FNVA 3E3AA 3L8CA 2XQIA 1XVIA 1YMVA 2VAVA 2VCEA 3KZMA 5DLYA 3WNQA 3OY2A 3EXG2 3WIEA 3LFTA 2G72A 1XD9A 3W6PA 1G64A 3CO0S 2GJ4A 3DV2A 3ENWA 4QTUB 4TV9B 3AKEA 3RLIA 2R4QA 4CG3A 1E98A 2MHCA 1AKEA 2NGRA 1XVLA 3F6SA 3WGTA 4LJLA 4ZJUA 1OFUA 4QVKA 4S1OA 1JHMA 3Q7RA 2DH5A 2XMQA 1LRJA 4BO5A 4AD8A 3UGKA 2ZXUA 1D9ZA 2I22A 3SDSA 4YQEA 3EDCA 2ZI7A 2F1RA 3FW1A 1ZH0A 3GLHE 4U8HA 4DLVA 2ZT8A 1SD1A 3U4AA 3FNFA 4PCVA 4UU8A 5DM1A 1KEKA 2H5JA 1JAXA 1W34A 2JK1A 2ZUWA 3HZZA 1CY0A 2XTMA 5FV7A 1IUKA 2XF2A 3MN1A 2UZ0A 1NRJB 4AURA 3UW1A 1T5TA 2WIJA 3K0CC 4MS4A 2FSGA 3NBMA 3KPWA 2E37A 2GN2A 3NVAA 4CIYA 3P19A 1EVQA 3DMNA 4CQNA 2WB2A 1K08A 1SCQA 3C3PA 3N6VA 3RSCA 3WADA 1X13A 3K0AB 4TV9A 4RJJA 2GPTA 1ZMOA 3IKTA 1JALA 1ZOIA 1LWNA 3HKCB 3Q7QA 3RUCA 4XASA 3D6NB 2QT1A 4Z0HO 4J1TA 3VZPA 4EG8A 4ARSA 4RTJA 4KFTA 3A9WA 1KZ6A 4K46A 1LBQA 3RSSA 2X2PA 1OJ7A 3FTNA 2VYND 2XZDA 1XLVA 3HR8A 1AB5A 2ATIA 5I7AA 4I55F 3VU9A 1HH4A 5A6VA 4NICA 3MXOA 5IKOA 2A0WA 1PS8A 3H8JA 4JS0A 3LT4A 5U4QA 1JWBB 5KTKA 1KQFA 3E18A 1XO1A 2C7PA 5MF6A 2OFWA 3IQXA 3PGMA 5IHPA 1R64A 3SPXA 1I5EA 1PGJA 3HDQA 3WV5A 4FDTA 3EFHA 1F60A 1GAXA 3A3PA 3G7NA 1E7MA 4HWKA 2WNSA 4MWTA 3CRQA 5FI1B 4MVJD 5IDYA 4B2IA 2QD3A 3OTIA 2X77A 4B3XA 4DR3B 3C0KA 4X3CA 4OX9Y 4UAGA 2O8NA 5AVTA 2VKTA 3K0AA 2P0AA 4PO9A 3T7CA 3PRJA 1NVAA 4LSMA 4YFVA 4INZA 4PLCA 5CNMA 4MV5A 3DDSA 1IG0A 2W6QA 3WLAA 2VNAA 3PLAE 2SICE 3KJEA 2YV4A 3ANLA 2ZBFA 3F5MA 4CMIB 5KOIA 2WR8A 3INTA 5EIXA 4G1VA 5AK4A 2FRVA 3WYNA 2HO4A 1CDEA 2AMVA 3HU3A 2VYVA 3OZBA 1PZFA 2WHXA 4IFEA 2PH7A 3VH3A 4RTRA 1RLIA 2OXCA 2NP6A 2H8GA 3GCDA 3PRYA 4HCJA 4TM7A 3KXIA 3ZBTA 3G5TA 3AKDA 1JFSA 3PNKA 1KFCB 5DYTA 1G4UR 1U4NA 2B4RO 2RI0A 3KPVA 3VR5A 1R7RA 3HV0A 1YVEI 4PX3A 1XVVA 1B42A 3JQCA 2ESRA 4G24A 2G1AA 4PYOA 2R60A 3U81A 1WZCA 2MIIA 4PS0A 3CEHA 3P9NA 4HRVA 4F4DA 1HUQA 4X60A 1RM5A 2VQSA 4HZGA 3TE6A 1YE5A 5CHEA 2P2ZA 3DQPA 4YV1A 5A2GA 1GNLA 4GYYA 4BO6A 1E4EA 1SA0B 2BN4A 1UOQA 3LDUA 4CMIA 2AN9A 5IVKA 4TMFA 3JYLA 1WY5A 4Q6WA 3COJA 2B4YA 1NUTA 2WJVA 1RQGA 3MJFA 1JLHA 3CJQA 5DP1A 3ULKA 3LA6A 1HNXB 3P9XA 1O58A 3BJZA 2C2GA 1H8ED 3TSAA 2PSDA 3W5DA 4IDOA 5A3QA 4CTMA 1D1PA 2OB1A 1DIHA 3OLZA 1E79A 1T1JA 3CWQA 3ZKWA 4EW6A 1DIGA 1CEEA 1KIFA 3TOVA 5EPEA 1P5JA 1GGMA 1DAMA 2B8JA 3SSAA 4BJ1A 2DFPA 1NU6A 5JQGB 4UAVA 4B6GA 1E4YA 4YH1A 2E4XA 4HUTA 1Y7TA 5ALHA 3GFBA 3WB1A 2HV9A 4Q16A 4NK4A 2P1DA 3CS3A 4YRKA 1Y1KE 2CK3D 2QZPA 1EFTA 2VDWA 4KBYA 5JBNA 3VR2A 3AF4A 3PWSA 1PFGA 4NU5A 1UZLA 1JWLA 3QV2A 2WZBA 1A7UA 2AFHB 1WDWB 2OMKA 2VHXA 1UC4B 2XA1A 1SA0A 4IJVA 1QXSA 2PHZA 3EW9A 2DPLA 2JA2A 4HQNA 1JHVA 4HPJB 4RO0A 4ZARA 2Q2QA 4EA7A 4JMPA 3JQ9A 2AN4A 4BVLA 4TS4A 4IJUA 3E0QA 5B5SA 3BDVA 2XB8A 3TD6A 4DLBA 1C8VB 4NG5A 4F93B 5BT9A 3DWFA 1ATZA 1UDRA 1PWYE 3I73A 4LY3A 5ALRA 1A72A 1BE0A 2QA5A 1JEYA 1MJGM 3BXEA 4GKJB 1GT6A 2VYCA 2JFGA 5JQGA 2H4JA 4OHRA 1N1MA 5ETJA 4E6PA 2G9RA 1NN0A 5D3MA 1DC8A 1Y37A 2OEPA 4UQLA 4NSNA 3M6FA 2Z9BA 4NRDA 3X43A 3ZCVA 1GRRA 2W2OA 4LNHA 1V3UA 3AXTA 1R0CA 2AFHA 4EVIA 4BJ6A 4WL0A 1ULZA 3H8SA 4BVBA 1D09A 1NNLA 2L18A 3TR0A 4HWOA 1SVIA 2Z04A 5FUWA 5KYVA 2BFAA 3QFRA 2IVZA 1XQVA 3IEUA 1DWUA 4GP7A 4OHCA 3VNSA 1NPYA 3ONVA 4BMOB 4MR8B 1X38A 4P58A 1BYUA 2R86A 3HG7A 2AEJA 4FD3A 1TD9A 3OM9A 2C3YA 4PGGA 3ZWYA 1O0SA 4ONEA 2I4TA 1KJYA 4FD2A 1J90A 4KQJA 4D3FA 4ZGBA 1EFUA 2AC4A 1E18A 2R6ZA 5ALYA 4ER6A 4YRZA 1G4AE 1T5BA 2PBRA 4C0JA 2HHAA 2GZHA 1X7WB 2NO4A 3W77A 5L3QA 3DA8A 3OZUA 1I7PA 4EGCB 4Y18A 1NVKA 4X1IA 4AG5A 3AIIA 4P5DA 2QZSA 3TTSA 4DSTA 2GESA 2NTVA 1GPDG 4ESVA 1QTQA 4BN0A 2OG1A 2FPMA 3AHFA 3UM9A 3L7JA 1AF4A 3QVTA 1QFJA 1EFPB 2HA5A 3ICOA 1L5VA 4ICIA 4G26A 4RDCA 4WK6A 1TE2A 4X9XA 5ALDA 4EQ6B 3WTCA 3NW9A 4A0GA 1PFWA 4R7GA 1W52X 5DULA 1DTWB 4PX2A 4W9NA 1QM5A 4IBOA 2H11A 5HP4A 3KYIB 4PC2A 5AKIA 3TG8A 4QYSA 1MPTA 1HV8A 3DO8A 1FYWA 2HFKA 1M34B 4TN5A 3C2QA 1PJAA 5D3ZA 3PC8C 1J0XO 5B4VA 3HVHA 4BC1A 3G0DA 1ESMA 4IH1A 4KVFA 4W1QA 1S2MA 3SXUA 3VAZA 4EFNA 1NR1A 2ZTUA 4X3PA 4YECA 3GLGE 3I58A 1UQRA 4RKFA 2C4TA 1RKUA 3CG4A 4C0BA 1AKQA 4YMTA 5BMVF 4BMXA 4XARA 3WOHA 1BVRA 8ADHA 2HREA 2OAGA 5CT5A 2JAPA 1R8QA 4IS3A 4X93A 3T61A 1RLTA 3K35A 1EFPA 3K9LA 1D5WA 1YRBA 4MWZA 1LLCA 1WJGA 2ZUVA 1YIDA 3ZWQA 3L4KA 2Q6LA 4Z9XA 4MAMA 1A1SA 4PWZA 3A10A 2BGNA 2NZXA 4ZXPA 3KOXA 5DWQA 3U9LA 1S9HA 4KO3S 1DTWA 4GR5A 4YAEA 2P4HX 5BSWA 1G9XA 3RM3A 4MIEA 2H8KA 3FPBA 5ECDA 3FYUC 1PJ4A 3NWPA 3WBBA 1KDRA 1W0JD 1JFLA 1R4NB 3D2CA 4N3NA 3KOOA 5IJXA 5AW4A 5KWSA 1GUZA 1K6JA 4IL5A 1DMRA 2DHCA 1G3MA 4IX1A 2HO5A 2YXDA 4CLEA 2Q27A 4K9DA 4QIHA 1IHDA 2FFBA 4R2WA 3WK6A 1II9A 2Y6VA 3LCUA 4JVMA 4QM7A 1D6MA 1TC1A 2PKQO 1P7YA 3CN7A 2B3TA 1BZYA 3B3FA 5TMEA 4BQRA 3PGJA 5B1DA 5SY6A 2GTHA 3TFQA 1JA0A 2F8LA 1MO6A 4R2LA 3NTUA 5INTA 2AMFA 3EC7A 3I32A 1SBYA 3ZWDA 2IS2A 4XDGA 1KZ1A 1Z07A 4YV2A 3DFIA 5ALJA 1QORA 3F6CA 2GFIA 4Q3CA 1LC0A 1QIMA 3T52A 2WVGA 3NNNA 1VYVA 2PSHA 1T4DA 2ZRNA 1NVXQ 3LDHA 3V3KA 3IJRA 1CFJA 4PZDA 3KELA 3QMMA 2FLWA 1DFGA 3LPLA 3T5CA 3DR3A 1JXMA 2NSDA 3ISJA 4HDNB 5B1IA 3WKBA 2GN0A 2JBAA 1K3UB 3DAHA 2ZSKA 2FWRA 1WHSB 2VRCA 2DPYA 3EXHC 3G5AA 1K75A 1XWWA 1EJ6A 2JHGA 5EL0A 3E9DA 4RGYA 1XTJA 3IJPA 4ME6A 1P0MA 4HGOA 4JQOA 3MRTA 3R8XA 3OM8A 1ZONA 5F2EA 5FWXB 4XUDA 3A6PC 1EVJA 1FE8A 1N57A 4MVJE 2BFFA 5DLDA 4CHTA 5KZMB 3TTWA 2GNOA 5T8KA 2B1JA 1VI2A 2UYYA 1JBEA 3JZAA 4TKMA 1WVGA 1G18A 4RM2A 2PLFA 2YJ3A 4IFIA 4Y9DA 1RKXA 3GJ0A 4HXFB 5DHRA 5AOVA 1E3WA 1SPBS 2DBZA 4K6FA 4G4SO 4MS1A 4ND3A 3IS3A 3A6DA 1GNRA 5LQCA 5C2JB 1FVXA 2I99A 5JU6A 2ODBA 2FJ0A 1QG6A 4Y2TA 4BHTA 3ZQ6A 3MFQA 2I1LA 1W5SA 3GLHA 2IUUA 3WQQA 2HJHA 4MWEA 1HORA 3HE3A 4AM8A 2GYYA 3HP7A 4HDNA 3FKSD 3M8KA 3PPYA 3PR3A 3QHPA 4LOJA 1EWTA 2QX7A 4LX0A 2XA9A 3C98A 3OCUA 3QKRA 3TLEA 1T2FA 3WNZA 3DB2A 1U1DA 2XB4A 5FOUA 3ONEA 2Y1GA 1I14A 4K8OA 1QWOA 4PG4A 4ZDWA 2WG1A 2VUIB 1BMFD 3QVJA 2TECE 4QAJA 2HD4A 3IB3A 2VWPA 4WLOA 2NYRA 3DMHA 4IUBS 3PJEA 4V03A 1ZVMA 3ZWMA 5LPNA 4LF7B 1E1QD 4PONA 4YMSA 1Q2XA 1E1NA 4GXTA 3RREA 1C50A 3CRZA 5J2UA 1L5HB 1J1IA 2VJMB 2QPTA 1RTKA 3KQLA 4A03A 4B73A 2A4KA 3H2GA 3SQNA 1DBSA 1RAEA 1GP2A 4KSCA 4X62B 1J06A 3QA9A 1JKXA 3OOSA 5EZQA 1W6RA 1EBFA 3QSGA 4J8PA 4J1SA 3OZAA 4BP1A 1DINA 4RD0A 3OJ0A 1Z62A 3LD9A 2VUUA 1QUEA 2JAQA 3FFTA 1SUBA 3G2LA 3JR7A 3AVTA 2JFNA 3SBEA 1XELA 3C70A 1DO2A 3TF5A 4O2RA 3QHAA 3AF6A 3S29A 3IXLA 5JS2A 4EBBA 2E5FA 2ZYDA 4Z54A 3G6WA 3AVYA 1H1LB 4I5GA 4XCXA 1E32A 2NX2A 1LV7A 5MN6A 4DUGA 1UXJA 3QU4A 4GEGA 4JNKA 1YQWA 4UHFA 1VTKA 2X7XA 2YYSA 4JU8A 4QRIA 1N2JA 1L7DA 2F1OA 2UVPA 4YRRA 2VT2A 1QG2A 1IULA 4JP3A 1TCVA 2HWWA 5EG5A 2VQFB 1EVKA 3BTSA 1OAOA 1VHDA 2P9FA 4IDQA 4MCAA 4Q47A 5EI5A 2VJMA 1L5HA 1F2UB 1NT2A 1ZKMA 4CGZA 1EFDN 1IJFA 1NRWA 1P77A 5IDQA 1Y6FA 1BFUA 1T29A 3GVPA 4M38A 4C0AC 4W5HA 3ONNA 4XLLA 5A05A 3MIZA 1JLRA 2IHTA 1EPUA 1F5SA 2AFVA 2BJVA 2C94A 2PUTA 3A1CA 3I64A 3D3WB 5KSOA 4QYMA 4ETIA 1KH1A 3W2EA 1QDEA 3KKEA 3G82C 1ZH2A 4ISBA 2CNWD 3MT0A 1QVAA 4NCBA 3BDAA 4Z1MA 3WKDA 1ECLA 1GFSA 1P2TA 1CUVA 1K8XB 1LJ8A 3L0YA 4M7OA 2ECFA 3ESYA 3PWTA 2Z6VA 2BONA 5TF0A 4EYQA 3HU1A 3NEPX 3UAGA 1QC5B 4LYAA 2WMOB 4MP8A 2I4RA 4UCQA 5CBPA 1RKVA 1QZZA 4Z0TA 4QELA 3SP1A 3VNVA 2RKBA 3STVA 3SHQA 1P45A 4OHUA 3PVZA 4BQQA 5CPFA 4YRDA 2OZEA 5IM4F 1UP6A 1Y48E 2WF6A 2NZUG 1RLMA 2WV7A 2DWCA 3EEFA 5AW9A 3WG9A 2GN4A 3ESBA 3PQEA 1JJIA 3LIPA 4CIDA 4GLFA 2EW8A 3I0MA 1EBUA 3MUOA 5DIZA 4BO7A 4GOOD 2BJWA 1JQ5A 3DMRA 3BXZA 2QW0X 3OOHA 2GD6A 1DCFA 1RAIA 1RBQA 5BYBA 1FXUA 4FNAA 4BMPB 5IF3A 4O8ZA 5KU1A 1SOMA 3LVFO 4NS4A 2XF8A 4I6EA 5TPZD 3KFLA 3RJ5A 5ITZB 5IXYA 2ZRQA 2IS4A 1XFAA 3TUZC 2XYPA 1NI5A 5EQDA 4EX7A 3W1VA 1RYHA 1LFAA 1QC5A 2Y2VA 4Y2UA 4EY5A 1E1LA 3FNIA 1QFZA 1M1YE 3OWOA 2IGTA 4JJ6A 1HI9A 3BK7A 3ZPXA 2IOQA 1G3UA 1S2NA 4R81A 3NUQA 3QX9A 2EF1A 5FO1A 4AN0A 2W58A 4DNOA 3QXGA 1MO3A 2DFLA 3P4YA 1K7CA 4TMWA 2H2IA 3JYOA 2E2WA 3WIOA 2Y1LA 4EARA 3C14C 3NHFA 4ZOLB 1Z08A 1DOZA 2FMHA 3LIIA 4DT1B 4DY6A 1PT5A 1K1EA 2ZIVB 4L5CA 4Y2XA 1A7KA 4ZQIA 1V5FA 3Q0EA 4OP3A 1PFUA 4NC9A 2V6GA 1MO4A 1N5KA 4JELA 5TMBA 4PU0A 3R3ZA 4IJMA 5AVJA 2ACVA 3LPMA 5J2TF 2OILA 2VDPB 3FY4A 1KZYC 4C2TA 5GPBA 1XDDA 1DQSA 2CB0A 2B9VA 4D4MA 3RH0A 1FSZA 2XCIA 1UEIA 4EO7A 3FRJA 3QX3A 4W1SA 2W6CX 4XUEA 5L53A 3KPYA 4K81B 3BFJA 5DOZA 1EXNA 4AP9A 3B38A 4TWZA 4JEHA 4LN1A 5A3RA 3FFXA 3MJSA 4DLLA 1O57A 1SCBA 1YFZA 4HQOA 4M9QA 5SYAA 4BTVA 1BD4A 5HFAA 2WIBA 2YFHA 1J8FA 4ZOLA 1P2BA 3RTDA 2YC2C 1GV1A 2ZTVA 1Q20A 2QWXA 3ZCQA 1T0IA 2GERA 1HPLA 2X6TA 4KVAA 3O1JC 1JXAA 1C1XB 3T6KA 1T9ZA 3LSTA 2Z9DA 4ZWNA 3CEJA 1E77A 4RF5A 1U3GA 1PJZA 2PX5A 2NO1A 4FFRA 2ZBQA 4RVGA 3ZGLA 4HATA 1JG4A 4EUSA 3ODGA 4S12A 3GRAA 3WNVA 5JSZA 2D2FA 3GJRA 5LNK1 4JBYA 1UXIA 3A4TA 1FPMA 3HEAA 1WX1A 3ZV4A 1RT9A 3KJFA 4BRWA 1QHNA 2I1VB 1SOUA 3GROA 4QHYA 4XVHA 1CQIB 1K66A 2XRFA 5DU2A 2VYFA 1YC2A 2C2WA 4TV8F 4IMRA 4AQYB 1RBZA 3AV0B 3E3NA 4UOZA 4REQA 1PQYA 3UJPA 4UBOA 1N33B 3L4JA 3M49A 2Q8NA 1Z5ZA 3QLTA 2C2MA 3SKXA 2HSZA 4XXHA 3GFTA 3USCS 3R2JA 2ENUA 4O2AB 5F5XA 1RPJA 1PUIA 1NULA 3K16A 3UXEA 4NAHA 5DLQC 3RRFA 2VHJA 1DLJA 5KB3A 4K9PA 2YR0A 1DOAA 2XB6A 3ZK8A 2C5SA 5KNLA 3GLGA 1AQYA 2QRNA 4JI1B 2XOKD 2VSQA 2DQYA 3BK1A 3HNOA 3ZWWA 2PQ2A 1SUAA 3K5HA 3RHTA 1Q1ZA 1UR5A 3NWBA 1YRQA 2JAUA 5C7LO 1YUMA 1W9HA 1W73A 3JR3A 4LS3A 4C1BA 4D2IA 4LF8B 1DKRA 1QGOA 1R15A 1U9IA 3G2OA 1QG4A 4L9AA 4XSVA 4XX0A 4MPRA 4OH7A 5H68A 3WO1A 3QU7A 3FDIA 2V45A 4LOIA 2W48A 3EVZA 2QL7A 2VAPA 1GQSA 1XHEA 1Y1TA 3HZOA 4RTOA 4E5MA 3C8HA 4H4DA 4N7JA 1JJFA 5JARA 4K87A 3ISVA 1HC7A 1W0KD 4PYMA 3A25A 2VTDA 3NRBA 3RAGA 3U0VA 5I8PA 3O95A 5CB0A 2BGTA 3G2QA 5I5EA 4JR2A 4WTOA 4B3MB 3CPHA 3IUJA 4OHKA 5A5VA 1NJ8A 5BN4A 4FCWA 5ERGB 3GJQA 5L3VA 2FP4B 2B4AA 3IAFA 2C98A 2A7XA 4MO9A 3LBYA 3N39C 4NJEB 1VFPA 4FIZA 4RJKA 5CT4A 2EAUA 5D51S 3TUJC 5ARCA 1P7CA 4JDUA 1HL7A 5HIJA 1PFQA 2VYNA 1SRRA 3OLCX 2CDNA 1GRCA 1TAGA 3JRNA 3N7AA 1IY1A 4P4LA 4RE5A 4LGYA 4ZC8A 3T0FA 2ZTMA 1JEYB 3PD1A 1QH9A 1XNQB 3QPWA 3UJ7A 4TXMA 1JG2A 4L74A 5KVVA 3C6BA 3AOGA 3E7FA 3P94A 4DUYB 1P31A 2QRZA 1GCAA 1ZLXA 3IMCA 4NMHA 2VHEA 3P1JA 4HLCA 3FIJA 2GFQA 4TRJA 2X6QA 2F7SA 1ZISA 3LVBA 1JAZA 3PKIA 4YJ2A 2V58A 3RROA 4R2JA 1SVLA 3FR8A 2AL7A 4MVJA 1A1VA 3GRZA 3HYLA 4JJAA 5B12A 4BGEA 4PAOA 1E9SA 3NKFA 3QVGA 1V6SA 1TX4B 5EE9A 5HILA 5EZYF 2XCUA 3JWEA 1MJHA 2FP4A 4BMSA 4C7KA 4IHJF 1DKNA 2ZYGA 2P8SA 2R84A 3FNRA 1U98A 2RIPA 3F7NA 1DGQA 1W44A 5EWMB 5J5CA 3LLSA 1NVMB 4AG6A 5FAKA 2QX4A 5JRJA 4BO1A 5EKSA 1SUSA 3AZQA 3B51X 3W8NA 2Y71A 1WETA 1IXYA 1OU4A 1H6DA 1SJ9A 1RE0A 1T91A 2AMJA 4Y2VA 1GLGA 2LP4Y 3ES9A 2IIPA 4EJSC 5LLDA 1FY2A 1J25A 2F1KA 3L4EA 4N3AA 4UCXA 1LZKA 3N2LA 1VPEA 4LC0A 2PNJA 4D8VA 3BWDD 3AONB 2X5NA 1Z0DA 2OZVA 3W7AA 3WLRA 1P44A 4I81A 4DB4A 5B3KA 5BSVA 1SC1A 1UAGA 2Z6UA 3L7CA 2J07A 3TOZA 4MGYR 2QUIA 1QRUA 4WX2B 3R7FA 3TUIC 1PG5A 1GOTA 3MB8A 4FEEA 4MITA 1MABB 1WW8A 4M8SA 4B4UA 1U7DA 3WX0A 4FBGA 3KQYA 2GEUA 4PG6A 4Z99A 5EWMA 2EQBA 4YCJA 2MMGA 2EJTA 1R0ZA 3IIJA 3GDOA 3AC0A 3FAKA 5G1OA 1Y9JA 3R6GA 2GJAA 2IYSA 3L82B 3NVDA 3R0XA 4B6FA 1Z63A 1NJ6A 5BOSB 3LCVB 1NKTA 1H8EA 3L2OB 3SLRA 2H9IA 3U26A 1HFKA 3H8WA 5LXTF 3H84A 2DUMA 1XTKA 3TQCA 2HJSA 3D8TA 3KTAB 1YZLA 4YACA 4AZWA 3CZ5A 1BXRA 1LI4A 3WWEA 3BCHA 4UDXX 2VLIA 2YHIB 4MI9A 3KC2A 4YRTA 4BVJA 4TSFD 1UADA 1HNNA 4XM2A 3QI2A 4R6XA 2ZDHA 1K3TA 2XECA 3E3LA 2NSLA 4M1QA 5EJ2A 3B3AA 1OH6A 1T9KA 2QN2A 1DXYA 4MLCA 3LT0A 2H0RA 3SQDA 2CK3A 2FOLA 3JQGB 3LQQA 4C3ZA 3DDCA 1SIUA 1FRVA 5FOVA 2ZE6A 2Y76A 1JVNA 3MTDA 1MABA 3HJHA 1T4GA 4NECA 4RKEA 4CR6A 3QBTA 1Q7BA 4BNWA 2C9CA 4NENB 4E2FA 1FTSA 2SKDA 3KETA 4C01A 4GOJA 4BRUA 1ZN8A 2GARA 3HH8A 1ZR4A 1CHNA 10MHA 1UJNA 2GI4A 5BOSA 4LDQA 2X1VA 4PQGA 2I7VA 5J4LA 5LZ7A 1B0UA 4X41A 4O8CA 1Q0ZA 1NAHA 7REQB 3BA1A 5C4IA 1ZMTA 4OQFA 4B2PA 1PR0A 3KTAA 1Z35A 1WR8A 2B5OA 3COZA 1QH1B 3ER6A 1IXSB 5AVOA 3D4OA 5IFLA 4NOKA 5DOVA 4BRSA 1IBMB 4PAQA 1Z3IX 2YHIA 4WN9B 1E96A 2HDHA 2IF0A 2DSTA 5BN3A 2EX0A 3E8XA 5KYUB 3EY4A 3EXFB 4E5SA 2QRVB 2WD9A 4YMVA 5CYGA 1U63A 1M1YB 4MPTA 1E2JA 4R5MA 4WT7A 1F8XA 3RR2A 4EUFA 1QH8B 4C4YA 1Q95A 2WV9A 1J0BA 3HSKA 4Q3OA 1KVRA 4L2IA 1PGOA 2JCYA 4YQFA 4YY3B 4AG3A 4D3XA 2PFKA 2AWOA 3DLHA 1Z2NX 4OJMX 3B5JA 5AW6A 4OAOA 5KTTA 3IUBA 3Q6NA