1XTJA

Structure of human uap56 in complex with adp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
379
structure length
374
Chain Sequence
b'SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase p47
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 114
structure length 374
sequence length 379
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA02
5FOTA 5FTLA 4GNKA 5AJZA 1E9RA 1NJFA 1NMZA 5IT5A 3ECCA 1Z6XA 3AKEA 1IJFA 4JIMA 4RFVA 5H8WA 5F9FA 1FFHA 2QMHA 2GF9A 1QHGA 2OAQ1 3RWMB 1N3BA 5KTYA 1FTNA 3I62A 4NTZA 4GFDA 3A4NA 4URZR 1JB1A 1NVUQ 4JMPA 2V8OA 3TW4A 4BZPA 1DPFA 4C0LA 1J99A 1RKBA 5KSOA 4HZIA 4DCNA 2QRZA 1TPZA 1FTSA 1IN5A 4C0JA 2GBLC 1DAFA 1KJYA 1RJ9B 2J46A 3I72A 1U9IC 2W83A 3BJIC 4TN1A 2VP5A 3P20A 4KHZA 4RVCA 4N0EA 1GIAA 2DYKA 1KJWA 4PHTA 4RD4A 5EXPA 1GM5A 1XD8A 3GEIA 3IILA 5ANRB 2H8KA 2CL7X 2G6BA 1KI3A 2XX3A 3ZZUA 1KKMA 3GJ8A 3AVXA 2OZEA 4OHWA 1KIMA 2DWQA 3VKGA 3KJHA 2IYVA 3SYLA 3TGPA 1ZU5A 3BORA 2GK7A 3UATA 2GDJA 4NYIR 3X1WA 2ZXUA 1DEKA 4MUAA 4AKEA 1CULC 4HLUC 2MMGA 1J8MF 3OIVA 1RRPA 4X8MA 2B8WA 1ZNXA 2WAYA 3FKQA 4KSBA 3WNBA 1HT1E 4CEHB 3GPLA 1HUQA 1Z2AA 3TH5A 4DZZA 1PZNA 1YZGA 3RRYA 4A2QA 4RD1A 3CO5A 2ZRHA 4LGMA 2XTZA 1FQKA 1J8YF 1II8B 3LFUA 5L8VA 1WB9A 3K09A 4D4MA 1COWD 1Q20A 2AKYA 3H84A 3JVUA 4MKFA 1MKYA 1NNEA 4N0DA 2R6DA 1Q3HA 2FSGA 3WRXC 4NONA 1W36B 2AD5A 3MFYA 4C9BA 4BFSA 1TEXA 3DVLA 4Q02A 3EPKA 4PO1A 1XBTA 2GRJA 2DPXA 4DDVA 3OFND 4D82A 3FB4A 2IK8A 4JLOA 3I3SR 4B3CA 2ZEJA 2WKRA 4ZDJA 3EZ9A 4QJ3A 4Q9HA 2I1VB 3I8SA 2ZRMA 3KXIA 1D2NA 1UF9A 2LKDA 2IBMA 4JYBA 2PCJA 4LJ5A 3ADDA 1HQCA 4Q1FA 1E9AA 3D6TB 2ZI6A 1UBFA 3THXA 1XEWX 2O52A 2ZR9A 3BK7A 2ZS8A 1ESNA 2XGJA 2CJWA 1KDOA 2N42A 2PX3A 4Q4JB 3SQWA 2QA5A 4G5QA 1EFCA 4BQSA 2JA1A 3UKDA 4DB2A 1GTVA 4W7SA 1COWA 1NG1A 3U6BA 1YZQA 1X8JA 1QDEA 1SXJE 4F4IA 2JLUA 4I1UA 5JECA 2RGCA 1X6VA 2WWIA 3L82B 3B7GA 4ZDWA 3FMOB 4HI0E 4EKDA 4M22A 2J0SA 4G5OA 4B3BA 1ZMXA 3QF4A 2ZRBA 4LV8B 2NMVA 3T1TA 4OQNA 3T5GA 2V4ZA 4KFSA 2Z4RA 2ODWA 4M9XA 1XTKA 2BEKA 4PQYA 4QHTA 4QKQA 3KUDA 4CDGA 3TMKA 2EYQA 3U3OA 1OT3A 1E1QD 2RKOA 1GNRA 1OW3B 3QY0A 2JEOA 4A6PA 1CKEA 4EUNA 1N6OA 5KSYA 1JR3A 5LB4A 1JALA 1L4UA 2IXFA 4RFSA 1X8KA 2JJ1D 4MKGA 1VCNA 3RS0A 1G3QA 4FMCB 5B57C 5CDFE 1P61B 5AK0A 4QBIA 4PTLA 2UZ3A 2QM7A 1R8SA 3OE7A 1G7TA 3FKSD 4O0MA 1UAAA 3UMFA 3AP2A 5L3RA 4HAWA 5C1BA 2EU8A 4GZLA 2D4HA 4IVRA 5JLJA 4ACAA 4KODA 1DTSA 2ZSDA 4IDQA 1SKQA 3GLGB 4QFMA 1KY2A 2RHMA 3R8CA 2ZR0A 3C7KA 3LX8A 1X8LA 4OK6A 3CRRA 1RZ3A 1H8ED 1E9FA 4U02A 1G1MA 1UKVY 2EFCB 1E1QA 2X19A 3SYNA 2ZVPX 3GJ5A 3QVUA 4FINA 2V6JA 1ZU4A 3AF1A 4GOKA 1ZW6A 5F9HA 4PX9A 3MUFA 1YZNA 4KLNA 1KK3A 1IN6A 4B2PA 2BIFA 1VCMA 2ZJZA 4CEJA 3SEAA 1F6BA 2NIPA 4QJ5A 5EP3A 1QHIA 1KTVA 2GAOA 4CEIA 3LBNA 4KFUA 2IHYA 2LWIA 5EXXA 5JCZA 2BCGY 1ZVQA 4DEYA 2OO7A 2WPDD 2GEDA 1T0HB 1IBRA 3KTAA 4JLNA 1OXUA 5FOUA 1U0HC 1NL3A 1ELOA 1F48A 1XMVA 2QSZA 3QF7A 4Q1BA 3RLFA 1U0LA 2BMJA 1ZD9A 2PEZA 1DBSA 4MYUA 2WBLC 4W5JA 5IRCD 1OH8A 2B92A 2Q9AA 1G64A 4JVNA 4D0GA 1P3JA 3LX5A 4YMTA 2ZJ2A 1WXQA 2ZUCA 5JEEA 1KMHA 5G40A 3UANA 2RB4A 4Q1CA 3BFXA 1F5NA 2A5DA 3B13B 3DL0A 1RRFA 4LDJA 1E79A 2VRWA 1P2TA 2R8RA 1KI1A 1JPNA 1FNNA 1G8YA 3T12A 1US8B 3CONA 4YC7A 1L4YA 4AKGA 3WBJA 3GCGA 4UNSA 4DLYA 4BPBA 2GK6A 2GTPA 5JI2E 1XD2B 5A5GA 2WPDA 5JRJA 1W7AA 4LY6A 2C5LA 1T5IA 1IY1A 1QZXA 2C8VA 3CF0A 3ND9A 4KJZA 1GILA 4ABYA 3IIJA 1XPRA 4CZ2A 3FPAA 4EJSA 4FMBB 4PSVA 2C78A 1G3MA 4DSUA 2BKEA 5K8UA 3HU3A 3LH5A 1K6MA 3D31A 2F6RA 4MRPA 3RWOA 4QM7A 3A37A 3AEZA 1A4RA 2AD1A 2VSXA 2AK2A 3SJCA 1ZRHA 2QBYB 2ZRGA 3IDQA 5FR1A 4Z54A 3KB2A 2FPMA 4L16A 1L2TA 3NH6A 3P1JA 4JLVA 4TMVA 1OFTA 5DYGA 2D2FA 5J4YA 3O8CA 3E2IA 1UJ2A 3GFOA 4KITB 3RYTC 5IK2D 4JYCA 4LYJA 4AI6A 1QG2A 1FOEB 2FFAA 5J40A 4PZZA 4C3ZA 2CDNA 1WBDA 3EIEA 4O2LA 2GXUA 1OYYA 1E2MA 4WW0A 4UNPA 1QBKC 5L3QB 4FCWA 2G3YA 2PEYA 4YMVA 3WP1B 4EPXA 3W5IA 3B1XA 4Q4HA 2BMDA 4L4UA 1ZJ6A 2QORA 5DE3A 3ZQJA 5BYKA 1D5CA 4DLXA 2ZS9A 3AF0A 4A0GA 2MSCB 1N25A 1EK0A 3AF3A 1ZM7A 3KQUA 5KO2A 4DCVA 3K0AB 4P3YA 4Q5IA 2PMDA 1BO6A 2R62A 3VHLB 4XVUA 2VTKA 2OAP1 4IRUB 2H17A 5SZHB 1MRSA 4NP6A 2ERXA 2O0JA 4EFMA 4KYUA 4CEIB 2VHJA 5IK2A 4ILEA 3C8UA 2A78A 3QKRA 3V9PA 1TF7A 2JLXA 1G17A 2FDCA 2ORIA 4YLGA 2J41A 3KTAB 2WWHA 1GNQA 1TADA 2A30A 2HJGA 1DARA 3QXHA 1E32A 4M21A 1ZM2A 1IXRC 3CRMA 2FEOA 3VKWA 2ODNA 4OHZA 2EWWA 2PLRA 3F5FA 2FG5A 1OXVA 5JMTA 1TX4B 2NO6A 4BLPA 2FV8A 4Q18A 1ZCAA 3IIKA 2GHIA 3FOZA 4D25A 1ZD1A 1N6PA 4K46A 3GLIE 2BCJQ 2YHSA 3K70D 5C4MA 4B34A 1TEVA 1YR9A 1O87A 4KFTA 1ANKA 3I92A 1Z0IA 3SFZA 3AKDA 4Q7LA 4BRUA 2QM8A 4PC7A 3GLFB 4DIEA 2FFQA 2O8DA 1Z0JA 2OSBA 3TRFA 3HYTA 3GFTA 4BLQA 1AS3A 1TQDA 2NG1A 5G41A 2HT6A 2TMKA 1GKIA 1XEXA 3K0EA 4TMKA 5FOVA 5IDVA 3CNNA 4Q01A 2CL0X 2OG2A 3X1YA 4UNRA 4EJSB 4TLAA 2JLSA 1BOFA 3EZFA 1I4DD 3GJ3A 4AY2A 4OBEA 4P4TA 4MITA 4LPKA 1VYUA 2FJUA 3B6EA 3HWSA 2N1BA 3NC1C 1CR2A 1P4SA 3BGWA 1UBEA 5FPYA 5JJLA 2R44A 3BE4A 1XZPA 3TVTA 2BOVA 3DZDA 3TE6A 1G5PA 2R6CA 3QXJA 4JBWA 4BFYA 3NEYA 2ZSFA 1PLLA 4KLZA 4BLSA 1Z0DA 2EFDB 3MLEA 3AUYA 1N0VC 1G8FA 5DI3B 1F2TB 2ZE6A 4G5GA 2V9PA 4RCZA 3ZIAA 1S96A 3BB1A 3V00A 3Q85A 1EXMA 4NYJQ 1E9EA 2ZQ5A 4PPQA 3RABA 2C98A 1DAKA 2QT0A 3QPVA 4Q4HB 5D3MB 1J2JA 3NWJA 4UXJA 3EASA 2ASEA 3CB4A 2VIIA 4FWIB 3B1YA 2NO1A 1AN0A 1E99A 3Q7PA 1GITA 2MSDB 5JWHA 2DFKB 4B75A 3HJNA 4PAOA 3TIFA 4CRWB 1JECA 2CLCX 2VSOA 4QGFA 5JFGA 3DKPA 3CF2A 2GA8A 2WIAA 1VIYA 3TBKA 2NZJA 2FSHA 1KO1A 1JEDA 1YR8A 2DBYA 2WWXA 3WP0A 1P5ZB 2PZGA 1DAIA 3QKRB 4ZIRB 5A4JA 5EJEA 2Z0MA 4A8JA 4BECA 1XEFA 4DB4A 1GAJA 3U3RA 3FHCB 3NBFA 1PLKA 2ZRJA 4QGHA 3TUZC 3ADCA 2FPLA 4XWOA 4AKIA 2HT1A 2P5TB 3OIUA 4Y0VA 1OB5A 3EW9A 4BRWA 3ONWA 2CE2X 4X8HA 2CK3A 5FUYA 4LBVA 1NMYA 4UJ5A 1KZ7B 3DHWC 3VKHA 2ECKA 2UKDA 2EFHB 3CPHA 3R7WA 2IYXA 4IOJA 1DADA 5EZ5A 3REFA 5B58C 1KAOA 5GJBA 4TL9A 3X1XA 1Q3TA 3MWJA 4JLPA 2IYWA 1Z29A 2QP4A 3TSZA 3CRQA 4AYXA 2G1KA 1ONBA 3U3JA 5BYJA 4CIDA 3EPHA 2J7PD 3KFXA 2CLSA 3HR8A 2QY9A 4QM6A 2VP2A 3B2EA 2O8DB 2RH5A 1SXJA 2GXQA 2BC9A 4BFTA 3GP8A 1KNQA 2CHVA 3X1DA 3E1SA 4DLVA 3KKOA 1ZUHA 1IXSB 4GT1A 1LF5A 2F1IA 5FUXA 4JJKA 4OK5A 3PFIA 4V0ME 5CYPA 5H68A 1G3RA 4A92A 1K5DA 4TSFD 1IM2A 1TAGA 4K81B 5HZHA 1KOFA 4F7WA 3MRSA 3L8YA 4PQFA 1Z06A 1QHHA 2OILA 4YMSA 2XXAA 5GADl 2QMOA 4M9ZA 3G0HA 3LLUA 4HEJA 3WYFA 4XWAA 4DLUA 1LS1A 5TMPA 4NHOA 4B73A 2DB3A 3CNLA 2D06A 4D4KA 2YOGA 1LTQA 4D80A 2XJ9A 5FL7A 3EX7C 3PIRA 3ZZ0A 4FI3C 2REOA 2BM0A 4OI1A 4F4CA 4ARZA 4M2LA 1FZQA 1Q22A 2ODBA 2FFBA 5TXGA 3ZVRA 3M0EA 1AS0A 4UNQA 1E2LA 2JIZD 3A1WA 4IDOA 3FMIA 1IQPA 1G6OA 2XSZD 4E22A 1PVOA 5IF9A 1XPOA 2OBLA 2QROA 4QJ4A 4TZ0A 4IEEA 2XAUA 2Q3HA 4LHYA 3GJ0A 4L9WA 2GVZC 3EG5A 4PO8A 5FR2A 3QSYA 2OFOA 1OHHD 1Z0KA 1EWRA 2HUPA 3KXLA 4PHHA 3UG6A 3UWOA 3MAAC 2WVJA 2AK3A 2YC4C 4R2IA 1NVVQ 1E2PA 2G88A 1CTQA 1KDRA 1Q0UA 4GMDA 4OQLA 2B7CA 4P31A 4MYTA 2DFNA 1NBME 2WAXA 2P6UA 1CLUA 1P62B 4XVQA 3WMEA 4ASUA 3AVOA 3QXCA 4M4SA 1NI3A 3FHOA 1CJUC 4ZCIA 2E9SA 3AGQA 2OBNA 4XWKA 2GCPA 2XSZA 3KXKA 3V4FA 4URYR 3W8NA 1P9NA 4A0HA 3VR2A 4B43A 3T1VA 2F1JA 5FOWA 4JLAA 2HDNB 1NP6A 1S9DA 5KYKA 4FIDA 2ZANA 3DM9B 2CCKA 1W36D 2QQEA 4P33A 1YHNA 3I4LA 4TMTA 3SJAA 4LBZA 3R9IA 1KI6B 1HEIA 3GJXC 1XXHE 2PJRA 1HE1C 3P4XA 1TU3A 5AJYA 3LD9A 5P21A 3NBYC 4MGIR 4F93B 3WYGA 1RVDA 3TLXA 3OEED 3QVVA 3ZS8A 1NJGA 1SXJB 1KSFX 1SHZA 2ZU0C 3E70C 4OQMA 5CB8A 4PPFA 5TB5A 4CEHA 1TMKA 4HLCA 5DHFA 2VP9A 2NZ8A 2Q0HA 2C9OA 4DKXA 3AGPA 1U8YA 4LK2A 2P6NA 3K1JA 4LRWA 3TR5A 2YWHA 1II8A 1MV5A 3QG1A 4LJAA 2IS6A 3B78A 2J0UB 1NVVR 1CJKC 3CX8A 1A2BA 4NU0A 4B6EA 1LV7A 2PBRA 1AM4D 2QTFA 2I3BA 5FBWB 1TL7C 5IHPA 1KK2A 3BRWD 621PA 3AVWA 2ZE5A 4CT5A 2OCYC 1ZC3A 2C03A 3U60B 4ESVA 1WP9A 1EFTA 1XMSA 2X2FA 4H1UA 3CH4B 5KPJA 2WJYA 3LV8A 5DYIA 2VYFA 4DLWA 1T5LA 2AR7A 1HURA 1TNDA 2PLFA 4EFLA 1WF3A 3T1QA 3OEEA 3A8TA 3AKYA 1W0KA 2EQBA 2PZFA 2XZPA 4NYIQ 3Q72A 2FFHA 4QNMA 3VX3A 4A8JC 2ZI4A 4HLDA 4TMXA 4D26A 3GLHA 1JJ7A 5B2ZA 4AYWA 4FW9A 2GETA 2KB0A 4JT2A 2ZYVX 5B64A 2IS1A 4QBFA 1BYIA 5EE5B 2UZIR 2WJVA 5FTJA 2ZM5A 4Q4JA 1OPXA 1U90A 2YINC 3RS7A 5EP4A 1KY3A 4D4JA 5JHGB 1QHYA 3OESA 2E87A 1XJQA 4QGAA 2ZROA 4DUGA 2QMEA 1II0A 1F60A 2IF2A 1NN3A 1XFAA 3TAHA 2VF8A 3A4MA 4BEBA 3BD9A 3TNFA 3LLMA 3IEUA 3HR7A 3VR3A 4DCUA 1IONA 2H18A 5HE9A 3AP1A 4Q9JA 4ZKDA 3N2EA 3L2OB 1A5TA 1KJZA 1SVLA 4Q1AA 4Q03A 5FOXA 1W4CA 1IY2A 1K8RA 1R5NA 3THOA 1QHNA 1IAQA 4P4SB 4RD2A 3FE2A 2RGDA 4QBGB 1ETUA 4RKEA 4LBYA 3KKQA 4IJMA 2A3RA 3BFVA 1CR1A 2GEVA 4LHWA 2PT5A 3W34A 4OKSA 4JBXA 3OIYA 4Z8XA 2W2TA 2ZUDA 5TDHA 3CZPA 2AKAB 2JDID 3QBTA 1R7RA 1U0JA 2GJAA 4PZYA 1VG9B 3SDZA 4EPWA 2JLYA 1NG9A 3IKJA 2HXSA 1L8QA 3MWKA 1C4OA 3QOFA 3AF4A 4JKYA 3R20A 1F2UB 4D4LA 3GLGA 3TK1A 3N70A 5JJIA 1E2EA 4Q1EA 4QNRA 2QGNA 1IN4A 2F9LA 3W6OA 4OYHA 3W9YA 1X3SA 2XB4A 3BERA 2GCOB 3IBYA 5AUQA 1U8ZA 1OFHA 4YDSA 3NHAA 3SZRA 5L3SA 1PV4A 3CR8A 3QEOA 4LHZA 3I1FA 1TQ4A 5CM8B 5DIFA 1NY5A 2BBSA 3I73A 2W2XA 1YR6A 5BN5A 3BB4A 1N5LA 1YU9A 3C16C 2BDTA 2CVHA 2IEZA 1G5TA 2JDIA 1XTJA 4EQ6B 4DWJA 4B3DA 4TLDA 4AYTA 1CP2A 4TQ9A 5E7MA 2R6FA 3RSOA 1SQ5A 4JSTA 1ZNWA 3UMRA 1CIPA 1W4AA 3NH9A 2QQ0A 2FSFA 2VA8A 4WZ6A 1YRAA 3KQNA 2V3CC 2ANCA 1VKJA 4DSNA 1XTRA 2K5UA 1EX7A 4HDCA 2ZI9A 1MO3A 3GLHB 1NVWQ 3ASYA 3OAAD 4B47A 4OHXA 1G16A 2EYUA 5C18A 1E2FA 2IW3A 1OXSC 3K8YA 4LBWA 4PZLA 4B2IA 5LD2B 1OH6A 3WNDA 3CW2A 4Z8YA 1CS4C 4KFRA 3R9XA 1JR3D 1TUIA 4ZO4A 5HKKA 4KVGA 3TQCA 4GDFA 1N6NA 2YWFA 4KV9A 1E1RA 4LYAA 1PJRA 4C2TA 4I99A 3LA6A 2DWOA 2QNRA 1E9CA 1JJVA 3LQRA 3FHTA 3OE7D 2GJ8A 2GWHA 4WVFA 1KI2A 1Z6YA 3UXMA 1US8A 3QQ5A 2ONKA 4HZUB 2WTUA 2XJ4A 1XD2A 4W9MC 5JRZA 1G6HA 1LB1B 2V54A 4FCVA 1FP6A 3MMPA 1XTIA 4D6PA 3LW7A 4Q1DA 2IS2A 5EZ6B 3L0SA 2C9YA 3OAAA 2V7QA 2CLDX 2GAAA 1AZTA 2OUKA 1P9RA 3EC2A 5J4KA 4EAQA 2VQSA 4CW7A 1ZCBA 1GL9B 2KE5A 4M53A 2QBYA 2ZJYA 5JJKA 5KHOC 2DFTA 4GSYA 4QRHA 3EZ2A 3DO6A 3AVPA 1W4BA 2WOJA 2ZE8A 4HLQB 4LX0A 3U3MA 2KI5A 1R0YA 5G3YA 5CIQA 3H86A 1W36C 3T5DA 5J47A 3VR5A 2H5EA 5FI1B 3W6PA 3CR7A 1R8QA 1DVRA 2P67A 2VO1A 4ZDIA 4M8NE 2CCGA 3GLIB 3KUCA 3TR0A 4EPYA 1E98A 1NLZA 2ZI3A 1KAGA 4I1SA 3QEJA 3LWNA 4M1TA 1Q1ZA 1QF9A 5EUQB 1PUIA 4RJLA 1LF0A 4LC0A 1ZIOA 2AXPA 2IYTA 1KSJA 3AVVA 2IUSA 521PA 5L3SB 5GJVC 1S3GA 2OCPA 3K0FB 2W00A 1HT2E 3CRVA 3KQHA 3ETLA 3K0AA 1H8HD 1G7RA 1MO4A 3CX7A 1S3SA 1E79D 4OI2A 3SR0A 1E2QA 4KO8A 1Z0FA 3D3QA 4XIGS 3W8RA 1DS6A 1TUEA 3C5HA 3NTUA 2C9CA 4RZ2A 2YC2C 3U7EB 4GOJA 1G3IA 2BJWA 3VMFA 3SE0A 1AIPA 1C1YA 2ZJOA 4IDPA 4NDZA 4ESHA 5GVSA 4BASA 1ZC4A 2OESA 1D2EA 1E9SA 2ZPTX 1P60A 2FMXA 3C15C 4C0BA 5JCPA 5JS7A 3KKPA 4WAUA 5J4VA 4BZQA 1FX0A 1HV8A 5F2EA 1N2CE 2CVFA 3ND8A 2O0HA 2G0NA 2EFEB 2J9RA 5LDDC 1YZUA 1R0WA 2JLVA 1NN0A 4NCKA 3T34A 2ZYUX 3VX4A 1JXOA 2QE7D 4LCBA 4PANA 3NHBA 4PFSA 1JI0A 1GKUB 3IPYA 4CVNA 2VSFA 4R98A 1H8HA 1IOZA 5FPKA 1TTTA 3WHKA 2A7QA 2NOAA 2WV9A 2IA5A 2WSSA 2QMUA 3EA5A 2D62A 1EFRD 2GEUA 2ZI7A 4IDHA 4KAXA 4C0KA 3GLFA 1R10A 3EPJA 4JL5A 1AK2A 5DO9A 3ZVLA 2XTNA 4A2WA 3ZYCA 2F3TA 3QUSA 4QXAA 1EG7A 1E0SA 4KI0A 4LYFA 2CNWA 4POAA 3AP3A 2ZJAA 1CR4A 1T3LA 2VHUA 3WNCA 3VR1A 5GVRA 4MRSA 4TMZA 2IEYA 3O8RA 2W6JD 1Q1BA 4LZZA 4BFUA 1NKTA 4XSHA 3WXMA 3DOEA 3FGNA 5CLLA 1S9HA 3PG5A 1G19A 3BC1A 4DXAA 1Q21A 2QE7A 3LXRA 3K09C 2VBCA 2REXB 4US1R 4AIIA 4DJTA 4M1WA 4II7A 2CMKA 1U99A 4XD7A 3SBEA 1EFRA 1YZLA 1FUUA 2P2LA 4B3XA 4MH0R 5DN6D 1N0WA 1GRQA 3Q9LA 2OCBA 2WSMA 5DI3A 1OF1A 1F2TA 3X2SA 3QIAA 3LO5A 2HCBA 4WXPA 5DH9A 2BEJA 2KBFA 4URXR 4AG6A 3VU9A 1N5JA 2FNAA 2X8AA 2GXAA 1M8PA 2O8EB 3EXAA 3AKCA 3W6NA 1UKZA 2F43B 2W6JA 1W5SA 5D3MA 221PA 2EVWX 1JEEA 2QG6A 2ZRPA 4R71A 1IJEA 1GL6A 3CIOA 3DMDA 1GKYA 2G9NA 1UM8A 2PMKA 2X77A 1XCMA 4OK3A 2A2ZA 3ICQB 4Q21A 2I4IA 2J87A 3DEFA 2E1RA 3SI7A 1GNPA 4KVAA 1FL9A 1UEJA 2CHGA 2YZ2A 1E2NA 1SVSA 3QJYA 1MT0A 5SZKB 1K5GA 4TWZA 3F3YA 5DN6A 3I8XA 1CF4A 4ZIRA 2Z5FA 3TQFA 3TUIC 4V0KA 3ZJYA 3ZVNA 2VEDA 4HB3A 4BFZA 2QU8A 2ZJBA 4AKHA 1NF3A 4G3XA 2GZHA 4E03A 1I4TD 1VPLA 3N2IA 4ZI3A 4Q7JB 4YDHB 1E4VA 2Z6VA 4KU4A 1FX0B 5KPDA 4TT3A 2IXEA 2JJ2A 4X8OA 5DHAA 1R5OA 4A1FA 4FXPA 3AVTA 1RRCA 2C77A 3NKVA 3GQBA 2IWRA 1Z08A 2GNOA 2HLDA 2NGRA 4HB4A 1MH1A 3A1SA 4Z1MA 5EE3A 1X1SA 2G83A 2WZQA 3PCRB 2QL6A 5FPTA 2C99A 3MWYW 2OFWA 3W3AA 4JKIA 1E69A 4RD0A 2ZS7A 1E0KA 3AVQA 1ODFA 4ZKEA 2AX4A 3ZIAD 1OXTA 3B60A 1NIPA 4EPTA 1W1WA 1NLYA 3GMTA 1VYTA 2Q9BA 3KL4A 2P0EA 4M1OA 2JASA 1RPZA 3I32A 3EZ7A 1G9XA 1T91A 4HSEA 4LHXA 1W5TA 2OCAA 4PO9A 1MO5A 1XRJA 4B3GA 4F91B 3P32A 3K0CA 4XVRA 1UFQA 2B8TA 3IHLA 2R2AA 3T35A 2RGBA 3REGA 4C0SA 3RRNA 3FFBA 5HCNA 2CBZA 4XJXA 1QRAA 2EWVA 4IVQA 3VR4A 3THXB 2O5VA 2HXYA 2HYDA 3RHFA 1Q12A 4QG7A 4EPVA 4OJKA 4U7DA 2ERYA 5D3QA 2WWYA 4CYMA 4C0AC 2CEAA 3SS8A 3NBXX 3BOSA 2YYZA 1FUKA 3PV0A 3WRYC 4B3FX 4D2IA 4HDQB 2PT7A 2ZRKA 5EE1A 3ZLJA 2DY1A 4LV5B 3ZS9A 1W46A 2C2HA 1N6KA 3MWLA 4NKRA 3VU9B 1XXHB 2OXRA 2B21A 1VECA 3L0OA 5K8TA 4MQBA 2CK3D 1I4LD 4IOMA 4BLOA 3GJ6A 4C7OB 4GBMA 3ASZA 3NBZC 1HH4A 4QGGA 4DCTA 1GVNB 1E3MA 3CKLA 3LVQE 5F3WB 2V1XA 1E2DA 121PA 3MGCA 1S8FA 1WA5A 1OE0A 3P27A 2D2EA 4XSGA 421PA 2J0VA 4B71A 5UKDA 3B82A 2XOKA 4Q4AA 4MDFA 4MYHA 2H57A 1PUJA 3NIBA 1SXJD 4A0FA 2A5JA 2B7BA 4DIDA 1S0UA 1E0JA 5EE9A 5G53C 2KSQA 4F4JA 3LXXA 4E09A 5E3HA 1AQUA 4JLJA 4GOXA 4EJSC 1EESA 1NIJA 4LSGA 3PR1A 2DFLA 1YR7A 1RC8A 4NYMQ 1XTQA 2IWHA 1KO4A 2FZLA 2IYLD 2QAJA 3QKTA 4NZYA 3CX6A 4TL7A 1DELA 8OHMA 3I5YA 2OLKA 1OIXA 4JT4A 3AM1A 1WQ1R 1XMIA 3AH8A 3B5JA 3EPLA 4PC2A 3QPUA 5KDDA 1ZUNB 1KI6A 1Q1EA 4JLBA 4ZCLA 2O8CB 4MGYR 1KI8A 2QAGB 5BWMA 1JR3E 4A9AA 5FL7D 2YVUA 2ANBA 1GWNA 3QG5A 4W5HA 2FA9A 4V0LA 4DLRA 3EARA 1P7CA 4UKDA 4MDEA 3G82C 1DO2A 4UXHA 2XB2A 4FWTA 2BM1A 5K8LA 1RIFA 2GZAA 1XD9A 2DR3A 1OJLA 3IUYA 3H0KA 3RVBA 4JLMA 4LI0A 3GD7A 1Z6AA 3LBIA 1W0JD 1G8GA 4PR0A 1QHXA 3FTQA 4Q47A 2RCNA 2J0UA 3DPUA 2QPOA 2GBLA 5EP1A 4PAMA 2Q6TA 2GJ9A 5HTKA 3IQXA 1II9A 1WDTA 1LNZA 1OFUX 2A5GA 2FH5B 4HAVA 4R7ZA 4RY2A 5C4GB 5TARA 3RS4A 3TSWA 4LC1A 1VHLA 2BHRA 1M2OB 4M1SA 2NTYC 1M7BA 4TL8A 4ZCMA 3MD0A 5DI9A 1F3OA 1U2RA 2F9MA 4OQXA 3BIFA 3HU1A 1EWQA 4I4LA 4XTRA 1XPUA 5CDFA 3ZQ6A 2IXGA 3B9PA 4GZMA 4NYMR 5E4FA 4C0QC 2IF0A 3WBKA 3ZH9B 4ASUD 2ZRCA 1IN8A 4PC6A 3VFDA 1TF5A 2BJVA 5KUTA 1D2MA 2HJVA 1G291 1ZAKA 1RFLA 1OIVA 4HUTA 1QVRA 1W0JA 4BGDA 3QKSB 3W3ZB 5EXTA 4FMCF 3V4RA 4NCNA 5FTKA 2IUUA 1WBBA 4BLTA 1AGPA 2PL3A 5TV2A 1E9BA 2Z43A 5AUOB 1TQ2A 3L8ZA 3K0SA 2QTHA 2BVNA 3RRMA 1ZD8A 3IQWA 1M1YE 4QL3A 4MA4A 3U44B 4I81A 4E07A 2BKUA 3EWAA 4Q4AB 2REBA 3K9LA 4IXMA 3QI2A 1GP2A 2ZU6A 2O8FB 5CIWA 1Y63A 5J4HA 1E0AA 2WICA 3PUYA 4P4SA 2HCJB 4QHSA 4ACBA 4IOLA 5DNYB 1GRRA 1P2UA 1U81A 2Q9CA 2BMEA 2ZAOA 2P6RA 4L9SA 2QP9X 1YE8A 1G7SA 4PC1A 4IW3B 1VIAA 5H1YA 3T1OA 1R5BA 1E2IA 1MOZA 2CHQA 3K0CC 3EIQA 3PITA 1T9HA 4OHYA 2VHQA 3RAPR 3K70C 2NPFA 1BYUA 2JATA 2PCLA 4AG5A 1SVOA 4TZ6A 2O8BA 1OV4A 5BXQC 2YKGA 3NXSA 3J81k 3RS2A 4DHEA 1UBGA 1F2UA 4XOIA 1T3HA 1N6IA 4DLSA 4OHVA 1ZIPA 1W0KD 1KZGB 1Z6GA 3CF6R 4GP6A 1Z3IX 1EX6A 4AURA 4NCHA 1UKYA 3VNVA 1BS1A 3A58B 3AVYA 4G1UC 2GCOA 1GG2A 3A1VA 1UKEA 2C96A 2WJIA 1KMQA 4IDNA 3NVAA 1Q57A 3WMFA 5JS8A 2R6GA 1VHTA 1J7KA 2FEMA 4HB2A 2PZEA 4WOPA 3VTKA 4LUCA 1KGDA 4DUGD 2WMOB 1DAEA 4MKIA 1L7VC 4RKFA 4L15A 1E2KA 4EQ6A 1KK0A 2CL6X 3AQ4A 4MKHA 3MJRA 3BS4A 5FBQB 1Q1QA 3D7MA 2FN4A 4UNNA 3CLVA 1MO6A 2D3WA 1J90A 5JSZB 1OH7A 5DGXA 1ZUIA 1N6RA 2ZRFA 1P9WA 4KSCA 1A1VA 2RGAA 2JCSA 2VHCA 4M0LA 4HAZA 4Q66C 1JR6A 1XZQA 3OIWA 3HU2A 1A82A 5BN3A 3B9QA 2N46A 1SVKA 3TW8B 2J0QA 1N6LA 1IY0A 1EFHA 5KNDA 4AD8A 5CYOA 3KFVA 1Z5ZA 3K9NA 1N5KA 4MGZR 2A5YB 4LJ9A 3PUXA 4MRVA 4L5BA 4PSAA 5JI3E 2QP3A 3UG7A 1LW7A 5DLQC 2MSEB 4H9GA 4QC2A 5JEDA 3ZVMA 4DT1A 4HZUA 4JVMA 1T3SA 1X1RA 3QKUA 2IT1A 1OH5A 3OEHA 4MRRA 2XITA 4URWR 4XH9B 2AN9A 1P6XA 1HY3A 4GL2A 1W47A 4BEJA 1SXJC 2AXNA 3ZD6A 2W0MA 1OKKA 3CBQA 2UVQA 1P2VA 4IOKA 3UIEA 1XDBA 1Z47A 4HB0A 5TY0A 3SC3A 3TKLA 1WMSA 2QRNA 3AV0B 3JZAA 4A2PA 1DAMA 2OE2A 4RZXA 3D8BA 3DZ8A 4LJ8A 4D81A 1YQTA 2IYSA 3QPWA 2WWWA 4NBSA 4Q4LA 3RANA 4YXWA 3E5HA 1HE8B 1LS6A 3NG1A 2ZR7A 1G7CA 4K8OA 4W5WA 5FFMA 1U98A 3T61A 1XCGB 1DG1G 1E94E 1M34E 2PX0A 1V43A 2R6AA 3BBPA 3P26A 2WMNB 2RGNA 2QN6A 2RAPA 1CBUA 2GCNA 3A36A 1NY6A 1G20E 2ZJ5A 3IBGA 2BBOA 3GLIA 3W5JA 2BV3A 1EGAA 5CK5A 1B0UA 2GVDC 2NO7A 2OLJA 2JLZA 4HAXA 3SBDA 3T15A 3A6PC 3CUEF 2OXCA 1KDPA 2HF9A 1M7HA 1XTSA 2ORVA 4EIWA 4A0RA 4YQFA 2W2VA 3K0FA 1A7JA 5HKKD 2QTVB 3LW8A 3RC8A 1OLOA 5LBIA 4B32A 1E1RD 3ICEA 4DCSA 5FOSA 3R8FA 4JL6A 3L0IB 3H2YA 4CF7A 3U7HB 3VNUA 1LY1A 5TVKA 2HYIC 2V1UA 2BWJA 2IL1A 2ZYWX 3IHWA 4V03A 2VF7A 4Q7MB 1SKYE 1AJEA 1ZM9A 4LPSA 1D8TA 4IVPA 2KWIA 4LJYA 4MUBA 2JLRA 1DO0A 4FN5A 4KXFB 1X86B 3RSLA 3THWB 3Q8XB 3BFKA 5FTMA 3FFAA 4C4PA 1CR0A 5HCIA 4PSKA 4Q19A 2ZYTX 4E5UA 4DLTA 3THYB 3RS5A 5AR1A 1HQYE 4YONB 2V7QD 4JS0A 1JAIA 4TQUS 1VG1A 3KB1A 3TUJC 2RGGA 1AS2A 1T6NA 2JAQA 3GFPA 5FPSA 3BWDD 4BZXA 4LWZA 5K8IA 4O25A 2ZRAA 5ELXA 3LBHA 3LQQA 4KBFA 1W49A 4A82A 3L0PA 2ZJ8A 1JQJC 1Z83A 1GL7A 2AFHE 5E7IA 2IS4A 2XNDD 5HR5A 3KQLA 2RMKA 5FUVA 1NMXA 1MRNA 4F92B 1NSFA 4DT1B 2IC5A 2ZITA 2LKCA 2GZDA 3U5ZB 5KDLA 4PPGA 1E2JA 4C0HA 2QPAA 5HE8A 3SQXA 4B2LA 2OM2A 5AJWA 4TYYA 3CPJB 4URUR 3UK6A 4ITRC 1NN5A 1SGWA 3U2QA 5FBLB 5C2JB 2FGKA 3MG9A 4WA7A 2RHDA 4JLKA 1GDDA 4BE7B 2IYRA 1XB2A 2WM9B 4TYWA 1CJVC 3RC3A 3OFNA 1FPMA 1G3UA 3SN6A 1WRBA 2OT3B 1VMAA 4FMDF 2QENA 5JBQA 2XNDA 2P3SA 5CITA 3FMFA 3MSXA 2I1QA 2J3EA 2P65A 4L8GA 1E9DA 4NH0A 2F1RA 2G1JA 2ZETA 1AKEA 2DWPA 1J70A 3FWYA 5A0FA 5LPNA 2Q21A 3PJRA 1Z0AA 1ZNZA 3TJZA 2O8EA 2FE4A 3QE0A 1T8UA 1XP8A 4IEIA 1JNYA 4Y0AA 4TL6A 3R9WA 2F43A 1ZM4A 2GESA 4WZAE 1G4AE 2F1HA 5CK4A 1KO5A 3BH6A 4QOSA 3S1AA 3TVDA 2W58A 5LD2C 3MCAA 4WZBE 3RDPA 2IYYA 4C2UA 4BFVA 5BQ5A 1G21E 4CGZA 1JAHA 1W2HA 1ZBDA 2VL7A 4DSOA 2ODEA 4V0MA 1SVMA 2YOHA 3M1IA 3PUWA 4JVLA 4CT4B 3CWQA 2WSSD 1A2KC 1NSTA 1GUAA 4NPHA 2AFIE 1TU4A 3WMGA 2WIBA 2YOFA 2NO9A 2CXXA 4RZUA 2ATXA 3IPXA 4NCIA 1WE2A 2F7SA 4US2R 4I1OA 2ZAMA 2QGZA 1Z22A 5LB2A 1KI7A 1IN7A 5FBRB 2FPKA 2CNWD 2YWEA 1P75A 2G0TA 2VPPA 1OB2A 5FBVB 4YMUA 3B8HA 4B76A 4A36A 4J0QA 3SNHA 1Z6TA 3O8BA 2JJ1A 1VG0B 1XF9A 4LYHA 1VCOA 4TTRA 5SZIA 1NBMD 2HEIA 1E2GA 1DAGA 4IXNA 4M1MA 2MMCA 1XMJA 3HYRA 5EE0A 6Q21A 2IYQA 2ZIAA 2LCFA 3BB3A 3FKSA 3KZ1E 5EXSA 3VHXA 1W2GA 4TYQA 1MR3F 2VHTA 4TMWA 4DEXA 2WJHA 3L43A 3QBVA 3ADBA 1FQJA 4XD7D 1CXZA 3NEJA 3FYHA 4B44A 2IHBA 3U6KA 2P5SA 2RGNC 1SULA 3EZ6A 5C46F 5KNCA 1Q44A 4GI7A 4HAYA 4IFBA 1H8EA 1UADA 4BUJA 2Y8EA 1RYHA 1ZNYA 4B48A 4KBGA 1UBCA 2R9VA 2CJWB 2X1VA 4PQRA 3ZZTA 1FMLA 2C95A 3SJBA 1ZYUA 2DHRA 2F3RA 3KDSE 4TQAA 4GPTA 2XZLA 1FMJA 1YRBA 3X1ZA 4Q9LA 1NBMA 1P73A 2C04A 3CH5A 4ZDKA 1RE0A 1TF2A 5BN4A 5HPYB 1N0UA 4O2RA 4NMMA 4Q9IA 1U8AA 1BH2A 1G5RA 3FVQA 3K9GA 4RCYA 3QF4B 5EP2A 3B85A 4F38A 4ZI2A 1GZSA 2WHXA 2FSIA 5BW8A 2AL7A 1KI9A 4Z51A 5EUMA 2OEPA 1VDZA 3Q5EA 3WHLA 1XCPA 2Q3FA 3DKVA 1KKLA 1VG8A 2EW1A 4LJ6A 5CM9C 4YMWA 1LFDB 1OYWA 4D0LB 1XXHA 4EDHA 4UJ3A 1G8HA 3Q7QA 3C5CA 1W44A 1YZTA 4TT3D 4B35A 4RFSB 1NN1A 2JJ2D 2ATVA 3BXZA 2A9KA 3O47A 1YVDA 4C7OA 4G5SA 4RD6A 3S1AB 3CRW1 1DE0A 2J1LA 3EA0A 3LAWA 4TYNA 4PXAA 2HLDD 4V02A 4RSGA 2VP6A 2AHOA 3GLHE 4Z1MD 2BMFA 2H16A 2XTMA 3IIMA 3SU8A 4R9UC 5DSZA 1E2HA 3Q5DA 4S2EA 1GOTA 1HA3A 4GP7A 3GEEA 2GJKA 3BAFA 4TYPA 2GXSA 2WOOA 3HP1A 3K9HA 2FOLA 2H1LA 3DOFA 3QXSA 4XTCS 1P72A 3HPRA 1XWIA 4GMXA 3IGFA 3PUZA 1ZP6A 4HUQA 1Z63A 4R2HA 2KBEA 1Z8FA 2IYUA 3H4MA 3HDTA 4DLZA 1DAHA 4DDWA 4PPNA 1CEEA 1C9KA 1BMFD 3BH7A 2XNSA 4M9QA 4CEJB 4TTPA 1MABA 4LJ7A 1EFUA 1HYQA 2A5FA 4HAUA 2XZOA 2WWFA 4O3MA 3TAUA 2AWNA 2FWRA 3UMSA 1KO8A 3I61A 1AQYA 2ZREA 4JBYA 3SJZA 2HF8A 2QEQA 2O8CA 2QAGA 1I2DA 3ZGXA 3U7GA 2WJJA 4G5RA 2J5XA 3OZXA 4BFWA 2FX3A 1T0JB 2WWGA 3GJ4A 4JJZA 1VYVA 4A15A 2V6IA 2BBWA 5GJCA 1CRPA 1KK1A 1NKSA 2OHFA 4DSTA 1AA9A 1UDXA 1VTKA 1XX6A 1KMHB 3K53A 1SZPA 2Z83A 1YZKA 3SFVA 3PENA 5AJXA 4AC9A 821PA 1N6HA 3GLGE 3FDIA 1QG4A 4HDOB 1BMFA 3CWZA 1I2MA 1D9ZA 2ZSBA 5L3VA 4IKEA 2J7KA 3RNLA 1Z07A 2GJSA 4URVR 3SHWA 3I5XA 3VQTA 1AGRA 3PUVA 1TQ6A 4WXRA 2DCUA 1W4RA 3VAAA 4ZPXA 3T06B 4KYIB 2XOKD 1JBKA 4G0NA 3NDBB 3EC1A 4OI4A 1R0ZA 1UPTA 3KKMA 1G4UR 4DBLC 5J5CA 5B30A 3PEUA 1Z28A 1E96A 2W6ID 1XU4A 4WIAA 4M9SA 3U7FB 2JGNA 3BH0A 3KJIA 4BFXA 3WY9A 3AF2A 4IHQA 3QKSA 1DG3A 2D7DA 4V0OA 2X2EA 3GJ7A 2Q3MA 4LV6A 5F98A 4M1KA 2VH5R 3HPQA 4LHVA 4ON9A 4B6FA 3U44A 5FTNA 3KJGA 1YJ5A 3SHFA 3IO5A 2D7CA 2YWGA 2O8FA 1ZM3A 5FH9A 1D9XA 2OV2A 2CE7A 3EWSA 4NE2A 2IUTA 1S1CA 1CJTC 4HUQB 3AUXA 5CB6A 2W6IA 2GF0A 2H92A 2J59A 4RZ3A 2FU5C 4Q9KA 5JZVA 1H65A 1KDTA 1YKSA 4TLBA 2PJZA 1CU1A 5CJPA 4QBHA 1BIFA 4US0R 1MABB 4MGKR 2FGJA 4B33A 3AVUA 1JPJA 4FMDB 4JL8A 4OL0A 2NPIA 3RRZA 3U4QA 4ZV4A 1V5WA 4HATA 2WKPA 3PXGA 1R2QA 1AZSC 2JJ8A 5AJVB 3W90A 1R6BX 4P4UA 5FI0B 4PHGA 4MYCA 3QXXA 4WBSA 2J45A 1GFIA 5FL3A 5E95A 4U5XA 4A4DA 1IXZA 3M4YA 2ORWA 4MRNA 1KHTA 5J4LA 3F0TA 2ZRIA 3ZDQA 5CLQA 4Q00A 721PA 1KSHA 4DVGA 2QPTA 2QT1A 1M7GA 1NRJB 2B6HA 5AUNB 1B23P 1G41A 1S2MA 2YJTD 1VCIA 4JVSB 4NCJA 1XJCA 3EAQA 4NYJR 1QVAA 4ERNA 5JHHB 4LJ4A 1HTWA 5FUWA 2AWOA 2ZE7A 1U9IA 3JVVA 3NDPA 1M6NA 4FCTA 5FPHA 5E7JA 2EFGA 3KQKA 4OJQA 1XEXB 3KX2A 5KDOA 5SZJA 2WJGA 4EPRA 4BLRA 2R65A 3UWKA 3A4LA 3PVSA 4I1VA 2FZ4A 1T8TA 5JSZA 2ONJA 1BKDR 1OXXK 3PEWA 2RGEA 3KKNA 1U94A 1PLJA 3NC0C 1G8PA 1XJ0A 5H70A 3GEHA 3VR6A 4RD3A 1GRNA 2VP0A 2BBTA 1KO7A 1S4QA 2QSYA 3RS3A 2ZTSA 4D0NA 5KU1A 3MJHA 2F55A 1CRQA 3K70B 2H7VA 1E4YA 3CZQA 2WKQA 2QUZA 4HLUA 3ZD7A 2OFXA 1R4AA 2IYZA 4M1YA 3C4JA 4AWXA 1G18A 1GSIA 3IEVA 2ZRDA 3EIHA 2Z4SA 2J7PA 1WCV1 3AB3A 4B74A 4DDTA 3U61B 1E6CA 4DDUA 1JXMA 2FF7A 5KSPA 3PEVA 3IO3A 1IHUA 2PH1A 2QAGC 1W48A 5L3QA 3DDCA 2ZSEA 1Y3AA 2SHKA 1M74A 4TSFA 3DMNA 5AWFC 2D74A 1SVIA 2XEXA 2W0SA 2YV5A 1D6JA 3P4YA 4GRAA 3GLFE 2YNMA 4PHFA 3PEYA 2JLWA 4LOAA 1SKYB 1AKYA 3OHMA 2L0XA 3C41J 4EFNA 2RGXA 4JSYA 1KSGA 4A6XA 2CCJA 4PAQA 1N5IA 3B1WA 2ZUBA 3JZMA 4Q48A 4UXIA 1DOAA 1XNJA 1RJ9A 2KJQA 4A8JB 3U4QB 4UQOA 5JWOA 4QHYA 1RRGA 1RW4A 4X8LA 3U3KA 3CNOA 2JIZA 4DC9A 4V0NA 4DRZA 1KNXA 1CJMA 2ZSAA 5EQTA 1SHKA 5GJWC 5KOYA 2ZRNA 5KNBA 2JLQA 4AK9A 3OF5A 4OI0A 1QHSA 3G5UA 3KJEA 1FNMA 5AUPB 1LVGA 3WYAA 4Q7KA 4NL4H 3R7WB 3C14C 3B1VA 5M04A 4BWYA 4JLDA 3TSOA 1ESMA 3QNUA 3N5CA 1OHHA 5JWRA 2HV8A 1R0XA 1RYFA 3LRPA 3PQCA 1T4GA 2OBMA 1P2SA 2VP4A 2GILA 3ADKA 1KI4A 3A1TA 4KCGA 4PC3A 1OIWA 3B1ZA 3H1TA 2ZI5A 4HYYA 2ZRLA 4TLEA 1Z2CA 3UPUA 1O3YA 4G01B 2NQ2C 1SVWA 1XEWY 4N1AA 5DISB 1JQLB 5HZKA 2O0KA 2VLIA 2G77B 3OEHD 4N3NA 5KSZA 1ZINA 3THWA 4U00A 4TLCA 3A1UA 3SYKA 4OQFA 4P0TA 3QENA 4C30A 1OKKD 3THYA 3M6AA 3Q3JB 3LY5A 1QHHB 2GKSA 2XXAB 4S35A 4H1VA 2O8BB 1FP7A 1OFIA 3LNCA 2QZ4A 4P32A 3O8DA 2ZVQX 4IFEA 1NVXQ 2QI9C 2V55B 4TTQA 3CM0A 3F8TA 1UEIA 1FW6A 3FMPB 4FD2A 4YXWD 3DM5A 1NLFA 4ARZB 3CPEA 3SOPA 1KYIA 5G3ZA 4JZKA 2NO0A 1OSNA 3LVRE 3LDAA 2IX3A 1UDWA 1S1MA 5CJ2A
chains in the Genus database with same CATH superfamily
1UMCB 3U62A 3IOEA 1ZRNA 4R9VA 2PZAA 3ZC3A 1NMZA 2FHSA 3RJMA 1LZLA 3N86A 2V6GA 5IT5A 3ECCA 5JAZA 2B1JA 2FRDA 3IE2A 3HA7A 1Y4AE 4J0CA 2HMTA 1M2WA 1M66A 1VFNA 4RKRA 3LDUA 1FYVA 1SEPA 1QHGA 2OAQ1 2PUJA 2BZGA 2WC1A 3HJTA 2O57A 2X23A 1OGYA 4OO3A 3KR0A 5BMVF 9ATCA 4RBNA 1JB1A 3TW4A 3NVKI 2V8OA 1DPFA 1J99A 1RKBA 2HC9A 4QPNA 4HZIA 4JU9A 2VNAA 3OCUA 2QRZA 4JUIA 1X80A 1IN5A 4ZAFA 2GBLC 1H93A 4YMLA 3H87A 1KJYA 3TQSA 2NAFA 4A8TA 1RJ9B 5LLSA 2J46A 3NHYA 1U9IC 2BFEA 1ML3A 1BC5A 2W83A 4BFCA 1D6MA 2VP5A 1DBRA 3GHHA 4KHZA 4P2GA 1RZVA 3N59A 1KEKA 1O9HA 3HY4A 3ITKA 1E7SA 1XZHA 1VBKA 3JV7A 3FPLA 3IILA 5CIYA 4WNYA 3WGHA 2VSNA 4RA6A 5JFTA 1VJGA 1F0NA 1KI3A 3L7OA 3GJ8A 3GXOA 3TOVA 5EUBA 2OZEA 1PGPA 5EJGA 3UMBA 3VV2A 4ENQA 4J4BA 4OREX 3L8FA 4D92A 1PSWA 4OP2A 3BORA 1RBMA 5KVAA 3E1KA 2HBYA 3UATA 1OMOA 3NORA 4NYIR 4NU6A 4GGOA 2XRFA 4UDOA 3KWJA 3FA2A 2G9VA 4ZXPA 1DEKA 1GPLA 1N75A 3MWGA 4TLLB 4DDKA 1FS6A 3AK4A 1ZK4A 5BSMA 3AONB 4S2UA 2MT9A 5TRTA 1RRPA 1OI4A 5A3SA 2G72A 4MVJD 4OXKA 3WNBA 4QOGA 3ZHYA 3LQ1A 4DZZA 1GZ3A 5BWOA 1SXPA 4L0MA 5JCJA 3JAWB 4L02A 4EHKA 3CO5A 2ZRHA 5H82A 1ULHA 1A3CA 4QXQA 1O8BA 4FQ8A 3LFUA 2R48A 4RENA 4D4MA 1COWD 2UDPA 1Q20A 1QGUA 2AKYA 4IDEA 5EZQA 4EHNA 2JFFA 2EHJA 2C8JA 1QGZA 3JVUA 4ENWA 3CZRA 1YZ3A 1R0BA 4KX3A 2XVYA 1O5TA 1JTFA 3LQKA 1EINA 1ORHA 3UCFA 2DEUA 4C9BA 4BFSA 3IDFA 2VDWB 3AESB 3N9IA 4L51A 4PO1A 3TCKA 4H7IA 1REQB 1TE2A 2RHWA 1Y8RA 3OFND 3FB4A 4D82A 1IIRA 1U9ZA 1X70A 3P7MA 4B3CA 3HBMA 2Q5QA 4KAJA 2D1TA 1J49A 3W1VA 5CA0B 3W5DA 1E5VA 2I6GA 4MB2A 2BCEA 5IMSA 2LKDA 4G5YA 3Q6MA 2BH9A 4NAUA 5I47A 3ADDA 2JG3A 2EW8A 2JHFA 4OBXA 4NZ9A 3D6TB 5LL6P 2K6GA 3VZDA 2ZS8A 5AVSA 2VWGA 1E3LA 4Q4CA 1FRVA 2Q29A 2Y9MB 1PR6A 1XHLA 3BHIA 2L2QA 3NHPA 2HAEA 4H6WA 2V97A 3IUNA 2EX0A 3EODA 1NG1A 3L04A 3L92A 4Y9RA 4Z99A 5DNVA 3S2SA 3UUGA 3V2UA 3LFHA 4B6RA 1KP9A 4EG3A 1QQ5A 2FWBA 3TZEA 4DQUA 3BD6A 4P0QB 2WWIA 2XCQA 4G9BA 3B7GA 3ESAA 4GIBA 3MBOA 3QV2A 3WGZA 3R77A 4ZDWA 1VPDA 2QMZA 3FMOB 2C83A 3EGOA 4LVCA 4KQ9A 3E9EA 1TW3A 4G0XA 1BQ4A 3H75A 4G5OA 4OJTA 3RYFB 1MQSA 2GNPA 4ZVTA 4OQNA 1CUSA 2QUHA 3T5GA 3HVJA 2V4ZA 1E62A 4KXYA 4KFSA 3BXFA 4ABTA 3L4BA 1N9GB 4R2MA 2JIQA 1WCXA 4JI0B 3WB9A 1VRCA 2P79A 5C52B 1OXBB 3TMKA 4CQLA 4DR2B 1E1QD 2Q2VA 1GNRA 4MDHA 4Z3KA 1NATA 3KR9A 3QTTA 3RIXA 1FXUA 1OW3B 3I05A 3LECA 3PX3A 1ZI8A 2JEOA 2RI0A 1WEHA 1CKEA 1WCYA 1DXQA 2JLCA 2PYZA 1IMOA 2XODA 4NZZA 1YC5A 5KSYA 5I7AA 5HIAA 2IXFA 3OIFA 5AJTA 5M3BA 4XWTA 5B57C 5FWXB 3T3EA 1A4IA 1TFUA 3KP1A 4FNGA 5EG5A 3E23A 1Q6ZA 3JQBA 1MNQA 1M73E 2JFOA 2X8JB 4PTLA 3ONFA 2QM7A 4YHBA 1JQ3A 1Z7BA 2HU7A 4BGVA 4RPKA 5KX5F 1G7TA 1RPTA 1UAAA 2LRHA 4IZOA 5L3RA 1JKXA 3MNFA 4HAWA 3SLRA 4P3KA 1GNVA 4KODA 3ZCPA 4AB1A 4B80A 5B4TA 3GLGB 1SKQA 2JC3A 4HHEA 4IX9A 1PQPA 4BQNA 1ARZA 6NULA 3VTFA 3NGMA 4WY8A 4HGQA 5JY6A 1BE6A 1DFGA 1N5RA 2VYCA 3T7SA 4BB9A 1RZ3A 1PR5A 4DDMA 4UVEA 1F12A 3H99A 4EJ6A 5LQJA 1ISPA 1JDBC 4MS3B 4JP2A 1QLJA 4F8YA 2R1VA 3QVUA 3SYNA 3JRNA 1KOJA 4FINA 4JENA 4RJIA 3RTCA 1ZU4A 3MWFA 3DVSX 5F9HA 1VL5A 4KLNA 2K2QB 3P9ZA 3QHQA 3UAOA 5E4YA 3WFZA 3WDKA 4RPLA 5LQUA 4AN0A 4ZMRA 4IQ4A 2BIFA 5FWAA 2ZJZA 5ESWA 1A9TA 1J9GA 3L7KA 4PNPA 1J8DA 2WF7A 1QHIA 1KTVA 2Y93A 2I3ZA 5EQDA 3I9V1 1BGXT 1CUWA 1U2GA 2LWIA 4GOLD 4E12A 4GR4A 5B3JC 5B6PA 5JCZA 2O7RA 2WM2A 3M82A 1ZVQA 3A05A 2GEDA 4REQB 3IELA 1T0HB 2OC4A 3IAM6 1H9BA 4JLNA 4YCLA 4GR9A 1NL3A 1ELOA 2DR2A 5CB0A 1RFGE 2P7IA 4OHOA 3U0VA 5I7SA 2KMLA 1ZD9A 1T8PA 5KQRA 4WJZA 2JD2A 1R6TA 3BL6A 4U3JB 4AY6A 3HBFA 2W8ZA 3P9SA 3UHAA 2ZUCA 1NZJA 3AG5A 2LCQA 5DJ5A 5JEEA 2O1SA 5ALVA 1KMHA 5BRAA 4PEVA 1D7OA 2W6ZA 3UB4A 4DMHA 3PHIA 2ZWIA 1SURA 3NM4A 4GU5A 3OUTA 1NQVA 3DL0A 3TOSA 1PUXA 1Z4PX 4X6XA 1K86A 5COQA 2R8RA 1X15A 2WLTA 1G8YA 3GVIA 5DEOA 3SIRA 1L4YA 1UJNA 4ZOLA 5HCUA 3UW3A 1EP1B 1ZD4A 4N8DA 1A88A 2FWIA 4UNSA 2C9ZA 3G8BA 1P3Y1 3FBWA 1A5BB 4LY6A 2C5LA 2ZOSA 1T5IA 1IY1A 3JQGA 2C2ZA 2C8VA 4XX0B 5B3LA 5MN4A 3U4MA 1GILA 1ISMA 1I6LA 1XPRA 2PH7A 4V1CA 2R68A 5JAHA 4PSVA 4J76A 1CF2O 1JU3A 2VJOA 2Z1NA 5FNZA 4UUPA 3CF4G 3DJFA 2PQ0A 3D31A 4JYMA 1VBNA 3C70A 3RWOA 1M1ZA 1AGYA 5TVGA 1W25A 1A4RA 3GRYA 1L1EA 1JEYB 2AK2A 4KTVE 3A4YA 3IDQA 2C7PA 1ZH6A 4L16A 3DOIA 4G5HA 4OAPA 4XWGA 1ADGA 1AUOA 2L82A 3NH6A 1D4AA 1KYTA 4TMVA 4X1IA 2AN5A 3UUFA 5FAKA 3R4VA 3U1BA 3E7XA 4KITB 1GZHB 5IK2D 3ESDA 4LF5B 3R40A 3C98A 2ETXA 3HCFA 1FOEB 3OU6A 5J40A 5I7RA 4C3ZA 4DV4B 4BGEA 3PHGA 5COAA 2I1LA 4O2LA 2WDPA 3BULA 1L5HB 1AT1A 2YASA 5E0OA 1PEYA 1Q7RA 4IIEA 1TM3E 1E8MA 1JEOA 1UMDB 2HSZA 2J3IA 1QF7A 2DT5A 4JQCA 1NVKA 2PEYA 3TGWA 4YMVA 1FY2A 2LNDA 2Y1FA 4MRMB 2C7OA 1NOKA 3I1IA 2CD9A 3U5TA 1F6WA 2Q3CA 1WUTA 4NZNA 2BMDA 4CFZA 5JSQA 5DE3A 4MIYA 1CQIB 3VXKA 1T9ZA 2ZS9A 2FVYA 2VRCA 4KQHA 2G0AA 5J63A 4PHCA 1I7SB 1GZ4A 1PS9A 4BKOA 3AUKA 5BSFA 2QG4A 4AO6A 1XL1A 2PMDA 1R8YA 5BMVB 3K5IA 5I7EA 5SZHB 2PLNA 1V41E 1MRSA 3HGMA 4L3VA 5FT9A 2QL7A 2O0JA 4EFMA 4KYUA 4AZ3B 5JS2A 1ZR2A 4CEIB 3ZI7A 2GHQA 2A78A 2Q1XA 3QKRA 3QHAA 3KE8A 2PKWA 2XVZA 4EZEA 1NJ1A 5B7PA 1KS9A 3QPAA 1VLQA 2FDCA 4DA7A 2EQAA 5BR8B 2WWHA 1GNQA 4LZWA 1Q7TA 2H2HA 1AUPA 1Z17A 4MWGA 5EPUA 1JQ5A 2VK1A 3E05A 5A7GA 1GYPA 4M21A 3NCHA 1E32A 1P39A 4FR2A 2PVSA 2FEOA 1P5RA 2ZIGA 5I3CA 2ODNA 2XPCA 3E0XA 4D4GA 1MIOA 2C1ZA 2JW5A 3SCZA 4RTPA 1QIGA 3H9GA 1P9LA 1NYQA 1UP6A 4Z4QA 3G88A 1I4EB 2YW9A 4LYYA 4Q18A 2I78A 3AT1A 4BLPA 4D25A 4K6KA 5KYYA 3KQOA 1XAIA 3DTVA 5BMOA 1ZD1A 2JANA 1NWHA 1N6PA 3GLIE 3W5VA 4LXGA 1O87A 1SN7A 4W4TA 3I92A 2P1ZA 1T2CA 3SFZA 2YQZA 4QULA 1BKSB 1V3VA 3PJDA 4KQWA 1ULZA 4Q6WA 3Q8LA 2PXXA 2Y77A 4TTAA 3ROXA 3UAVA 4DIEA 3PHLA 1FJGB 1Z0SA 2FFQA 3ZGLA 5FTWA 1R8XA 3RU2A 3JD2A 4X1YB 1D2CA 2OSBA 5AKKA 3HYTA 5AMXA 1AS3A 1TQDA 4MWDA 3W7AA 2HT6A 3S2GA 1GKIA 4U9IS 3WIBA 4E5VA 3MS2A 4W8HA 3T7RA 4MWBA 4Q01A 2DQYA 3S0JA 1BWRA 3ENNA 4HGPA 1UBNA 4UNRA 1E7WA 3AUFA 4B9AA 2OZLA 1BOFA 3UKJA 4AY2A 2PUDA 1U28C 2FJUA 3B6EA 3HWSA 1M34A 2N1BA 3NC1C 4BXOA 2JZOA 3J80A 1H5NA 3OJ0A 4JELA 4W99A 5FPYA 3SF8B 4IIFA 4BAUA 2R44A 2XDWA 3LRXA 2BOVA 1HQDA 3MJ4A 4ZT4A 1HFWA 1NQWA 1Q11A 2E6UX 3KZVA 1N8KA 3F49S 2WTNA 1Z56C 3IB6A 4Y98A 1R3UA 2JZNA 1GZ5A 1RJDA 5ES4B 4BLSA 4QBTA 5JZBA 5LVAA 1E3DA 1JLLA 1KEUA 3SXPA 1CNEA 2ZE6A 4BE4A 4RCZA 1SJ9A 3QFRA 5F33A 4BNIA 1V8ZA 3I9MA 4J07A 4IDGA 3Q85A 2XA1A 3V00A 4JOCA 3CT4A 4G84A 1SRQA 1GQQA 1JHVA 3BE6A 4F4HA 3EZNA 3S29A 1E9EA 2ZTLA 4Q3OA 5LYJA 3SGLA 4JROA 3Q3EA 1JX6A 5IBQA 3VRHA 2C98A 2WIJA 4UHJA 3RE1A 1HG0A 4LDAA 4Q4HB 2ATEA 5D3MB 4PO3X 4R1UA 3EASA 3CB4A 2VIIA 4BC0A 2R79A 4ENRA 1FBNA 2HCTA 1AN0A 3H2GA 1GITA 3ORQA 2IIBA 2VDRB 3C4QA 4BB6A 4GYJA 4B75A 1WZNA 4F11A 4CRWB 1UQRA 3P2IA 3OF3A 5IABA 4HL6A 3AM4A 1P0IA 3UAGA 1IC6A 1X19A 1N8SA 2VSOA 3DV0A 3DKPA 3CF2A 2GA8A 2EP8A 3F7TA 4HQ6A 4EO7A 1HNXB 4X9XA 2XLBA 4I4NA 1C9YA 2FSHA 3KUUA 4JQOA 4M1QA 1ZOSA 1JEDA 1GV1A 1SA0B 4PW0A 4AS3A 1P5ZB 1DAIA 3TFOA 2ISQA 2YIVX 1W96A 4IYRA 4BECA 1E4EB 4DB4A 2OWEA 1GAJA 3SYTA 5JT1A 1BCRA 1RACA 1TK2A 3AUTA 5ECYA 5L9AA 5DW0A 1LZKA 3D6AA 2W8BA 2OCKA 2CLEB 3I2GA 3DR3A 1A2OA 3KPVA 5AJHA 4BRWA 4CF5A 3DBRA 2IEIA 2WHYA 4LBVA 4RJKA 1MNAA 1KZ7B 1Q83A 2GKGA 2HMVA 2WSBA 2UYCA 1PDVA 1SCQA 2ECKA 3PC4A 1RZRA 3CPHA 3R7WA 2IYXA 2AN3A 5EZ5A 1IOLA 1L4NA 2I2DA 5U1PA 4XQGA 2WYOA 1JEQB 3C6ZA 1JIQA 2FW8A 2IEBA 3NGXA 3PGKA 3X1XA 2YRFA 2H6EA 2QB5A 2XTAA 3G7NA 4H1HA 4JLPA 4KC0A 5LIPA 3C3KA 1JEJA 3HZRA 1A8SA 1ONBA 4V2IA 2R4TA 1V37A 1ST3A 3FCSB 4QM6A 5EWLA 5DX1A 2WF6A 2PXHA 1Y80A 1SXJA 4OLFA 3SICE 4ATNA 2Q5JA 4EL5A 1NJSA 1D07A 3NZEA 3OUZA 4M38A 3X1DA 3E1SA 1IXSB 3MINA 2X4IA 3K32A 2V7BA 1ZN8A 3O31A 4XFDA 4O1MA 4PGHA 4JJKA 4PNEA 3ZYZA 1JT9A 1J33A 3B3AA 2VN8A 2V5VA 1K5DA 3EUWA 3FXAA 3SSOA 1RKUA 3CZ9A 4K81B 1GKLA 4N40A 4YPVA 2OHXA 1KOFA 5EUCA 4HXGA 1ND6A 1SXHA 3IA7A 4KPFC 1PG5A 4S24A 2OTCA 3RF6A 4C7BA 4YMSA 4HNTA 5J4VA 3SIPA 3DMYA 3QVXA 2GZSA 4JUFA 5GADl 1CZUA 1QS0B 4IJUA 4DY6A 2QMOA 4M9ZA 1X1TA 4ZOCA 3VDMA 3G0HA 3WYFA 5K4GA 3SHQA 1LS1A 4MKRA 4O02B 2VHEA 4EY8A 4B73A 1WDMA 2OGTA 3DE0X 4D4KA 2IPLA 3M5CA 1NMSA 1LTQA 4QXRA 2XJ9A 5FL7A 4CVNA 3K9FC 4CI9A 3AY3A 1Z4JA 1VLJA 2REOA 4YJHA 3A6DA 2P35A 4OI1A 3DA8A 3SSAA 4ARZA 4DUZB 5IHXA 2YMLA 1VZ3A 5CVUA 1UINA 2FFBA 1MW9X 5AKGA 5TXGA 3WC4A 2Z3WA 2RC6A 2YZ7A 3EZLA 1UPXA 4MIOA 1G21A 3JQAA 4KYTA 2A0KA 4XX1A 3KZXA 1UMKA 3KYBA 4R0VA 5G2OA 5KNBD 3HSKA 5BWLA 5FV4A 4LXQA 5HF5A 1O77A 1EP2B 3W05A 3IHKA 3ESZA 2V03A 4JDUA 3VDQA 2MSWA 3IVXA 1B23P 3P2YA 4GPEA 3PQDA 4MVJI 4I9FA 4IQ8A 4UM9D 2G1PA 4LHYA 4KQJA 3FHJA 1N7GA 3GJ0A 4L9WA 4PO8A 1RWKA 5F52A 1LVHA 1J2UA 4CL8A 4D8XA 5JVDA 1OHHD 1Z0KA 2ZBDA 3CCBA 2YXDA 2WVJA 1NFRA 4F2PA 4CM3A 4C4SA 4IFIA 4R2IA 4CMGA 5CFNA 1Z0ZA 1ND5A 3WGKA 3ZJUA 1MD9A 4RETA 1CDEA 3AR3A 3IPCA 5JANA 4OQLA 4AUEA 1E5XA 3KSMA 4P31A 1VYHA 2DFNA 2WAXA 3TLYA 3ETEA 3KYCA 1NJ8A 3LY7A 3THSA 1YB7A 3AVOA 3IP5A 1CJUC 2FOIA 2P0YA 2ECOA 2OBNA 3NTVA 3M33A 2WY2D 3TZHA 3PFWO 4BRZA 4MI1A 2OVBA 2J31A 4E32A 3ZHXA 1PBTA 3W8NA 4F86A 4ZOBA 3K4QA 1T4CB 1TAQA 2AHRA 4NV3A 3VNSA 3IT2A 2AIRA 3T3DA 3NFRA 4JLAA 2HDNB 3OOHA 4OTZA 1V1MA 1NP6A 4DRXB 2SECE 1GCAA 3I01A 2UZAA 5D01A 3DM9B 2Y27A 4WK6A 5DGIA 1Q74A 1YHNA 1IRXA 4QDTA 1DP4A 1QOPB 4MB6A 3SJAA 4G1FA 1VI6A 1ZH0A 1OLUB 4MKXA 2J9YB 1W88A 1HE1C 2EGUA 2IDKA 4ITUA 4JHXA 4DREA 4MGIR 1K2WA 2C20A 5I4BA 2OKGA 2QYTA 4M99A 1DFHA 2PS1A 3SKVA 3ZS8A 1YRHA 2ZU0C 1SHZA 4D02A 2F8SA 1XAGA 2G08A 2HGZA 3GLSA 3VVMA 2UVDA 3K0KA 5CCEA 4JI8B 1HWYA 1THGA 1YVUA 3JQ8A 3UJ9A 4HLCA 1XRQA 5DHFA 4BNYA 2Q0HA 1FYWA 1G9SA 2FQYA 2RBEA 3AGPA 3IDOA 3MEQA 5ETJA 5AVKA 1U8YA 2RK4A 4R1LA 2JFWA 4KQFA 4QXOA 5DHPA 2P6NA 4LRWA 3TR5A 5B4VA 2YWHA 1J0DA 4NLLA 1MV5A 5E2AA 1A9ZA 4PFQA 1E7MA 1SPXA 3PVZA 2IS6A 4HGRA 3FPCA 4ARUA 4RJTA 3EMVA 3OIDA 1IATA 3C8ZA 3CX8A 4NU0A 4YO8A 1LV7A 1C9MA 1XDZA 1AM4D 2J33A 2PBRA 2QTFA 1DV2A 3EIXA 5BURA 1KK2A 5HTOA 3GEBA 3I01M 2ZE5A 4PAGA 3NQ41 1T0BA 1C30B 2AJCA 1XMSA 3JYHA 2X2FA 1B7GO 4DCCA 3DWFA 5DYIA 4UU7A 4DLWA 3QX9A 1R0CA 1TNDA 3T9CA 1FU8A 4CM8A 2GJ4A 3WSTA 3WWOA 3AC0A 3GZTB 3KQWA 3KOMA 3OEEA 4Z0HO 3AKYA 4KB5A 4W7IA 4HX5A 3T1QA 1U4OA 2WINI 3A3PA 3ENVA 4HLDA 4D9NA 1L6RA 3LUGA 4DBVO 3L1IA 2AOTB 4D26A 4GNRA 3ANXA 4AYWA 3KD3A 2A92A 1ESDA 4K3VA 5GV8A 2DF8A 2RC5A 1K8XB 2G5GX 1ADYA 2GETA 3O0DA 3OCZA 4JFAA 4JT2A 4QBFA 4XPZA 3WDLA 5KINB 3NOXA 1FFAA 1BYIA 1EUYA 3WIDA 2WJVA 4ZWNA 3G6KA 1XDUA 1Y4ZA 2YINC 4BMYA 4RSMA 3OLYA 1K89A 5BOSA 2UAGA 3CVVA 2MWMA 2O6LA 1LK0A 3COSA 3QVWA 4QGAA 2ZROA 1FLDA 3LCCA 4IG4A 4QXMA 3M1LA 3ZHUA 5J2UF 1II0A 4OLBA 3BRWA 5CDTA 1QHEA 1XFAA 1VZ2A 3C48A 4QDUA 1PQWA 3S5UA 2VF8A 4CETA 2R84A 4QVGA 4BEBA 6REQA 3TNFA 1AH2A 3LLMA 3IEUA 1QRSA 1JDUA 2XKJE 3WBFA 2DECA 4EG1A 1M5RA 3PYLA 4I2NA 1SCDA 3EPPA 4I55F 3DDOA 2WQ6A 4DR3B 1EK1A 5I9TA 3NPAA 3GVPA 1SVLA 5FOXA 3E7PA 3THOA 1HEYA 1NXXA 1XF1A 5C51B 2BFBA 1K1EA 2QJTA 4G36A 5JCJD 3NM6B 2R8BA 3O4VA 4LK3A 4CXMA 4MV6A 3WJ1A 1DC6A 2A3RA 2CXRA 4G89A 3KL2A 4YALA 1V1RB 3CZAA 4ZV9A 2GEVA 2A14A 4CPDA 1SUFA 4QSHA 4FHGA 2W2TA 1P17A 3CZPA 2D1YA 1GZVA 5B6JA 3MWEB 4MJXA 2DHDA 3T7IA 3KV3O 1U0JA 1WUIS 4RL4A 1TXGA 1VG9B 3W1WA 5E9AA 5K0EA 3ZD6A 2HXSA 4KNVA 4Z2AA 1U7XA 3SBXA 5LN1A 1OZHA 5FNVF 1EVQA 3GUZA 2H63A 1RR6A 1TKCA 5HVNA 3KVYA 2FSSA 3DULA 1X7GA 1XZLA 3WSVA 3MXOA 4EHFA 2IXAA 3C87A 4AL4A 1HMYA 4TKMA 1RQNA 4LRXA 3PKIA 3MAGA 4CKEA 3G1UA 3GROA 3Q3CA 4OYHA 4CNBA 4EATA 2DBVO 1Y6FA 2XB4A 1AMNA 3WZMA 5DTMA 3STXA 1E1LA 3MJSA 5DTEA 2A6PA 1PV4A 1KH1A 3TFQA 3CR8A 1MB4A 3GWZA 4KXNA 1YB6A 4D9FA 2PKYX 3BTVA 2MOKA 3C0KA 2COEA 3ZVKA 1OOEA 4ML3A 4P3NA 3DWGA 3UB3A 3PPYA 1M10A 2JDIA 4IRXA 5FPPA 2IKSA 4EQ6B 4DWJA 1TJYA 2PWPA 3AIOA 3H2BA 2JI9A 3IVAA 4M0CA 1KWKA 2WKSA 4NABA 2H1SA 3PDJA 3IKLA 2LZ0A 4LSMA 3RSOA 2PQ2A 1NMQA 1U1EA 3DAGA 3NH9A 1FU4A 4UOZA 4MVWA 2JCVA 4NJEB 5TQ0B 5CA1F 1K6IA 2FSFA 4AWAA 3EEOA 3CW8X 2GEBA 4MV5A 2FLVA 2V3CC 1JKJA 2DH6A 4DEVA 4YAUA 4X71A 4CMJA 3GLHB 3ZJVA 1NVWQ 4OHXA 3ZE6A 3U4HA 4TS4A 2EYUA 3IRUA 3VNBA 3EXIA 2HWYA 3UJ7A 2ET6A 5IJ0A 1U2DA 3E18A 2B0JA 3ANNA 4KFRA 4O4LF 3H19A 2KQUA 1R88A 1TUIA 3GNSA 4KMOA 1IE3A 4ZO4A 4F5ZA 4EELA 2PZLA 2BRUC 4YRDA 1K66A 1E1RA 1PJRA 4FHDA 4FCCA 2ZIUB 1B0ZA 1ZOIA 1Q1GA 5AM4A 3GDWA 5EY5B 4YRBA 3LQRA 3GVHA 2GJ8A 2GWHA 3I5AA 1KI2A 1CFJA 1O89A 1PJ4A 1MTOA 1RPJA 1Z6YA 3OFSA 5AHWA 1WXDA 4ZOAA 1L1FA 3M4ZA 1DQZA 3DMTA 4TX1A 3ROZA 2WTUA 1G2OA 1O8CA 5KJFA 4XXHA 2IDMA 3ZDCA 1JDBB 4Y6PA 3MM4A 1KFKB 3N2GB 1XD2A 1H23A 1IEVA 3L7BA 2M98A 3K1TA 1LB1B 4FCVA 2ZT8A 1M2KA 5ALIA 1MOPA 3H3FA 3OQHA 2C9DA 2CLHB 4NMHA 5FOQA 3EHEA 3G68A 2A1UA 4ZGWA 1YQXA 3T5MA 5EZ6B 1FRQA 3A2MA 1VE5A 3L0SA 3NT4A 3OAAA 4HVCA 3AYXB 1BRTA 2OUKA 1OXMA 3EC2A 5J4KA 3LC1O 3MA0A 4EAQA 1AA6A 4JBIA 2A0XA 1LPNA 2KE5A 3MGGA 4M53A 1WTAA 5EGSA 1EVIA 3EZ2A 2MTBA 2WK1A 2YH2A 3OKFA 4X91A 2E5WA 2A0YA 2I34A 2I03A 3OURA 3IVGA 5DWDA 2KI5A 2P77A 1NNSA 1R0YA 4ND3A 3JQ7A 5G3YA 4LMAA 3E3NA 2OXIA 1HRDA 4KEAA 3VGPA 2OK8A 3K1AB 5AIBA 5J47A 4ND8B 2H5EA 4IZHA 3PWKA 5TQ2B 1F2DA 5F7JA 4J03A 1F9EA 3W6PA 3SC2B 2VO1A 3UENA 1KYXA 3E5MA 3KUCA 3FNFA 1F2VA 2XZDA 2K2WA 4O2BA 2A9QA 4EPYA 2XE8A 4DMKA 3QEJA 3DSRA 4YY3B 3PFCA 1T9BA 3JXEA 5EUQB 5ALLA 1LF0A 4AJJA 1OGIA 1S7CA 3IAUA 2XUOA 1TM1E 3OLXA 2IYTA 1YJXA 2IUSA 521PA 4BVEA 5L3SB 5B1IA 3NAGA 3FRHA 4YASA 3GMIA 5EJ7A 3CRVA 5BSVA 5FWYB 2VUUA 3WAGA 2QLNA 2FRDC 3ETLA 3K0AA 3KQHA 1MGOA 2PWBA 4JX9A 5BN5B 1G7RA 1MO4A 1A8PA 1S3SA 5CTAA 2JIPA 3SR0A 3V32A 2F3UA 4WFKA 4XIGS 3W8RA 1I6WA 1OLSB 5F1PA 1F5SA 3U7EB 2G5CA 2YC2C 3PDIB 2I29A 1UWLA 3T52A 3BEOA 3L0DA 4NDZA 4YREA 5G4LA 1ZC4A 2OESA 1L3IA 1FC0A 3USZA 1XVVA 3S1SA 3SZGA 3NWPA 1V8PA 4PG7A 5JS7A 2ARKA 2YWXA 3JWGA 3KJNA 3KKPA 4GQAA 3EBPA 2WILA 4Y2QA 5JJCA 3AJ8A 5IT0A 3BXGA 1FX0A 1FDIA 5BQPA 2FUG6 3AFGA 3OVMA 4WLVA 1KRWA 2QVCA 1FYFA 5JSUA 4DQDA 1MF7A 4MS4B 3PRHA 3T34A 3VX4A 4URFA 5HS6A 1NVEA 2CHFA 3DNPA 2PZKA 3NHBA 1I3MA 1S2LA 5E6SA 2QNBA 3DE1X 1X1QA 1GKUB 1MENA 3FOBA 2VSFA 4O4HA 4V39A 2H2FA 3VUEA 3KT3A 1POWA 4R31A 4HN4B 4E13A 4IRMA 5KJCA 4PICA 1G8MA 4U39A 2IA5A 2QMUA 4EKYA 2WHQA 1N2SA 2P62A 2JGFA 2ZI7A 3JASA 1BHSA 3UT0A 3GI1A 2HMAA 2A88A 5AKEA 4QXAA 4R6XA 4EYQA 1WLYA 1NUAA 2V7TA 4LYFA 3ZJTA 1R74A 4POAA 3GAMA 3UXHA 1QO0D 3QWHA 1LA2A 1CR4A 2J9ZB 2VHUA 3K6JA 3VR1A 4MRSA 1OWOA 3E9MA 5IVHA 4DMLA 2I6FA 3P2KA 4OAOA 1GXSB 3B2QA 4AF8A 4KWIA 3M49A 1ODSA 4PSDA 1SB9A 2X7XA 3PG5A 2Y1DA 1AE1A 2J5BA 3PA6A 3WFIA 3E2MA 4OHMA 1Q21A 2QE7A 3A9UA 4UBNA 4YQYA 3R7LA 4DXAA 4MQEA 4I8DA 2VBCA 2REXB 3PXCX 4AIIA 3TG2A 5A3VA 3GUUA 1E0DA 2XUQA 4JB3A 1EZZA 2B8JA 5A0TA 1YDGA 4NWIA 4BE9A 3FIUA 2Q3LA 4OJYA 4DGSA 3I34X 3SBEA 1YZLA 2OCIA 1MB2A 2DWUA 3SM3A 1QYXA 4DMUB 1J5PA 1L5VA 3JAKA 4AJNA 5K0BA 5GAJA 3HJFA 5LUAA 5A0VA 1DXHA 2OCBA 3H5AA 4L7VA 1F2TA 5JARA 1X38A 1XMOB 1MORA 5LDGA 3SVLA 3STYA 2NZWA 4BWGA 3OTQA 3E5RA 2JBAA 1DJMA 5ALUA 3NT2A 5DH9A 2BEJA 4KN9S 4YJDA 5E3JA 4E5NA 4URXR 1CEYA 1PKEA 1N5JA 2BLNA 2FNAA 1L5ZA 1SKUA 2X8AA 1JG3A 3EXG1 4HVTA 2GZ3A 3AKCA 3EXAA 3L8HA 3D4BA 3IV9A 1ATIA 2XCTB 1W5SA 3OBIA 2YQ4A 2EVWX 2OY0A 4YLEA 1VXRA 4MV1A 4KQGA 3OZDA 2IHKA 1GL6A 5TJHA 3DMDA 4QYWA 3X3HA 5BT8A 3DTVD 3WGGA 2ZTHA 1B00A 3FNQA 5J2UB 2X77A 3D8NA 4G23A 4OK3A 4Q21A 1K97A 2I4IA 1O97D 3SDSA 3G2OA 2WJZB 3DEFA 2GARA 3U9SA 1G2QA 3SI7A 1QGED 5T4EA 3LJKA 2HPVA 4M1ZA 4QELA 1JV2B 2JH9A 2YZ2A 1SVSA 2CMFA 2DRIA 1DX6A 1MT0A 1QTRA 1NASA 1TQHA 3K2BA 4FNAA 1BD3A 4WFJA 3I8XA 5DN6A 1N1DA 4I55B 4J7AA 4DCJA 4ZIRA 1Q7BA 5D87A 2IYOA 3AG6A 2VEDA 2HCFA 4WI1A 3KQSA 1NYRA 3HSYA 3UC9A 4BFZA 4OUKX 2ZJBA 2VJCA 4YRQA 4AKHA 3FGZA 1C1XB 2O0LA 1NF3A 3AHIA 1UBTS 3G2JA 4GM0A 4Y2VA 1I4TD 2A0FA 3PGMA 2RHJA 4MJ7A 4YDHB 4YH1A 1E4VA 4KU4A 3F4KA 3ZU4A 2CWWA 2WG1A 4TT3A 3ISVA 3Q1LA 4DM7A 5AVTA 1QKJA 3Q5GA 4FNOA 4ETNA 1T10A 2B1QA 3AVTA 1BMTA 2NU9A 1J07A 4M88A 5A1JA 2ALJA 5M2QA 1K8QA 1Z08A 1QQTA 1GUZA 1DBVO 1O54A 4FYKA 3HDJA 4HB4A 4UU8A 4ZYWA 3UJPA 4OXIA 4RORA 2J9FA 2F90A 3CZMA 5EE3A 2G83A 1ZSNA 1YE3A 3SYMA 5F1YA 2P6PA 1C3JA 1CFZA 5KYWB 4KMSA 5FPTA 2PKEA 3PT5A 5HM6A 2Z57A 3W3AA 4MW7A 1T2EA 2EG9A 2QN1A 2XMRA 4LY3A 5FNVB 5JR3A 3ML1A 4HYEA 5EZYF 3Q9SA 5HF8A 4WZZA 3PNOA 1GDTA 1I32A 4ZKEA 2AX4A 1SQSA 3B60A 4AMZA 1GPNA 4EPTA 2Q27A 2VUSA 5GGYA 1AKRA 2B30A 3E9ZA 5FUQA 1CDDA 1ECCA 3I32A 4KZPA 4MW0A 3WLSA 1W5TA 5A03A 4PO9A 1GGHA 3WLMA 4B3GA 3KYDA 4R2JA 1L9KA 5DLYA 3P32A 1OZFA 4PONA 3EWIA 1W6UA 1UFQA 5JD5A 2DQ4A 3Q41A 3IHLA 3NUGA 3ZWWA 3NMUF 2PGXA 4I5FA 4EDFA 3GRKA 2NSYA 4B84A 1X3LA 1W2WB 3FETA 2KW5A 3FFBA 1HNZB 4H15A 5BN4B 3G9XA 4XCQA 2EWVA 1GGJA 4HVAA 2VR1A 4IVQA 1QPBA 4K6GA 3TLZA 3VR4A 4O1HA 4PLZA 3RHFA 3U17A 4AROA 4EPVA 1F7VA 5JD3A 4OJKA 4U7DA 5D3QA 1FVXA 2HWXA 4PLCA 3Q9UA 4CYMA 4EUEA 3AEUB 4I3HA 5HFNA 1A8HA 5CA1B 1U2GC 2YYZA 4Y2JA 5AXAA 3TSYA 4TKUB 4TVBA 4HDQB 2NV6A 1I7NA 2GCGA 2V58A 2PRZA 1Y1LA 4P53A 1W46A 1XXHB 1WZCA 2UUBB 1VECA 5E8RA 4BNTA 5DSXA 2VHWA 2V0CA 3A4VA 3PD0A 1A9RA 2IUFA 1I4LD 1P0PA 1YK0A 4UFNA 1F51E 2WYHA 1JSRA 4O4LB 1LX6A 5HWSA 2H5LA 1C9EA 2H9IA 2F17A 1NBOA 3EZYA 4FGSA 5TE9A 3BD8A 3CKLA 3NKFA 1NVFA 2GN4A 1DC8A 4GM1A 1U4SA 2V1XA 4MUKA 3PI6A 1E2DA 4EUFA 3AKZA 5F3WB 2VKTA 5DPMA 1Z16A 3ENWA 1OPRA 4QPDA 5E2IA 5EESA 1PG2A 4L6IA 4YCJA 3DEJA 3KQPA 2D2EA 1CEQA 1FSSA 3RTBA 421PA 3UJNA 3KZCA 4GLFA 4MYHA 4JI4B 2I7VA 1WOYA 3QX8A 4NI5A 1BJRE 3NIBA 1SXJD 4KR3A 3V4ZA 4B31A 3PGA1 1P1FA 2B7BA 1S0UA 4DIDA 5C81A 4QYIA 1DJPA 3EFEA 4ILKA 1AQUA 1C3XA 1CUGA 3GBVA 4JLJA 1ONSA 2WUGA 4M9CA 4O1IA 2AJBA 4QLOA 1PD1A 4OQPA 1QF6A 4G0WA 2PA3A 1ZVJA 2BGUA 1QORA 3CS3A 3DAHA 2DFLA 3LUJA 3OMLA 3WFJA 2JGDA 2FP4A 3RIHA 3H5RA 4NYMQ 3PZBA 4KIUA 4C7MA 4UTNA 3WLLA 1KO4A 2FUNB 1KU6A 2IIQA 3GQBB 1HSOA 1E5LA 1M8GA 2GO7A 4LNAA 2QRVA 4TL7A 5CDUA 3SJUA 8OHMA 1WQ1R 1XMIA 3BVPA 4OUDB 1EX9A 2XMDA 3RYHB 2VXCA 4PN3A 1UC4B 1KI6A 1Q1EA 5BP7A 2O8CB 1KI8A 2QAGB 2QTTA 5BWMA 3NDJA 1KRXA 1YRYE 3E3LA 1I3OA 5FL7D 2FX2A 3IP3A 4JMLA 4G8CA 1MVLA 1FB5A 3G1TA 1NXQA 2ZYRA 4V0LA 3EA4A 4UKDA 3NW9A 1KEVA 1YJBA 2XYQA