1XTJA

Structure of human uap56 in complex with adp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
379
structure length
374
Chain Sequence
SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human ATP-dependent splicing and export factor UAP56
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Probable ATP-dependent RNA helicase p47
total genus 114
structure length 374
sequence length 379
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xtjA02
1ZUNB 2RHMA 3CPJB 1C1YA 3B13B 3BAFA 4M4SA 2H92A 1NN5A 4ZCMA 4KJZA 4QHSA 1NN3A 1TQ6A 3O8CA 1G8FA 1Z06A 5DHAA 4G5GA 4TTRA 2B21A 3RANA 3VKWA 4KFTA 1IQPA 2GA8A 1TUEA 1HYQA 1U90A 4O2RA 3GLGE 3W5IA 4NZYA 3QSYA 4XD7D 4IDHA 1E1RA 1XPOA 3LX5A 2Z43A 3VR3A 1YZQA 4C2UA 2FPKA 4IW3B 5FOUA 3X1YA 5SZIA 1Z07A 3ZIAD 5KSZA 3UXMA 3FKSA 1W5SA 4HEJA 1SXJB 2WPDA 4M1MA 2WMOB 4AYWA 5EUQB 3RWOA 4D82A 3TH5A 1KI2A 2VHJA 3F0TA 5EQTA 4Q1CA 3GMTA 4P31A 2AWNA 4LBYA 4NYIR 2PL3A 1SULA 3SHWA 4TT3A 4LHXA 4WZ6A 3Q7QA 5DHFA 4UXIA 3OIWA 4HAXA 1KSHA 3C14C 3ADBA 1G64A 1X8LA 2GWHA 2JCSA 1RYFA 2W83A 3AKCA 1YR8A 2QSZA 2GXUA 1F6BA 3QKUA 5BN5A 5AJWA 5CB6A 4A82A 2IHBA 2F1IA 3S1AA 3VR1A 1YR6A 4O3MA 1E9SA 1ZNWA 1XCGB 5TVKA 4RZUA 3ND9A 4CVNA 1CS4C 5AUPB 1G3RA 1TADA 2WSMA 3DZ8A 1L8QA 1VG9B 4M1OA 4B3GA 4BEBA 5J4HA 3A4MA 3PFIA 1E1QA 2QA5A 5C4MA 3RWMB 4EFNA 3VR6A 4C0SA 3V00A 3AGPA 4JSTA 2A2ZA 1V5WA 4RD1A 1NSTA 1NBMD 1ZNZA 4EIWA 2JLWA 1NLFA 2W2VA 1QHHB 3DEFA 2V7QD 3WRYC 3GLIB 1LW7A 4Q1AA 2QP9X 821PA 1SVOA 4L16A 2WKQA 1U81A 2BCGY 4AK9A 4L8GA 3DZDA 4AYXA 1GAJA 1E2DA 1JAHA 3LVRE 1P2SA 4Q19A 4WW0A 4AKEA 1VMAA 4UNNA 5A0FA 2ZU0C 1G3MA 2BKEA 2R6FA 4MKHA 2FNAA 4IVRA 4KFSA 4BZXA 1HEIA 3HDTA 2REBA 1Z0FA 2ZJ8A 3AP3A 3B1WA 4B2PA 4DC9A 5HPYB 4TLCA 4OK6A 1Q1EA 1AGRA 2VSOA 2A3RA 1KI6B 1R0YA 2V6IA 3LD9A 4J0QA 3QPVA 1W2HA 3GCGA 1IN4A 2ZSEA 1T8UA 1CKEA 2IUUA 3BBPA 4C4PA 3L8ZA 1W4CA 1XMJA 2W2TA 3NDPA 3RC8A 1GRRA 1CBUA 1B0UA 4QNMA 3TE6A 2YYZA 1JBKA 4IDQA 2JDIA 3HP1A 1OB2A 3CWQA 1UEIA 3N2IA 2F6RA 1FW6A 1MO4A 2JGNA 2OG2A 2NZ8A 2HYIC 4RCZA 3PV0A 5GADl 1OFHA 1JR3E 4M8NE 3UMRA 2BMFA 3SJBA 4ZDJA 3B9QA 3QKRA 5FTLA 3BB1A 4US1R 3NBXX 2HCJB 1UDWA 1CF4A 2CVHA 2ZIAA 1CJVC 4A0HA 2JIZD 4LI0A 5KSYA 1FX0A 4XTCS 4BFTA 4URVR 1PJRA 1C4OA 3UG7A 1OH5A 5FUVA 2PT5A 4UQOA 2PJZA 4MRNA 3I8SA 2GBLA 4A0RA 2IS1A 3IILA 5L3RA 3QNUA 2WIBA 1R5OA 4DLUA 3BERA 4W7SA 1ZAKA 3IEUA 1ZP6A 3AUXA 4ZDIA 3IBGA 1PLJA 3SQWA 4FMCB 4U00A 1E3MA 2X2FA 2KBEA 4NYMR 4LHVA 4BZQA 2XNDA 4AD8A 1WQ1R 2WWYA 2PBRA 1KJWA 3V9PA 4Q1EA 4KO8A 3PIRA 1LTQA 1NY5A 1QHGA 5CDFA 1CTQA 2FJUA 1QDEA 4D0LB 4TQ9A 3QE0A 1DEKA 2WAXA 2A5GA 3CNOA 3OIVA 3P4YA 4GFDA 5CYOA 3PXGA 2G9NA 4D4KA 1OH7A 4NCHA 3K0EA 2CDNA 1UJ2A 2RGDA 2XB4A 3A4LA 4TYWA 1Z08A 2NO7A 1DBSA 2B6HA 1WB9A 4M1WA 2JJ1D 5HE8A 1J2JA 1ZYUA 2J5XA 3R7WB 3LO5A 1COWA 5KNDA 2J7KA 4Z54A 1ZM4A 4RVCA 3NHAA 1GKYA 3K9NA 3PEVA 1WCV1 2ZE6A 2IXFA 2D74A 1E1QD 2BOVA 4LSGA 3TQCA 1F5NA 1KMHA 1W4BA 4HB0A 4UXHA 3PG5A 4FXPA 1T3LA 1VYTA 2ZJ2A 2QTVB 1N5JA 3I8XA 1XPUA 1Q57A 1U9IA 2V8OA 2ZJOA 4BFZA 4OHWA 3EZ7A 1QHXA 1O87A 5FOWA 3CBQA 3L0OA 1G8HA 1NVXQ 3AF3A 3U44A 1OYYA 3QENA 2FSGA 2ZS8A 4CW7A 4JKIA 3QJYA 1IJFA 4URWR 4DLVA 1N6NA 5BN4A 2XXAB 4BLOA 2A5DA 1OKKA 4MYTA 2QU8A 3C15C 4X8HA 4GSYA 3TVTA 1FUKA 3OZXA 3DPUA 3RC3A 2IYVA 3SBEA 1T0JB 4Q66C 1G6OA 4YMVA 2DWPA 2CNWD 4LK2A 3U7GA 2VPPA 5CM9C 1GSIA 2EFCB 4TMTA 3M1IA 5HZHA 5L8VA 4WIAA 4GDFA 2KB0A 3KKMA 4ZPXA 1JPNA 1S4QA 1P5ZB 4FCWA 5J4KA 3A36A 3RABA 2JAQA 2VIIA 4NKRA 3K0FB 2ZTSA 3B78A 1AK2A 1GTVA 1LY1A 4MA4A 2QN6A 2QAGA 3SDZA 3CWZA 1XWIA 4IVPA 5FI1B 2FSIA 3OE7A 4A0GA 4BGDA 3LY5A 1RKBA 3ZLJA 3EAQA 2Z5FA 3ZYCA 2R44A 4LC0A 4D0GA 1OPXA 2QT0A 5ANRB 4LJAA 4MKGA 1E2IA 4LHWA 2JATA 3L0SA 2OLJA 2O0KA 2FZ4A 3RRMA 3EZ9A 3RRYA 1M1YE 5AWFC 2GJAA 1CR4A 1LB1B 1GUAA 3QF4A 1P2VA 3WMEA 4I1UA 1QHIA 4LV5B 4MGIR 3BJIC 4WAUA 4RZXA 3GLHA 2QAJA 4OI0A 3GEIA 2Z6VA 3LDAA 3UKDA 1G3QA 4EJSB 1QF9A 1OH8A 1KI8A 4DUGA 2GCOB 2AK3A 4A1FA 4Q9JA 3GJ6A 5BYKA 4GOXA 4B74A 2JASA 3SC3A 1VDZA 2IF0A 4Q02A 4XWAA 2D7CA 4OK3A 2XEXA 2O52A 4EPVA 1OE0A 4LCBA 4B73A 2ZRIA 3GLIE 1S3GA 5FBRB 4ITRC 4C7OB 3O8BA 4JLVA 4QL3A 4TN1A 1Q1ZA 2IYXA 4PC7A 1SVIA 3SFZA 3FVQA 5JWHA 1E98A 3T1TA 2P2LA 3BIFA 3CONA 3HR8A 1S8FA 1D8TA 2OEPA 4C9BA 1ZUHA 2V54A 4IOKA 3K70D 1BIFA 3H4MA 3W6NA 2A5JA 1CP2A 3FHOA 2TMKA 3KJGA 1IY1A 2J1LA 3THWA 1N3BA 4TTPA 2IS4A 2ZRPA 2FGJA 1N0UA 1PV4A 1OXSC 1D2EA 3F8TA 3NKVA 2X8AA 2CL7X 3AGQA 4MITA 4HUQA 4KVGA 2ODEA 2ZU6A 3FB4A 3VR5A 2BHRA 2EFEB 1LFDB 4MRVA 1P7CA 2WJIA 5TB5A 1VIAA 2QAGB 3UATA 4JLAA 4WOPA 3IEVA 4G1UC 3THWB 2R62A 2V1UA 4CEJA 2PX0A 4U7DA 4KYIB 2OXRA 3PR1A 2FX3A 4JBXA 2VP6A 2IEYA 4WZBE 1SKQA 4KCGA 3QXCA 4EAQA 3LBNA 1KI9A 2ZITA 2W6ID 3A4NA 3WNBA 3A8TA 2O8FB 2AN9A 1XD9A 4F7WA 5EJEA 3AF0A 1JR3A 2F55A 1XCPA 2BBTA 2R6AA 2WWHA 4RJLA 2OM2A 5FBVB 2FDCA 4H1VA 3T35A 4LJ6A 1W49A 4N3NA 4ACBA 1G5PA 1SHZA 2P67A 5B58C 4TQAA 4L4UA 5JRZA 1SQ5A 3IQXA 2V55B 4Q1BA 1US8A 2ZVQX 4PPGA 1J90A 1A2BA 4IOLA 2PMKA 4M9ZA 2GCOA 3QXXA 4MYHA 2QE7A 4MGYR 2CJWA 5FPHA 1EWRA 1BOFA 2P0EA 3RS5A 1KI3A 3PEYA 2WJVA 3AVXA 4UNSA 3NH9A 4Q00A 2WICA 5DYGA 1U9IC 3WHLA 2ZRLA 3OFND 4TLAA 1MH1A 2XZLA 1Q21A 4JVNA 4Q7LA 1WE2A 4FMCF 4LJ4A 2KWIA 5EXSA 1YZUA 4BLSA 2BMDA 1IXZA 4WVFA 2ZRGA 4NL4H 1G7CA 1EWQA 2ZRAA 4V0ME 4NP6A 3UMFA 2XNSA 1CJTC 3RS0A 2QBYA 1LF5A 4PTLA 1P72A 4TYPA 4ZIRA 3ZVNA 1UBFA 4KXFB 1RC8A 1FTSA 3G82C 4A36A 1T0HB 2LCFA 4Q5IA 3AB3A 4C0HA 2ZXUA 2E9SA 3THXA 3OAAA 4PPFA 1CJKC 4RKFA 1R8SA 4V0KA 1VECA 4PQYA 4JT2A 2W00A 1JI0A 3TSZA 3J81k 1VCNA 2Z4SA 4TL8A 2OFXA 2FSHA 1U0LA 1E2NA 2R6GA 2OO7A 2X2EA 4HLDA 1OFIA 3I73A 4LY6A 3I61A 1GITA 1MRSA 3PUZA 2QI9C 1SKYB 3KTAB 4RZ3A 1L4UA 3SFVA 5CJPA 2BM0A 3GLFA 2QORA 4EKDA 5KHOC 1P60A 1E6CA 2H1LA 3UK6A 1T3SA 3KQLA 2QTHA 3TKLA 2CLDX 1HE1C 2F9LA 3ICQB 3RLFA 1G21E 4D4MA 2QTFA 4ESVA 1M74A 1UKEA 4QKQA 1GZSA 4JS0A 4PAOA 2PZEA 2IYTA 2ZPTX 4QGGA 5DIFA 4A8JB 1W36D 1UDXA 4KSCA 3K53A 4QHYA 4URXR 3RAPR 3TAHA 2J0QA 1AN0A 1II8B 1NVWQ 1ZM7A 2OCBA 2ZRBA 3U6BA 1MO5A 2ANBA 4KI0A 3U4QB 2JJ1A 4A0FA 3LAWA 4U5XA 1E9EA 1Q20A 2J46A 1W36B 4HAVA 1KI4A 1W48A 2IBMA 4DIEA 2ERYA 3EWSA 4M1SA 5GJCA 1GOTA 1ZCAA 3MD0A 5EP2A 1R0ZA 4RD4A 4DEXA 3U3KA 4B3FX 3ZQJA 3SJAA 2QP3A 3UWKA 3BOSA 2VF7A 4BRWA 5D3QA 3IPXA 1UF9A 2J0UA 2VL7A 3CF6R 4PC6A 3QOFA 2P6RA 5HKKD 3GEEA 3NBFA 3KKOA 3KUDA 1DG1G 2OE2A 2PH1A 4PZLA 4V0NA 4ZCIA 3WP1B 1ANKA 4OQNA 3VX3A 4DT1A 2W0MA 3Q3JB 2F3RA 3SYKA 2YWGA 2YNMA 4KV9A 4LC1A 3B1ZA 2OBNA 3LV8A 4ZDWA 5LD2B 1YZNA 4Q21A 2GEUA 4DSTA 2JLZA 4NCKA 2VHUA 4HAZA 3TR5A 2QGZA 2YWHA 3GLGB 4FIDA 4S2EA 2GXAA 2XZPA 2C98A 4RD3A 1XJCA 3VKGA 4IHQA 4W5HA 3GJ5A 2ZVPX 2D06A 2H18A 5G40A 1I4TD 2ZE8A 1E9RA 4PPNA 4B71A 2C99A 1Z28A 2L0XA 4UXJA 2KI5A 3IO3A 1ETUA 2IYZA 2JEOA 4TZ6A 4Q1DA 1ZD1A 3LBIA 3LLMA 4K46A 4LRWA 2EVWX 4UKDA 3GLFB 3EW9A 3TGPA 1NN0A 1U2RA 1ESMA 1WP9A 2FGKA 2ORIA 4NCJA 4A8JC 1N0VC 1AZSC 1NVUQ 1E2MA 3BC1A 4DVGA 3NBZC 2GZDA 2FFHA 2B7CA 4LOAA 3SYNA 3AUYA 1E69A 2Z4RA 3CKLA 2VH5R 3IO5A 1A1VA 1G7RA 221PA 1E94E 4NH0A 1W36C 1GKUB 1MRNA 1FQKA 2P6NA 1NVVR 4TMXA 4DCUA 3ASZA 2AX4A 1TPZA 1K5DA 5E7MA 1TMKA 3VR4A 121PA 2PT7A 5JWRA 1WBDA 3TRFA 4XSGA 3BFVA 1J8MF 1MABB 5BN3A 1X6VA 5L3QB 2CMKA 1I4LD 1ZM2A 5DN6D 5E4FA 1ZMXA 5FBLB 2R9VA 2WJYA 3KQUA 1S9HA 3PJRA 4CRWB 1XXHE 2PCLA 2I1QA 4DCSA 2D7DA 1QG4A 1GL6A 4D2IA 1KI6A 1YR9A 2FF7A 2EFDB 2GCPA 4N1AA 5B64A 3THYA 4DDUA 5BW8A 4AY2A 5TV2A 1NG1A 1YKSA 3K9HA 4Y0VA 3BORA 5JWOA 2HT1A 4H9GA 3IDQA 6Q21A 3FMFA 2WMNB 2IUSA 2ZQ5A 4GP7A 2N46A 4NTZA 5JCZA 2F9MA 4W5WA 4BFUA 4LJ7A 4TZ0A 3EA5A 2VHQA 1NBME 4BE7B 1G1MA 3THXB 1US8B 3U2QA 2HYDA 1KMQA 2IYRA 4FWIB 1NLZA 4P3YA 5FBQB 5B57C 1Z83A 1H8EA 1DO0A 1DAHA 2CHVA 1NMXA 1NN1A 2RGCA 2RAPA 3I72A 4OJQA 3REGA 3CH5A 3RS2A 4FI3C 3PITA 4X8LA 4QGFA 1Q44A 2D62A 4EUNA 3B1XA 1F48A 1O3YA 2WBLC 3FYHA 4QFMA 2D4HA 1UBEA 3CRW1 1TNDA 1P2TA 2QEQA 2NG1A 4QJ3A 2ZR0A 3CX6A 3LLUA 4QHTA 1FUUA 4P4SA 2AD1A 4R2HA 1HE8B 5TDHA 1UKZA 2C2HA 2G83A 4K8OA 2XNDD 5FR1A 4GBMA 1KK2A 5BYJA 4BPBA 1CR0A 2CJWB 4N0DA 4PO8A 3U5ZB 3I62A 4DT1B 5EP3A 5AJZA 2VYFA 3PQCA 4B2LA 3C5HA 3EG5A 1JPJA 1P2UA 2IYQA 4LYHA 3KQKA 3RYTC 1GDDA 3NEJA 1T3HA 3TLXA 4JBWA 2ZSDA 2J41A 4ABYA 1SVKA 2GJSA 1II9A 2ZRHA 2C9YA 1YZGA 2A5YB 1EFRD 4KLNA 4EJSA 4FWTA 4F4IA 1UPTA 3P1JA 3PUXA 2XTMA 5E7IA 3AVYA 4M21A 5HCNA 4AYTA 5A4JA 3QF4B 3EASA 5G3YA 4M2LA 3IKJA 1KAOA 3I3SR 4C7OA 2VO1A 3WMFA 3QVUA 2GAOA 2QPAA 5IK2D 3LNCA 2YINC 1VCIA 2V3CC 3E5HA 2QENA 3QEOA 1AS3A 4KBFA 5DISB 2ZEJA 4KU4A 4XVRA 4D6PA 3NVAA 2YOGA 4C0LA 1X1SA 2HXYA 1BO6A 4L9SA 1NI3A 2QPTA 2R65A 2GEDA 3C5CA 3NTUA 4HSEA 5B30A 3MAAC 3QG1A 4URUR 3CRQA 4ARZB 3HWSA 2Z83A 5FTMA 4BECA 3N2EA 4JLMA 8OHMA 1Z47A 3GQBA 1HQCA 1UBGA 1XP8A 4NE2A 1TTTA 1XPRA 5EZ5A 4FMDF 3RS4A 4CZ2A 3WXMA 1J70A 2PZGA 1GIAA 4R9UC 2GK7A 3B6EA 2QPOA 1S96A 2NPIA 1PVOA 4OHVA 3KKNA 3THOA 4CEIA 3SNHA 1OHHD 2N1BA 1GKIA 3AVOA 1M7HA 3CIOA 5CITA 4FCVA 2XZOA 5L3SA 1UKYA 3CW2A 3MUFA 1L4YA 2KBFA 3T1VA 3DMDA 3QPWA 1TQDA 1KSGA 3CX7A 1E2FA 3SJCA 2J9RA 4F91B 3CRVA 4B43A 3K0FA 1RE0A 4LZZA 3QVVA 5KDOA 2NIPA 4D81A 4NU0A 1KJYA 3W3ZB 1G8PA 2ZROA 2JLQA 2ZYUX 3LX8A 2CBZA 2CCKA 3T5GA 1YZTA 1YQTA 2FN4A 2NPFA 3SYLA 3VU9A 3ZVRA 2ZI4A 4IFBA 4Q9KA 4A2QA 2RGBA 4S35A 3GJXC 5FL7A 2ECKA 4WZAE 1UAAA 3TBKA 1E2JA 3A1SA 3K0CC 3H1TA 1J99A 3NHBA 3RS3A 3FGNA 1RRCA 3Q85A 5D3MA 2PLFA 1RYHA 3EC1A 3JZAA 4GPTA 4BQSA 5C46F 1G8GA 4ZDKA 5G41A 3QXJA 1VG1A 1YZLA 3DO6A 1ZM3A 3FMOB 1RRPA 1XTKA 2WHXA 2ZS7A 1Z5ZA 3NDBB 1VCOA 3EIEA 4Q18A 621PA 1JJVA 4HUTA 4BLPA 1U0HC 1FP6A 5HTKA 3TK1A 2A78A 2VP9A 2YC4C 4KHZA 5DLQC 2O8DB 3LH5A 1KNQA 1YU9A 2SHKA 5CJ2A 2IUTA 4C2TA 4LUCA 4DZZA 4YDHB 1N6PA 4AC9A 4CEHA 1KGDA 1XU4A 4DDWA 4RCYA 3SS8A 5EXTA 3WBKA 3QPUA 3BWDD 1VKJA 5AUOB 3T61A 2FFAA 3EIQA 4G3XA 3ZDQA 5AUNB 4CIDA 4IDNA 4E03A 1X1RA 4L5BA 1I2DA 3KB2A 3U7EB 1YR7A 1XBTA 4PAMA 3OEED 3QY0A 3ETLA 4OQMA 2QROA 2V7QA 2ZETA 3BB4A 1DPFA 3B85A 4OHYA 2ASEA 1W4RA 4NMMA 4BFYA 4CF7A 2OUKA 1ZIPA 3OFNA 1OB5A 3PCRB 4B3BA 2GILA 3C7KA 2GJ9A 1KNXA 3IQWA 4C30A 3L0PA 1KMHB 3AQ4A 2IC5A 3N5CA 5TARA 4YQFA 3O8RA 3NIBA 5HCIA 3B1VA 4XOIA 3BS4A 2IYYA 4TSFD 3G5UA 5CIWA 2GZAA 2ZE5A 1RW4A 4DHEA 3EA0A 2AD5A 4MDFA 3VHXA 2CVFA 4HB4A 4FMDB 1ZNYA 1JR3D 1AQUA 2DR3A 3GD7A 1W1WA 1P9WA 2I1VB 4G5QA 3BD9A 1TF5A 1KO4A 4JVSB 2PEYA 2QRZA 1AKYA 3IIKA 2ZRNA 4TQUS 1YRAA 4MKIA 1NJFA 1D2MA 1Z3IX 2X19A 2ZREA 1F2UB 3F3YA 4C0JA 2VP0A 2W2XA 3MJRA 1SVLA 4MUBA 2ZYWX 4PSVA 1Z6AA 4UJ3A 5DN6A 2QL6A 4DBLC 4ZI2A 2BEJA 2XAUA 4BWYA 4EPYA 1DAEA 2UZIR 4Q4JB 4A6XA 5K8UA 1HV8A 2DFLA 1G3UA 1VIYA 3EZFA 3TNFA 3ZS8A 4DKXA 3UMSA 3CB4A 4PFSA 4URZR 1XB2A 3B2EA 2Z0MA 2OXCA 1FMLA 4H1UA 4B47A 1QG2A 3BFXA 4Q4AB 3OIYA 5FUXA 5GJVC 3QQ5A 2HLDA 1JB1A 3CX8A 1E9DA 1GNPA 1I2MA 2VP4A 4QC2A 3ZVLA 2JLUA 2JJ8A 4DLTA 3JZMA 2NZJA 5BXQC 4D4JA 1M34E 1S0UA 3THYB 2H17A 2XTZA 2AFHE 2MSCB 2JIZA 4BUJA 1KJZA 1MKYA 2VQSA 2Q21A 2WKRA 3K0AA 2WWFA 4XTRA 4Z8XA 1A5TA 2OHFA 1ONBA 5G3ZA 1PLLA 1X8KA 3BB3A 4DLXA 2IT1A 3AH8A 3W5JA 2X1VA 1AQYA 4JKYA 1W44A 3BH0A 2B8TA 4V02A 4LBVA 1A7JA 2DBYA 5EE0A 1P62B 1Q3TA 4KVAA 2RH5A 1JEEA 1M7BA 4HDQB 2HT6A 4XVQA 3EPHA 2G0NA 4B32A 1G4UR 4EPWA 3GFOA 2C77A 1WF3A 2HDNB 3GEHA 4UNQA 4V0OA 2QM8A 2BV3A 4O25A 3A37A 3EWAA 5JRJA 2V1XA 3BGWA 5FTKA 4ESHA 1HUQA 3ECCA 1OIXA 3DOFA 3CUEF 2C5LA 1RVDA 5J47A 3I5YA 1QHHA 4OJKA 3GLIA 3QKTA 2IX3A 4LJ9A 1GM5A 1JJ7A 1CR1A 1MO6A 1TQ2A 2AFIE 3BH6A 4PHFA 4MKFA 4PSAA 1D9XA 3K9LA 3TAUA 1HY3A 1XJ0A 5CLQA 2QP4A 2WVJA 5HKKA 1OXUA 2BEKA 3OEHD 1KDRA 4G5RA 5J4VA 3HU2A 2EFHB 1U8AA 4DSOA 4D25A 2EW1A 5KDLA 2R8RA 4WBSA 5KNBA 4YMWA 3GJ7A 4IXMA 3WNDA 4QM6A 1G291 3IIMA 4PQRA 4JL5A 4U02A 2ZR9A 1KKLA 1TL7C 2I3BA 2GHIA 1FTNA 3SU8A 4Z8YA 3GP8A 2OCAA 1E79D 1R0XA 3OEEA 4OI4A 1EK0A 1OV4A 1W0KA 2FA9A 3U3MA 3R7WA 2CEAA 5JCPA 2DFTA 4BFWA 2FPLA 3MG9A 4PPQA 1G9XA 1T8TA 3DL0A 4P4UA 4QGAA 2DFNA 2B7BA 4GP6A 4KFUA 1XX6A 3VFDA 1KZGB 3KJEA 4G5SA 1GL9B 4LPSA 3FDIA 4JMPA 4P0TA 4ZO4A 2IYLD 1CULC 1OSNA 2BJVA 5KNCA 2JLYA 4TSFA 4I4LA 1DS6A 4O2LA 1KO5A 1SKYE 4JZKA 5FPKA 1EESA 521PA 5JI2E 1G4AE 1SXJD 3K09C 2ZYTX 3RS7A 4TL7A 3WY9A 1CRPA 4LYFA 2IYWA 1NL3A 3A1VA 4JLOA 4DWJA 2YKGA 3L82B 2NGRA 1YJ5A 2WJJA 4Q1FA 5KOYA 2ZRJA 3PUWA 2P3SA 3NC1C 1S9DA 3R9XA 4JLKA 2ZAOA 1ZD9A 1GG2A 2ZJBA 1RJ9A 1KKMA 3VTKA 3CO5A 4EPRA 3TVDA 3D8BA 4WXPA 4W9MC 4B34A 2GETA 1Z0JA 1Z8FA 5IK2A 3CR7A 2FU5C 3SJZA 4HUQB 4LJ5A 4JYCA 2OZEA 2WIAA 1NG9A 2GVZC 2C96A 1G18A 2CE2X 4LV6A 1OFTA 4L15A 2J0UB 2ZJZA 2H8KA 4DLZA 3P32A 3UG6A 3GFPA 1XMIA 3ND8A 1U98A 4NDZA 2AKAB 3KJHA 4UNPA 1AA9A 1NSFA 1U94A 5GVSA 3AF1A 4BZPA 2ZRMA 3W6PA 5J4YA 1RRGA 5FL3A 5JJKA 3ZH9B 4NYJR 2O8BA 1XFAA 3U60B 1RZ3A 4DUGD 4LBZA 1G17A 1WRBA 2GDJA 1HT2E 2J3EA 2XOKD 4RFSB 3SBDA 3KB1A 2NQ2C 1A82A 3AP2A 2OCPA 3HU1A 4IEEA 5JS8A 1EXMA 2IEZA 2PX3A 5GJBA 1TEXA 4DRZA 1E0KA 1E2GA 2XSZA 3DVLA 4DLRA 1T6NA 2OESA 3VMFA 4OI2A 2QBYB 1NKTA 2LWIA 3VQTA 4CT5A 1OW3B 2OAQ1 1XTQA 5D3MB 4OI1A 1EGAA 2G77B 3KL4A 1W0KD 1ESNA 1FL9A 4TT3D 3K0SA 2JLXA 4RZ2A 2WV9A 3HR7A 4JT4A 5BQ5A 3B8HA 1IXRC 2WZQA 3Q72A 1JEDA 5KSPA 4TMWA 2CK3A 2G3YA 2RGGA 4EFLA 4KSBA 4WA7A 4TYQA 3B1YA 2VHCA 1KO7A 3KFXA 5M04A 2ODNA 1E2EA 2P5SA 4C0QC 3ZD7A 4MGZR 3LRPA 1G6HA 4MYCA 3EPJA 3FMIA 4Q7KA 2QMUA 5JHHB 2H16A 3ZVMA 4B33A 1BKDR 3DOEA 4NBSA 4F4CA 5FUYA 1XZPA 3WP0A 1T5LA 2P65A 4QBIA 4ZIRB 3I92A 5SZHB 4B6EA 1VYVA 4HLUA 1RFLA 2KE5A 1EFTA 2F1JA 5KO2A 4N0EA 2G1JA 5JMTA 2OV2A 1T4GA 5FBWB 4TLDA 4A9AA 1D2NA 4GMDA 3KXLA 4Q9IA 2NO0A 4EPTA 1LVGA 1EX7A 2ODBA 2Q9AA 4B3CA 4DEYA 4CEJB 3IIJA 1UEJA 3OEHA 1OYWA 2DPXA 3KX2A 3SEAA 4G01B 2BKUA 2REOA 2RKOA 3AP1A 4DCTA 2GKSA 4E5UA 2UVQA 1FFHA 1XEXA 1E99A 1DAIA 4ERNA 1XTJA 5JS7A 3C4JA 2O0JA 2ORVA 3U44B 5SZJA 4R2IA 4TL9A 3K0CA 4A4DA 1KDOA 2GEVA 2MSEB 5JEEA 2GBLC 1Z63A 3P4XA 3AKYA 2WJHA 2C95A 4QG7A 1CR2A 5FPSA 1H8HD 3HYTA 3BE4A 2XJ4A 4JBYA 4XIGS 5C18A 1JXMA 1KAGA 1N5IA 1VYUA 2HXSA 2FEMA 4Q4HB 4DLYA 2MMGA 5H1YA 1N6LA 4RD6A 3A1TA 3RNLA 3GLHE 2IYUA 2OILA 3KFVA 2B92A 1DVRA 4OQLA 4ASUD 1M6NA 1YE8A 2GXSA 5FL7D 1HA3A 1WXQA 4XWOA 4Q4JA 1XD2A 3CRRA 3HU3A 1WA5A 5FH9A 2O8CA 2PZFA 3CLVA 2V9PA 1G5TA 3K09A 1VG8A 4PO9A 4Q4AA 5DE3A 2REXB 4QM7A 1R5NA 3LW8A 1YVDA 1UKVY 3W9YA 1ZM9A 5AJXA 3QI2A 3L8YA 3TUJC 3UWOA 2K5UA 3AF2A 4EQ6A 4II7A 5L3SB 4TMZA 5FR2A 1DAFA 4LYJA 5G53C 4DIDA 3VNUA 2R6CA 5AK0A 2ZJ5A 1OLOA 2YJTD 1IY0A 3QXSA 1OXTA 4Q9LA 4KYUA 3BK7A 5DNYB 5JBQA 1T9HA 4EDHA 4BRUA 5EXPA 2ATVA 1KSJA 1GRNA 5AR1A 5JSZA 4RD2A 1Z2AA 1P73A 3CNLA 2MSDB 4OBEA 4QJ4A 1KO8A 3ADKA 2ZI6A 4MRSA 4CGZA 5F9FA 2VF8A 4B75A 4AI6A 4YXWD 4QJ5A 4TYNA 4GOJA 1E1RD 1F60A 2ZUCA 1N6RA 4XD7A 2P5TB 2FE4A 5EP1A 1NIJA 4L9WA 1HTWA 3H86A 4CYMA 4M9SA 1T91A 3MWLA 1JQJC 1P4SA 4XWKA 1Z22A 2EQBA 5KTYA 5JI3E 1KI1A 1Z6TA 3PUVA 1UFQA 2JLRA 3NXSA 1XF9A 3LXXA 1YRBA 2NO9A 4QNRA 1LNZA 1EFUA 4F38A 5F3WB 3DM5A 2WKPA 3MRSA 2WTUA 4HZUA 3D31A 1W0JA 3O8DA 1NBMA 2XTNA 4OHZA 4B48A 2VSFA 4OK5A 4P32A 3EARA 1W0JD 2QQ0A 2ODWA 1P61B 1RIFA 4PXAA 5JFGA 3GJ0A 5K8TA 2J87A 5TY0A 2VHTA 1ZW6A 1EFRA 3U7FB 3IGFA 3EPLA 4W5JA 4A15A 5A5GA 1GP2A 4NYJQ 5DSZA 2RGEA 5EE1A 3OESA 4NCNA 1E2KA 2FMXA 5CK5A 4BLQA 4PR0A 2LKDA 2HF9A 1E96A 4LHZA 1YZKA 4DXAA 2QQEA 4Q7JB 1ZNXA 2ZYVX 2ERXA 3WHKA 4IFEA 1MABA 4PO1A 4HB2A 4NCIA 3AVWA 4Q01A 3U61B 2J45A 1JQLB 3WYFA 3G0HA 1OT3A 1G8YA 3GFTA 4C0KA 1A4RA 1DTSA 2QMOA 1PZNA 2EWVA 1TQ4A 3AVTA 1XTSA 4DSUA 5K8IA 5HZKA 4HB3A 5JECA 3EC2A 2PJRA 3I4LA 3CZQA 2NO6A 2EYQA 3DMNA 2VRWA 3BH7A 2HCBA 4IRUB 4UJ5A 1JECA 3X1ZA 4OYHA 1F3OA 4GOKA 2FPMA 1VTKA 1CJUC 5CLLA 1LV7A 3K70B 1KK3A 3LQQA 4M22A 3KZ1E 2IK8A 1XXHB 4PSKA 2C04A 3DKVA 1SHKA 2CXXA 3I1FA 1XEWY 1XJQA 3TJZA 2JJ2A 2BBOA 4IVQA 3SZRA 3UANA 2QG6A 4MRPA 2E1RA 5FI0B 1N5LA 4GMXA 2HLDD 4JJKA 4CEIB 4PC1A 4QBHA 1SVMA 1FNMA 4Q48A 1HURA 2H5EA 3GJ4A 3TMKA 2F1HA 3TW4A 1ZUIA 2F1RA 2ZS9A 3NH6A 2O0HA 3FPAA 3QKSB 2KJQA 3FFAA 2XXAA 2C8VA 3OE7D 3FKSD 1Z6GA 1KDPA 3C41J 4JL6A 3VHLB 4F4JA 2F3TA 5KYKA 4TL6A 2OAP1 1H8HA 1N2CE 1S2MA 2C03A 2ZSFA 2KSQA 2C78A 1E0JA 4MGKR 5DI9A 2FFBA 5L3QA 4JLDA 4B44A 4DB4A 1KY3A 1ZJ6A 1Y3AA 5E95A 4ZCLA 3ZZTA 2B8WA 721PA 2IWHA 2IYSA 2XOKA 3W34A 3Q9LA 4LV8B 2OCYC 3R8CA 2WWIA 2DYKA 4M53A 4E22A 5F2EA 1EX6A 4RKEA 1VHTA 5FTJA 1FQJA 3JVVA 1MT0A 5FFMA 4A2PA 1QHNA 4DCNA 3RVBA 1F2TA 2N42A 5KSOA 3CPEA 4Y0AA 4V03A 1XMSA 1U99A 1XTRA 1G5RA 2O8CB 1OF1A 3EX7C 3A1WA 3OHMA 1DOAA 3P20A 1E79A 5DI3A 4A8JA 1KHTA 4HZUB 4X8MA 2ZRDA 2CLCX 2W58A 5EUMA 2GNOA 4XJXA 3T1OA 1ZU5A 1ZCBA 3E70C 3EZ2A 3TSWA 1OFUX 2ZUDA 2BM1A 2Q6TA 2WWGA 3REFA 3CPHA 3TUIC 4M9QA 2CK3D 1HQYE 3H2YA 3WBJA 3KTAA 5J40A 1E0AA 1BYIA 1X8JA 2QE7D 4BEJA 2IHYA 3TIFA 1Z0IA 2BMEA 1TX4B 3P27A 2NOAA 1G19A 1XEXB 2GESA 1Q3HA 1RJ9B 4K81B 4DB2A 3WYAA 4MUAA 1DE0A 2P6UA 1ZC4A 3MJHA 4ZI3A 2WSSA 2ZSAA 1BMFA 1IAQA 4HLUC 3CF0A 1FX0B 3MCAA 3O47A 4QBGB 2G88A 2GF0A 5HE9A 4B6FA 2YHSA 1NMZA 1KZ7B 2EWWA 5KU1A 4YDSA 2WWWA 1R4AA 4LDJA 4TWZA 3DM9B 1OJLA 1IONA 2BJWA 2YVUA 4I99A 5FOTA 4US2R 3IHLA 2GJKA 4ILEA 5EE3A 1G41A 4I1OA 1E2LA 1IXSB 2RGNC 2UZ3A 3QBVA 4HZIA 4AG6A 1Y63A 4EQ6B 2J7PA 3QKRB 1NY6A 4FD2A 1W5TA 4OL0A 2ZI3A 2RCNA 1G7TA 1XRJA 3RSLA 2DWQA 1N6OA 2ORWA 1U8YA 4PHTA 3NEYA 3U4QA 1DARA 1OXXK 2QSYA 3W8NA 4B3XA 2E87A 4GZLA 4HAUA 1Z6XA 3RRZA 2AR7A 1ZRHA 4AKHA 3DKPA 1AIPA 3CRMA 1XEWX 5AUQA 4URYR 2J0VA 4M0LA 3RHFA 1NLYA 4B76A 3L2OB 1R7RA 3TSOA 1FOEB 2HF8A 3T1QA 5L3VA 1QHSA 1Z0KA 5UKDA 1S1MA 3LFUA 4GNKA 4NYIQ 2RMKA 5IDVA 3U3OA 4DLWA 2C9OA 1IN8A 1BS1A 3ONWA 4GRAA 1SXJC 1XEFA 4GT1A 3RRNA 4D80A 4UNRA 3QUSA 3AM1A 4AIIA 1SXJA 1W4AA 5H68A 3FOZA 1KSFX 3P26A 4RFVA 2AHOA 1VG0B 4E09A 3TUZC 1Q22A 2QMHA 3M4YA 3KXIA 2W6JD 1KIMA 1Q12A 3U6KA 2VP5A 4LJYA 3SN6A 5C2JB 4AKGA 5FOSA 4JLPA 2GRJA 1K5GA 3BXZA 5TXGA 3ZD6A 1DAMA 5AJVB 2Y8EA 2Q3HA 3RDPA 4V0LA 2LKCA 2GVDC 3Q7PA 1QZXA 1ZC3A 3S1AB 3U3JA 4PHHA 3SHFA 2IW3A 4TTQA 1U0JA 3KQNA 1GNRA 1Z29A 1Q0UA 5DYIA 4KLZA 4JLJA 2ZI5A 1TF7A 2ZRFA 4GL2A 1OH6A 4EJSC 3AV0B 5FPTA 4Q7MB 1S3SA 3N70A 4V0MA 1L2TA 5KPDA 3DDCA 5FPYA 1XCMA 4IDPA 3MSXA 2D2EA 3A1UA 3PUYA 2IXGA 3ADCA 2FSFA 2V4ZA 4PZYA 2C9CA 3X1DA 3AEZA 4XH9B 5FTNA 3UIEA 4LJ8A 2PLRA 1QVRA 4D0NA 1NNEA 1E0SA 4YC7A 1KDTA 2ANCA 3QEJA 4JSYA 4HLCA 4I81A 1COWD 1UADA 2QM7A 2VTKA 3HYRA 1TU3A 3ZZUA 2H57A 1OIWA 2VBCA 1BH2A 4US0R 2YC2C 4TLEA 1KOFA 3WYGA 2OSBA 3GPLA 1CU1A 3B7GA 4OQXA 1GRQA 1MOZA 5B2ZA 2VLIA 3QBTA 5H70A 4CDGA 3GLGA 1IHUA 3CR8A 2CCJA 5IF9A 2CE7A 5KPJA 3JVUA 3RSOA 3AVQA 4YXWA 1AKEA 2QT1A 3PEUA 4M1KA 4ON9A 3LBHA 3MGCA 5LPNA 3D3QA 5J5CA 2WPDD 5JEDA 1CIPA 1JNYA 1MR3F 4G0NA 3ZJYA 2IF2A 2RGXA 2AWOA 4Q4LA 2NTYC 1KTVA 1OKKD 4JYBA 3CF2A 3KKQA 3DHWC 3GLHB 3B5JA 3MLEA 3VX4A 2CL0X 2Q9CA 3T5DA 3MWKA 3NG1A 2IA5A 1AGPA 3ADDA 2PCJA 4WXRA 1HT1E 1N5KA 1NRJB 4DCVA 4YLGA 2HJVA 5P21A 5JLJA 4PHGA 5ELXA 2CL6X 1XD8A 5CIQA 3T15A 4A6PA 3A58B 1Q1QA 2O8BB 3B60A 1NF3A 2WWXA 4HI0E 4POAA 4TLBA 4C0AC 2AL7A 1X3SA 3OIUA 5GVRA 2R6DA 4NPHA 1ZVQA 4YMTA 1AM4D 1II8A 1C9KA 3AF4A 3BFKA 4DDVA 4AKIA 1E2QA 3KKPA 2ZJYA 2H7VA 5SZKB 3TW8B 4M1YA 1E9BA 2FV8A 2CNWA 1Z0DA 1GVNB 2OT3B 2YV5A 1NVVQ 1VCMA 4HLQB 1P6XA 1W47A 1N25A 4QOSA 2J0SA 2FWRA 3B9PA 2HEIA 3EXAA 1WMSA 1D6JA 1E4YA 3E2IA 4MH0R 3ZS9A 4ZKDA 4BFVA 1R10A 2XX3A 2JDID 4R71A 1IY2A 1Z2CA 3V4FA 2QGNA 1AS2A 5DI3B 5FOVA 1E9CA 4CEHB 5IRCD 4FINA 1W2GA 421PA 4LPKA 2O8EA 3IBYA 2QZ4A 4LBWA 3GLFE 3X1WA 3UPUA 1G20E 1AJEA 1W7AA 2WM9B 4MQBA 1F2TB 5LB2A 2O8DA 4F93B 1ZU4A 1M7GA 2ZUBA 4P4TA 3WRXC 3QF7A 2ZI9A 3K9GA 3QIAA 4JIMA 3X1XA 2CHQA 1XNJA 3GJ8A 2Q0HA 1II0A 3OAAD 3FHTA 3AVUA 1XZQA 1NP6A 4D4LA 5LBIA 2FH5B 3D6TB 3LQRA 3CZPA 3W90A 3K8YA 2D2FA 4PQFA 5KDDA 1KK0A 3MFYA 4ASUA 1UM8A 2YOHA 2A9KA 2JJ2D 1E2HA 1L7VC 3LXRA 2BC9A 2QAGC 3C16C 1FMJA 4B3DA 4RD0A 5CDFE 4PAQA 2GJ8A 1EFCA 1SGWA 2F43B 2Q3MA 1YHNA 1D5CA 3SI7A 1PUJA 3E1SA 5GJWC 1DAKA 1H8ED 5LDDC 4DDTA 2WJGA 3KDSE 3VU9B 1JAIA 2IS6A 4KITB 4A2WA 5C4GB 4B35A 1SXJE 1BYUA 2DHRA 1X86B 1TEVA 3QKSA 1XMVA 4JLNA 5DO9A 3U3RA 1CLUA 1PLKA 4FN5A 4B2IA 5JJLA 2AKYA 3R20A 4PC3A 3T12A 4MDEA 5CYPA 2GAAA 3MWJA 2VEDA 3MWYW 4NHOA 4C3ZA 2AK2A 4Z51A 1XXHA 4EPXA 2O8FA 3IHWA 1VHLA 4FW9A 4PANA 1F2UA 2OFWA 3ZGXA 4TMKA 3LWNA 1TAGA 3AKDA 2FZLA 2QRNA 2VP2A 2UKDA 1CRQA 1P9RA 2WOOA 2ZM5A 4DLSA 2OFOA 3T06B 5C1BA 1GWNA 4KBGA 1KY2A 4I1VA 2OLKA 2BBSA 2Q3FA 2HUPA 4MYUA 5AJYA 2XJ9A 1R5BA 2BWJA 4X8OA 1TF2A 3WMGA 4NYMQ 2NMVA 4XVUA 1N6HA 4RY2A 1WDTA 1DELA 1BMFD 3NBYC 1JALA 2ONKA 2XITA 4M1TA 5KUTA 3I32A 2ZR7A 3MMPA 3TQFA 2CHGA 2DWOA 1OIVA 3LVQE 4BLRA 4BASA 4BFXA 3L0IB 5EP4A 3HPRA 1P3JA 3FMPB 3PENA 4C0BA 2HV8A 2CCGA 2YZ2A 3K0AB 4TMVA 4NONA 2ZANA 3FWYA 2BBWA 5LD2C 2IL1A 2JLSA 4JVMA 3SE0A 2ATXA 1RRFA 2ZE7A 5EE5B 3VR2A 3AVPA 4M9XA 5J4LA 1DG3A 4MRRA 2WAYA 4XSHA 3Q5DA 2FFQA 5HR5A 5JSZB 1TUIA 1J8YF 1LS1A 4RSGA 4Q03A 5K8LA 1LS6A 3A6PC 5JHGB 3TR0A 1GFIA 3FFBA 1NMYA 3IPYA 2AXPA 1KI7A 1E2PA 3KXKA 5F9HA 3PVSA 1DADA 4LWZA 3FHCB 5EZ6B 4IKEA 3WNCA 3L43A 4Q47A 4D26A 3IUYA 1KK1A 4FCTA 4Q4HA 2AXNA 2W0SA 3FKQA 3W6OA 2FG5A 4JLBA 5CB8A 5JZVA 1H65A 4IDOA 3KUCA 1G3IA 5EE9A 4HATA 1MV5A 2G6BA 4HAYA 3R9IA 3K70C 3CNNA 2D3WA 1QHYA 4R98A 2VA8A 4OHXA 1OXVA 3M0EA 2A30A 3KQHA 1Z6YA 3HPQA 4OKSA 4QXAA 4YMSA 2HJGA 1CJMA 4JL8A 1IN6A 1XD2B 1SVSA 4G5OA 3CM0A 1J7KA 4ZV4A 3ZZ0A 3HJNA 2BVNA 1I4DD 1GILA 2GK6A 3AVVA 1G7SA 4IEIA 5E3HA 1MO3A 1XDBA 2QNRA 4JVLA 4QRHA 4P4SB 3B82A 4JJZA 1IM2A 1Q1BA 2ZRKA 4YONB 1CEEA 1R6BX 1VPLA 3NC0C 1JR6A 4HDOB 1T5IA 1E9AA 3GJ3A 1FPMA 1NKSA 2QMEA 3Q8XB 4HDCA 1FNNA 1N6KA 3FE2A 4IOMA 2ONJA 5JJIA 2RGAA 3QG5A 2GXQA 3W3AA 1AZTA 3LA6A 4PC2A 1E4VA 3X2SA 3W8RA 4KODA 4E07A 2X77A 3V4RA 2ZSBA 3EZ6A 1ZINA 1NIPA 1G16A 1ZD8A 1PUIA 1GNQA 4OQFA 1NJGA 4IJMA 4QGHA 1RPZA 1W46A 4LYAA 1KYIA 4AG5A 2GTPA 4I1SA 1QVAA 1R2QA 5IT5A 1D9ZA 2RHDA 1M8PA 1ELOA 1QRAA 3CH4B 4IOJA 2RGNA 5DH9A 4Z1MD 5F98A 1SVWA 1UBCA 2EU8A 1EFHA 4HAWA 4EFMA 3ZIAA 3M6AA 1R8QA 2VSXA 3I5XA 3NWJA 4PX9A 3LW7A 4HYYA 2DY1A 2IWRA 2F43A 3VAAA 1FZQA 4ZKEA 2WSSD 4P33A 1S1CA 1FP7A 2BMJA 1SZPA 2PMDA 2XSZD 2DB3A 2QUZA 2IS2A 5E7JA 2GF9A 3R9WA 2W6IA 4ARZA 3OF5A 4Q9HA 2GZHA 1IN5A 5FOXA 2MMCA 2BDTA 3K1JA 4A92A 3KJIA 2DCUA 5DGXA 1IOZA 1HH4A 2V6JA 4Z1MA 1M2OB 2A7QA 3ICEA 4GI7A 4FMBB 3T34A 2R2AA 1AS0A 2ZJAA 2GCNA 1Z0AA 3EPKA 4F92B 3C8UA 2XB2A 2BCJQ 1IBRA 1DO2A 4PZZA 3BRWD 2O8EB 2YWEA 1CXZA 5TMPA 4BFSA 3SQXA 2PEZA 1B23P 2QY9A 2NO1A 3ASYA 2O5VA 1A2KC 3SR0A 3QXHA 1JXOA 3VKHA 2A5FA 4IXNA 4O0MA 5H8WA 2CLSA 1V43A 4QBFA 2BIFA 2EFGA 1WBBA 3F5FA 2OBMA 1DAGA 1R0WA 3H0KA 2J7PD 4KFRA 2FEOA 2G0TA 3EIHA 2XGJA 1P75A 4GZMA 3PEWA 1XTIA 4RFSA 2YWFA 3Q5EA 4YMUA 3R8FA 2ZI7A 1P9NA 1ZBDA 1ZIOA 1ODFA 2DFKB 5FUWA 1K8RA 1K6MA 3D7MA 1IJEA 3VNVA 1QBKC 4DJTA 2RB4A 2I4IA 1IN7A 2Q9BA 3FTQA 2G1KA 4LX0A 5CK4A 2ZRCA 1TU4A 1EG7A 2YOFA 4LGMA 2ZAMA 1GL7A 2FOLA 4KAXA 3AKEA 3ZQ6A 4CT4B 5CM8B 1N0WA 1OHHA 2IXEA 2W6JA 4DSNA 4AWXA 1KO1A 3H84A 5IHPA 1N6IA 2OBLA 4TYYA 1E9FA 3SOPA 2J59A 2JA1A 1U8ZA 2WOJA 5LB4A 4LHYA 2JLVA 1E32A 4R7ZA 2EYUA 3U7HB 5EXXA 4BLTA 4AURA 5BWMA 4ACAA 2F7SA 1LF0A
chains in the Genus database with same CATH superfamily
1NURA 1ZUNB 3E8MA 4TM8A 1WB6A 1CDZA 3AINA 1C1YA 5B55A 1E1NA 2C31A 3H5AA 1NN5A 5B1IA 4NXNB 2D8AA 3EGWA 4QHSA 3UWMA 1FBNA 3HJGA 3JQAD 1NN3A 1UMKA 1TQ6A 3IDZA 5SYNA 3ZTTA 2NP7A 1Z06A 5DHAA 3BSYA 2A88A 2LW7A 4G5GA 1KMMA 4KQIA 4TTRA 4DADA 5JZ9A 5JNTA 4C07A 2GA8A 1A9YA 3L8GA 1VP9A 4URHA 4X71A 4C5BA 2Z6AA 4ZJYA 1WPQA 2PL1A 4WBXC 3DBIA 4LY0A 4MV9A 2JFBA 1RPAA 2B6NA 3TSYA 1SU6A 1J0EA 3VOTA 1MB2A 1YZQA 2RC5A 4J1TA 3EB9A 4JP3A 2QRUA 2L69A 4IX9A 3WADA 2HMVA 3LCJA 3R4VA 2B2XA 4LN1A 4M1MA 3HFSA 2IOYA 2WMOB 3CCBA 2BFAA 3M2TA 4L75A 5EUQB 4AYWA 1KI2A 3KTOA 1NOKA 2EKBA 4M0CA 3ESZA 3N0TA 4D82A 3HFRA 2WB2A 3GNQA 2ZYDA 3JD1A 1T2AA 2AWNA 4RFLA 1NUUA 4WBNF 5MFPA 1L5YA 3SHWA 2BZ1A 3A4TA 1KSHA 3C14C 4U6NA 3ADBA 5AUNB 1XDDA 1G64A 2P4EA 2P1RA 1TM5E 3LDGA 4LI3X 4YCJA 4YRTA 2GWHA 4KBYA 1J7JA 1I5OA 3QU4A 3SVZA 9GPBA 2W83A 4KVFA 3AKCA 5IT9A 1FCJA 1PS9A 2QSZA 3R0IA 3U0VA 3B51X 5DXAA 5K3FB 1UFOA 3MJVA 4J0CA 3G23A 4LE0A 3TQTA 3ZW8A 2CL5A 3QVGA 2IHBA 1GUDA 3NX4A 4OMFG 3S1AA 4A6DA 4M8SA 3C85A 3VR1A 1QJ4A 2X0IA 3LX6A 1SQSA 1RZVA 5ALPA 1ADJA 3ND9A 5TVKA 2XCLA 1CS4C 5ITSA 3HCNA 4YCAA 1USWA 4DQXA 1KFCB 3TX2A 1M76A 4BEBA 2R6HA 3SEQA 4D97A 2QA5A 3MMSA 2NU8B 1R3UA 1TMGE 1NVKA 2PSJA 4B7CA 4EA8A 3BHNA 3W3AH 4YPFA 1NSTA 1NBMD 3UT0A 1Y8QB 3D0OA 2JLWA 3DEFA 4KZKA 1DQRA 1LW7A 2DR2A 4BNGA 4PSCA 4Q1AA 3K4HA 1MBZA 1SUDA 1Y5IA 3DDOA 4IZHA 4UVHA 4C20A 4EA7A 4NOMA 2WKQA 4PYOA 4ARVA 1OH8A 1PWYE 2XUZA 3G9XA 4LCJA 1M34B 1Z39A 2JFQA 3AEKA 4XIJA 3C6YA 1E2DA 1YRYE 4GYKA 1QTIA 2BSAA 1JAHA 3IXLA 2DUMA 3LVRE 4K87A 4AKEA 5AW0A 1VMAA 4UNNA 1RPJA 3RC1A 4P80A 1G3MA 4RK7A 4HGRA 5I9SA 2HQ1A 4FFPA 3HDTA 1Z0FA 3TD9A 4DC9A 4BQPA 4OK6A 1CUWA 2VSOA 2VNSA 1FPQA 2D1FA 4HEQA 3I5AA 2VK8A 2I1WA 1JZSA 3PRJA 4LF6B 1GADO 1EVZA 1T8UA 2E1PA 1QPBA 2YHUA 4MUXA 1KDVA 1NAHA 1VGRA 2V6FA 3DCYA 4PFQA 5E4JA 3U3ZA 3G7NA 1XMJA 3UGQA 1MG0A 3TL3A 2H7CA 1SK9A 1H4SA 2JH8A 1JLKA 4H3SA 4XVCA 1CBUA 2BM9A 2ID7A 2GPAA 1P77A 2V7GA 4HRYA 1XZAA 4MWGA 4MVJF 4EMSA 2JDIA 1P2BA 3GELA 2WHPB 1UEIA 3CWQA 1YVEI 3G5TA 3N2IA 4Z99A 3T1YB 1FW6A 3DHEA 1CY0A 2OG2A 3L6BA 4MUYA 5JDCA 2FR0A 1A7KA 3B89A 4WKGA 1E89A 2HQBA 2R48A 1A8PA 1DEHA 1JR3E 1ACLA 4TLMB 2BMFA 3TRJA 1XTTA 3O4RA 3SJBA 4RVHA 2RGUA 1Z17A 2JZNA 1V39A 3VDMA 4ARCA 3LL7A 3QKRA 1ECLA 1A27A 3FCYA 3O0TA 4QUIA 4BP8A 3HJBA 1H69A 1ZJZA 3BB1A 3F96A 4JOCA 4US1R 1AQLA 3UVEA 4QT4A 5FWYA 3C6ZA 4HEA6 4RXUA 5ETJA 3WGMA 3DE2X 1H0KA 1UQUA 4YUXA 3GH1A 3AUAA 4KTTE 1CF4A 1DUSA 2ZIAA 3IVAA 3SBOA 2DMRA 2JIZD 4E6EA 3CLUD 3D6HA 2EQ5A 4LQCA 5KSYA 2HJHA 1FX0A 4BFTA 1PJRA 1OH5A 3WVNA 3DF7A 2PJZA 3JQAA 3FNIA 2GBLA 3TDNA 3WJ1A 1V7PC 1RNLA 4OAOA 4PG5A 5LFAA 1VMKA 1W9MA 5DU2A 3DV0A 2WIDA 4BKMA 5JTTA 4KMMA 3HKDA 2HREA 1XL0A 4W7SA 2IELA 3G6WA 4HFJA 5B7QA 1KYTA 1X7GA 2R8YA 1K5HA 3R23A 1U11A 3UJBA 5FWDA 3W06A 4DV2B 2IZ5A 3IJ5A 5AKLA 4MI9A 1Y1KE 2CLFB 3Q7RA 2KPOA 3NQ41 3NC4A 5IJ0B 2OCKA 4IDFA 4MV0A 4AD8A 3ORQA 1PYGA 4IF4A 4ZU6X 4DR5B 1JFSA 1WXHA 1TT5B 4N5LA 1VE5A 1LTQA 5KDLA 3AR9A 2ZXFA 2GZ2A 3U7IA 3VU0A 4D0LB 3DH0A 5CA1B 5G4LA 5GQSA 1L5HA 3EZLA 1JKXA 5BSWA 2HWUA 1H2BA 1VB3A 2D7JA 2VPZA 2XUHA 3RVJA 4D4KA 3KPUA 3QELB 4I50B 4JELA 1FP2A 2R97A 3OLYA 4X9XA 5CYOA 5T4FA 3PXGA 1F0NA 2CDNA 3LBAA 4EHDA 3A4LA 4HT3B 4BNDB 5BR4A 2NADA 3PUIA 1GA4A 2DH5A 4CG1A 2JJ1D 1EXDA 2Q6OA 3CNBA 1LK0A 1N2IA 2ZYHA 4PLYA 3OF2A 3EH2A 3IUNA 4NIMA 5F5NA 3SF0A 1YASA 5KNDA 3IAEA 3QVWA 3CT4A 3OT1A 1ZM4A 1PW5A 2P2YA 3IB3A 2MSWA 1JKMA 1MA0A 5BVGA 2IBSA 2O7VA 3SYTA 2WYIA 1VLLA 3OZUA 3TQCA 1LD3A 1GJRA 4N4AA 1F5NA 1NR7A 2PJUA 2WLTA 2LVBA 2EW8A 3PG5A 1VKHA 1T3LA 4FXPA 4LNAA 3I8XA 4Q4CA 1CF2O 3JARB 4DWVA 1Q57A 2VDOB 3KEFA 3ONVA 5ER9A 1DZ3A 2ZSUA 1E1MA 1RPZA 1KYZA 1QHXA 2A1TS 5FOWA 3GXOA 1JDNA 1KXJA 1NVXQ 2RI1A 1M0WA 4FDAA 3HVIA 3ROMA 3QBJA 4JASB 3ZKWB 6CHYA 1OYYA 1HLPA 2QXTA 3PQ3A 2IU4A 2FSGA 3QENA 4H7KA 1DFIA 4JKIA 3RWBA 4CW7A 1W8IA 3OU7A 1ONOA 3N2ZB 4FU0A 1P4HA 5ILGA 3R5FA 2HZBA 5BN4A 5JADA 2XXAB 1SCUA 1DTWA 1HE4A 1R6VA 1OKKA 2X2OA 4MYTA 1SBNE 2CJPA 1DBWA 3BWMA 3C15C 3DHNA 3TSCA 3VPCA 2CV0A 1FUKA 4RA6A 3B53X 4YMVA 3GGPA 3A28A 1T0JB 4YRKA 2DWPA 4MLDA 3TQHA 1XJWA 3M3HA 5ICEA 3PHGA 3QFCA 2OSVA 1Z2EA 4QUBA 3AO0B 4WKPA 1O5OA 4ZPXA 4FCWA 1P5ZB 3W2IA 5JH7B 1ONSA 2JJMA 3RABA 2JAQA 1GSHA 3IAS1 4YMGA 4RAQA 5JDCC 1DX6A 2ZFUA 4HMQA 3B78A 4MA4A 5AI6A 3CFYA 4Z3DA 1QX3A 3OQIA 4RHYA 3SY8A 3T7JA 4XM2A 1L6IA 1U5AA 5BYAA 3ZJVA 1R15A 1IVSA 2HIMA 4GI5A 1VE1A 3SJ7A 2TRSB 3WGHA 4F11A 4GEGA 4BO0A 2WZDA 3ZYCA 5IBCA 1KEVA 3KSBC 5E0KB 1ISMA 3LT0A 4DCPA 5ANRB 3OQMA 5H4GA 3AJAA 4LJAA 4LHWA 4HR7A 2OLJA 5IYZB 4S1WA 3CRZA 4TTJA 4W5RA 3OQPA 1NW6A 2C1XA 3AX6A 3B2NA 3EZ9A 3INRA 3Q9UA 4HX9A 2GJAA 4WK4B 5AWFC 3V4ZA 4OP2A 4MWOA 3L77A 3U1BA 1GUAA 2XRFA 2JCVA 4I1UA 4HRXA 3G5LA 3RADC 1Y6RA 3TTYA 3WQSB 3L7DA 1EDZA 4U9HS 3ONNA 1C0PA 3GLHA 2EHDA 3C3AA 1MD9A 1T2EA 3COPA 3ZI0A 4AKTA 1J56A 1QF9A 3DMFA 1KI8A 1A9XB 4DNQA 4EJSB 5KMGA 5BWLA 4XRGA 3W77A 5JAMA 4RPKA 1YSCA 4B74A 2JASA 4J9VA 4S0ZA 3SC3A 2IF0A 4PQEA 1BEUB 4Q02A 5KREA 4OK3A 1DDGA 3TX6A 3GLVA 5ALOA 4CM5A 1OE0A 1KDZA 1YR2A 5BSKA 3PTAA 2Z8YM 4PZ0A 3SJUA 2CW5A 1YQUA 5FBRB 1O95A 1SXPA 4C7OB 1YUBA 1FFCA 4E4TA 1VL2A 2SKCA 2VBIA 2Z09A 4A0SA 1SU4A 2IYXA 4HDRB 4Z4HA 1NVFA 5IVPA 5JQGB 1JL3A 4WNIA 1CUGA 1QQ7A 1WXEA 2P1DA 3CONA 1S8FA 4KFCA 3UQZA 4KEAA 5IZCC 2QSJA 3AB7A 4IOKA 1BIFA 3A1FA 3EQ7A 2EEZA 3H4MA 4KMSA 2VTEA 1PYOA 3IP7A 4ALNA 3EVCA 5A7FA 2FHSA 3F5DA 3RUEA 1QVVA 5K0SA 2TMKA 1GRVA 1YNSA 4B6QA 3C4QA 1L7DA 2YNMC 5FO0A 1X87A 4UFOA 1N0UA 1D2EA 3ZWPA 3K9FC 2GK3A 5EESA 5FRDA 5CCBA 4BGUA 1TO1E 5AVVA 4EVQA 1EK6A 2FWPA 4HUQA 5JSKA 2ODEA 2ZU6A 3FB4A 2JVJA 3VYTB 2BHRA 5JXJA 1USVA 1LFDB 5HJ5A 2GPTA 2SKEA 2FRDC 3EGXB 5A1JA 2JGLA 2QRVA 4MV7A 3H2ZA 3OQIB 4Y8VA 3O3CA 4JLAA 3A7DA 4P98A 4WOPA 5HP4A 4CG2A 4NV0A 3TCKA 3Q40A 2COEA 2PX0A 1FUIA 1POXA 1YL6A 4JQZA 1DFGA 3ND7A 3CBGA 3MS7A 4GECA 4GW3A 4O2BA 4R2WA 2WHPA 4KXYA 3NT4A 2VP6A 1Y9DA 1L7OA 3AK4A 4ER5A 3E8SA 4WZBE 4UATA 3QXCA 2Q99A 4EAQA 3UOGA 1PBNA 1Z9BA 4GM1A 2HTFA 3V32A 5BUQA 4QX6A 1XD9A 2IXDA 3AF0A 4RTMA 2BBTA 1QTRA 4PLFA 4DRXA 4X6XA 1DBPA 2YYYA 1W49A 2V8BA 1Q0RA 2W2OA 1G5PA 1SHZA 4QFBA 4ACBA 4D46A 3BN3A 1Z4QA 4L4UA 4TQAA 3UJ8A 4ZRDA 1US8A 2ZVQX 4G0YA 3I9V1 4KJXA 2PMKA 4M9ZA 3QXXA 4MYHA 4DS3A 3A3YA 2UYCA 5A9SA 4Q3CA 1EWRA 3VO2A 3NBKA 2P0EA 3QWIA 4HF7A 4U2KA 3S40A 3AVXA 2PKCA 3S2ZA 4HGOA 4Q00A 5DYGA 4K7JA 4JIGA 5JDIC 1M34A 2CXHA 3WHLA 5CVCA 4DJDC 4TLAA 1PJAA 1JHDA 5K0CA 1VJDA 3R3YA 4U0KA 3L0YA 1DXQA 4JVNA 4PRLA 3JZIA 1V25A 5EOVA 1WE2A 2ZJ0A 3ILHA 1AE1A 3PHLA 4LJ4A 4FJ2A 1QK4A 2JFFA 2KWIA 1YZUA 2QDXA 5EXSA 4OLAA 5AM1A 3SSOA 2EJUA 1G7CA 1AQ6A 2ZRAA 4V0ME 4IV8A 2XNSA 3JR3A 2FPRA 2J3KA 1ISSA 5KWJA 1DJPA 4JUFA 3KB6A 1P72A 3ZVNA 3L1IA 3P8ZA 5IUKC 4KXFB 3UMGA 3I6QA 4BV3A 4UARA 3G82C 4Y2UA 4A36A 3G0BA 1JTFA 1T0HB 3R74A 2ZIWB 2BRUC 2P2SA 3YASA 1AH2A 5DGIA 1K8QA 3JD3A 2ZXUA 3SSAA 1V71A 4C4OA 1UT8A 4HWPA 3WLIA 1ZICA 2XYPA 2NU8A 3G2JA 4MHOA 2RJNA 2XBMA 2R7MA 3HDVA 3I83A 3DOIA 4YCCA 2PUCA 4XIIA 2W00A 4JH0A 4A3SA 1U2GA 5HZMA 1EHYA 2UVDA 2WIJA 3GG9A 4D9GA 3QUAA 4DF3A 3W78A 3P2KA 1VCNA 2JARA 4TL8A 5DDIP 5DNCA 2FSHA 2W2QA 4BBAA 4CFSA 1LDGA 4AN0A 1MMFB 2QLBA 2RI0A 3ESXA 5H7XA 1I9GA 2A9QA 3ZGLA 2O2GA 1OPRA 3I9OA 3KAJA 4DV7B 5LA6A 1JVNA 1X92A 2NXJA 4OQPA 1RI1A 3H0EA 3MRVA 4EW3A 4IZIA 4LRXA 5CJPA 1GZUA 2P3OA 1W94A 3JPYA 3MQFA 3GLFA 3OKCA 4GU5A 4EKDA 4XX0A 3HBLA 5DX8A 2BFPA 2O2CA 2H1LA 3PE3A 1N77A 4LZOA 3EZYA 4FDTA 1HE1C 3MRTA 1DIRA 1Q1GA 1WTCA 4MNTA 3RLFA 4ESVA 2B5VA 2XOEA 1KS9A 2IXTA 3WBBA 3DUFA 2MWMA 1PJTA 3O6VA 4XASA 5CR9A 3RT7A 1MP0A 1Z75A 1UDXA 4KSCA 3K53A 5FX2A 6YASA 4CPDA 2J3LA 2B61A 2J0QA 2OCBA 4KI0A 4BBZA 3U4QB 1FRQA 1Z5UA 3LAWA 1WUJS 2J46A 4ZOCA 3WIBA 1D2RA 3C7AA 4HAVA 1W48A 1PI3A 2GNPA 2O4UX 3PGMA 1T13A 4Y9TA 4G1CA 4M1SA 1ETHA 3KAKA 3OKFA 3X2FA 4WBNA 5EJ4A 4C76A 1GGEA 1RJDA 1VLHA 2IU6A 4YA6A 5ITZA 2Y76A 2VWGA 2BD0A 2V6MA 2V59A 3STWA 4C5CA 1RKVA 3VUEA 4B09A 3DXFA 4DIBA 2VHZA 2H08A 2UYHA 4R41A 5HKKD 3GEEA 2GD2A 1HL7A 2O2HA 3WP1B 1ANKA 1M54A 3Q3HA 4IKPA 4KZPA 2W6OA 3OOJA 3DTVD 4FYHA 4V24A 3VYSB 3LPLA 3Q3JB 1Y3DE 4MEJA 3QE4A 2YNMA 4RTOA 5CDSA 1JEYA 4JNCA 2O19A 3RYCB 2Y1KA 3H5TA 5D01A 5FXMA 1DCMA 2QTZA 1A9RA 1O6GA 3Q8KA 5LD2B 3W2GA 5JNSA 1IOWA 3N74A 2C07A 3ZUPA 1TQ8A 3HNOA 4HAZA 5DWVA 3ZV6A 1KFJB 2OENG 2R1VB 2WM8A 1X1DA 1BG6A 3N2KB 4UU7A 3TO5A 1RQ7A 3WKEA 2GXAA 4DJAA 4S04A 2J85A 3Q2KA 2WA1A 3AWIA 3GJ5A 3IQEA 3JAWA 3BFJA 2FSUA 1CUJA 4AROA 1LBHA 2C2YA 2OWEA 1I4TD 2ZE8A 3DVSX 4RIEA 2EFYA 2OZLB 1SBHA 2KI5A 3HJAA 1P1JA 2H4WA 2R25B 2X3FA 3QA3E 4DEVA 3C1OA 1TKRA 2QJRA 3PYLA 2EGGA 4O4HF 3I39X 3UNXA 5IAAA 5ECDA 1DIBA 1ACMA 3OX4A 2C5FA 2O3JA 5A3RA 4TZ6A 3LBIA 5AHOA 3NGMA 2P8SA 3FHLA 4GAEA 3JQ8B 3TGPA 2PRZA 5IASA 4LF4B 1U2RA 3RF7A 1J5PA 4QUDA 1ZSVA 1BFDA 1OFGA 4TSRA 4CMJA 2V45A 2ORIA 3L84A 2HA0A 1HC7A 5SYMA 2Y1CA 4ETMA 3IMGA 3R24A 2GN8A 2GZDA 4EY4A 2FFHA 1P39A 1QGDA 2QB5A 3VH1A 1E69A 4DG8A 1XLWA 2C7VA 2Z4RA 1M1ZA 2VH5R 3NUZA 4ZEOA 4NDAA 1N2HA 1WO8A 221PA 3UCXA 4KDCA 3D8RA 4OM7A 1GKUB 3WFIA 1DT3A 2XVZA 1W36C 3BX1A 1W5BA 3SZ3A 3M70A 4X7BA 3CEMA 2FOIA 2R5FA 3JATA 5E7MA 1QQTA 2WMDA 5GP1A 2ZJ6A 5TGZA 3OA0A 3VR4A 5ICSA 3EMBA 4P7GA 1AXEA 4XSGA 1XF1A 3L1UA 3SPXA 3DHYA 4WZAA 1X6VA 1X70A 1OZFA 2HA6A 2LTAA 3DS8A 2CMKA 3LU1A 1ZM2A 3NJ4A 3OIFA 2VPYA 4LOIA 1JU4A 4ZI5A 4DA6A 2GKGA 1KTIA 1YTUA 5A4FS 1IK6A 3ONDA 3PJRA 4CCSA 1VYHA 2A6PA 1VFNA 2RHLA 5KYVA 1K89A 2HBZA 4JA2A 5K01A 3DDSA 1ORDA 1Q77A 5BMVF 1I2ZA 1NYTA 1GL6A 4D2IA 3G2PA 4YJ3A 2F62A 2Y92A 1T34A 4D44A 4IO1A 1NQXA 2R1TB 1QYWA 2HNKA 1O94C 1POWA 4DDUA 3AUSA 4DDKA 1L4BA 1L5ZA 1SCDA 2WT4A 3D64A 1JJBA 4AJIA 1MB3A 3K9HA 4FFSA 2XWPA 3DFFA 4Y0VA 4F4HA 5JWOA 2HT1A 1NVGA 2BKLA 1XT6A 2CYBA 2Q5HA 4H9GA 1L4KA 6Q21A 5KX5B 1PT6A 3ESYA 3KYCB 3MXOA 2PX6A 4B7AA 4NCAA 1RYEA 2N46A 4C4YA 1OQAA 2C5BA 5D1HA 5KYUB 4CQNA 2NUAB 2B3DA 2GBIA 3ABZA 5CG2A 1E63A 1OLSB 2O8NA 1EVYA 4FOTA 5C7YA 5HRUA 2CFRA 2VHQA 3BK1A 5E2BA 4AZ0B 1NXXA 1ADGA 1E20A 1G1MA 1E1DA 1JQEA 4GHWA 4BE7B 5I5EA 5ELMA 2PBLA 4BXOB 1SUIA 3H97A 3C6KA 5JJBA 1EI9A 3SEFA 1DO0A 2WFMA 4PFKA 5IU6A 1LV8A 3R5KA 1WDMA 4ZO7A 1OTYA 2IFTA 3EIOA 4OJQA 5JIBA 2O3QA 4FI3C 1P7YA 3Q12A 4Q0MA 4EUNA 1ND5A 2OO5C 1LPBB 3B1XA 3P97A 2WBLC 4IDAA 3KYBA 3SZMA 1I2CA 2BGTA 3T5CA 2AV6A 2CF5A 2FP3A 2ZJ1A 3AC0A 4QXRA 4M9RA 2FMUA 2O2SA 3AYXB 5TQ2A 2JFNA 2WSIA 1TNDA 3NAMA 4XWTA 4ZYYA 1NXWA 3WOVA 4QJ3A 1A2OA 1IMOA 1IH8A 1UANA 2ZR0A 5HRAA 3WOHA 3AJ9A 1FUUA 4WKNA 1JDJA 4OYYA 4R0MA 4KQHA 3OZ7A 3MTJA 1IYZA 4PFJA 4DA9A 1TRHA 4RPCA 1NVEA 2DFPA 2XKJE 1KK2A 3HEAA 2ZW9A 5CVUA 5EQFA 2ZUEA 3D2LA 4Z4EA 1QF7A 4R2KA 1YBVA 1ADCA 2CJWB 4N0DA 2O14A 5CM2Z 1HL3A 2AH5A 2WSBA 1X80A 4PO8A 4K5QA 4DT1B 2J5RA 5EP3A 4XYEA 4B82A 4PIMA 3UHFA 4BMOB 4G0VA 1VL1A 3ILVA 3EG5A 5BQOA 4LYHA 2IYQA 4KQGA 1CJSA 3RYTC 1SC4A 1XK7A 4DYHA 5M7EA 2BCEA 3KQKA 1T3HA 1V48A 1XHEA 1I6LA 2O4CA 4JBWA 4KNWA 2FK7A 1QNFA 2J41A 2ZSDA 1SVKA 3Q7SA 3MWFA 4W8GA 5CEFA 1MOQA 4F6CA 1II9A 3N8DA 4Z4CA 3MOIA 1YQGA 1YR1A 2A5YB 2YDXA 4TV8B 4FWTA 4KLNA 3EEOA 1V1MA 1QP4A 1WZUA 1P5RA 3PUXA 4O4IA 2XTMA 5HW0A 3A7EA 4M21A 4U39A 3NHWA 4BNMA 4NFSA 4KR3A 1P8AA 3X1KA 5AVUA 4DUZB 2VJMB 1BQEA 1TFUA 4G1BA 1XVVA 4RV4A 5HCNA 5HIIA 3NLLA 4Y2VA 3I3SR 3DMGA 3AJDA 3G9UA 3B3QA 2QPAA 2XUJA 4B3JA 4YAKA 1I1OA 3L6CA 3R6DA 3T5BA 2B25A 1VCIA 4FWBA 1GXSA 3DFKA 1ODJA 1QZZA 2QENA 4L9AA 1AS3A 1PL8A 5KKAA 4CFZA 3HM9A 2QRVB 4YRQA 4KU4A 1P0QA 2G1AA 3EVTA 4HWKA 3E27A 3TW6A 4D6PA 4EG4A 3JYPA 2HXYA 2GRUA 1ZCFA 4IWNA 1BO6A 3T5MA 3C5CA 3FWZA 4R2MA 3JYNA 3QG1A 1KGSA 4MPRA 5TMEA 1J24A 2C2ZA 3FNHA 2HHJA 2UXBB 3N0VA 5DLYA 4ABTA 4J0FA 5ES3A 3GQBA 1XP8A 4NE2A 4RDXA 4UDXX 1XPRA 5FYDA 3O9ZA 8AT1A 2HK9A 4QO7A 4FMDF 4F04A 1C9MA 4MPPA 2FLKA 5DHQA 4CHTA 1LWOA 2AW5A 1S96A 4D8XA 2NPIA 3OFSA 1OHHD 5T41A 1M7HA 2O7RA 4O2AB 4V38A 4BPRA 5K5EA 2EGUA 1JT9A 1J2YA 1J6UA 3O7MA 2JAHA 4Z9AA 3H05A 4TS9A 2H3HA 2HK6A 3W5HA 3MUFA 4WN9A 3WL8A 4ZYLA 3UAZA 5LXTA 3NIWA 2J3JA 2KBFA 4JI3B 1RWNA 2EOAA 1RIIA 2BFBB 2FKAA 3CX7A 5KHLB 1E2FA 4R8SA 3ZTYA 3CRVA 3K0FA 2VTBB 3QVVA 3WL6A 2NIPA 2XQKA 2CV1A 1Y8ZA 3AR8A 4DR2B 2L18A 4J0GA 3RG2A 1FTWA 2Z57A 4X7RA 1G8PA 2OBFA 3W3ZB 1JLSA 4K2AA 1QFMA 2CBZA 1A2QA 1RQGA 1L5VA 1A96A 1Y7PA 1YQTA 2F64A 4UU0A 4ZI7B 1TFRA 2ZI4A 2ZT5A 3T5TA 1IEWA 4A2QA 5A9RA 5C1OA 4HMPA 2FVXA 3GGOA 4Z4QA 2IPNA 1XPJA 3GJXC 4WZAE 1RABA 2DBQA 3A1SA 3EZNA 3H5LA 3A26A 2WFZA 1Z4KA 2I2CA 4PYIA 4CJXA 3RS3A 4LISA 5TJHA 4DAEA 4ZFNA 1VL0A 3Q85A 4JJEA 4K6MA 5I48A 1RRCA 4BQSA 2PXHA 3HY3A 3ZE2B 3KU4A 2VH1A 3HP4A 3QXJA 4DNOA 1YZLA 3M3DA 1IWOA 1ZM3A 1RRPA 2ZT6A 4JLSA 3TZEA 1QORA 1Z5ZA 1VCOA 1PD0A 4PYNA 4RKYA 1BU5A 3FAKA 3NASA 3F6SA 4LZPA 1I9CA 2GBGA 4ZCSA 2R1ZA 3T7EA 4BMYA 4BLPA 2OP1A 4D9FA 2C8LA 2WI8A 3IOEA 5BNTA 1ECJA 2W2NA 2EZ8A 1ST3A 5E2AA 5EZYF 1A9PA 5DLQC 2XGOA 3E7DA 3LH5A 3VPFA 3ZYZA 3V6LA 5CJ2A 1YOVB 2FUG6 3CUTA 2PS1A 3E3LA 1J22A 3HEBA 4QATA 4LUCA 3TIIA 1G8SA 3K0KA 5J43A 2ABWA 1JWAB 2Y68A 4YDHB 1QE3A 2P2ZA 4QTUB 3SKVA 2A0YA 4DZZA 2A9RA 1IRXA 2UZ0A 5ERXA 3OPYB 4DDWA 3SS8A 2H5JA 1BROA 3L8DA 3CZ9A 4BJ6A 1GPAA 5BMVA 2WMYA 1PKEA 1UOEA 3BWDD 1MJGA 1UJCA 2H1IA 3NVDA 4ZOEA 3T61A 5I4IA 2GEKA 2FFAA 2DSTA 3WWOA 1YGPA 5ALZA 1NJ8A 2JHAA 4J1SA 1NUSA 2JVIA 3OPYI 5AH0A 1YR7A 3AWDA 3DNMA 1FP4A 3E6AA 1NE7A 1QIMA 1ULSA 1H85A 1XBTA 4C05A 4HP8A 3ETLA 1QQAA 4LXYA 1OZHA 2QROA 3JWJA 3VVCA 4AP6A 4DOMA 5HGXA 5LOVA 3AYZB 2PGAA 4OHYA 2ASEA 2QX8A 2XD9A 4NMMA 3ZXXA 4BFYA 4E12A 2CFCA 2OUKA 1P7PA 3RAJA 3RFVA 3WKCA 1CB7A 5TEWA 5JXWA 5DCWA 5KEIA 3NOOA 3C7KA 3DAHA 5I6DA 3F98A 3L0PA 5I8WA 1KMHB 5KOIA 5KWIA 4P7KA 4INAA 5BN3B 1Y1SA 3H6HA 4II3A 2JLAA 3RO7A 4XOIA 4BX0A 5IJWA 4TSFD 1W2WB 3JRWA 3IESA 4IIXA 1ZK0A 4MJXA 4KXNA 4L73A 5H4HA 4F1KA 5IEJA 4I1PA 3KG2A 1RW4A 4MV3A 2LBPA 1MQ8B 3TLBA 4TKUA 4UULA 4KRFA 3M2PA 4YJHA 3D2BA 4R2JA 3ZY5A 4HTAA 1CW2B 2CVFA 2I9KA 3PIIA 3F7MA 1A9ZA 1L7XA 4FDMA 3LKBA 5TSDA 4D8YA 4UTRA 2IEBA 1A4UA 2K4MA 2FN7A 1W1WA 2QW8A 3GD7A 1P9WA 2A14A 1NE2A 2ZUUA 1YMUA 2I1VB 5AI9A 4F56A 1KQOA 1YRWA 3KT3A 3KSRA 2FEXA 5B4VA 2FXIA 4CL3A 4JR1A 1ZJWA 2X19A 1QRUA 1ECFA 1F2UB 4LHSA 4QICA 4FNMA 4YRJA 4C0JA 3LT4A 3UHAA 2ZYWX 1Z6AA 4KMOA 1SU7A 3MHTA 2BEJA 5JCOA 4CM3A 4LQLA 3DXXA 1TRKA 1SR8A 2HA5A 4A6XA 4CIAA 5K8UA 2BP7A 2HA2A 1G3UA 4KV7A 1VLQA 3TNFA 1EBUA 3UMSA 2WUWE 1M33A 1VJCA 4C7KA 3KJNA 3LMKA 2FWBA 3BFXA 4Q4AB 5AKYA 5KTOA 1T9DA 2C4MA 2HLDA 3ET4A 3ROTA 1EFVB 3N8NA 3O74A 3CS3A 4XUGB 5FUQA 3ZVLA 5I8PA 4NX2A 4YV7A 1YA8A 3O4IA 2ILTA 2JIPA 2CDCA 4OHFA 2JEZA 1XRQA 1S0UA 2XNJA 1LGYA 3DV0B 2AFHE 3NOVA 4R1PA 1YS1X 1PFYA 1K92A 1VI2A 3L04A 5HRCA 4KE7A 4CM7A 1HMYA 4EF6A 2VQSA 1FBTA 2WKRA 1FYXA 3O3MB 4ZARA 3RVLA 3SCZA 3OBIA 1IY9A 5BNIA 1X42A 4OXRA 2IQIA 5FNVF 1I4WA 3KZMA 4XEHA 4RM2A 5JW6A 1U0NA 1Y3CE 3AH8A 4HPWA 1HSOA 2JW5A 4JKYA 1ILWA 3N2LA 1A7JA 1NX6A 3PGA1 4KVAA 1M0TA 2RH5A 1M7BA 3WGUA 1ORIA 5LJLA 2XPCA 3GRPA 2OQVA 1KEEA 4EPWA 4ND8A 4UVIA 1QGZA 3BF8A 1R1DA 2H6EA 4V0OA 5LJIA 3OZCA 1D09A 4B4WA 2V1XA 1IWBB 1LPNA 3QVGB 1HUQA 3CZ5A 4XE5A 1T8PA 3ECCA 3GARA 3T0GA 3VZCA 2DTDA 3EUWA 3U26A 3U9LA 5GZ3A 2XLBA 2QLFA 4BGVA 2A94A 1KDYA 4RNDB 3QKTA 5D6OA 4LJ9A 4IHJB 1JJ7A 4KRGA 1FVHA 1XRRA 2AR9A 4G9EA 4JXKA 2DHCA 2O2DA 4P5EA 4L3WA 3K9LA 1ODIA 5CNKA 3TAUA 5EIXA 4IY1A 1XJ0A 4M86A 1ZD2P 5AW8A 2BEKA 1N7IA 1YIDA 3G2NA 2R8XA 3MVEA 1QK5A 4DSOA 1NDUA 3D4NA 4UHHA 2R8RA 5DX1A 5KNBA 4X3CA 4ER0A 4N5HX 1UBMS 2WAMA 4AW9A 1K7XB 4LEIA 1HE3A 3EPRA 2EP8A 1CUYA 3P9QA 1SZCA 3N7UA 3TPZA 3CV3A 4I4TA 3O92A 4HXFB 3CVWA 1CEQA 1XU7A 2ZR9A 1KKLA 4GC5A 3WWEA 1IJKA 2GHIA 4HJXA 3FR8A 3GP8A 3SU8A 2OCAA 5TGDA 3PQ2A 3IEIA 4I7EA 4Q3EA 4RTKA 1R0XA 4CTKA 1ONPA 5CCXA 2FA9A 1OV4A 1W0KA 3BAZA 1K4MA 4MO9A 4R7GA 3U3MA 3AFGA 3RRMA 3WLOA 4B31A 5JCPA 1O94A 2DFTA 3GL9A 4MPTA 3BMOB 1BE1A 4LDPA 4PPQA 3P94A 4U2BA 4YT2A 4P4UA 3GEDA 1R27A 1XX6A 3VFDA 1G2QA 1KZGB 1PJ3A 1GL9B 3CH7A 3KJEA 4G4SO 4G5SA 1TDJA 4JMPA 4LPSA 3QELA 2IYLD 2QQFA 1AKTA 1KP9A 4I50A 4ZO4A 2GYUA 4BBJA 1BDIA 2V03A 4ZK2A 4E1BA 2YW9A 1CULC 4JUAA 1RQPA 2C57A 2FEPA 4ZWNA 3GJSA 5EIAA 4RPGA 4I66A 4R31A 3MLBA 4R54A 4FQ5A 2NLOA 3AIMA 4MW5A 5AM4A 4MR9A 521PA 1UBRS 1X1TA 2Y2UA 3K09C 5E8RA 2REQB 1OTHA 3V48A 2WF7A 2IYWA 4WESA 3CG0A 1Q5PA 3A1VA 3C7TA 3E5RA 2HA3A 3FPJA 3SQNA 1BVYF 5E6RB 3DZKA 2D5IA 1PZFA 4XB1A 3D8HA 1U8TA 3PUWA 1MTOA 2R5WA 4P4LA 2P3SA 1S9DA 3EXHC 2IOFK 4JU9A 1ZVVA 3ZBPA 2Q4EA 3A1NA 2A0WA 1SVUA 4UCFA 5JD6A 2QNIA 2GZ3A 2XLCA 5ALLA 3HTXA 4WKCA 4B3FX 1WUTA 2EX4A 2HK8A 5JYBA 1H1LB 3A27A 3FTPA 5CA0F 2XKAA 4RPLA 5JU6A 5CDHA 4AS2A 1NG9A 2MYNA 3DEZA 1DXHA 2XA1A 1IHYA 2CJFA 3IMKA 4LAFA 4LV6A 4C6RA 1QS0A 3DZGA 1PW7A 1OFTA 1AB5A 1JKFA 4N7MA 4B9AA 3D0RA 4Y6OA 2HIGA 3EDOA 1FU8A 4ZP1A 4DLZA 4M87A 4U2EA 2HN9A 4W7HA 3SLRA 4E2WA 1M5TA 2EX1A 4NNOA 3UG6A 2B0JA 3BG5A 4L6CA 3URMA 2AKAB 3IVMA 3JRNA 4RPIA 4UNPA 5T67A 2IY9A 4MVJD 1T4MA 1KQFA 3F73A 1QKIA 4BZPA 4IIUA 2ZRMA 3D81A 2VPWA 1ORHA 3KU1A 4HVCA 5JCOC 4ISCA 2D0PB 2DPYA 4DUGD 2R5NA 4KAJA 2GTIA 4BMXA 3LBFA 4EHHA 1WRBA 2NP6A 1E2UA 2J3EA 5G4KB 3SBDA 4YREA 2NQ2C 3OMWA 4BIMA 4EKGA 3AP2A 4IEEA 4LNUA 1YH3A 3T94A 5BV0A 5GJBA 2YFKA 5F33A 1D2AA 4WACA 4C87A 1VLJA 2EBHX 4EBFA 1KFBB 1TEXA 4YMHA 3U7JA 1Y3IA 5F7XA 4REMA 4A8HA 4DLRA 1JV2B 1T6NA 2C3MA 2HM7A 2OESA 4OI2A 2DT8A 1KP3A 3U13A 1D2GA 3VSDA 4C7BA 2OO5A 1LSUA 2VXBA 4IUCS 5HYVA 2FDRA 3H04A 2C9DA 5D3MB 1I4EB 5FNZA 1EGAA 2NYAA 1ZG3A 1L7RA 2YR0A 1FL9A 4G2NA 3PDHA 3K0SA 3Q6NA 2LRHA 1T5SA 2WV9A 2KS6A 1V8OA 4JT4A 3B8HA 3PDCA 1SXGA 2WZQA 3F90A 4ZYXA 1L4LA 4HOYA 3IUEA 4M6WA 1EKXA 3HVKA 1SIUA 3QNMA 4H60A 5KJ6A 3A32A 1XZGA 2X0DA 4CKXA 4AQDA 1P33A 5K6RA 4YH1A 4UNIA 5GZ6A 1DBIA 2CYCA 3DXYA 1I30A 4HX2A 1E2EA 2JCBA 1XZNA 4YRLA 1EBFA 2H54A 3P0EA 4AZ3A 1Q83A 1Z36A 2JFPA 2QMUA 3FMIA 1DOZA 3ZVMA 2YZKA 5E6UA 5EWJA 1BKDR 1J23A 1DKRA 1EBBA 4F4CA 2IDJA 4HD8A 5K2OA 5LXTB 4M9CA 3S1LA 2P65A 1FF9A