1XTMA

Crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIHEKGSCVRPDFESAGGHFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical superoxide dismutase-like protein yojM
publication title From an Inactive Prokaryotic SOD Homologue to an Active Protein through Site-Directed Mutagenesis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1xtmA00
2GBTA 4A7TA 1SPDA 2JCWA 3HOGA 1P1VA 2WZ5A 2R27A 1IBBA 1PU0A 1BZOA 1YAIA 2E46A 3GZOA 1CBJA 4U4IA 5CU9A 2Z7UA 3MKGA 2ZOWA 3KH3A 1B4TA 1Q0EA 1SXZA 1SXBA 1IBDA 4MCMA 3S0PA 1YSOA 4BCZA 1SRDA 1EJ8A 2ZKXA 2XJKA 1E9OB 3GTTA 1B4LA 1IBHA 1RK7A 3KBFA 1EQWA 1SDAB 3RE0A 2Z7YA 3H2PA 3ECVA 2C9UA 1KMGA 3GZQA 1BA9A 2AQNA 1CB4A 2VR8A 3GTVA 1JK9A 1UXLA 3T5WA 1SXNA 1PZSA 1F1DA 2K4WA 2Z7WA 1N19A 1JK9B 1E9PA 4FF9A 1SXSA 3F7KA 1IBFA 3CQQA 3L9YA 4OJAA 4BCYA 2WWOA 3GZPA 2Z7ZA 1OALA 2XJLA 4OH2A 1S4IA 3CQPA 1N18A 2WYZA 4A7QA 3ECUA 1HL5A 1F1AA 4BD4A 2APSA 1COBA 4A7VA 1QUPA 1OEZW 3F7LA 1DSWA 1Z9PA 2AQRA 3ECWA 1E9QA 1ESOA 3HW7A 3QQDA 1OZTG 4L05A 2WKOA 2C9VA 2JLPA 1AZVA 2SODB 3GQFA 1SXAA 1TO4A 3KM1A 3QQDB 2AQSA 5KBLA 2WZ6A 1Z9NA 4A7GA 3H2QA 3CE1A 2ZKWA 1E9PB 3L9EA 4N3UA 1F1GA 1XSOA 3KBEA 5KBMA 1XTLA 2AEOA 1HL4A 3KM2A 2VR7A 1SOSA 1F18A 2WKOF 1OAJA 1OZUA 4N3TA 4A7GF 1FUNA 1SXCA 3KH4A 4A7SA 1TO5A 1E9OA 1E9QB 2Q2LA 2V0AA 5KBKA 1XTMA 1JCVA 1PTZA 2AF2A 3K91A 2AQTA 2AQPA 2GBVA 3MNDA 2GBUA 3LTVA 1YAZA 2VR6A 4MCNA 3HFFA 4B3EA 1SDYA 1IB5A 2E47A 4A7UA 2LU5A 1L3NA 2ZKYA 2NNXA 1UXMA 1DO5A 3SODB 2WWNA 2AQQA 2C9SA 3PU7A 2WYTA 1MFMA 2WZ0A 1U3NA
chains in the Genus database with same CATH superfamily
3L3JA 5E2UL 5C0CB 5ISZD 1VADA 2Y69B 5I1IL 3UYRL 1A64A 3EH2A 1QRNE 1J1OL 3OR6B 1G7PB 3MRKB 2WLYA 4K9EC 1JDCA 3CXHK 3HNVL 2VABA 2NYYC 4OIIL 1SEQL 2PW1B 1DQIA 3QJHB 1CL7I 4A66A 1HJCA 1VJSA 1CE6B 3X3GL 2O6DA 3LB6D 4YXHH 5DUBA 1QR4A 4GUOA 4K5OA 3UTPD 2UZIH 1WWCA 4JFOB 4PREA 4OD2A 3VH8B 3WN5C 1KDIA 2YSTA 1IKNC 2BLFA 3U7WH 1AANA 3WS6C 1YLBB 1J5DA 1A9BB 2VDQL 4TNWF 1B9ZA 1OAUL 1FFQA 3IDXL 1G0DA 3H6AA 1A4JB 3QEHA 3ZE2F 5FIEA 2JB5H 4JUSA 2YRPA 3UBXI 3Q3GA 2A4EA 5ID1B 4O02A 1QLRB 1MRDL 1CGYA 1KG0B 4BQBA 1FGVH 3GHEL 3LPPA 2JTDA 3TBSA 4U1NA 4H8VA 4YBLC 3KWWA 1UWFA 1NLBL 1DSFL 5GGSA 4U1MA 2HMIC 2RAMA 2DM3A 3LN4A 3ARBB 3VI3A 4J1UA 3QAZB 3V5KB 3RDTB 5DZNA 4ODHL 4WW1A 4ODBD 1JYVA 1TQBC 2DQHH 4OD1L 4HQQH 4PN6A 3I9GL 2CRIA 1PIGA 4X5XB 3HC0A 4ZO7A 3T65A 5I1CL 5CR8A 4MCZB 2VLLB 3VXMB 1SQMA 5D1QE 2CJ3A 4LARL 1NCCL 1T7VA 2UWEF 4HKZB 7PAZA 5KAQF 1LLAA 1RIHH 3DX8A 4L3CB 2EYSB 2HJFB 4TQEL 3BZFA 3W0WD 2W0FB 1CE1H 3KH4A 4F20A 2R7EA 3MJ8A 4LIQL 3QDJD 3TBYA 3O8XA 2D3VA 4CVWA 3TT3L 9PCYA 3F6IA 1GGTA 5DHYB 1OW0A 4J4PD 2VR6A 4XCYB 4XH2A 5DU7A 3Q2WA 2WJ5A 1RPKA 3EOTL 5EDXA 3AS3A 4NUJB 2UY7B 2AEPL 5GRJL 4J3UA 4PJAA 1I1YA 3DO3A 3OHXB 3ARDC 1XQ4A 2CUMA 3U7YH 1PKQA 2XIDA 1FRGL 1XF2A 4QRUA 2Y2WA 2IH9A 3ZKNC 3N50A 2I26N 4BH8A 1I8UA 1FHNA 1JZDC 5EC1B 4YO0B 3DGCR 3TBVB 5ACMA 5ALCL 1RUAH 3HI6L 4K0OA 4YHOH 1CXIA 3D0LB 4NEHB 1HOCA 1RK7A 2HUEA 5GRUL 5IB1A 4NFDA 4PJEF 1OVZA 1Q9KB 4DW2H 3GHPA 3IXTA 3RX5A 5LQBL 4N90E 1ZLVK 4X4ZA 5L8LB 1BCIA 4JN1L 4M62H 2V5YA 1UUNA 2XCMC 4U1GC 3MOBH 4XAWL 1QP1A 2VUKA 2P4AB 1KUMA 3WFHA 2VLKB 1WAAA 2N4IA 2CO6B 1WQVT 3MRPB 1IC1A 4X6CE 4DZ8A 3D39D 3Q5TA 2D0GA 2OTUB 4HJ0D 3L5JA 3LNHA 1RZFH 4EIUA 4X8GA 5GGRB 3ARQA 3P9LB 3VFVA 1KDJA 2NY1D 3EBHA 3L3OC 4G3YL 1J0JA 3CPUA 5DD3L 4NZUL 3UMNA 2E75C 5D6CB 4PJ5B 1WT5A 3GLAA 1NCBL 4MDIB 1A9EA 3PG2A 4OKVA 1ANUA 5DVMA 2Q6WA 4DGIH 3T0DA 4E0RB 3NA9H 2VMJA 1HYRC 1KBVA 1YEWA 2ZD0A 1GAFL 2YPVA 1DL7L 2APTA 4ERSL 3TVMD 4UT6H 4DJMA 5DYFA 4I0PC 1TQTA 5FOBB 3D25A 3NAAH 2ARJA 3AWEA 1IO4C 4FFYH 1KPUA 5FAAA 4UBDD 3F6JA 5H37G 1ZVYA 3WJMA 3TURA 1MJUH 3G5YB 3B43A 2W65A 1I1FB 1Q1JH 3QUXC 3UH8A 3RA7L 4JRXE 5AFAA 3LQAC 1GGYA 2EVGA 2K4AA 4U33A 5MEPA 3FBKA 1BZ7B 1Z9OA 3MLVH 2E0PA 2KKQA 4EIGB 2ZYHA 3OKEA 5AVSB 5KSBE 3SE6A 3D48R 2ED8A 2AV7B 3QCTL 4BZ2A 4DGWC 5FO2A 4D0CB 3NK3A 2OSLA 5EEYA 3QJZA 5IOKA 1J8RA 2XVBA 3A5VA 1B4JH 3LKQB 1EV2E 3BKMH 3W38A 3FB5A 4IW4C 3A6CH 3QULB 4M5YH 3VFNB 2AXGB 1MXGA 5IK3B 5FWQA 4ADJA 5M94B 5FFOA 5KYUA 4Z78B 5AAPA 3FTUA 4JCLA 1M2VB 1AACA 5DRNA 1REIA 1WZAA 4HBCH 1KCWA 3HAEG 4PV9B 2R39A 4XP4L 4JRYA 2FBJL 3ARFB 3QQ4B 3E2HB 1DBML 1T22A 1RUKH 3D6GA 3QI9B 4Q2ZB 1ZHBA 1L5GB 4BCZA 2GABA 4Z77B 3EZ8A 1NSNH 2WLZA 1QEXA 3ARYA 1DLHB 1TVBA 4JHWH 2DQGL 5GSVA 4ZFZA 5SWSB 3L4YA 4BRVA 5IQ7H 1KN2H 4XMLL 3LIUA 3OB0H 5CSBA 3LKRB 5GGRY 1CGXA 5HPOA 1QFHA 4NLHA 4PBWD 4GQ9L 5JIQA 3QNXB 1IGML 4PGBB 1N8ZA 4QWWD 5CJBA 1R3HA 1OAQL 3UBXG 2AFNA 5CINH 4Y1TA 4YFLI 3DSFH 4UAOB 2DLTA 2BWIA 2A9MH 4J3OH 5AVWB 5E9DB 5E8EA 4DGUA 3BH4A 4L1TA 4P57B 3R06B 5EOCJ 1ADQL 3OX8B 2CIIA 4QTHB 1JRHH 1W0VA 4LEBA 4Y7MA 4FOMA 4HSQA 5E8DL 3QIUB 4L5FH 2ZSWB 4W68A 2VXSH 2BMKB 2ZSVB 1CBVL 3B2VH 2FYYA 3SPGA 4K23L 2HPTA 4JG0L 5GS1A 3WY2A 1DEEB 5I1KL 4LHUG 4NT6B 1HCFX 1QAWA 1FZMB 3HG1E 4KZEL 5FYKE 3DJTA 2N1TE 1FYTB 2FJUB 4LRIC 4Q9QH 3S34L 2K0RA 4M3JA 4N8CL 3SGKC 5BMFL 1QBBA 2B1HL 2R8SL 4JKPH 1DQVA 2UY6A 2VDNB 4U6HB 3DHJA 4R90L 2WWMD 3HA0A 3Q1SL 3Q6GL 2DYSB 2N1KA 3QHZH 4QRRB 4XMVA 1IZJA 3PAZA 5ANHA 2VW6A 1E6OH 4H4NA 1HU8A 4HEPG 4XN5A 1N3NB 2GUOB 1MCSA 4TLUA 3O4LD 5J8OA 5BW7A 4EN2A 2IJ0C 5IMMA 5E5MA 2M83A 5DJXB 1HEHC 2VDNH 3KPPB 4Z7NB 3T4YB 4MJIB 1G84A 5I1IH 3UYRH 1TZAA 4HALA 4H8HA 1Z9SB 4YIQA 5D2NB 1J1OH 1DANT 1UB5B 5FS5A 4MQTB 3MI6A 1WA1X 2R0WL 3HNVH 4OIIH 2VDQB 4K7PX 3T6XA 5KBKA 1M9WA 1BXVA 2E6QA 5F7AA 2X1OA 3MGOB 3APCA 1CJYA 3X3GH 5A2FA 1RKRA 2DAVA 4N5UA 1AD0B 4XOEA 1I31A 4UU9B 3PWVB 4HH9B 3SGDH 3SJVA 5DDHA 1EZUA 3K4ZA 3EO9L 3R1GH 2ERJB 2VDQH 3CHRA 5EBMA 1D9KA 4Z3GA 3WFBL 3VXSE 2NNCA 2WXOA 5EA0L 1EJOH 3POHA 4ONHB 4YZFE 3TBBA 3GS0A 5BOJA 4HMDA 4DUXA 1CBJA 4PJFA 4N2AA 5FW6A 1WRFA 3SB3A 4WSKA 4D7BA 3ULSB 4B7IA 3OZKA 1MRDH 4QHKI 4LL4A 3FU5A 1UH3A 2X10A 4E9SA 4TSBH 4N2CA 1A22B 2WQAA 4UIKL 3DBSA 1NM4A 4R4FL 4KRPD 2P47B 4RETB 2NZ9D 1NLBH 4H1LA 1DSFH 3TBWB 3QORB 3TPKA 4NQEB 1ZANH 3MDJA 1TTUA 4AX3A 3B4NA 3M1BB 4YK4C 3WIFA 4NENB 3EBAA 3UZVB 3DHPA 4M8VA 5DJAB 2YKLL 1SXSA 4FQJL 1G9ML 4G6JL 1A6AA 2D7OA 1G7MB 2NTFA 3VA6A 4U1SB 3L3KB 5T1JA 5LN8A 1RJCA 2E9BA 1X5KA 4C83B 1GZQB 1Y07A 2XTJE 1SEBB 3M46A 2FT7A 3QAQA 3IGLA 2ZT9C 4LARH 1NCCH 5CJOL 5EC2B 4JLRB 3K81A 1OD9A 4LGSB 1RZJC 4U1JA 1IGTB 1MCFA 5E6YA 5G5DB 1CYGA 3ZYJA 2OZNA 4J8QA 1W16A 4POZC 4V1DA 2R23B 4HC1L 2PXYA 4G8EA 2XDHA 1HI6A 5HVWA 1BPVA 3F5WA 4QXTA 1I9RL 1JWSB 1KCKA 3P40A 3VI3E 1MNNA 4LIQH 5EO1B 4Y5YB 4OFIA 2V2TA 1DBBL 2B0SL 4HJSA 4RFEA 3TT3H 3ILPA 4CA4A 2J25A 5IVOA 3QWOA 3U9UA 1R4XA 6TAAA 4MMXA 1Q94B 3JTSB 4I0KA 4NO3A 4YHIB 1F58L 4KKBD 4W6YB 2BNQB 2ZP8A 2ZUQC 1QVOB 5FUCC 1G4MA 2OP4L 5CILL 1BQKA 1FRGH 1LMKA 2DI7A 5AL0A 2ICWJ 2I07B 3ECBA 3C6LA 5FV1L 5HI4C 5EBWB 4DSYA 3B2UD 5ALCH 2P5WB 3HI6H 3TNMA 3T09A 5JW3L 4QRTA 1KT2B 5GRUH 3MR9A 5ITBL 5DJ0B 1NFAA 2PYFB 3K74B 1E8XA 3WV0A 5FK9A 1XH2A 4GXVL 4TYUA 4Z7OB 3UYPA 1RZKC 2X4PA 2H2PC 3SD2A 2AQQA 2NYYD 2XRAH 1JF1A 4PJAE 1MFMA 3LEYL 4RFOH 1Y1UA 2K6WA 1MCBA 5EZPA 1R6VA 2ADIB 3PWNA 5E2JA 1PKQE 2Q86A 5J3HC 4CVZB 3UO8B 2JMRA 1ET5A 1WJ3A 3VXNA 3MV9A 4HLZH 4ZAKC 4XP1L 3VU2A 3ELAT 2V3EA 2F7QA 4AC2A 1BIHA 1NFDB 2I32A 4G3YH 4C58B 1KLGB 3Q8FA 5CZXC 4FFWC 3OMZA 5HVHC 1USQA 1NCBH 3H2PA 5MEQB 3AW5A 2HFEB 3ILQC 1CICC 4AITA 4JDEA 4JVPA 4RQQB 5AAWC 3WLWC 1LO4H 1GAFH 2N59A 1MWAB 1MZZA 1WAPA 2Z31C 1U41A 3IYLW 3OXRA 4XP5L 1WD9A 1WAAE 5DVLA 1SJEA 4ERSH 3QEQA 3X13B 4DN3L 4EVNB 5LGJB 5DC4B 4ZUWA 4Y4HB 4PR5B 1E3FA 4AE1A 4RIRB 3C6SB 1JFQL 4AQEB 4BCYA 1WBZA 3BRDA 3QW9A 2HMID 4IMLA 2DQDL 4PIBA 1CLZL 4ENZA 4N24A 4GBXC 4P23C 3ZBMA 1A2YB 2XFGB 3QC6X 4LHQB 2X2IA 3RA7H 4XPBL 4OF0A 5GZNC 4NCC1 6CGTA 4X9HA 4R4NC 3RGHA 3WTUA 4K7FB 5LCVA 5E08L 1KXTB 3ECWA 4LEOB 3WFCH 2G4GA 3BVUA 4G8IB 1YCSA 2AVGA 3O3EA 2ZUYA 2KMWA 1GYWA 5JMRA 2ILLA 2NR6C 2R0ZH 3QXUA 2V3FA 4OLXH 1H5BA 2WINB 4WTWA 4H8WC 1S7XA 2GY7B 2H0JA 5IW1A 3PGCA 8FABA 5G55A 2EIDA 2X89A 3QZBA 5KVMC 4AVIA 1AVAA 3VXTB 3RWEA 5FGSA 1ZLUK 4Q6IA 2XKNB 2XVGA 1HL4A 4LVEA 2XG4B 5D1QC 5F21B 5H94B 4P9ML 3D2UB 1HQRB 2WWKO 2NLJA 4JN2A 4G6FB 4XP4H 1W91A 5C7ZA 3TASA 3JV5A 4S0SD 1YG9A 2YBRB 1DBMH 1SXCA 5AW3B 5BOPA 5KSAB 1T04A 5K9OA 1CDYA 4HIXL 3ZTCC 1IEBB 5B1AB 5DVKA 1P1ZB 4DO5A 3ARDD 3SE3A 5DQ9B 4XCNB 4XMLH 4PBVC 3QZNA 2JV6A 1KJMA 4XBGA 3ZKND 4OFDA 4XXWA 1HJBC 4ZUSB 4GQ9H 1IGMH 3DTXB 1F6LL 4LOVA 2O61A 5I1DB 1R9FA 2JNZA 4W4NA 4UOW1 4Z7VA 1P6WA 2G4EA 3BOVA 2CBMA 5KW9L 4YSPA 1A65A 5DGRA 3RDTC 4EPSA 3BAIA 4NAMA 5DJ6A 4MA3A 2FX7L 4FL4B 2OXHB 1ADQH 5EZJA 4JRYE 5HYQB 3MJ7B 4WTZG 4YXLL 3CSTA 4FQ2L 1NINA 1IM3B 5E8DH 4XMTA 1X6NA 3EHBD 3JWOH 2DWXA 2WLLA 1CBVH 4K23H 4AZ8B 4JG0H 1A6UL 1G7IB 2CJSA 4I8DA 4NAJA 3WNOA 2FSEA 5I1KH 2EILB 3ARGA 3D69B 3PV6A 3B9EA 1NGYA 3H1ZA 4FNLH 4LLVB 2HX9A 4KZEH 1G7LA 4KDVA 4B27A 3G5WA 3SCMB 4WU5A 1XB8A 1D3CA 4N8CH 3SBRA 1I8KA 1T83A 3ATFA 3MRGA 2B1HH 5BMFH 3CNKA 3VFWA 1WIUA 2Z34A 4ELKB 2WSPA 1F1DA 3VO0A 3FUIA 2Z4QB 2J55A 2QKIB 5EORH 4H8PA 4R90H 3ZX1A 5C1MB 4YSQA 3Q1SH 3Q6GH 4N8VA 1UWXH 1HSBA 4APQB 2OAAA 4KTDL 4OM1H 4AIXA 3QFGA 4Z1PA 3AJ7A 2WXPA 1OE3A 4W9GC 2YRLA 2VMEA 3MNVA 4OQ1A 3OHXC 3VSUA 3TCTA 3BVNA 4M61B 2BOLA 3KYAA 3MRRB 4KRLB 3L13A 4P4KB 4I0PD 4IRJB 2CE6A 4P5KB 4LPXA 4JY6A 4P49A 2G5BA 1IVTA 4YDLB 2H3NB 1UB6A 4IJTA 4JHAH 3VGHA 3KPQA 3MA7A 2R0WH 1BOYA 3N41B 1W6LA 1SOKA 2X4TA 3NT0A 2Z93B 1AI1L 3FQUB 3QUXD 5KBLA 5FGBA 3AAZB 5KUKA 2XNAB 2B1OA 3ROOB 3FRPB 4MJ4A 1NTDA 4KKNA 4B5ZA 2P1YA 3IN2A 2CGRL 1BXXA 3GSNA 1OARL 5D2LB 1DCEA 4ANWA 4KFMA 3Q0HA 1KXVA 1L9PA 5CMAB 3EO9H 4B5EA 2CRMA 5A43C 1UT9A 2Q8AL 4ZYKA 5BUAA 1F18A 4W9KC 5D7IF 3T04D 1F42A 4J8RB 1NL0L 4HUKB 1QHOA 2OCJA 12E8H 4UTBH 5EA0H 1ZGLB 1PIFA 3L4ZA 1MAML 2D7NA 5J9PB 5I75B 4P2RB 4XN4A 2QELA 3GSWA 1JZHA 4MAYC 4WI9A 3U4AA 1KLUB 1FVDA 4FFZA 3V9FA 4XCEA 1BWMA 3J7HA 2R29L 3UDWA 5AW2B 4MZ3A 4ICXA 4QO1A 5HYJA 5T33L 3PDOB 4OCSL 5LN4A 2YAQA 5F7DA 1SJVA 4UIKH 1BGXL 1JGIA 4Z5RB 1LP9B 2D0HA 4R4FH 3ZDXB 2IDTA 4X80L 1IIIA 1CGWA 4ZFFB 4JFXA 4XMXA 1J8HA 5BRZA 3SJVE 1ZLEA 4NKDB 1JWMB 3NCYP 4ZFOL 2YKLH 5DO2C 1SZNA 4WO4B 5F96L 4RBPK 4FQJH 1G9MH 2EIMB 2W91A 3FQXA 4G6JH 4NQXB 2A0LC 1GS8A 3VA2C 4PJFE 2ALWA 3A22A 2L4OA 3HHRB 3MGTA 3PAYA 3UZQB 3RY6A 3AXLB 1FVCA 4NYLB 4N5EC 2XC8A 5CJOH 2CBOA 4GNKB 4JPWH 2EJ1A 1TZGL 3VWKB 3BESR 1EDYA 4RGNB 3QYMA 2JB6A 5GJSL 4CBZA 3H3KA 2ZNXA 2JKXA 1MFBL 4D9QE 1I9RH 3E8VA 3K3QA 4Z7QF 1MFEL 1KTLA 4NKOA 1YPZA 5JHLH 1JDDA 3S3CB 3UAJC 1DBBH 1FJ1A 1PYWA 1XVSA 2B0SH 3V4UH 1Z5LA 2JI3A 3K6SA 4KKLC 1RUPL 2DB8A 3GEWB 4TQ8A 3FONB 5DJDA 5HJ3A 2YLKA 3DGGB 5DHEA 1F58H 1OP9A 4YLQT 2OP4H 5F7EL 4EUPA 4XVOA 1U8MB 3IF1B 3I3BA 4OUUA 3EYFB 3ZUNC 3WNKA 3SKOA 3GMLB 3QJVB 4RGMB 4XODA 2VNCA 1MCQA 4K5LA 4JZOA 3WLBB 1QEWA 4V1DE 4C8XA 4QTFA 5JW3H 1FNEA 4YDNA 2SODB 1HWHB 2H8PB 3OLDA 5KS9A 1H9VA 4UM9B 1TTAA 2Y5TB 3CPLB 4I5BB 1IAII 1XGPA 3SYPA 5ITBH 1N4XL 4J3OC 3S2AA 1BIIB 3VB8A 2NZ1A 5D93C 3T77B 2C3VB 1NGXB 2FWLB 2KBGA 4W9EC 1E28B 4GXVH 4JM2A 1DBAL 3VQLA 2DWDB 1PNDA 1HXMA 1SUJA 1XCTB 2JK5A 2O6PA 2YPLB 4MD0A 4QXGL 2CO4A 4D94A 3HS8A 2A9BA 2H7WA 1U58A 3I6LD 2R1YB 4N2IA 3LEYH 1BEYL 3VM7A 5I76B 2PW2A 4U6XA 2ZUVA 1LDSA 1PZ5B 3WKML 2VERA 2ESVA 4YVNA 4BE5A 2EDFA 5IQOA 1E30A 1U8KA 2D73A 3QARA 3V4VA 2LR4A 4HIJB 5EOCH 3ISYA 3F7VB 1S6NA 3GMPB 4Z76A 4MB3A 3ZZSA 4XP1H 5A40E 4NI3A 3BISA 43C9A 2DIEA 4X6BB 2WXGA 1UFGA 3DURA 4GT0A 4PJ8A 3HJEA 4QGTA 3X1BA 5F1NA 4G8FA 5CWSA 2AQTA 5KJ7E 5HDBF 3BLPX 5H8DA 1YMMA 1OCZB 3S35L 3STZB 3CFBA 3ZDYE 4BRJA 4PRIA 3TN0B 1EAOA 1NFKA 5DZOA 3W2DL 4OZIF 1T7ZA 2WZPD 5GHWH 4BELD 5ICYB 2AGJL 2A6DA 3RL2B 3NG5A 3ZMRA 4MA1C 4HIIB 4PTUA 1YEGL 3LH9A 4BHUA 4HHAB 5EN3A 3N0PB 1JFQH 3GZOA 2DBJA 4RNRA 3CLEL 4N0UA 3MV9E 5AKVA 4P2QD 1CLZH 3VXRB 4GO9A 4N20A 3T1WA 2AXJA 3MCLH 4XPBH 4AYGA 3TA4D 1KXQA 2Q3AA 4AW4A 4NQDA 2QGBA 3MV11 1KYDA 4OZ4A 3PDGA 3V6FB 4I18A 2NXZB 4QHKJ 5CF3A 3IVKA 1VSCA 4M7JL 3AUWB 1NGQL 4R97C 1MZYA 4YSSA 1WCBB 4QYOA 1QBAA 5IM7B 5I17A 3MLWL 1FF5A 3L17A 3D1MC 5B8CB 4MD4B 1KJVA 1OB0A 3QEQE 4HZ1A 3WNNA 1I9JL 5IZ7A 1EGJA 1PFOA 4HFWA 5DFAA 5AYTA 5JIKA 3GSXA 4HAGA 4POZD 1RAMA 3VI4A 1XGQB 2XTJC 5ACZA 4YDVB 1HZKA 4YGVB 5FO9B 2DYPA 4PY7A 3BGMB 4UNUA 3R18A 4BFIA 1IGYB 3UTZB 4ABUA 3LNDA 4DQAA 3Q43A 1OEZW 4KOBA 4RMBA 4EXKA 3FQRB 2VR4A 5I1EL 3VXUA 3MRIB 5HDQL 3QZWA 2EKSB 5FECA 3QDGB 3QIWB 2J44A 2LU3A 4HIXH 3U36B 2W9DL 1DJYA 2X4RA 3VFUA 4JB9H 3GBML 2UYLA 5IQ9A 4CC4A 2NNAA 1Z9NA 4ZDHA 4BWUA 4JGNA 2P8MB 5FM5M 1XF5A 2YLHA 3ME0A 3P73B 4UQ2B 1YECL 5HI4D 2FEDC 4E5XG 2B1AL 4E41A 1BX2B 4PJ7F 2CPCA 2NT1A 2KPWA 2R1WA 4B0MM 2FX7H 2HG0A 3ABMB 3RIAK 3VD1A 4UIMA 4XB3A 2VAAB 4W6WB 3QISA 1KTJA 3ZPDA 4AIZA 1XMWA 4HBQA 4YXLH 4QHPA 2ALAA 1P7QB 4FQ2H 2GB2A 2KT6A 5LWYL 3U2SB 2WN3A 3KEHA 2H2PD 3L5HA 4U6YA 3VXQA 2AQ1A 2X6MA 4IU3A 4OCRL 1J9QA 5CZVH 3CDFA 1NIAA 4RAVB 1UEYA 1RMFL 1KWGA 1A6UH 2P8PA 3CDGA 2EO1A 4XZUA 1S2EA 3CVHA 5J3HD 5CGYC 5DZAA 1JPSL 1L9QA 3T3MF 4ZAKD 3KGTA 2AV1A 3NPZB 4HMCA 4Z7VE 1G7JB 3GXNA 3MLYH 3OSKA 4Y16B 5C0CA 5K9KA 3LH2L 3ZE1F 5CZXD 4FFWD 5A7BA 1F86A 3GZKA 1CXKA 1O6SA 1E0OB 1PL3A 4Y5YC 4WZ9A 2EYTA 3ZKSD 5AD0B 3OR6A 3BCFA 3N91A 3ORJA 3P4OB 3ILQD 2OTWA 1B0WA 1CICD 1P9MC 4KTDH 1M53A 4AEEA 1QI4A 1BAWA 6PAZA 3WLWD 2ZP9A 2Z31D 1CE6A 3QJOA 4PVMA 5GZOC 3GJEB 1B0GB 2NZIA 3VH8A 3QJSB 3ZIYA 4HUVA 1JZFA 1ACZA 1AY1L 1A9BA 4IBLT 2HTKC 1GYCA 5IHUL 3ZDZB 4GBXD 4P23D 4JFDB 1AI1H 3GD1C 3BHBA 1OQXA 1S7SB 5I6MA 5IUSA 1EIBA 1BXUA 1H3UA 5GZND 5H37H 3ZZ1A 4R4ND 3VXOA 4XP6L 5DVOA 5ID1A 3LNEA 2CGRH 5C0NC 2OMZB 1KEMH 1OARH 2R56H 3E80A 2OK0H 1H6TA 4U31A 1RK0A 2XV0A 3GC3A 3PHQB 4GSDL 1DBKL 3WJLC 1U8PB 2PCPB 4ZOBA 2IDUA 2NR6D 4FQIL 2C1PA 1X5GA 2CHWA 1NL0H 3U4EB 4BK5A 1MH5A 3EFFB 3VFRB 2IWFA 5JIIA 3O9WB 5D7HA 4W6XB 3OBAA 3RWDA 4DQOL 1FORL 1GSMA 2D0FA 1XMEB 35C8L 1J5CA 4I0CC 4C57C 2IDCA 3APDA 4UV7L 3MUJA 1TSHA 3BDYL 4UANA 5CN2A 5D1QD 2R29H 4ZFOB 3SDXB 1ZA6A 4OFQA 4X5XA 5T33H 4OCSH 3RWCA 3V8OA 2J43A 3LZPA 1RJZB 2HYMA 4X80H 2K9FB 2BWDA 3VXMA 4RSYA 5DRWA 2NY4B 3EFDL 1CL7H 1I53A 1UOVA 4HKZA 4GKNB 3GINA 2F53A 3BZDA 3LDBB 4M7LT 5C0AB 2C34A 4L3CA 2EYSA 3MBEB 5EUOB 1MSPA 4IHOA 5F96H 5ICZB 2W0FA 3P9MA 4NM4L 5CNHA 1N5AB 2AK4D 4M9PA 2EUZA 1QSFD 1KCBA 4NO5B 3ARBD 4P0DA 4PD4J 3RDTD 1RJYB 3APMA 1NGZA 2OM5A 3OMAB 2UVEA 4ETQA 2QGDA 1TZGH 3IDGB 5HYJE 5LVEA 1JJUA 1EFQA 2C3WA 5GJSH 1CI5A 5TJWK 3MMEB 2WY3B 4AUYA 5JHAA 4XAKE 1BAGA 1E4XL 4LHUB 5FR3A 3BSZL 4FERA 3T8MA 2Z92B 1MFBH 1J8HE 2KDYA 2AXWA 5BRZE 1IC7L 3DRQB 3H54A 5L88L 1MFEH 3LKOA 4OSUL 2DKSA 5C07D 4HJUA 5EC1A 3X12B 3SBWC 5C71A 1RUPH 5ICUA 1AE6H 3D0LA 4PVBA 4RLDA 4U2ZA 1Q9KA 2CSPA 5F7EH 1NZRA 3G6JB 4OF8A 2CA4A 4YWGL 3IGKA 1NIBA 1R3KA 2PWFA 3FCSB 4Y9GA 3LS5H 3RRQA 5HP5A 3FT0A 2E59A 3MREB 5KSAC 5F7WC 3UIYA 2EIBA 2G5UA 2YA0A 3G9AB 4FG6C 4GG6A 4HIHA 3OR7B 1EUTA 1N4XH 1N10A 1YPZE 2ROXA 4KI5C 3S36L 2VIRA 1RL1A 5ENWA 3SDDB 3FH7A 4HJ1A 2WB1A 4YEFA 1FZJA 5GGRA 3MSPA 5E99L 4KX9A 4ZMWA 2EIJB 3VYOA 2Z1KA 2LLLA 2CHZA 5KUMA 3L95A 3QIBB 3SPIA 4YSCA 2AABL 5D6CA 3FT2A 4WJ5B 1PNCA 3TIDA 5FM8A 5IJCC 4XHQA 4D0BB 4I3GA 4KUZH 3HNSL 2AS5M 3HR5B 4E0RA 1OLZA 4FL4C 4K5NA 2VDRL 3NJIA 4M93B 5CLTA 2OMTA 2AI0L 5KS9F 3F7LA 2WIIB 3IAPA 2WO4A 1RZIB 1ESOA 1WA0X 3A23A 4L05A 2QZQA 2DJSA 3PF2A 4D9RD 5KS9E 2VLKD 2H26A 4KMLB 5HGAB 4A2GA 5FOBA 4Y5VB 4RDBA 5BUGA 1IC4L 4OT1H 5ID0B 2OL3L 3S35H 4GW1B 4BSVA 4N2FA 1YRKA 1HKFA 1LDPL 2MCG1 5JIDA 3G5YA 4MAYD 1W0WB 4RX4A 3TV3L 3L81A 2ENYA 4J23A 5K59F 1BFTA 3V0IA 2AGJH 3N6YA 1BJ1H 5D7LD 5AB9A 1FA4A 5FB8A 5C0IB 3AC0A 4ZO6A 1BZ7A 2ESVE 4PJ5D 1YEGH 4PVLA 2J1XA 4JO2L 5HVFB 4HWZB 2CUHA 2QKSA 1BQ5A 1LM8V 2DWTA 1HH9B 2JJTA 3WELA 3CLEH 4L4TB 2EE6A 3A67H 2A7BA 4OZFA 1F2QA 4YSAA 3IKCB 5CAYB 1AS7A 2WANA 2HLEB 5KG9B 4D0CA 1ONQA 2J72A 2Y2TA 2ZWKA 2FL5B 5DO2D 5E8PB 2X38A 3LKQA 1DE4B 4P4KC 2OV0A 1YMME 2WV3A 3G7TA 3QULA 2A0LD 1U93A 2AXGA 1J05B 2GT9B 2XWEA 3QUZA 4M7JH 4A6YL 4YDLC 1NGQH 4PRIE 5TPWL 3ET9F 1CD8A 2PP7A 4LF3A 4Z78A 4Z0BL 2CK0L 4N5ED 1MW3A 4CADB 1W6WA 2ITCB 1A8JH 2WZ0A 3HG2A 4S1SL 3X1GA 2ZF9A 2GBTA 3QJQB 3TZVC 1MIML 1IM9B 1I9JH 3ARFA 2V7NB 3IFPB 2VISA 2I24N 2G0KA 1L5GA 2CIKA 1BZOA 2YUXA 3HI5L 3QI9A 2E56A 4Q2ZA 1A7BA 2BSSB 1DLHA 1JZ8A 3S0PA 2FH8A 1E7UA 5SWSA 5DUJA 4M1DL 4N0UE 1SM3L 1SRDA 5JPMA 2CBPA 5KAQG 1TNMA 5D5MB 4WFGD 3UAJD 1EHAA 3NZHL 4Q6YA 3S8WA 1KXQE 4KKLD 3AABA 1ODAA 4NQDE 1J7VR 5I75C 5I1EH 1H6EA 5HDQH 2NT0A 4AK1A 3FAXA 5BUPA 3BUDA 3CN2A 1GOHA 3MV01 5D6DC 2W9DH 1CYWA 5E9DA 3HUJF 4TQIA 3GBMH 2FBOJ 4P57A 3R06A 3SE4A 1E4HA 3CC5A 5DA4A 3OD3A 4QTHA 3S5YA 1G9MC 3QIUA 2ZSWA 3NCJH 3OMNB 5FYJE 1YECH 1EHKB 2BS71 3ZTDC 4ZO8A 2A6JB 1OOWA 3VI4E 2L8AA 3GZPA 2B1AH 4TTGA 3VD0A 3OC8A 1T3FB 4OF5A 1FZMA 1LD9B 4J3OD 3FB6B 4F9LA 3WU1A 1FYTA 4L2LA 1TEGA 1XCWA 3PHOB 4TS6A 1HL5A 1JZ2A 4BFNA 4PRPD 5CCKL 1KBPA 4DK3A 3O3BB 3AVEA 2VOTA 4TQHA 3VXUE 5LWYH 4UTAL 3EDDA 3O6KL 3RX8A 1EAJA 4LPVA 4OCRH 1BM3L 2AVFA 1RMFH 3FC8A 2EINB 2XWZA 3IJ7A 1DJGA 1HHHB 1I1AB 1I7UB 2A5UA 3VWKC 1XR8A 5C0DA 1JPSH 2EVIA 1N3NA 4NZDA 1IVLA 4X7SL 4CGUB 4TVPE 2F74A 3BYTA 5JIPA 3FUJA 1BZEA 1P5UA 5DJXA 3LH2H 4KO5A 4MJIA 4E41E 4KTYA 1ODUA 3T4AA 3NIGE 1YVLA 4R7XA 3L4TA 5D2NA 4RZCB 1UB5A 4GAJL 3EXLA 1KLFA 3S3JA 3ZE0E 1CF1A 3TWCL 1E9OA 4LCYB 4Q4EA 4ODUA 4ZQKB 3QFJB 3AROA 3K91A 5HHOD 2N7AA 4UU9A 3PWVA 4HH9A 4QRRD 3PNWB 4PRHB 2WKGA 1AY1H 3GDCA 4MXVF 4CU6A 2Y1VA 4UQ9A 1AXSB 4K5MA 5CU5A 5DHVA 4ONHA 5C0CE 1HWWA 1DFBL 3BH9B 4HUCA 1U92B 1S9YA 2DY2A 1QFUL 1JVLA 2RFXA 2O1AA 5F3FA 4TNVF 2XVKA 3U1QA 2AKRB 2F61A 4XP6H 4OGXL 3VVVA 3RUGB 1X7QB 1RK1B 2VH5L 1J0IA 5AW6B 2ZOWA 4GSDH 4O58L 1L6ZA 1DBKH 1RU9L 1LHZA 4W93A 4AOFA 5CIPB 2MFNA 3C9NB 3WXWL 3BIAX 5J57B 4WFED 3FULA 3TBWA 3QORA 4DKAA 5AZ2L 1FORH 3M1BA 1E42A 4R9HA 35C8H 1EFXA 3T08A 3KBPA 4U2YA 4UV7H 4LLWB 5DJAA 3BDYH 1C08A 3U1PA 5IROD 1VENA 1KBWA 5CIPH 1MCJA 5JIMA 4HKJB 2JKRM 1PY4A 1FVEA 1NANI 2FT8A 4YL9A 2ZAHA 2H32B 4U1SA 1MF2L 1XGUB 4BDVB 2W5PA 1SEBA 4D3CL 4KTEL 1JPGA 2UXGA 5CEZD 3VB9A 1BG1A 3D0AA 5EC2A 3FU9A 4R2GB 3E7JA 3IJEB 4JFEB 5A6MA 4JLRA 1KY6A 2FWOB 4IM8A 3QB7C 4I9XA 1IGTA 3UTSB 4ZNEA 1KBBA 4GMSH 2R23A 2H32H 1T6BX 4NM4H 3RU8L 2FEDD 1JWSA 3OF6A 2OMUB 3ZT6A 1JYWA 2UXFA 1T7YA 4NQED 5LDSA 2C4FU 3KXFD 1M9SA 3NIDE 5TFSL 1E7VA 4YUEL 4Z9KB 3JUYA 3EG9B 5IJVB 1I75A 3MQIA 4LBAA 3QEUB 1OB1B 1D6EB 4UDTB 1Q94A 3EGSB 2DWYA 4Y2DA 5EO0B 3U0TA 1FLRL 2TSBA 5DJYB 4YHIA 1E4XH 5KOVC 1B0IA 5F9JB 3VXME 4NNXB 2BNQA 3BSZH 1QVOA 4HG4K 4GOSA 1I85C 4OSUH 1K4CB 3GLDA 2CR0A 2F53E 1KPVB 3SDCB 4HXBL 2X6BA 5EUKB 4KJQC 5E6ZA 4UF7C 1ACCA 5CGYD 4GP8B 4XB8A 5C08E 2P5WA 3R19A 1AZUA 1UC6A 1JGEB 1WZ1L 5HYSG 3OC5A 5TD4A 4K8RH 2HKAA 4L8SB 1FNSL 3FFOA 2PYFA 4BH7B 4PY8I 2KYIA 4YWGH 3H9SD 1X6LA 5T3ZL 1A6ZB 5D9SB 3L1GA 1X5IA 3STLA 3FQNA 1CVSC 4I13B 3IBOA 3LV3B 1TLMA 2ADIA 1ZHKB 3I3EA 1M7DA 3TM6A 4CVZA 3ZO9A 5GZOD 1LO5B 1VFOA 4QAWA 4WI2A 3ZIMA 3ZU8A 5KYXA 2R27A 2H2SD 1SVBA 1NCWH 1XGRB 1YEKL 2E4TA 1YAIA 3NYKA 2A83B 2ICEC 4IBQA 3QO1A 1NJ9B 1MVUB 1NFDA 4RMWA 2JFCA 2HTKD 1KLGA 4MLIA 1CF8H 4QRAA 1O7SA 2AABH 2CHNA 1I3UA 2VXTL 2QLVB 3V0AC 5MEQA 1UWGL 2FTAA 1E5YA 3GRWA 4LCWD 2IPKA 2OL3B 3FU8A 4RQQA 2AI0H 3CU1A 5C0ND 5I6XB 2BJML 1MWAA 2O30A 3F84A 3T71A 1ZXKA 1AXIB 5ESAB 3LVEA 4QDGA 3X13A 4YR6A 4EVNA 5LGJA 4GG6E 4M5SA 4Y4HA 2Y6SC 4TMPA 4PR5A 4RIRA 4AQEA 3QRFM 4BJLA 5LBVA 5AAMC 3BPLB 1OP3K 2OL3H 3ISRA 1LDPH 2YJLA 4FNQA 1HNYA 1YY8B 1A2YA 2ENSA 3PJSB 5J5EA 2JELL 3TV3H 3RY5A 1BYNA 3E1ZA 1OTUC 4Y16C 3PIQB 2DLIA 2DKMA 1M71B 2MIZA 5DJZA 4OF3A 3KPSB 3MRMA 4FZEL 4JO2H 5DMJB 1HNGA 5B22A 4A7VA 4A6YB 4IIQB 3VGAB 1LVEA 1F45A 2DBLL 5F7FA 4JZNB 2GSGB 3PPSA 1SXAA 1F8TH 1U8JB 5DI8A 5IMLA 2ZX5A 2AQ2A 1E4KA 2AXFB 2DWSA 3QQ9C 3DYOA 3BAXA 2XKNA 4A6YH 2FNBA 4U7SA 2XPGB 2XG4A 5H94A 5EDSA 5EBLA 2CK0H 4UTCA 4K73A 3HHSB 1QNZL 5MI0C 1CGSL 2Z0UA 4QIRA 2OMBA 2B3RA 4UOQA 4WWID 3PGDB 4AYID 1NIFA 1BXAA 1HHJB 2YBRA 3K8LA 1VB9A 1N8OE 3HI5H 3PP4L 5EF2A 2B4CC 2BP0B 3DJ9A 4W9ZA 2JCCF 4QHUB 1XCQB 1KNOB 2GHWB 4D0DA 1GTNA 4M1DH 1SM3H 5E5RB 2Q2LA 1OGAB 5JO5B 3NZHH 2NX5A 3NFNB 4FJYA 2VM9A 4BQCA 1UZ8A 2VZ1A 4HJGA 3SKMB 3B7SA 4AG4H 3FT4A 4R83A 3JTTB 3BPOB 2VB5A 4PQXA 5FPIA 3DK0A 2E6PA 2ZOLB 3CHOA 1G9NL 3AB0C 4ZMPA 2OXHA 3R8BB 1BREA 3S5LA 3TIEB 3ARXA 2R2BB 2QSVA 3D2UD 1IX2A 3VRIB 4J3OF 1IM3A 4MQ7B 1WS7A 1H6UA 3QUGA 4GS7B 5SWSE 5KSAD 1CLYL 2NY4C 4P5MB 3V0DA 1A6WL 4CRPA 5IV2B 1G7IA 2QQNL 4FG6D 3B7TA 5CHNA 4PS3A 4YNYB 4LLVA 4KI5D 1L9SA 2XXCB 3SCMA 5CCKH 2YN5A 3QUKA 3L1OL 3MHZA 3BE1L 4RRPG 4ELKA 1T1ZA 7CGTA 3EFOB 2Z4QA 3O6KH 2QKIA 4IRSC 2EEAA 4R4BB 3KLHC 1SHXA 3D4GA 2HUHA 1BM3H 5E9DE 4YFEA 2EDJA 2ZYRA 3CVBA 5HGGS 1A7PH 2ZF8A 2HFFB 3IFOB 4APQA 3N42F 1PGRB 2YEVB 4OIFA 2A77H 2VXQA 4X7SH 5C8JA 2AMUA 2D7TL 2NRDA 5I1AA 1JUFB 4X9IA 1LEKA 3BUYA 5BV7L 4X4YB 4HWBL 2XIBA 4PJDA 1HL9A 2GVYA 4U05A 4IRJA 4LAQL 4ODSL 5IFAH 3RWHA 1JMZA 4GAJH 1C7SA 1FYTE 2H3NA 1D5ZA 1ZTMA 3SDAC 1LILA 1HCVA 1U33A 2R0KL 3QPKA 5D7JA 4LKCB 1CXFA 1QFWI 1OTTC 3AAZA 4HF5H 4UTBA 3G5XB 1OHQA 3AQDA 3ROOA 1PD1A 3FRPA 2XWTA 4ADGA 2Q7AA 4L8CA 1JXJA 1T2XA 1I9IH 4WEBL 3ZOAA 5D2LA 5KSVA 3LCYA 4TNFA 3FJTA 5CMAA 5IEHB 3V7AE 1F4HA 3V0JA 4GB9A 1RSYA 4EDWH 1NCDH 5LLIC 3MV8D 4DKEL 5C9KA 3QXAA 4NDMB 1ZGLA 3E6FA 1UYWH 4Z95L 3T6ZA 4Z7NE 1DFBH 2GI7A 5J9PA 1QFUH 5C09B 5D8JH 2BS9A 5D2NE 4P4KD 1KYUA 4OGXH 2AK1L 4MMYB 1C8QA 1KLUA 5CJQH 3ULVL 4NPKA 3EIFA 2R2CA 1QG3A 4O58H 1Y0LB 1RU9H 1HH6A 2V9UA 4ODVL 1QHQA 3PDOA 4WW2B 3ULUL 1Z3RA 3WXWH 2BSDA 4ECNA 2WPGA 3TZVD 1BD2B 1G6RB 3DHMA 3DV6B 4MRCA 3BXNB 2Q87A 2MH4A 1X5FA 4ZFFA 5AZ2H 4M93C 3MNWB 4XN7A 1LEIB 4QF1B 4NKDA 3WFDL 2A99A 2WWNA 4G11A 1ZLWH 2B3IA 4N2MA 1DQML 4KU1A 3N85L 4G9FB 2BNUA 4WO4A 4NN5B 3W9EB 4NQXA 3B2MA 4Z3IA 1G6RH 1U2CA 1WVZA 4AQ1B 1MF2H 4IBVA 3FSVA 4PJCB 3RP1A 3UZQA 4P2RD 5IQLA 4D3CH 4KTEH 2VUOA 5GS2H 5JHLA 2BSEA 2BSRB 1WS8A 3T2NL 3WUZA 3NEEA 1RERA 4KGJA 1A7RL 1LE9B 1BOGB 3PL6C 2W80C 1A5FH 1G0XA 2JLLA 3ZZLA 3RU8H 5DURB 4Y9CA 3WI9A 1UM4H 4G8AC 2XTLA 4LSTL 3O6LL 4AJVA 4KXBA 3RX7A 2BVPB 2IO5A 4ODWB 5TFSH 4QHMB 4YUEH 1OT1A 4WDIB 3O3DA 4L29B 4YHLH 1NGPH 3WE6B 3FONA 2PR9A 4PJIA 5F89B 3GLEA 1FLRH 4DVBB 4U1HB 1IBFA 3DGGA 3HI1A 1ZLVH 2PCFB 2Q3ZA 3ZRFC 3BUTA 1A6TB 4UYPA 3OJ2C 1U8MA 4L3EB 4KDTA 2D3JA 3GMLA 4HXBH 3VWKD 3WLBA 4ZNEE 3U0PA 1Q9LB 4IOIB 1F3DJ 4NBZB 3NCYS 2V2WB 1WZ1H 3KWTA 3QWRD 1SMDA 1OZTG 3GM0A 4NGHL 4P3DA 3CZNA 1BIIA 1FNSH 1RIUH 4MS8D 1NGXA 3UG4A 1A1OB 4OZHB 3KEDA 4DN4L 3CH1B 5T3ZH 2DWDA 4GKLA 1XCTA 5C0GA 1TKWB 2FJFA 4NB7A 4ZXBA 4PLKC 1AXTL 5CJ8A 1EO5A 1BYOA 2XZZA 4JFPA 4MNHA 4BXVA 2BNQE 3TFBA 3O2WL 3FB7B 4GKZB 5HJDA 3FU6A 4X6EA 3NPSC 3ZTNL 1MEXH 1PZ5A 2NXYB 4O2EB 2F5AL 4QT5A 1MI5A 3KD4A 3GJFK 3TYFA 4XNBA 3F7VA 1AQDB 1LE5B 2HB0A 1YEKH 4OY9A 2P5WE 1DYZA 4IMKA 2VE6B 2FBRA 4WWKC 2X6CA 3TX4A 4Y5XB 4UQ3B 2QSQA 3MJ6A 5C2UB 1EPFA 1V05A 3N1QC 2VXTH 3QT2A 4UM9D 5FHBH 1PTZA 2AF2A 1UWGH 3STZA 2RHEA 4M7ZC 2C3GA 4B60A 3TN0A 1SHSA 2WIMA 4Z7OE 5FF6B 5CBAB 2BJMH 4LLDA 2QPEB 5DQJB 2YPLD 5IR1B 2VJXA 2G30A 2X4UA 4LCCA 3RL2A 3WE1A 3SQRA 3BDXA 4XWGL 1QYGL 3BZ4B 4HIIA 4C56B 4E2OA 1QR1B 4HHAA 3QQ3B 3FMGH 5F1IA 2C3HA 3TPUB 1C9SA 4F7KA 2NY7H 5DA0B 3O2DA 1NICA 2O5XH 5E4EC 5JQIB 1HINH 1SXZA 1NFDE 4MNQB 1HXKA 2JELH 4URKA 5E5UB 4A68A 2HVJB 2QTEA 3V6FA 5TQ2L 5CCGE 3MRCB 3DK2A 1TU2A 3RBGA 1E40A 4W9HC 5IB4B 4FZEH 5IWLC 4G42B 5GSRA 3MLTB 5IJDC 1A4AA 5BO1L 4P8QA 1UA3A 4UILL 1WCBA 3G08A 1P84K 1DHKA 4ZPTB 4MJ2A 5B8CA 1HSAB 4MD4A 4N6RA 1NDMB 2XSKA 3MX0A 4IDLA 3T0EC 4OAWB 4L4VB 1AC6A 1NDTA 3ZRSA 1IUZA 1BVOA 3L5WB 4N0FA 5MHSE 3C87A 2BHFA 5EZLB 3IMBA 3CQQA 3N1GC 1AKJB 4M5ZL 4JDTL 4YDVA 3HC2A 1UASA 3FQTB 2XJLA 3NSFA 1YNTB 3VXRD 3IDIB 1MCRA 1QNZH 5BO0D 1IGYA 3AWGA 4GXUN 1CGSH 3ZW3A 1BSIA 5IBLC 4GRWB 3DROB 1E5ZA 3ATEA 3D18B 3Q7JA 2EKSA 3PP4H 3QIWA 2DD8L 5BZZA 3U36A 3CSYB 2AJ3B 3QUYA 3BT0A 1O9WA 3ALXA 1MCWW 3ZHKA 3RWJB 5BPPA 3NBNA 2GTZB 2DQTL 4I88A 2NQDA 2P8MA 1KIPB 4K3GA 1CDUA 4GKSB 3P73A 4KHXL 2J71A 4GRWH 4UQ2A 4KJQD 1E8YA 2NY6B 1E4JA 2E74C 2WXIA 4MB4A 1BX2A 1VFAB 3AT0A 1OQOA 1HILB 5IB2A 1JK8B 3ELQA 1CR9L 2BNRB 4JRLA 3GUFA 2VAAA 4WO0A 2X2HA 4XE5B 3HC3L 1P7QA 4KI5F 4WUKL 3FYEB 4N1EA 1QO3B 3K7UA 3MJGX 4TXVB 4ZMAT 1ID2A 2E9GA 4XC1L 1H3PL 3EYOB 3I6GB 1A6WH 3QDGD 4NP4L 4R2GC 4YHPB 2QQNH 1ASQA 3DNKA 2DF3A 2Y07L 2PTTA 5DEFB 4HV8A 2AEWA 2Q9OA 4RFNB 2Y4SA 2NX5E 1Q8MA 4BFJA 3BE1H 1I8IA 2IBBA 5L2JA 4PY8J 2D2OA 4PP2B 2XQYG 2RD0A 1CFQB 2AV1B 1Q0XL 4GG8B 3FFCD 5AD0A 3IFLL 1QSEB 4Y4FA 5SWZB 1ZT7B 2FQGA 3BP4A 1C5DB 5K1JA 2MCAA 3T1FA 2D7TH 1AMYA 2X05A 4JAMA 3W56A 4AKQA 1L9RA 3GMNB 1UT1A 5CJXA 43CAB 1H0DA 5H37A 3RPKA 4WY7H 3CIQA 2A74B 5GXBB 1QHPA 1B0GA 2Y6SD 3FSWA 4ODSH 2VQTA 3GUTB 3QH3A 5AENA 2F1AA 3EJJX 2OYLA 2XFXB 2V37A 5FM4A 2DL9A 5TH2A 5TK4A 5HSFA 5I1JL 2Y7QA 5BS0B 5L4JA 5EOTB 1WO2A 1S9WB 3LPWA 3KL5A 2FDBP 4HUXB 4M8QB 1OTUD 4Y16D 1CTNA 4KNSA 4BKTC 4WEBH 2AZUA 3BP7A 1YZZA 2OBGA 4KRNA 3QA3B 3GSVB 2F7RA 2PPFA 3D12B 3PHQA 1KTRL 2YARA 1U8PA 1XHHA 2PCPA 1VEMA 2PWHA 2X12A 4HLJA 3HB3B 4XN2A 2R29A 4L23A 3HE7A 1HESA 4GAYB 2CUAA 4DKEH 2CG9X 4Z95H 4PJDE 3VFRA 3HZYB 3N41F 3O9WA 3C8KB 3QQ9D 1OCRB 3HAEA 1I7RB 3U4BL 3ZXAC 3O2VL 1UKTA 1U6AH 1ZY9A 3ULVH 4MZIA 2X70A 4EN3B 1YYLL 2WXJA 1OIOA 1ZXQA 4IGBB 1TZIB 4ODVH 1TQSA 4JFDD 1ZDSA 3PNRB 1RJZA 3PWUB 2MCMA 4H5SA 5ITFB 2KLSA 2EH8H 3CFJB 4HZAA 4KX7A 2C8NA 3MA9H 4LSPL 5D2LE 3ILEA 4QJ4B 4XOAA 2WMPA 3EXJA 3CDCA 1J0YA 3WFDH 3HMWH 5C0AA 4JDZB 3QNZB 3BQUC 3UBXA 4S2SB 1X4XA 4YHYC 1I8LA 1DQMH 3MBEA 5EHFA 3N85H 5DT1L 2J8UA 2IAMC 4LSQL 3B6SB 1N5AA 4HDIB 2X3AA 3V6ZB 1NGWB 5E9AA 5LBSL 1LP9F 5I66B 1I1RA 2B59B 7TAAA 1X3DA 1KPRB 3T2NH 3B1TA 1GZHC 2YXWA 2P8LB 2WC7A 3FO0L 4WI4A 2ZWYA 5IKCB 3ZDXE 3X14A 3MMEA 1T89C 3OKDB 4LHUA 1A14L 4OLUL 5JHDB 4IBTA 2VQUA 1AYOA 1U3YA 4KVPA 1YMHA 2HLAB 3MLRL 4IIQC 1F97A 3ATDA 4LSTH 3O6LH 2NY4D 5KANI 2FECI 4M4PA 3WAJA 3H9ZA 2JKIS 1JNJA 3VRLF 4U3HA 2DTMH 2YPKB 3WO4B 2IMMA 3JZ7A 2W9LA 3SZ6A 4JKLA 1IBBA 5LHDA 2XN2A 3CGTA 4HEPA 4IRSD 3DI3B 5F88B 3FO1A 3DKHA 3KLHD 2F68X 3ZMEA 1BVZA 4BA0A 1RULH 3DOHA 2C1OB 4RGNE 2HJLB 3B3BA 3INUL 5TE4L 4LQ1A 4AQAB 1QABA 4EZJA 1EZLA 3K6DA 4Y19A 2C9UA 3MREA 4PJHB 1M05B 2QMKA 2X87A 4F33B 2DQFA 4HHGA 1BFVL 3OR7A 4NGHH 1UXLA 4XOCA 4BKLB 4HU8A 3GF8A 4DN4H 2CXGA 3GNML 1QD0A 5EEWA 4MKTA 1AXTH 1SJHB 4PJIE 3SDAD 5I8KL 4HKXB 3QIBA 5IVZB 4FS0A 3DBXA 3UADA 3O2WH 3CFQA 4HPHA 3ABLB 3KE0A 3JV4B 1OTTD 1SFDA 2CNYA 2CMRH 2DWEB 2PPCA 2QMJA 4OGYL 3LKNA 4MSWA 3BCDA 2NCMA 2ZONA 3NCFB 1UD4A 5E5LA 3BDBA 3VNYA 5KZCB 2IGFL 4L8BB 1RZIA 1FFOB 3I6SA 4EBQL 2BXYA 2WYIA 4P2OB 2XN9A 1PZUB 3L5XL 4H2AA 4IOFC 3EJTA 5JPNB 2BX5A 2XV3A 4FNSA 4GS7C 5HGAA 1ZPUA 1OP4A 3OB8A 4HD5A 4Y1SA 4Y5VA 1A3ZA 1EA9C 1I7TA 4GW1A 3DHUA 3O6FA 4FTVB 3SDDD 1SLVA 4LSUL 2FD6L 3EKCA 3HZKA 4N25A 2JIXD 1RZ8B 6FABL 5FA4B 5DD5L 4GEIA 4GT7A 4BYHA 1A3LH 3HZMB 4PGDB 2BVQA 1F41A 1QYGH 2OULB 1WC7A 1MI5E 4HWZA 2P80A 4PWEA 4XNYL 4DO6A 1A47A 2DQEL 3GSRB 4L4TA 5L2KD 4B9FA 3E0GA 3IKCA 3AGVA 3WKYA 4AGMA 2FK9A 5KG9A 1F6AA 2WBWB 3IE9A 2BM3A 3TO4B 2R9HC 3DUUB 2H3KA 4XVUC 1ZLUH 2ZOKA 1WFNA 5GRVK 5E8PA 1DE4A 4WI5A 1HN1A 3VTAA 3B9KC 4GRMB 3IRZA 5E94B 5E70A 5I2IA 2CLVB 3EGDB 3QR2A 3C5XA 3A0OA 4DP7X 5BO1H 3V0VB 4UILH 5F97E 5IVXB 2JE8A 4H2CA 3AREB 4HP5A 3E8UL 4JJHA 4W9FC 5KN5A 4NRXA 4AC4A 4C4KO 2V7NA 3U0WH 2ICCA 4NRYA 1FIEA 3KLSA 2BSSA 3LD8B 1YHPA 3PL6D 3UERA 4AQZA 1JHTB 4HAFA 1JBJA 1WTGT 2APWA 2GK0A 4M5ZH 4JDTH 4S1DC 1QZNA 4WNJA 4IOSD 3E3QC 1GA2A 3P3YA 1WFOA 2CKBL 4JL2A 4PG9B 1V3LA 5L4IA 2EICA 1JGLL 4R3SA 1KACB 1K6QH 1AQ8A 2CO3A 2EC8A 1ZS8A 5LXGL 4LRNH 1CXHA 2MHAB 4QRPB 2FB4L 4G70B 4K3EH 5AZEL 3ATBA 3FSAA 5AZUA 4CMHB 4M4RB 1E43A 2A9CA 1MHHB 2J4WH 2G2RB 1B9KA 1VHPA 4KO7A 2EP6A 4XP9H 4KHXH 2DMBA 2XG5A 1IM9D 1MCCA 2W60B 4NOBA 1CDHA 5E9NA 3EGXB 5EFIB 4WIQA 1S5IL 3LRSB 2JKWA 4X6DA 1HEJC 3JTBA 1ZJAA 1R3JB 1T3FA 1QUNB 1MHCB 3MPCA 1LD9A 3GMQB 2H6PA 3FB6A 4LLYA 1BWWA 4F9PC 3PHOA 4QY8B 1MDAA 3MRQA 3O3BA 2F5BL 1J9SA 2WCGA 4PLKD 4KY2A 1MLCB 3M45A 4AQ1C 1GCFA 4Y0GA 3IRCA 2OI9C 1C5CL 4XC1H 1H3PH 5GS0L 4UUJA 2HN7B 4NP4H 1I1AA 1I7UA 4P59L 1YEEL 1N7MH 5T5NF 2Y07H 4CC0A 1FZKB 4XTRC 4GFXA 1XV8A 4MYPA 4IS6B 1ITCA 3BIKB 4MMZB 4ZTEA 3ZSTA 1JYNA 4LNRB 4HKBA 1X9UA 5SV4A 5EZIH 4NUPA 1K9TA 4DGVL 4WWKD 4Z6AT 3RGVA 1Q0XH 2AEOA 4KQ3H 4PGCA 4RZCA 3IFLH 4PJGB 4KZ0A 2PF6A 3O11B 1UXWA 5IB3A 3RWIB 4LCYA 4H0GA 4Z3TA 3NFSL 1HHKB 3P77A 2VZUA 2Q76A 1PD0A 2XICA 3S9DB 2PPDA 3D4ZA 3KDMA 4GQPH 5KANG 4F7PB 1GZPB 2XWDA 3AM8A 3UG3A 5JTWA 2B39A 2Y7MA 3X3FL 5D1XA 1TMQA 1AXSA 4EI0A 4PHXA 3TESA 2CK2A 4G6AC 1Z2KA 2MCPH 4NPYB 2Y6TE 4TRPL 1MKFA 5G2NA 2AKRA 3W81A 3TEZA 2OPCA 4WEMB 1X7QA 3NH7L 1M1XA 3IFNL 2F18A 1BFOB 2E46A 1YUHB 5DXWA 3OL2A 3N06B 2OSWA 2F6AA 2KHAA 3FT3B 3T0ED 1U8OA 2Z91B 1J0KA 3NIFB 1OP5K 5T1MB 3ZDZF 3QFJD 5FO8B 3FSZA 1SDAB 1VFBB 1QSZA 3O2VH 4RBPH 1F4YH 2AJUH 4GRLB 1P69B 4LLWA 4PRHD 4QRSB 5EIIG 1YYLH 5CO1A 3W0WB 3R4DA 4HKJA 4HK0A 3IWUA 1KB5L 4HS8L 2E9IA 3HFML 5IBLD 1ITBB 1MLBB 1XGUA 1MFUA 3V0FA 4BDVA 4TUKH 4C59B 2GBAA 4LSPH 1DJHA 3Q48A 2GTWB 1I8MA 4NRZB 1BP3B 2FWOA 3BT2L 4GO6B 5DJCB 1A4CA 3GS7A 3FU7B 3S96B 1GOGA 3MCKB 5F1KC 3BW9A 3UTSA 3UZEC 1OTSC 1VEOA 4GUQA 5DT1H 4OIAA 5T3XL 4AT6B 3T6VA 4JY4B 3SDXF 5SV3A 1F1AA 3MLZL 4Y9BA 2BCMA 4X42A 2I7SA 1ORQB 4WTZA 1BLIA 2WKOA 4WK2B 2QDWA 2X3CA 2YD3A 1OB1A 1D6EA 3CFEB 3QEUA 4XNZB 3EGSA 5EO0A 1TQUA 3D3VB 4MQSB 5DJYA 1FV1A 3CE1A 4OLUH 2XWXA 5F9JA 4NHUA 4AGNA 5C08D 4C47A 3S88L 5EUOF 3WD5L 3MLRH 1MHPH 4CNIA 2OJEB 2EABA 2OJZL 2V17L 3B3IB 5HVGB 1KPVA 5FCSH 5C0AE 3SDCA 3W11C 4R2GD 1ZT1B 4JFED 3JWNC 3DUSB 3IMUA 2PYEB 2J8UE 2WXHA 5MENA 4HX1B 1CDIA 2Z1PA 2GJJA 5IJBC 4L8SA 3HG3A 5KVEE 4BH7A 3RZCB 1WFJA 2A9NL 2KUTA 1NANH 1TOXA 5KEZA 1JNHA 2GJ6B 2X0VA 3P30H 4H26B 4BUGA 4DOHE 3INUH 3IGAB 1UHVA 2VWEE 4TULH 4AQ8C 4JQIA 5FKPB 1WWAX 2GK2A 1ZHKA 1E6JL 1WEJH 4Q58C 1BFVH 2LLGA 2P24B 1G9NC 1Z7JA 2X6UA 1X5ZA 5LG1A 4OCNC 3HPJA 3DIVA 3TXAA 3DTDA 4G7YL 4J3TA 3TVMB 1NJ9A 1AQKL 3G6JF 4EIBA 5I8KH 1INDL 5GIRB 5K1VA 3MBXL 5A6LA 5C0EB 2LABA 4PRBA 4PV1C 1MCLA 3RIFK 4FQXB 1XF3B 5EBGA 3B9VA 5GGVL 3KMDA 5J1AB 1VLXA 2B14A 3L2MA 4JO3H 4X4MA 4EBQH 5JA8B 4Y19E 4MDJB 3CFUA 3L5XH 2J88L 3SD5A 3UG5A 1OLLA 4M5TA 3O0RL 4MAUL 3EDEA 3G6AA 4BFEA 3MRLB 3WIHH 1K8IA 1G1OA 3BRFA 1UOKA 2YD9A 1YY8A 2FD6H 4LSUH 4RFNC 2BHYA 3PJSA 2OSYA 3L9YA 3LPGA 1NOAA 1RZPA 1TZOA 3LS4L 5BV7C 3PIQA 3VDBA 3I9IA 1M71A 4DAGH 4K71B 2ZXAA 1MVFA 4AJ0A 2NSXA 1IEAB 5TDNA 1OSZA 4XNYH 1QQDB 4JQVA 4LSSL 2DQEH 3WUWG 5B1JC 1TJIH 5KVFL 1S7WA 1OT4A 5I8EA 2GUYA 2XN9E 3M8OL 4XPGL 3BQUD 3NFPA 1W72L 2AXFA 2XPZA 2COQA 4YHZL 5FC9A 2A74C 2M26A 4L8DB 5FHAL 2IAMD 2YGNA 5JQHC 2ATPB 4OW6A 4WLCA 4A7GA 1NLDL 2ZKWA 4X4XA 3NCCB 5T1DL 3ZT5A 1T1YB 1B0RB 1XWVA 3V5DA 4G5AA 1L0YA 4HCRA 4MVBC 1HC1A 4KVCL 1WP6A 4R8WH 5I6NA 4LXFA 3SPVB 2RH0A 3MROA 1PX8A 3VD9A 1F3JB 1AOHA 2BP0A 3H2WA 4QHUA 4S1QH 3KPSD 1XCQA 4L4TE 1EDHA 1NEZG 1TFHA 1I8AA 2BRRL 3ULVC 2GIYA 3KPOB 3ULUC 5E6IB 1D7DA 4WI0A 1MFAH 4TSCL 5ACLA 1UA6L 2VN5A 5I0VA 2E86A 1FNGB 3JTTA 2V3DA 3KWUA 5LXGH 3C2AL 3LHPL 5MERB 3Q8EA 3CN0A 4FXTA 4ZMXA 2ZOLA 5AVZB 2FB4H 3AACA 3VWJA 5CFAA 1OAXL 2ZAIA 5AZEH 3GKZA 2X7LB 4A55A 2QSCL 2X41A 1IAKB 2R2BA 1SBSL 3BFWA 3I85A 4IU2A 2R2HB 2A6KA 4A7TA 4D7PA 4Z7WF 3S98A 4KAQL 5D5MF 3K8MA 3ASWA 4P5MA 4FLQA 3Q6FB 5B38G 1KYFA 2GAZA 4YNYA 5I6KA 1NIDA 3AY4C 3U25A 1OGAD 4HULB 3FSOA 1FH2A 4QRQB 3OGCB 3SGDI 1BAFH 2XWBB 3L45A 1HZLA 2IXQA 2A6IB 5CGMA 5HTSA 1J5HA 1C5CH 1KYOK 1JN6A 3VFPB 5GS0H 4MA8L 5M95B 3AS0A 3RX9A 1CLVA 3KPNA 4U1KB 4YGAB 3IFOA 1JXGA 4FX5A 4P2CG 1EEZB 5E2VL 4I4WB 3BUPA 4FXGC 1QA9B 4W9LC 1JUFA 2PO6A 4WUUD 3PHSA 4X6DE 2FEEL 2WXNA 5GGUA 4IOFD 4DGVH 2WTRB 1X9LA 4BZ1A 4DK5A 3PXJA 1DUZB 2OR8A 1X5XA 1Y7VA 2YGOA 3N9GL 3KWVA 1ETB1 1JFHA 1GRWA 3D33A 3WO4C 1WIOA 4NUQA 4LKCA 1T21B 2WLMA 1D7CA 3GPSA 3LQAL 3NFSH 4GI8A 1T2QL 3G5XA 4TM9A 1VACB 1ES0B 1BECA 1R24B 3LN9A 4M02A 4PG2A 4XCCL 5E24E 3VVWA 2ZUWA 3MKKA 2YKKA 3MFGB 4OFKA 1G6VK 3FQ1A 3W57A 3X3FH 2XXMB 1E9PB 4K3DL 4ZS7L 4ACTA 4YQXH 4JR9L 1C5BL 4E36A 5E1IA 2EVHA 2O5YL 1KBKA 4KKPA 4NDMA 5F7UA 2R9HD 4GXFA 4XVUD 3RB5A 1RZ7L 1IBZA 2Y7SA 1MUJB 4TRPH 5IHWA 2QBWA 2BWQA 3B9KD 3RG1C 3S3PA 1H3GA 3NH7H 4HIQA 3IFNH 4Z7UB 5F3BA 1AJ7L 1U3HB 1JDAA 4L1SA 1U91A 2ZJSL 1RZGA 4WW2A 2Q8BL 1KJ2L 1BD2A 1G6RA 1KB5B 2ZXBA 5DMGC 4EKXA 3RVTC 1DVFB 4ZTPH 1AO7D 2XZAL 4OV6F 3MNWA 4POYA 2QVIA 5F9WC 3ZHNA 4QF1A 2NNRA 5D1XE 5D4QA 2A9AA 3IS1X 4S1DD 4LGRB 4G9FA 3D05A 2YC1A 3RUGF 5JPNC 5DFWH 2H3XC 2P5EA 1KB5H 4HS8H 4BEIA 3HFMH 4L9LA 5C09D 3HE6A 1IMHC 5ALBL 4NX0A 3L6FB 1HKLL 5J12B 5JORA 4XXDB 1DVQA 2NUPA 4Y1AB 4PI2A 3AT8A 4E5XA 5I6OA 1H8OA 5D7SL 5CM1A 2J7LA 2HAZA 1LE9A 4FTDA 2BIOA 4AEFA 1BOGA 2J20A 3UTTD 3O4OB 5T3XH 3AADB 1O7VA 2J2ZB 2V7HA 4FKEA 3IETB 1BZ9A 1GS6X 3ASNB 3MLZH 1SHMA 2F19L 4OZGA 3FKUS 1Q0YL 4X7FC 2BVPA 4ODWA 1ZLDA 3MRFA 5F8RC 4WDIA 3PWPB 4L29A 3SQOL 1B3JA 3WE6A 4J39A 3WS3B 4J2XA 4U1HA 5I9QC 1JTTA 4AGQA 2PCFA 1TVHA 1BLNA 1A6TA 3TONA 4HOMA 1THAA 4JPQA 3WD5H 4GW4A 4P05A 2OJZH 4L3EA 2L7UA 3AREC 2H0EA 1IC5H 3BC9A 4J3OG 3GSQA 4L37A 3UTSE 1JGDA 1L4IA 4DP8X 3IU3B 5CGBA 3FPYA 1Q9LA 4IOIA 1TETL 4XTRD 2V2WA 2FWUA 1H3VA 4PJ9C 3D85A 3HPLB 4S11A 1UQSB 5DURD 5BZDB 3BVXA 1AKPA 4OZHA 3WN5B 1AZVA 4JKKA 1T1XA 4AXWB 1RSFA 1TKWA 4U0QB 2AQSA 4WNQA 1P4UA 5AOZA 1G43A 2NY3C 3QRBA 2RCSH 4FMKA 4PS8A 3FB7A 4GKZA 1RCYA 3QZMA 3B37A 1E6JH 5ESQB 1D5XB 2DM4A 3G04B 1YQVL 5IF0B 5LG6A 4MBRA 3F12B 1AQDA 3FO2A 2DIAA 3N44F 4G7YH 3WL9B 3IGFA 4PW4A 1AQKH 3HMXH 4I2XB 5MENE 1Q9OA 1OAJA 1ASPA 1ZHLB 4ZSOB 1OPOA 3KPRD 3KJ4B 1INDH 3I9PA 4Y5XA 4UQ3A 4JANB 4NZ8A 4YBLB 4G6AD 3MBXH 4OZIB 5ERWB 4CJ0A 2V0AA 4DKTA 3FTYA 4Y7OC 1JWUA 3J2PA 1PPIA 5GGVH 4D9LL 3HZVB 4ZPVB 3MNDA 3HHMA 5BZWB 3RL1B 5DQJA 5FF6A 4IBUA 1TQBB 1B6UA 1KCUH 3DC0A 3MO1B 2J88H 1QR1A 3G5VA 3PUUA 4MAUH 2ZWZA 3CG8A 4DIXA 1DUYB 5HPMA 2MNJB 3N1PC 3TPUA 3OG4B 1JV2B 2PMZA 4F2MA 1XZ0A 4ZW8A 3QJRB 3L48A 1FBIH 4MMZC 4PB0H 5DS8B 3DSNA 4HEMA 2M8XA 2VZSA 5EG6C 1DP0A 1UA7A 2B7DT 5IIEB 1FN4A 2HVJA 2QQLL 3RI5F 1EJ8A 2DZEA 3MRCA 4C4UA 4BUHA 5IB4A 2IFFL 4G42A 2WBXA 3RJOA 3U9WA 5H4YA 1HZHH 3SQBB 4LSSH 5LJYH 3NK4A 3REVA 3VFMB 5CEXB 4X4ME 4WHYG 2DJMA 1BQHB 5E8OB 4BWTA 4TUJB 1NDMA 4XPGH 3IDYB 2CLZB 1V7MH 2JI1A 4XPAL 4YHZH 1OTSD 4PBXA 3ARSA 4C56D 3TNNA 4JFFD 1ZKAA 1AAJA 1AKJA 4KTGA 1NLDH 2VSCA 4PSRA 3PP3K 4F8LA 3DYMA 4UT9H 4RAUB 1ACXA 2XKSA 1YNTA 2DQIL 1XH3B 3V55A 4TPRH 4KVCH 2E7LA 4MNQD 3NJMA 3HE7C 3UAAA 4CUCA 3DROA 3ETSA 2V5SA 4UCFA 2WYZA 5JHMA 1O75A 3EYVB 1TJGL 2D8KA 3CHXA 3GMMB 4XBEL 1WZMA 2GTZA 5AOKA 3E6HA 5F9AC 5GGVY 2BRRH 2X1XR 5GGTL 2J1YA 1KIPA 4J12A 3BWZA 5L4MA 3DO4A 3LH8A 4U1GB 3W11D 3L08A 2BIIA 3D4YA 4LOUC 4PJ7B 5E1GA 4TSCH 3QQDB 4L4VD 4ZMQA 5F0LB 1DQLL 1I9EA 4UQDA 5DSCB 2BIMA 2Q10A 3C2AH 3J8F7 1VFAA 2ROYA 1HILA 5CGTA 3CZFA 3VDCA 4ZUUA 1OAXH 4M8RA 2YS4A 1LL1A 3IDMB 4GRLC 4LSVL 4M56A 2QSCH 3EH1A 3L5IA 3NQIA 1SBSH 4HZLB 1YYML 1GHFH 3VCLB 3L3OB 3R7QA 3V9EA 4AMWA 1QO3A 4B50A 5DMKA 4KAQH 2UXTA 3EYOA 3N3EA 3RTQA 2YMOA 1Y6KR 2HG5B 3OJDB 4I1RA 3L9BA 4MJ6B 4XBPA 3T3MB 5T1LD 3T6WA 4RWYL 5IGXL 4JVWA 4PUBL 2QV2A 3Q13A 4AYMC 3OLGA 1K5NB 1DLFL 1YUKB 5E6UB 3STBA 1LK3H 4KJYB 1S9XA 4BK4A 1P4LB 1BDYA 1YEFH 2YEZB 4U4BA 4U1IA 3ZK0A 1O7DE 4I0PB 4PP2A 1ADWA 1CFQA 4N2BA 1FFPB 1FO0L 4QYAA 3TJEL 1X44A 3L1FA 4MA8H 3D9AL 1CO1A 2Z8RA 2TRYA 4N1HB 5SWZA 2IV8A 3DX1A 1IIKA 1INQB 2DI9A 1C16B 1SQ2N 4HSCX 5JDSB 5I6PA 1C5DA 2BNRD 4XNZC 5B7FA 1T66C 5FKAB 2YUZA 4P5TB 1E3XA 4WHTA 1OGSA 2MPAH 4XVSL 4ZZFA 3OAWA 43CAA 3OKKB 5C2BH 4L0PB 1USZA 2MJWA 4YDKL 4F7TB 1OWRM 4C4BA 1D5BB 1GYUA 2QGEA 3KJ6L 3N9GH 2Z35A 3D2TA 2XFXA 2E7HA 2ENPA 5EOTA 3II1A 1Z5YD 1GC1L 3JVGC 1PVHA 3LQAH 2N7SA 2PLTA 1T2QH 4HUXA 3H55A 4OI9A 4X6FB 5L4FA 2DLFL 4Z3HA 3RZCC 2G2NA 4JFUA 4XCCH 1E2VA 1PDKB 1TJXA 1U4EA 3QA3A 2O4EA 3VACA 1YEJL 1QSED 4XN1A 1H8NA 3VRJA 4K3DH 3AQZA 5G4MA 5CFHA 3CQFA 1C5BH 1A1NB 5I8OL 4EI6A 2O5YH 5FYLE 1CCZA 3VX0A 1KJ2B 2ZIDA 3CZLA 3UBHA 1RZ7H 2ZQKA 1MCHA 1SY6L 4NQCA 5IEKB 2KLTA 2ZAGA 3BH8B 1OCWL 4JG1H 4N85A 4PYGA 3ZYOA 1AJ7H 1EAPB 5I16A 4EN3A 2FJSA 1D6VL 5IJKA 1GCYA 4FABL 5DD0L 4IGBA 3HNTL 5BS0D 4MVBD 3M17B 4MS6A 2Q8BH 3SKJL 2UWEA 1KJ2H 4HETA 1XIWA 3B56A 1TTFA 1E50A 3HRZB 2L7JA 3KPMB 4FQXC 1DN0B 1KIRA 5DTFB 4DEPB 4E9WA 2GC7C 1WAEA 1NA8A 4GINA 2W07A 3BAKA 2E7MA 5TF0A 5I24A 2BVYA 5F9DC 3CFKB 4S2SA 4R96B 1UUSA 3ULVD 2B2XL 5DLML 2X4QA 2HA1A 4Q6KA 4MTMA 5E1AA 3EJPA 2BDNL 1RY7B 3ULUD 1GTFA 4LESA 3LZRA 4HDIA 1ZV9A 3V4PL 1NC2A 1NBYB 3V6OC 4ANXA 1NGWA 3H3PL 5ALBH 2WOYA 1CT8B 2FNWA 5I66A 2F2HA 3P1VA 1HKLH 1KPRA 3JXAA 4S1RL 4L0YA 2P8LA 3CJJA 4GMTL 5D7SH 5D4IA 1JXKA 4JMXA 1BD2E 3OKDA 4K71C 4HLEA 2H6OA 3DJRA 3VDAA 5JHDA 1IQDB 1IKFL 1M6OA 4JHBA 3ZL4H 5D72L 2EYRA 1MQKL 1AGFB 1JZ7A 1IB5A 4P07A 5DWUH 2E47A 2OZ4L 2G9KA 4PJCF 4PJEA 4G9FE 3SQOH 5B3JF 3AZUA 1J1PH 2P5EE 3DETC 4ZMZA 1G1CA 4TUOB 4WI7A 4XO9A 5AW9B 3REWA 1AR2A 3CWGA 4XNMB 3NRPA 1MG2C 4JDVB 1KGWA 4B6ZA 4O9HL 2EZ0C 2BY1A 5JOPD 1NCGA 4O2FB 2X4OB 3DVIA 3KGSA 2HJLA 4NNYA 1Q9WA 4Y2NA 4LHJB 4EI5B 5FUZL 3HTLX 4AQAA 4W4OC 1TETH 3TJPA 1MY7A 4TSAL 1M05A 4AWJC 2J12B 2UX6A 1N12A 3MUY1 4OZGE 3GZQA 1IQWL 3MCYA 4PCYA 2KQMA 4WKZB 5I73B 2QV4A 1MCEA 1OO2A 1TMCB 1YDPA 5DJ8B 3LZLA 4WSGA 1TQVA 4OF6A 2ZUUA 5E6IC 4NM8L 3RQ3A 3CZUB 4JGJA 5GISH 4HKXA 4Y4KB 5ETUA 2VLRD 5I28A 5C6WH 4KZDH 4ZMNA 5KYNA 5DD6B 4PGEB 5AW1B 2CR6A 1I3RA 1A7QH 2R69H 3ZO0A 4L3EE 1RUQL 2GITA 3CUPB 2WXQA 2W94A 2PWDA 3VSTA 5T3ZE 4L8BA 1FFOA 2LOEA 5B1KA 1R47A 4P2OA 5E4IA 3BX7C 1OP3H 3HBGA 2DQJL 1KC5L 2GSIB 3H7BA 5AG8A 4AYEC 4HOWA 1A4BA 2XWJB 4PJBB 4Q9CA 5GS0C 4OZHE 1EJFA 1MW2A 3H9HB 1OPGL 3HS0C 4IBSA 2VSKB 4P2QB 4R0LC 3TCLA 3ARZA 4YK4B 4O2CB 4D9LH 5F1OB 4JPVL 5FCUL 2BOBB 1RZ8A 4R26L 4GAGL 1YEIL 4ZBJA 1S7TB 2VAJA 4NNPL 5FA4A 2EEDA 2IPUK 4AM0B 1XH1A 4YXKH 3HZMA 4PGDA 1KV3A 3JYBA 1H9DA 4Y89A 1Q4NX 3RGVC 3SKNA 2CDFA 3U30B 2JKJA 5DMGD 5EIIB 3NRFA 3RVTD 4XVJH 3WY3A 4ESKA 4FC3E 1KJ3L 5HI5C 5DD1H 1YN6A 3AFLA 3MLUL 3IGUA 3TO4A 2DLHA 2EDKA 5KZCD 1AD9B 1GGIL 2JF1A 1T1WB 4MD5B 1OF2B 3TH3T 3O3AB 1F2XK 3GXMA 3K1DA 2QQLH 3G6DL 5E94A 5HGBB 3PQYA 5KYYA 3EGDA 2IFFH 4RMQA 1WHOA 4NBXB 4X99A 3EJRA 4FLSA 2E7DA 2FR4A 2TRHA 1S3RA 4FTVD 5IW6A 1S3KL 3K5SA 1F4WH 4M6OL 4OU3A 1T7WA 3ZUCA 5BQ7A 4XPAH 3WJJA 5IQMA 5JXEA 1T03L 4BQ6A 3ZR5A 3RJQB 2MQ0A 1JHTA 1CFTB 1SN0A 2JSFA 1AIFB 1IGJA 1H19A 4F2ME 4NCC2 1P1VA 2AHIA 2IH3B 2P9RA 1PLGL 2X9ZA 5I5RA 2AJYH 1J8SA 2F8OA 2DQIH 3VD4A 4HEME 2LLNA 2Z8WC 1SXBA 4PG9A 1NBZB 2ORBL 4MCMA 5EPMB 3OV6A 3HUJB 5IESL 3NACH 5FW7A 3KLLA 5E00B 3SGJA 2MHAA 1K8DA 1F02I 4QRPA 4WV1A 5I1GL 1TJGH 2DM7A 4XBEH 1LWHA 1C1EH 1U3HC 2APBA 4XPHL 1N6VA 1MHHA 2G2RA 2ITFA 2VR8A 3ARED 5HYSA 3DMMB 2AITA 2W60A 1WCQA 4YSOA 1DQLH 3EGXA 1N0XL 1DVFC 3LRSA 2OA9A 4PWFA 4HJIA 4FYQA 2FH6A 5J11B 4FFTA 4GRWF 3GMQA 4NOFA 3S2CA 4PJ9D 1NC4D 4N87A 2DQ6A 4LSVH 4QY8A 4XP9L 1FPTL 1M7IB 2G9HB 4L4JA 4ZAKB 3RPBA 3DX2A 4ZK8A 4QAMB 1YYMH 3GO1L 1MLCA 5ISZA 3EJCA 2COVD 2NY3D 5CUSL 3I02B 5HVHB 4ORGB 2HN7A 2AAAA 1FO0B 2X88A 3D7PA 4PS4L 5J12C 5F7HA 4RWYH 5IGXH 1EX0A 1CICB 1A6VL 3AXIA 4PUBH 1F5WA 1N64H 2G3ZA 1FZKA 5EU3B 5IOPA 1DLFH 1HXYA 3KM1A 3QUMA 2HFGL 4LNRA 5DEZA 4F92B 2FLBT 4NPJA 3L9EA 1SBBA 1FO0H 2G3NA 5GRWA 3TJEH 4ZMVA 5EEVA 3DV4B 5BXFB 3D9AH 5JDJA 2D3LA 4HPYL 1MJ7L 4PJGA 4HXAH 4P04A 5CZRA 3BZ5A 4GBXB 3BSGA 4YL4A 1KENH 1AP2B 3RWIA 5I0ZA 1SLWA 5IP4A 3DECA 1LTXA 3HLAB 1EDQA 4XVSH 1TEFA 5CBEB 4RVBA 2YO3A 2F1BA 2D7MA 2UZXB 5IBUG 4L3AA 4YDKH 4F7PA 3WHXA 3C8HA 1GZPA 3KJ6H 3B9DA 2F54D 4IDJL 4QUOA 3EJYC 3CN1A 2IGLA 2WBJB 3LIZH 2YUVA 3ILDA 4J2QA 5GS3A 2WOBA 1GC1H 3L3IB 3VD5A 4CSZA 2FX8L 3BN9C 3DIDA 2X5PA 4NPYA 5D7KE 5AOJA 3MRDB 4KBPA 3WUWB 1AGCB 2VQ1B 3OPUA 5CP3H 2DLFH 2B5IC 1A8ZA 4LZKA 5CSGA 2IADA 2BSBA 5SWZE 4OV5B 1E8WA 5IW3A 3TBCA 1YEJH 4R84A 5D1QB 4EXPX 4WI8A 5C7XL 1BFOA 2E4FA 2YA1A 3BZEB 4H8WH 5LDUA 5I18L 4OCXL 3S37L 5I8OH 4MWFA 4HWNA 3FT3A 1KGCE 2Z7UA 4NS0A 2Z91A 2JWYA 5EN2A 5F71A 1CD0A 2C3XA 1SY6H 3WKNA 3ZE2E 1NDGA 3LRMA 3ZL1A 4YX2L 4Q97A 4O02L 4ANUA 1VFBA 3QXWA 2XA8H 4Q9BA 1OCWH 4LB8A 3MODH 1D6VH 3ECVA 3IMVA 3W0WA 3KJ4C 4FABH 1B2WL 3K71B 3HNTH 1O6TA 3SKJH 1X7TA 4OLWL 4ZX4A 3KW8A 2AK4B 4TVSa 2ZX9A 5CEZL 3QDJA 4WTXA 1FL3A 1MLBA 1NEZB 1QSFB 2D31B 3CHSA 1ZTXL 3ULVF 3V4PB 3K6OA 4WFHE 5DK0A 4KK9C 1TUPA 1FGNL 1XSJA 3IJHB 1JZ3A 1AHWB 3BGFB 2GTWA 3OAUL 4J4PA 5DQDL 3VSQA 4H0HB 5ESVB 3ULUF 3N43B 5L0QB 1SDDB 5AVVB 5DJCA 1ZGLM 3RURA 3FU7A 3IJSB 2J57A 1JTOA 5I30L 2B2XH 2I85A 5F6HI 5DLMH 5JLZA 3RZCD 4L1HA 3CVIL 4HUWB 3KNBB 4LPYA 4LOUD 4AT6A 1S4IA 4JY4A 2ZXQA 3V4PH 4NQCE 3AITA 3H3PH 2BC4B 5C07B 2EDEA 1JIBA 4S1RH 4B41A 3CFEA 4AGLA 2GEQA 2OW6A 5JUEH 4GRLD 4M6MH 3L2LA 2UWEE 4WF7A 1NBVH 3QNYA 1KOAA 5B38B 1U0QA 3AXHA 3DVNB 2LFGA 4FXKC 5F93C 4MJ5B 1U95A 1ILSA 3IE4A 1IKFH 3FTXA 3H2QA 4N2DA 2IOOA 5D72H 1MQKH 2H47C 3B3IA 5AOMA 4RRPA 2VRQA 1MREL 1NAMA 3IDYC 3WTYA