1XTMA

Crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
b'AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIHEKGSCVRPDFESAGGHFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical superoxide dismutase-like protein yojM
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title From an Inactive Prokaryotic SOD Homologue to an Active Protein through Site-Directed Mutagenesis.
pubmed doi rcsb
total genus 31
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1xtmA00
1S4IA 1N19A 5CU9A 2Z7WA 1COBA 1IBDA 2VR6A 2LU5A 3KH3A 2VR8A 2WZ0A 1JCVA 2C9SA 3F7LA 1E9QB 2AF2A 2V0AA 4L05A 1PZSA 3KBEA 3KBFA 1AZVA 1U3NA 1KMGA 2Q2LA 1XTMA 3ECUA 1HL4A 2AQQA 1UXLA 2R27A 4BD4A 1SRDA 3RE0A 3GQFA 3T5WA 2WZ6A 2GBVA 2Z7ZA 3GTTA 1SXCA 3HW7A 3HFFA 4U4IA 3GZQA 4MCNA 2WWOA 3GZPA 1DSWA 1CBJA 1IB5A 1MFMA 1IBBA 1RK7A 3GTVA 4A7GF 2NNXA 1PTZA 1JK9B 1SDYA 3MKGA 3PU7A 1XTLA 4BCZA 2Z7YA 4A7SA 1B4LA 1SXBA 1Z9PA 1E9QA 1ESOA 1N18A 1YAIA 4MCMA 1SXNA 4OH2A 1E9OA 5KBLA 4N3TA 3GZOA 1CB4A 4A7TA 2AQRA 4FF9A 1UXMA 2WKOA 1IBFA 2XJKA 4A7QA 1F1AA 2AQPA 2ZKWA 1TO4A 1EJ8A 3CQPA 2E46A 1BA9A 1F1GA 3H2QA 3CE1A 4BCYA 2WKOF 2SODB 2ZOWA 1SXAA 2WYZA 3KM1A 1SDAB 1E9PA 1SPDA 1Q0EA 1Z9NA 3KH4A 2Z7UA 1JK9A 3L9EA 2K4WA 2AQNA 3H2PA 4A7GA 1IBHA 1E9OB 1F1DA 2WZ5A 3ECWA 1B4TA 3QQDB 1SXZA 2ZKYA 2WYTA 4OJAA 3SODB 2AEOA 2AQTA 1XSOA 3F7KA 5KBKA 3CQQA 3LTVA 5KBMA 1FUNA 2C9VA 1OEZW 2ZKXA 2JCWA 3QQDA 1F18A 1BZOA 4A7VA 2AQSA 3K91A 3L9YA 4N3UA 1HL5A 1OAJA 1E9PB 1YSOA 1EQWA 2APSA 1QUPA 3HOGA 1SOSA 1YAZA 1L3NA 2XJLA 1DO5A 3ECVA 3KM2A 3S0PA 1OZUA 2VR7A 4A7UA 4B3EA 3MNDA 2GBUA 2JLPA 2GBTA 1SXSA 1P1VA 1OALA 1TO5A 2WWNA 1OZTG 1PU0A 2C9UA 2E47A
chains in the Genus database with same CATH superfamily
1I7TA 3LKSA 3DGGA 3SQRA 4LLUB 3FUFA 2WO4A 4FFZL 3TEUA 4F1ZA 4G8GE 3PWLA 2CMRH 5IFAL 5KVEE 1FVDB 2HJFB 2QFPA 1P5VB 4AYGA 2F7RA 3BT0A 1HSBA 5C9JA 1DBKL 3HJEA 4A6YH 1MCLA 2CUIA 4GRWH 1HILB 4NKDB 3CDFA 4KFMA 5J1TC 4G3YL 5BZDA 3K74B 2C4FT 4NO0A 4GUPB 2YAQA 3RVTC 1ZHBA 1LE9B 5ERWA 4PU2A 1A4JB 1CICB 4OBRA 1A5FL 2VXUL 3TFBA 3V5KA 2FQFA 5T5FH 2EC9T 2CE6A 2E76C 2Q10A 4MNQE 1MNNA 4NLAA 1NWOA 3KR3H 1ITCA 4MXVE 3KGSA 5BNXD 2VDOH 1MG2C 5D7LE 5HXMA 1KG0A 4MCYB 2A9NL 4RMBA 5L6YH 5DMKB 4G2AA 4NZRL 4LSDA 1E8WA 2Z92B 3AW5A 2L7EA 2JIXD 4HIJA 2HVKB 3WTYA 3K3QA 4XBGA 5JHDD 3LEYH 1NGYB 3KPSB 5JIMA 3B83A 4GXVH 3UMNA 1BZ8A 4ETQA 3DJZA 5KYUB 3NIFE 4KUZL 5FM8A 3U25A 2VL5B 3DSNB 2O6PA 2Y22A 3F65A 2AERT 4YWGH 4JRFA 5BUPA 5E1AA 1NBVH 2HJKB 3A67L 4F7CB 3NZSA 1WHOA 3IU3A 4Q0XH 4I9WD 2XYBA 2ZOKB 2ILLA 4XMPH 3MV01 3QUXA 3REVA 4J3OH 3PWPE 2J3SA 2H6UA 3LYRA 5IVZA 5T5FL 5KZCB 2QGBA 4XGZB 1RPKA 4LSVL 1J8HB 2NYZA 1WQVT 3QXVA 4GRWF 1NUNB 1IAII 1AHWC 2DMCA 3VSVA 4D3CL 1ZA3A 4JFQA 3ZR6A 5ESVB 1QNIA 2YMTA 3B2VH 4Z18A 3WNLA 1ZLSL 2VERA 2VDNH 4A1RA 4BXVA 1OAQL 3UTOA 4J23A 2WXNA 4L4VA 3WUWB 2ZXAA 3LS5H 1HC1A 2EIEA 4L3FA 1J05B 2HMIC 4NWUL 1ZJAA 4QEGA 3MSPA 5LAXB 1FJ1A 4I3RH 4YR6A 3EYVB 4ZODA 1E3FA 1ERNA 3QULA 4LL9A 4F57L 5HVHB 1CC3A 3QIBA 3BD4A 1IC0A 3NIDF 1HXMA 3OXSB 2ARJQ 1UM5L 1V27A 1ULVA 4HA1A 2YAPA 3X12B 2PTUA 2XQYA 3E6HB 4K8RD 4LDEB 5E8OB 3S3DB 2ZZUT 1QW9A 1MHCB 1PU0A 4PJXB 4LVHC 4BFIA 5KYWB 4ZMYA 2C9SA 1MFBH 2WBKA 4QLRA 2EDJA 2AJVH 1ZKAA 2JWYA 1XH3A 3MYJA 2KDGA 3L3OC 4GNKB 4MSWA 4N0UE 3TCLB 3VGBA 3HN3A 3WN5B 3KPMA 2EABA 4G70B 2Q3ZA 2DMGA 2YKLH 4PPTA 3ZTNL 4XBMA 1ORSA 4YDZA 4Y5YC 1XBDA 2YBGA 4MNQB 4ENED 5MENE 2FEJA 1GGBL 4JQIL 1D9KA 1K8IA 4O2CB 5I15H 2H1LM 4UM8B 2B0SH 2DJMA 2WIIB 3BWUC 1BDYA 1LWRA 4XCYA 4LNVA 1D5BB 1GTFA 2JFCA 4KOCA 4KMQA 1MFMA 1T3FA 4P3WA 4L5FE 3ULAB 3S35L 3MRBB 2OI9C 2ZJSL 4OCNC 4TULL 4WO4B 5AAWA 5JNYB 3DTXB 5HHOE 1AFVH 4JW3A 2ZUQC 1FVDA 4UBDD 4UV7H 4WV1C 1GTNA 4HXAH 2GITA 4GPVA 1DDHB 1ECYA 1F41A 2X1XR 3WEXA 5ACZA 4CGTA 5IHHA 3TEZA 1IM3B 4X8XA 4UIKH 1FNEB 4WTZG 5F9OL 5AD0A 4H1LG 1IIKA 5GISH 1U8OA 1ODAA 5ANMB 1CD0A 2BP0B 1IEAB 1T4KA 4XP1H 1L7IH 3IDNB 1J8HA 4AV5A 5BZWA 3NJHA 3INUH 4H1LB 3Q9PA 3I50H 3ZZQA 2VXQL 5JR1L 1VLXA 5KBDA 4LIQE 1G7HB 4F2MA 4I18B 2P3YA 1UT1A 2F5AH 2XWJB 1WFOA 3BVNB 4OI9A 3TNNB 2E27H 4RRPM 1IC1A 4GQRA 3OHXA 2Q76A 2ZXCA 3PQYD 4BH8A 1B4JL 4PJBE 3MLVH 4WCYH 3TBVA 1RSYA 1XIWB 4ZAKA 3U9PL 4AQ8A 1JZ4A 1UOWA 4FKKA 3S5LA 5F0JB 5D7KE 3SDCB 2CALA 2YQ3A 1MHCA 2PYEE 2XVGA 4KQ4L 2YPVL 3DRQA 4XVJL 4GW5A 1RSFA 3E6HA 2VCOA 5CZVL 1OF2B 1JI2A 1I3RB 4A2LA 5CBAB 1ZDSA 4UIKL 2FBRA 1QPXA 4DO4A 1NIAA 4FG6D 1PSKH 5F7DB 1MQKL 2UXTA 3ZMNA 2AS5M 5DT1H 1ASOA 1O9ZA 1DVTA 2H5UA 3V6BR 3EYQC 3U48A 1F4YH 3WHXA 2GJ6A 3IETB 3HPJA 1CU4L 2HYMA 2V5MA 2CGRH 1PG7H 1JGLH 2FWLB 4O2CA 4X5WB 2IVFC 1JHTA 2FWOB 3OKDB 4MNQA 3O9WC 3CV5A 5HHXL 2F1EA 1AXTL 3O2VL 3ZE2B 3BP6B 4K3DL 1CFSA 4NQTA 1FIGH 3V6FA 5JPNC 2ERJB 1MAML 3PRZA 1NM9A 1NAMB 4ISVA 4DKFH 3F8UB 1NH6A 4UBDC 3QVAA 4FNPA 4P48A 3N44B 1B88A 1MFAL 3SDYL 4J4PC 4JFVA 2NTSP 3SE4A 3MMEA 1EHNA 1SXCA 2OFQA 2DLFH 3ZKND 4ERSL 4HEPA 5CGTA 3EHBB 4P5TD 1MH5A 2CCWA 3UTSE 2YZ8A 2QDVA 1CF1A 2PXYB 2VJ8A 4OQ1A 3SGEI 1GC1H 4LCYA 3LPOA 2DQCH 2HTKC 3GXUB 4YSQA 3DGDA 3FCTA 3M45A 1UA6H 3DX9B 3KYNB 1I4FB 3ARUA 4Q58C 4WTXA 3V7AE 3WG7B 4DP5X 5FA4B 4JKMA 5C7XH 3H8NA 5FYKL 2ADJB 5GHWH 5SWZE 4HZ1A 1V05A 3HB3D 1XF2A 3B1TA 4XPTH 4A7TA 1K4CA 4KHXL 2AK4A 1U8NB 4L8BB 4OVVA 5CJQH 4FFYH 4ZPVB 5K39B 1MLCA 3KXFD 3FQXB 1T5WA 2XQYK 1JPSL 3HHMA 4MNGB 3GSVB 3ASWA 2XETA 2DWTA 2WLZA 1DHKA 3UZQA 3FSOA 5IESL 2YRPA 3MXWH 1YEFL 1RZQA 3C2SA 4NI6A 2VDKH 3VWKC 5IB5B 1LEIA 1ZSDB 4E41B 4N2HA 4AV4A 3RVXC 1RVFL 4Q6IB 1DQLL 2XTJE 4FG0A 1J7VR 4ZFOL 1Z9NA 5BRZE 5KSBB 3UPRA 3MRBA 1BG1A 5EB9A 4A7GA 1S7UA 1HCVA 3A6BH 5E1AB 3WE1A 1DVFD 4F9PA 5E2TH 3WIIL 4MZIA 3SKMA 4LQ1A 4UT7L 5F3HB 3SDXE 1MQKH 4F58H 1RK1B 4KQ3H 4XN2A 3VX1A 5K9KB 2R1WA 3BZ4B 3LIZH 4C56B 3D12B 2XQBH 2HH0H 5HGBA 4XO5A 1FN4A 4FRWA 3GLEA 2Y6TE 4R4FH 4MD4B 1NICA 2NMSA 4JFZH 4JX0A 4KKBD 4W93A 1MLBB 4RIRA 5CZVH 5AW9B 1HWWA 1MCNA 4PB9H 3PJLA 3REWA 2FD6H 3QAZB 1HHGB 4MA1C 5IHWA 4LU5H 2EKSA 1RUQL 3ULUL 1Z9SB 1BM3L 4LEEA 4OF3A 4BSJA 3QEHB 1OZUA 4E9QA 4NT6A 3D25B 1GL4B 3MLRH 3FULA 1A7BA 4RAUA 4QRRE 3TT3H 3TS8A 4K73A 3GMOB 4KUCD 5F7AA 1X5GA 3FT1A 4HULB 3QCUH 2DICA 3A22A 4I48B 4NQQA 2AEQL 1H9DA 3BSHA 2MOVA 4GT7A 2JKWA 4OFKA 4HW6A 1MCKA 3V9FA 3MQIA 4PH8A 5C0BE 4JFFA 1AP2B 1GS7A 4NO2A 4XWGH 3MLUH 3CHSA 3APMA 4JCLA 3ARQA 5FYKU 1W91A 5FWQA 3ZZLA 4CU7A 4NUGH 1NFIA 1TJGL 5JOPD 1SDDB 3H3KA 4FXKB 4Z76B 4EBQH 4H4NA 3MA7A 4M61A 5DRWB 4PP2A 4JDZA 3WXWH 2MSPA 1VF5C 5KSAC 1NUGA 4FYSA 3GZQA 4WW2A 1Q72L 3NEEA 1JZEA 1A0QL 5ENWA 4ZI8A 1EJ6A 1WE5A 1YEJH 3KPQA 1PZDA 4ZMQA 3GK8L 1MLCB 3P9LB 3CSBA 4X0NA 3EYFB 4KTGA 2AK4B 4WFHE 4GKSB 3GSRB 1NGQL 4Y7MA 1QHQA 4J8QA 3C5JB 3GT6A 3CIQA 1W0WB 3QZBA 3T0VA 2ZWSA 3HC4L 1G7IB 3VD1A 5D5MA 3V5HB 2BNRB 1AZUA 5GS1B 3C87A 2GEQA 3IFLH 4PGEB 3POHA 3UADA 4I2XB 3ZRSA 1MH5B 2H3XC 4ZMTA 1ET5A 5CGMA 1PZAA 3T0BA 5AD0B 2AEPL 2B9AA 1E9PA 2X0WA 4D9QD 3S88H 3DMMC 3VA2C 3T6QC 2FJHA 3RI5K 2JKIS 5L7XL 1H19A 4LU5L 4JFED 2B59B 3OJVC 2BFVH 1R3LA 2OSLA 4D94A 1IAOA 1LGVA 5I1LB 4X9GA 1UOKA 4MDJA 7CGTA 1GYWA 1IC7L 4AVJA 1R9FA 2ATKA 1F18A 2FWOA 3VCLB 3LEYL 3VSTA 1BYOA 4PMFA 2OJEB 4AENB 5C0IA 1ZHNA 2XI9A 5BXFA 4MDJB 1F5WA 1PQZA 2ZYSA 3BT2H 2WQWA 3BYYA 5IMLB 1IZKA 3EADA 1HAUA 3IGKA 1VADB 1O7SA 4Y16B 1QLFB 1F86A 2HJLA 3HZYB 1PZ5B 4KRMB 3C8DA 4DK6A 2G2RB 4WUUA 5JA8B 3T4AA 3RAJL 3BFOA 3FCBA 1XGYL 5ALCH 1HEJC 3MODL 1AZRA 4HUXB 3SDAC 3VG0L 4Q52A 3NCMA 3N44F 3HS0B 5TDPB 5EZPA 5DEJA 2RACA 4IW4C 3F7LA 1Y6NR 4FXGB 5C0RL 2W38A 5D1QE 1PZSA 3BH9A 5JXAL 4XI5D 1NANH 1RUAL 3NA9H 2WZPD 3KXFA 1ZLSH 3QDGD 1M4KA 3BQUA 3FB8A 3BW9A 1TYRA 3NIFF 4EI5A 3KZ8A 3UFIA 3QIWD 2XBTA 4PTTB 3P69A 2DWEA 3FPXA 1B9KA 3JVGA 1M2VA 4LLMB 2NUTA 3KXFB 1E5ZA 2NQCA 2YRLA 1USZA 4HH9B 1CN4A 2PXYC 2Q7NA 3EGDA 2VDOL 4F57H 2MNJB 1NAKH 3PHSA 3GK8H 4DKEL 3QNZA 4Z7OE 2BSBA 4TL5A 1PBYA 2Q2EB 3PU7A 4I4WA 2HFFB 4XB3A 2NW3B 4MB3A 2V2TB 4PBVC 1L9NA 4Z3GA 4JDEA 1B90A 1SDDA 2D7OA 2ERJC 2J20A 4DP6X 3VFMA 3HI1B 3KJ4C 1I3UA 3G7TA 3VFWB 1TVDA 3MCG1 2X1WL 3O6LL 3U9UB 1MWAL 3A5VA 3CBKB 4WENB 5DEFA 5HHNA 1KPVA 5TE6L 1MUJA 1CFVL 4GRWB 1FNAA 1BEYL 2D2OA 2R4SH 3QCTL 5DRXB 5AVWB 1ZPUA 3ATAA 3O3BB 4DTGL 1FORH 1FZOB 2JJUA 5ALBL 1J0ZA 4MA8H 5HD8C 1JYNA 1PS3A 1ZT1A 1QFWI 2VMFA 1K72A 5CWSA 5DURD 3QQDB 3IFPB 3LMJH 3BZFA 3QWRA 5LN8A 2BH0A 1J11A 5CN1A 4DEPB 1AACA 2AV1B 5BW7C 5B39B 2KLSA 1TVHA 4AIXA 5LQBH 4LSUH 4EMZA 4NHCL 3B9KD 1I8UA 2GTWA 1NSNL 3JXAA 5K9QI 3SZKC 3STLB 2VSKB 4H40A 2YS4A 1ZLVK 5E8PB 1YQ2A 2TRYA 4EIBA 4KMLB 1SY6L 3IPBA 3IJSA 4PG2C 5E8OA 5GRUH 3CDGB 4CNIA 3X11B 1KPUA 3OGCA 2QADD 5AAWC 3D08A 4P5TB 5FYKD 5ABDE 5CSBA 1SY6A 5JPNB 1R3HA 2K6ZA 3DJRA 5IV2A 1AY1L 2QPFA 5I6MA 2NY4D 3BKJH 5DJYA 1AKJA 1KYUA 5I17A 1LEIB 3ARDC 3UX9B 5BJTB 3AUWB 4N0FB 5H2BB 2QDWA 3Q7JA 4W6WB 1F4WH 2FLMA 1PLGL 1IX2A 3QDAA 1C9SA 2EDHA 4F7PB 3MRDA 4XMKH 3F7QA 3VFGH 1G6RL 4PP1C 1KIQB 2AXGB 1CD8A 1NPUA 2X12A 3V0IA 4HC1H 1N7MH 5JHLH 3GKWH 1S9WB 4M8QA 2WZPA 3RKDD 3GBML 2F58L 1J9SA 2VLLA 4PJCE 5C0BA 1YHPA 1AQDA 3SPIA 1T21A 1CGXA 5IB3B 4HPOH 3H42L 4MCNA 1BQUA 3HMXL 1UH3A 4PJDF 5F9WB 5J3HC 2WSDA 1UXSB 1DVZA 1OY3B 2WXPA 1OD9A 5ESQA 3C09C 1O7DC 3NFPA 3P4NA 4MQXC 1WBYB 4KI1A 3ZRFC 4OT1H 3IFOA 1RHHB 1B0WA 3MLTA 3RLSA 1Q9LB 4WF7A 2VM4A 1CFQA 4NT6B 3NABL 1EFXA 3E2HB 3J8F7 4G6AD 4DTGH 4LCCA 4UTAH 3L5WA 3KWWA 5IBTH 3TA3B 4F20A 4NQDA 1BQLL 5A1AA 4ALAC 5D7JA 3AB0B 3JZ7A 4LP5A 4P59L 1FH5L 4PJ8A 3MZTA 3L7EB 1TO4A 5K93A 2VJXA 3L17A 3QQ3B 3US0A 1AHWA 3CE1A 3QS3A 4TQEH 4AGNA 3KPLA 2J12B 4PRAB 2ZUXA 3P4MB 4WJ5A 4YSTA 1OGAE 4GI8A 5FCSH 4B0MM 4F15B 3TJPA 1J1XL 3OBAA 5AKTA 5AQ0A 4GEJA 2F61A 4N2CA 4F92B 1MFEL 4ZT1A 3PWVA 2GQHA 2MPAL 2EH8H 3FOMB 3DUHA 2EO9A 4OSUH 3IMBA 1QSVA 4NO5A 4X5XA 5FUCE 5CP7A 3G9AB 3EJZC 3GHPA 1RHFA 1CXKA 3CFMA 1TZIB 1RFDH 2Y1AA 2ZPKL 3DK0A 2H32H 3OLDA 4L8SC 4OCXH 4WFED 3V0VA 1SGKA 2IQAB 1S7RB 3QDMD 1IVLA 2MJWA 1KFAL 3D85D 1Y0LA 4Y89A 4CMMA 5DZNA 1EEYA 3PJNA 4HC1A 5AB9A 2QGDA 1FVEA 5HP5A 3O9WB 4HUCA 3QDMB 2F19L 3VFTB 1MEXL 1HKLH 3MBEB 4I88A 4MGXA 3WDHA 3ULVH 3FXIC 1EO7A 2WOBA 1VA9A 1AGEA 1H0DB 2DJ4A 2DH2A 4OM1H 1ACYH 3VO0A 5C0GB 1T83C 4LSQL 4TUKH 4AQ1A 1PMYA 4WW2F 3L3DA 4Y5VC 5IFJB 3ARGA 4LLQB 1WFJA 5GGQL 1E90A 3H42H 1ORQB 4PJCA 4FZEH 4HOXA 2NZ9C 1UXLA 2DIEA 4G83A 1IM3A 5E8EA 5D93B 1TEFA 4G7YL 4UYQA 4Y88A 1GOGA 4HISA 2VN5A 4XNXL 5GXBB 3FMGH 2JCCE 4HF5L 1CF8H 2NXZD 5D6CB 5HYQB 1OSPL 2EE0A 5JHDA 2W65A 4NQXB 4BZ2A 3O6KL 4P05A 4JR9L 4IGBC 1GC1L 1NOLA 4YHYC 1VFMA 1DSFL 4MAYD 4ZS7L 3S36L 2YFOA 4JG0L 4NRXA 4DNLA 4YWGL 2BSSB 5JPMC 1VRSA 4CVWA 4DP0X 2WK2A 3KPLB 3MTRA 2EXSA 1ETJA 1PCXA 2W9DH 3CN2A 3V9CA 1OAZL 1BQKA 1KZQA 5I1JH 4NSKA 5LGHL 1BFVH 5HVWA 5GGTL 4L4TD 3TGXA 2F8OA 4AEFA 1R3JB 1S3KH 3DGCR 3GI9L 3C9NB 2Z93B 1XH3B 1NLBL 1BD2A 3GLAA 3AY4A 1EHLH 5C0AA 3U1SH 4NGHL 4FG6C 4YAQB 1DVFA 1AGFA 2OKMA 1OSPH 4ODWB 2R23B 1A8JH 4Y8AA 5I75C 4IBTA 1BVLA 2ZKYA 1YEJL 3NCYP 1OSZB 2YIHA 3QG6B 2A6DA 2X1QA 4PJXE 1MW2A 2NX5B 3WXVL 1W80A 1IKNA 3BUPA 3U36B 4L4VD 1FJ1B 2DYPD 4JG5A 2Z4QA 4LOEA 5J11C 4YIQB 4N2NA 1UWXH 3Q8EA 5D9SA 3QZMA 4HOWA 3VD4A 2OZ4L 1MCSA 1CFTA 1FYTB 4BH7A 4BUGA 1OHZA 1R5VB 1XSJA 3WJJC 4BGDA 4PGBB 3L3GA 1J5HA 4OFYA 4B41A 5TQ2L 4LLAA 5KVDE 4RFNB 4Y1SA 5F6HJ 3ZPDA 4QY8B 25C8H 1KPVB 2D8KA 4FQJH 1EJOH 5EBLB 2QZQA 5I2IB 2YA2A 3VFNB 35C8L 3E3QE 4PN6A 3QPKA 3V6ZB 2BFGA 3W38A 4HF5H 4J3BA 3UTTE 3LXUX 4EOWH 4OLVH 4Y1AB 5INDB 1TZOA 3DYMA 5H4YA 4OD1H 2PO6D 2LFEA 1JN6B 1CTOA 5EO1A 3ZR5A 3FN9A 2AQQA 3N41F 3QBTB 4HKJA 4XNXH 1I8MA 2IGFH 3HC3L 4XBGB 3CAFA 4ODHH 2H2PC 2DQHH 4MAYC 4PRDB 3HFFA 1KNOB 1JCKA 4ONHA 2XLLA 4N85A 1ET8A 3LDBC 4AEIL 3W56A 4OLUH 4FABL 2VWEE 4LSSH 2QV2A 1HEZB 1NAMH 2HT2D 3SD5A 3NEOA 5FW6A 1S9XA 3CHXA 3VD9A 4RISL 1KXVC 3VMOA 5KSAA 1TVBA 1JVKA 2C7FA 4PRHA 5EZLA 4C8XA 2JB6B 3MNZA 5DQ9B 2OSWA 2QFRA 5KBLA 3V4PA 5E95B 2BMKB 3E1ZA 4FI8A 5HYSA 1BFVL 3ZGHA 4YDVA 5IB4A 4U6XB 2A9MH 4K8RL 5A7EA 2F74B 3FJTA 3NBNA 4C56A 1RIUH 3DVIA 2OMYA 1Y18B 3NAAH 4QF1A 3IFLL 4YIQA 3ARDB 5A7BA 1IBYA 2A73B 4I13B 3TN0C 1IARB 2J21A 4N68A 5HGHA 5GGSA 5ICYA 3VXMB 4BQCA 3BH8A 2NPLX 1HHIB 1XR8A 3GBNL 5CKAA 1A6UL 1IAMA 1LK2B 3ZKMD 3WTXA 5C0IB 1AE6L 4MCZA 3ROOA 3PQYA 1JXDA 4NZTL 4AENA 1P7KB 3P30L 5IHUL 3EOBB 3HE6C 3VYPA 3AS0A 2J2ZB 2W1NA 4K5OA 3DRTA 3OKNB 4PS7A 1G43A 1UZ8A 3TYGH 5KG9A 4JPIA 1MFUA 1H6TA 2NY7L 1K4CB 1ND0A 3H3PH 5FO7A 4AGPA 1Z5YD 1A9BA 3LTVA 4IYKA 3MRHB 3K8MA 4GUCA 4TTDC 1T22A 2FECI 3FAXA 2ATPB 4FNSA 4KX7A 2CO7A 5D2LE 5F9WC 2W91A 4XE5B 1EO8H 4FAAB 4A2EA 4Z7NB 1H6EA 3MC0A 3T6ZA 2AI0L 3ZDYF 3PL6B 3BDYH 2OPCA 3DVNB 5J89A 1S7QB 3EH5B 1X4XA 5HHXH 4DESA 1I8MB 4BQ9A 4L3ED 4OD1L 3FUIA 3UTZA 1E27B 1JAEA 2IALB 3HAEB 3HNVH 3N40F 5EO1B 5C08E 4GB9A 5CBEA 5H35A 1TUPA 4DUVA 1I9JH 1FGVH 1TO5A 5A2AA 2YQBA 4X8JB 1QSZA 4QHLB 3BP5A 4P2OD 2V7NA 4XMTA 3HJ0A 4L9LC 5CEZL 3O8XA 3MLXL 2ZP0T 2Z4TA 1HINL 1QRKA 3BUDA 4GP5B 1UB5B 3IWVA 4NUPA 5C09E 4KZEL 5FHBH 3IKCB 5JW5A 2R2EA 4NO3A 4FQXB 3N85L 2KUTA 4KXBA 4LSSL 1J9TA 3CH1B 3RYMA 4CDGC 5IBUB 4JO2L 4JY5L 1K3IA 3QEQA 3L3GB 2Y24A 3C08L 4Y4KB 3V10A 4IK6A 3R7RA 1JGEA 3I2CL 1ORQA 4P99A 1XB6A 5DUBA 4MLIA 5HJ3B 4NXKA 1CXEA 2J1XA 1WAAA 1Y7VA 1BOYA 1JGVH 4QYAA 4JFXB 3MN8A 2XZCH 3J7HA 1IM9D 2BXZA 4HOZA 1NAML 4RZKA 1PD6A 3WIHL 3N1FC 4ZMZA 3FO0H 2GUOA 1AR1D 1TQCC 5DMIL 5E51A 1D9KC 5K33A 2SEBB 1Q0YH 1FG2B 5IW6B 4QOKA 1V3KA 3CFBA 3SCMD 3NIGE 3FQNB 3VGEA 1MRFH 3A47A 3O0LA 4M7KH 3OXRB 4HC1L 4IU3A 1YNLH 3FQ2A 3FRPG 3KS0J 4IRZH 5B7EA 3AG1B 4AMWA 2D7NA 5ETUA 3GGWA 4R4FL 1AR1B 1F3JB 3QA3A 4DQOL 3W0WA 4G42A 4EDXA 2W9DL 5HDOA 1F4HA 3ARBA 2HCZX 4X7SL 2QHLA 5CP7B 3S36X 1S8DA 4YH6A 5EU3A 3VVVA 3X1NA 2BVUA 4KVNH 5TDOA 3L1FA 4MD4A 4Y4KC 1ZV5A 2CUMA 5C0BD 4DAGL 5C0ND 3QIBC 5AWNH 3VFOA 3CQQA 1EHLL 5CSGA 2A6JB 4L1SA 2VDRL 5I1EL 1VEPA 5HHOA 4KTYA 2VLRD 4OLWL 5CFHA 1J9RA 4LEXH 4U1SA 3CHQA 1UQSB 3D52A 2B4CC 1R33A 5IIEB 1K5NA 1UD2A 3MROB 4WEMB 4LP4A 5FO8A 4TXVB 4E0RA 1YMHA 1SF5A 2JTYA 4WGVB 2Q3AA 1WAEA 3DMMB 4JLRA 4Y5XC 1MVUB 1OGTB 4IRZL 3DBXB 3HNSH 2R29L 1KCSL 2DQIH 4UM8A 4XNQB 4X0KB 2FQGA 3OMAB 3ARFD 1EV2E 1KENL 3ZDXB 3QIUC 1BECA 3BQVA 2J6WA 3DBXA 4KRNA 4UV4L 4X8CA 4BA0A 3WAJA 4OLEA 2QZ5A 3OSKA 5DK2B 4U6HA 5C8JA 4N9OB 5JW4Q 5SWSE 4CC4C 5HI5C 4TRPL 1I4FA 4YHLL 2BHZA 3IT8D 4GAYB 3RHWF 3BEWA 4XPHL 5L8LB 2XN0A 2FIKB 3MLZH 4FQLL 4LCYB 4UINL 4F80A 1EHXA 1X44A 2XC8A 2VZTA 5HYJD 4WTZA 5I5MA 3WIHH 4FNRA 4XNMB 2GBVA 2XZQH 3G6DH 4U1HA 1NA8A 3JV6A 5GS2D 4TOYL 4HQQL 1NGWA 3UBXI 2CLZA 1FRGH 1KTLA 2Y6SD 4XO3A 4MJJA 3APNA 3SO5A 4IRJC 3I74A 3TBCA 4JFDA 1QBMH 4J39A 3U4BH 2GC7C 2GW5A 2MEJB 4HGKC 3AQZA 3CMGA 4U1IB 3QUYB 3L8QA 4HIEA 1E40A 1ETZA 4K3HA 1FSKB 4NYLA 4DOHE 4WK2B 1AMYA 1DE4A 2PCFA 3EJSA 3A67H 4UTAL 3NSYA 3QRFM 3L9BA 4UQ3A 5AW6B 4PJDB 4WLCA 1EMTL 4U49A 3LN9A 1T04B 2EDNA 2VXTL 1RV6X 3Q8FA 4FMKA 4TUOA 5D7IA 5EO9B 3RKDC 5J9PA 1QUNA 4N2FA 3SPGA 1H9VA 3N42F 1LHZA 4M3JA 4WWPA 1ML0A 3FQWB 3STLA 3VSUA 3FT9A 3FOLB 4V11A 4ZMPA 3WFDL 1Z3GH 2HT3C 4M5YH 4MXWH 1I7RA 1P4IH 1VIWA 1T1ZA 2NY6C 1RMFL 4NNPH 4XI5C 2B0SL 1ZVSA 1JK9A 4LRNH 2EH8L 2IDUA 5DWPA 3T4YA 4HVBA 5CLWA 1QI4A 4XCCH 4XMWA 1SJHB 4NX0A 2EEXA 2VISB 1PLCA 1IL1B 1XGRA 3WSQH 2VMEA 4B9KC 4U1LB 1SVZA 2YUWA 2L7QA 1C1EH 1M6OB 4AUJA 5GGVY 3AM8A 2DM3A 5E5MB 4PGZA 3UTSD 4ENZA 2DM7A 3VDBA 3OAZK 3S34H 1AAJA 1M3JA 4OZHB 5EO0B 5BMFL 1AS7A 1Q4NX 2CHDA 3O3AA 1WUZA 3CFNA 3CH1A 4A2GA 3F64A 4BUHA 3L45A 2WTRB 5F9OH 1H3VA 4E5XG 3FTZA 1FBIH 5EORL 3WKYA 3BAEL 3P2TA 3WY4A 4WI3A 3HKZA 1AO7A 3QIUD 4ODXB 3N1MC 2BVPB 4HGWB 4Z7NF 2N4IA 3EFDL 5EU4B 4MMZA 3MFFB 3RY6C 3TNMB 2NY1D 1NCOA 1CVRA 3H6JA 2OMBA 5D70L 3V8OA 2AQ2A 3EGSB 3FZUD 1YPZB 2HRGA 4HK3J 1MHPL 4M48H 2VXSH 4GUPA 4NZ8A 3KH3A 4OV5B 4QKTA 3HAEA 2XWEA 2WVVB 4R5VA 3RWDA 4G82A 1XX9C 1ETZB 4HJGB 2LU7A 4JCWA 1F97A 2FVNA 3VH8B 4JFDD 3VQLA 4Z7IA 5E9NA 1ZOXA 5BCAA 2OCCB 2GVYA 2P45B 3ET9F 1NIFA 2APTA 3RA7H 3K6OA 5E00B 3HHSB 3F6LA 4GW5B 4X7FC 3GPEA 4IU2A 1R5WA 5F1KC 2WNKA 4ZK8A 1AC0A 1MY7A 3UBFA 7PAZA 3GWJA 3WS6C 4PJ7A 1XD1A 5T3ZD 5GRWA 4PLJC 3LNGA 3CLWA 2WP3T 3CVIL 3DI2B 4JPKH 1J12A 3WIFB 4HG4J 4LQFL 1ZEAH 2FWUA 3QWNA 4MX7B 4WO4D 35C8H 4Y4HD 5EDXA 4M6NH 3VXOB 4Q9CA 1QLEB 2OTPA 1U8IB 1P7QB 2W60B 3KLKA 3LIUA 3U0TA 1IKFL 5EFIA 3I84A 2VXTH 4OLVL 5F7MC 4GW4A 4LCUA 4OGXL 3V52H 4E9XA 3M1CA 2MHAA 5T1JA 2AQRA 3RL2B 1IBFA 1U8JB 4I5BA 2Z31D 3IXAB 2R2CA 4YDVB 3IBEA 4LOFA 3UG3A 2OJEA 5FCUH 1UOLA 2VDPB 5FM5M 3HS8A 1IE4A 1I3GL 1GW0A 4H8PA 5LQBL 4PV8A 3FTXA 1UQSA 5ITBH 1TSRA 3TEWA 1H8LA 4XNBA 1SJXA 3JTTA 4NPJA 5D7EA 1BVOA 3BQUC 3DGGB 1IBHA 1UJ3B 1XQ4A 3L3KB 4YNYB 4WSJA 5ID0B 4S10A 1HU8A 3VFVB 5DHVH 3CPLA 1H5BB 5EBMB 4EJ1C 3BGFB 4EKJA 4ODBD 3Q01A 4JGNA 2XPGA 3GSOA 2XCMC 2JQAA 2PPDA 2H6PA 5I28A 5LBGA 3RNKB 2BNQA 2XWTB 5DF0A 3HLAB 3P11L 4TF4A 3FT2A 4OJYA 3KW8A 3TVMA 1PSKL 5DJ6A 1F3JA 3V52L 2XX1A 4LSVH 1MCHA 4MMXB 2ENJA 2WQVA 2APSA 3L16A 3A6OA 1YQVH 2IBZX 2X7LA 2YPLE 2JKSA 3RGVC 2YRZA 4K3DH 5KYWA 2AMGA 2WBJC 2PETA 2IEPA 4L8DB 3FU9A 3NT0A 4X6EA 3UIZA 3ZJAA 5LUMA 2PR4L 3K4ZA 3GKWL 5SX5H 4HSAC 2APXA 3V4UH 2V2XB 1RVFH 2UZXA 2YEVB 4LPWA 5DRNA 3NIGF 3SDYH 1S7VA 5ENWB 3QYNA 1R5IB 2I07B 3F7RA 1YZZA 1NPNA 1S5IL 4HIJB 1CJYA 3D4YA 1KYAA 1XGQB 3FSAA 5JPMB 2DEXX 1P7QD 4IQHA 1R24A 2NY7H 2X4PA 4NZRH 5IMOA 1Z32X 2AAAA 2GSGB 3II2A 4LCIH 4Y4HB 2FR4A 4L2LA 4QXGH 4D9RE 5L4IA 3EH3B 3G5YB 4XOBA 1CDCA 1PVHA 2CR6A 1MRDH 4AM0Q 1ACZA 4ZXBD 5FYKH 1E2ZA 3N06B 3B3IA 1LQBC 3L1EA 1LO3L 2ITFA 1DQIA 2OMWB 4PD4K 4PRBB 1NPJA 5C6PB 3MV7D 1BJ1H 4YSDA 4K94H 2BMKA 2CIKB 5J5EA 3L95B 3NACL 4NAMA 1UA6L 1SM3L 3PXLA 4XZUB 5AZUA 1JYVA 5CAYB 4P23D 2Z1PA 1W0VB 2RCSH 4O9HL 1UZ6F 3WS6A 1N6VA 1G9NH 2YUVA 2I5YL 2X10A 5AVTB 5KVDL 2AJSL 4N86A 1B3IA 4GI6A 1IGYB 5DD1H 4NOFA 5DUPH 4ADGA 1TJXA 4ZUUB 4KROC 2ODIA 3O8XD 2XQ0A 5EPMB 4HFWA 5KJ4A 2ITDA 1ZTXL 2CKBB 3NAAL 4TNWF 3ILPA 1MVFA 1XZWA 1S9KC 4YUEH 4R7NB 3AS3A 3S35H 1DQML 2H3NB 3ES6A 3WENA 3KPSA 4OIFA 3T71A 2P8LA 4FTVB 4DCQB 1OGSA 1LEKB 3V5HA 3GSQB 3WNMA 1XO8A 5AFAA 3QQ4B 3MNWA 4BFKA 4PRIB 4PS3A 2VQ1A 4LT7A 3G9VA 2K8QA 1OSYA 4DEPC 4DGVL 2ATPA 2FJUB 1DSYA 1G6RB 2EO1A 4FYTA 1GSKA 4QRUA 2MCPL 4G6KL 1WIUA 2BCKA 4HYTB 3RZCA 3UPRB 1MI5E 4QDGA 1QSFB 4NKMA 4XP4L 2N7SA 5AUMA 5I1DA 5I1IH 3INUL 3QORC 1CICA 1FYTE 4Z5RB 5T3ZH 3O9WD 4YBLB 3VRLE 2XN9D 4C83B 5I1DB 2BX5A 4IM8A 2QEJA 1OAJA 3LQZA 4P04A 3TV3L 5C0JA 2DLTA 2D7MA 3QJQB 1U8NA 4L8BA 1MW0A 4UM9A 2DLHA 1EJFA 4AEEA 5EMYA 2XJLA 1EIBA 1CCZA 2EDOA 4W9EC 4KI5E 3FHQA 3OB8A 5IR1B 4L0PB 1DQMH 5LVEA 1QAWA 3DBSA 4NQDE 4XWGL 3ZGIA 4YK4C 3TVMC 2GSGA 2NY4B 3ABGA 4W9JC 3MAWA 1LILA 1R24B 4RX4D 3OMZA 2PWDA 2V5TA 1AANA 4B7LA 5D2NC 5BPPA 3T08A 1AGEB 2H1XA 5GRVK 4LASH 1I9IH 1FL3B 2WZ0A 2OTUB 3MDJA 3BI9X 4MJID 5KOMC 5JXEC 4PJFB 2BXYA 1KPRA 1E8XA 2Z0BA 3X1GA 2QMJA 2ZP8A 4B9IA 2VISA 5C0CD 4WKZB 3SBPA 2J56A 4Y9EA 3QUYC 3APCA 2UWEB 1ZS2A 1BZDA 4L1HA 2QLYA 3EFFA 1Q0XL 4J8RA 4P4KD 4K4KA 1EZUA 1UKSA 3QYCA 3QR1A 5IIEA 1W0VA 4S0TD 1MCQA 4P2RA 1DBBH 4B9CA 3OJDA 5E5UB 1CFBA 3LN5A 3NACH 1NFDB 3F7VB 4DETA 1JNHB 1YA5A 2VOTA 3QHTC 3V0HA 3PHOB 5IEHA 3O4LB 1NBYA 3A4FA 2HUHA 5F21B 1A1MB 1YEHL 4IRJA 3CZFB 4CU6A 3JWOC 4X4YA 3P4MA 4IKJA 3U1SL 3QQ3A 2NY6B 1DE4B 1BM7A 4OY9A 2C9QA 1K3ZA 1JZ8A 3CVHB 1I3RA 2YKLL 4ZNEE 4A7QA 3PDGA 1WC7B 2XACC 2DTMH 4KAQL 3ZTNH 3H4HA 4GIPD 3GI8L 3KPRD 3MV8A 1HOEA 1TIUA 3EJUA 5B38B 2K8MA 1BWMA 4XRCA 2CLZB 4ACPA 4FKEA 5C6TL 3THML 4KH2A 4U1LA 1G6VK 3CX5K 4C57C 4WFFD 3SPVA 3U4BL 4YO0B 3U0TB 5HDWA 1OCZB 3G5VB 4HH8A 2J8UA 3AAZA 3QPQC 4O2EB 4XCFH 1NC2D 3NFSL 2FHCA 1ACXA 4HWZA 4FHBD 3V4LA 3VI3A 1XR9A 1OD7A 3K91A 4FXGC 1EX0A 1UXWA 3ARRA 3KMDA 3HS0C 1I82A 1KGYE 5AW3B 1ZPLA 4H8WL 2MNWA 4RGOH 5EOCH 2YLHA 4QLWA 1UWFA 1IEBA 3DIVA 1EAJA 4I1NB 2RIKA 4QHKI 3CVHL 4AYEC 1VZHA 3ZDZF 3U4EB 3RWCB 1DVYA 4W6YB 2XQBL 1Q9WB 4HK0B 3RB5A 3AITA 2IPUK 2ZCLL 4TLSA 1CG9B 4JNXA 2FEEI 2BY2A 1O5DT 4WJG3 3MRIB 3TJEH 3UMTA 5SWQB 1OTSC 3L4VA 1A6ZA 3H1ZA 4NB7A 5L8KB 5DEGA 4AEHL 2W9EH 4V1DE 4WWOA 4XVTH 5KSVA 4GH7B 3DHPA 4IBZA 4NNXA 2NSMA 2YUXA 5EU6D 1HVXA 4XOEA 1VEMA 2G60H 1AGBA 3MV9B 4IRJB 4PLOB 3F7PC 5GZNA 3RVXD 5EC1B 4I0CC 3NFSH 1NC2B 1WWWX 3WMSA 1A6VL 4CSSA 3CXHK 4Q2ZB 3TBTA 4JRXE 2GTWB 4XE0A 1O7VA 1M71B 2F8XC 2O5YH 3TCXA 3KJ4B 3ARZA 2BERA 1PYWB 1KEGH 2XQYG 3FFCE 4QRRB 4OTXL 5CN2A 2YZ1A 4QHMA 1GY2A 4TNGA 2XKSA 1ES0B 2LGNA 2YMXL 5DVOA 1JF1B 1XV8A 5FECA 1NOFA 2PYED 5I23A 4XXDB 4AKQA 2P5WE 3KPRB 2Q7YB 3MRKA 4CN4A 1MCCA 2RFXA 3DJ9A 1YAIA 4YHIA 1EEZA 5GRJL 3S98A 2K78A 1MHPH 3D39A 3HRZA 4JHWH 4M48L 4BRVA 1A6UH 3QEUB 3VWJB 3IJ8A 1ROCA 1E43A 4PY8I 3VH8A 1AXSB 3UTQB 5C0FA 4TNFA 1L7IL 4ALAH 3VFTA 2EINB 4DVBA 3GJEA 5HDQL 2V2WB 4RAVA 3IDIB 1KELL 2FATH 4Q6KA 2HXAA 4Q4IA 1Y0LB 1ZVNA 3AS2A 5HI3C 5C3IA 2WGNB 2J1YA 1G7JA 3MO1A 3NZHH 4L8CB 1B4JH 1G9ML 2DJSA 4N2IA 4F7PA 1U91A 4PWJA 2EEDA 1EBPA 2QL1A 2HTLD 3VG9B 4W9HC 4CJ0A 1V7MH 4MAZA 5F72S 1LDSA 4JDVB 3BKCL 1IM9A 5A2JH 1LJMA 2HJKA 1RQ5A 2IDSA 4JPKL 4Y5VA 5LCVA 3BVDB 1FFPA 3CJJA 4W70A 4PJIA 1XHHA 5LXGL 4OD2B 2WOYA 4J3OF 5HI4C 9CGTA 3N9GH 4PJAF 5CIPA 2VQ1B 4MNGE 2XTJC 4M7LH 3S88L 1BJ1J 4JANB 1ZANL 1JVLA 1BD2E 2WQAA 1A6AB 2VAAB 4TKWA 4G9DA 2OTWA 4IRSB 4NZDA 5CZKA 4IJ3C 4FQXC 4FG4A 1KELH 4LE8A 4P57B 1NCGA 2NY5C 2EUWA 4HKZB 4F9LA 4RMWA 4R83A 3MRJA 4IDLA 3HIZA 4KTDL 4JFEB 3IMSA 3GO1L 3ARED 1PL3A 5IP4A 3D0AA 4NM8H 5CEZE 2MFNA 4ZW7A 1JCVA 4HCRH 3BUYB 4HPOL 1M7UA 5HI4D 3VFPA 1XGPB 4F2EA 4ZUWA 3KGRA 1E8ZA 2P8PB 3S2AA 4KK6C 3ZHKA 1HXMB 1X5IA 3OXSA 5FEBA 2ESVB 4NIYE 1FO0B 4KJQC 4G7VL 3MV9E 3G6AA 3BP7A 3OR7A 3S3BB 2ZG3A 4PVLA 3S8GB 2Q86A 4AMKL 2B4CL 3N91A 4LLVB 5H37H 5B3NA 1ZANH 1E4XH 2Y25A 3DURB 4NCC1 4FNTA 4NM4H 5B8CC 1EUTA 4YE0A 1Y18A 1MXGA 1JXFA 1X9LA 4KXAA 5ESVA 5DGRA 4PLNC 5KVGE 2F74A 5CLXA 1WFMA 1BBDL 4JJHA 4R2GC 4H13C 4ZW5A 4M7LT 4N0FA 3G6JE 3W39A 1JGDB 4WI0B 4IRJD 2CRIA 1WZ1L 1FV1B 3BIKA 5EIIG 1J1XH 2OQJB 2MTAA 5IG7A 2WXFA 1KLUA 5HI5D 3TTSA 4HUNB 4P9MH 1TITA 2R1YB 4XAWL 3HUJF 2B39A 5D4IA 3EOAA 3MRMB 1XGTA 4QO1A 4C56D 2XV6B 1M05B 3FSZA 2EXYD 3MPCA 4WHTA 2I9TB 1JYXA 3QAZC 3FU7A 3UYPB 4R0LC 1GZQA 4GYBA 1Q0EA 2F53D 3N40P 3S4SA 4UQDA 3MOAL 3V0DA 5DVMA 1SFHA 2YOAA 3NCCB 1KV7A 3ZT6A 1A22B 1D6EB 2YD8A 3ZL1A 1B4TA 1FYTD 4NQCA 2V8MA 3V0EA 3SYQA 4LKCB 3K6SA 1KLFA 4JG0H 5FIEA 5KBKA 4KDTA 1NZRA 2OMXB 1CLYH 2ORBH 2QVTA 3PV6A 1HWHB 5E7FA 1OWRM 5FXCH 2X42A 1FF5A 1OB1B 3BCDA 1XGUA 1IGCL 2NX5D 3TWCH 4U0RC 4PIBA 3EYSL 3PV7A 3Q8AA 3OR6A 4JM2C 5E94B 5F44A 3FFCA 4UQEA 1A3QA 5I8KH 4JO5A 5D2LB 4AX3A 1QFOA 5DJAA 2P44B 4QHUA 5AL0A 5IB1A 3F85A 2EDXA 5JLZA 2V33A 3T2OA 3C5ZA 2XDHA 4ZTOH 4JHAL 1QYGL 4HG4K 5LWYH 1NBQA 3JSSA 4NC1E 1T89C 1I3VA 1KN2H 4EDXB 3BSZL 3OX8A 4NO3B 2BIHA 2XA8L 5IFHH 3BFWA 1JV2A 4GG8A 3EHBD 2VRKA 4HJUA 2E6JA 2APWA 2NSQA 1N2RB 5GRUL 2FSDA 3TH2T 2BIPA 3FO1B 2VUKA 1EHKB 5I1AA 3X1EA 2Y5QA 4OJFL 4QUOA 4XN7A 3FB5A 4CRPA 2A6DB 3RX8A 5DSCB 3ULSA 1WS7A 1A7PH 3BKML 1X4YA 3GSNL 2L0DA 4DPAX 3ARGC 3GMPA 3NSDA 1G84A 1AIZA 2TAAA 5F7EL 4PRNA 3E0GA 2R15A 3L6FA 1TU2A 3QPXH 1YN6A 3VGFA 3CN3A 3WLWD 1EEYB 3K7UA 1QR1B 1DFXA 1QHPA 2WLYA 3DUUB 2DYSB 3FB8B 1SLUA 1T89A 1M05A 2R0WL 4H0LC 4P2QB 3PDOA 1KB3A 4YHKH 4P9ML 2ZWLT 4PHZA 2DOCA 1U8MA 5HHPB 2Z7YA 3L1GA 4HJGA 1JZ2A 3FN0H 4WU7A 4Y9GA 3N04A 1H3WM 4XB7A 4XB8A 1ZSDA 1UZ8B 3LJ3A 3WIAA 1JZIA 4E9VA 1SXNA 4Y4FA 5IUCA 1E9OA 3DSFL 1WC7A 4H8UA 1FH2A 3GSOB 4QGTA 2HLFD 5JOFA 1S3KL 3RBSA 4HV8B 2A99A 1TFPA 1KN4H 1R3IL 2WGXA 4GAJL 1RUAH 3GXFA 3NA9L 4ODUA 4B9PA 4JDZB 2YSTA 2JJSC 2XUWA 5KAQG 3P0VH 3SYAA 1LL1A 4L4TA 2DQEH 4IOIA 1INEL 1NUFA 2Y1YA 4DN3H 1IQDB 3ETBJ 4LKCA 3K6SB 5LJYH 3MBED 4HJ1A 2F53E 4U05A 4XPFL 1DCLA 4KRPD 5H35B 2XV2A 2FAUA 4C4KT 5D7IE 3SCMA 1F1DA 3GBDA 4G6KH 3FT4B 1MFDL 3OJDB 4ELDA 2B2XL 1G7MB 4L29B 4M6ML 3L4UA 4Z7WE 3WGUB 3B34A 3G6JB 1ED3A 1PJWA 4PGDB 3T65A 4W9CC 3UJJL 4EE2A 4N90E 5DK0B 3QFJE 2MQ3A 2Y5TB 2YC1B 1MCFA 3E80A 1GAFH 3EDEA 4BFGA 1X5YA 3FB6A 2AANA 1ADQA 4BFBD 4Y2DA 4EXKA 4JRYE 2YD7A 4ISVB 3MRGB 4X2UA 4U6VH 3I6SA 5IB3A 1B2WH 1FFQA 4GLRI 2VXSL 2P42B 3L3HB 1QNZH 1FC1A 2W95A 4XPBL 2EE2A 4UI2A 5FKPB 4ANKA 2A9CA 4RFNC 4YS4A 2ZSWA 1RFDL 1Y1UA 1A3RL 4M1GH 3HUJA 5IFHL 3SDXB 3KPPA 3EJTA 2XG4A 4R97B 5CIPB 1TQUA 1N6UA 4C54A 4PJIB 3KPTA 5TD4A 4O5LL 2WQXA 4PHXA 2AF2A 2OMYB 2WMPB 3LKOA 1ITBB 1BM3H 3E6FA 1TTAA 1XTMA 2HFGL 2VW6A 4R7VA 4HK3N 2IPTH 4U1IA 4X6DF 5CJ8A 3TPUB 4CVZA 1SRDA 4LBAA 3ZQWA 3FPYA 2WZ6A 3HB3C 1IU1A 1QA9B 1IC4L 3HG1B 1VDGA 4MNGA 2QELA 5L4JA 2VO8A 3FQUB 4A2MA 4NCDA 3KPOA 5FUOH 3RQ3A 3FRPA 1U8LB 1DJSA 5F9AC 3RGVA 1ZT7A 4ZXBB 3HZ3A 3U0PB 4OZGF 3B1UA 3E9UA 3L7EA 4FXLA 4NCC2 4M43H 4KKQA 4JO4L 1TVHB 4UOZA 4HIIA 1A3ZA 1RLBA 4JZJC 3RIFF 2R8SL 1IZJA 4F37K 5CEXB 2WB7A 1A3RH 1BXUA 3AVEA 4G8EA 2BNRE 4OB5H 4PJFE 3QE5A 3VX0A 1XF5B 4N3TA 1ZT4A 4QRSA 4Z3EA 1IQWL 1VB9A 2Q7AA 1E7VA 3MJ7A 3OWRA 4XPFH 3ULSB 5HDBF 4KDVA 4NZTH 5CXPA 4HS8H 5K1JA 1AMXA 5TE7L 1CFMA 4HHWA 1I8AA 5DU7A 1SZNA 4YPGB 2CKBL 1FNEA 3W0WE 4B50A 4BZ2L 3DMMA 1INEH 5IJBC 1Q1PA 2NY3B 2SODB 2YC1A 2ZKMX 4KXCA 1KLUB 5MHSE 4P2QD 3FHAA 3C6SA 5FV2A 3WFEH 1Z66A 3IN0A 2KERA 1QHOA 2VW4A 2OXHA 4BE6A 2IPUG 2EEAA 3ZSTA 3IWUA 1KXHA 2VZOA 2BP8B 2D9QB 1R5VA 1S78C 3BZ5A 4OJEH 3QH3A 5ACLA 2HVJA 2YRBA 2P5EA 1PNDA 1QKZH 4M6OL 1PKQA 1QFUL 2D3NA 4L4TB 4ZO7A 5KVEH 2PR4H 3PJSB 3K71B 1N10A 3QDJA 4MD5B 4R5TA 4BA8A 3P4OB 5I66B 2VLME 2YD2A 2ZWZA 4M8RA 4OZGE 1M56B 5CD3A 1JD7A 2FHFA 4MJ5B 1UM4H 4MA3B 1A9VA 3O11A 3L1OH 3RX7A 3CVHH 1URZA 5EUKB 2MTPA 3HG1E 4HMDA 4S1RH 3DKHA 1CLYL 4KZEH 1IEHA 1CZ8L 2ZYIA 3OC5A 2X9XA 3ROLA 2R0KH 3FFOA 3BUYA 4IHOA 1KJMA 3RIFK 2X0VA 1AKJD 2QBWA 3X1BA 3ROLB 2K45A 3RU8H 2F8IA 3C75A 1JWUA 3GMNB 2C3VB 2DQJL 3J07A 4JR9H 4KMTL 3WHE1 4L23A 3CHOA 3K0WA 2HT2C 1CL7L 2JCCB 5C0GA 3EZJB 4LNRA 3SGDI 1OQOA 1BZEA 3FK3A 1KJVB 1EJOL 5KOVC 4NP4L 3DV6B 4NPKA 1OSEA 5FM5O 4ABWA 4AGMA 1F3DJ 4ZMOA 3EH1A 4CBPA 1RP8A 2EVJA 5B38A 3FO1A 2H0PA 2E7BA 4CMMB 2ZF9A 5C0RH 3TBYA 3ZOAA 1P7HL 3DX7A 1N68A 3HE7B 3DXAE 4IBLT 4HJIA 1CFSB 2HLEB 5B7FA 4KZDH 5DS1A 3IPEA 4KKCD 2BSED 5AVXB 3CXHJ 3ZT5A 5B1CA 1TNMA 4WNQB 4WHYH 3MO1B 4A37A 1MPAL 1OM3L 4DZ8A 3H7BA 2QVIA 2BSCA 3VW3L 2NXYC 5HYJA 3FQ1A 4YEEA 5BUAA 4H8WC 4E9RA 3I02B 4HWZB 5DD5L 3S8WA 4X6CF 5JO5B 3W9DB 5EEYA 5HY9A 4E5XA 2ZUUA 3JWNG 4PJ8B 3DVNA 5F96H 5J6GB 4JPVH 5LBSH 3WHE0 2MIZA 8PAZA 4JMXA 3T4AC 1GGIH 4MJIE 1CXHA 5BRZB 1CE6B 2EDYA 4BFIB 5C0CE 2AITA 1L9RA 1U8QB 5A43C 2WC7A 5LNDA 3EYFA 1BBDH 3FTSA 4P2RE 5EUKA 3ZE2E 1ZK9A 4X9IA 4K7FA 2F6AA 2AKRA 4XXCA 2YQ2A 4JL1A 3MBWB 1W6LA 1FZJB 1J8RA 4UDUB 4XVUC 1I9EA 4ILDA 1HKLL 1A1OB 2BDNH 3JWDH 2VLLB 1ZIBA 3TBSA 4A7UA 1JNNL 1WEJH 5ADPL 4GY4A 5CP3H 5I6NA 2OLDA 3PIQB 4YHOH 2OX5A 1ZGLP 5TJWK 3MUZ1 2YJLA 4IRSD 3D34A 5HVGB 2ITCB 4NM8L 4BQ8A 1SN5A 1KGCD 5E6IC 3AQYA 2J88L 4D9LH 1OHQA 3SD2A 1HSAB 4OCWH 3BGMB 4OGYL 1HNYA 2D03H 2OSXA 2V9TA 1GYCA 2Q2LA 3FBKA 1KZYA 3HE7A 4J8RB 2VT0A 1MDAA 4OGAD 5EBWA 3TO4C 5IQNA 3ARBD 5E4OA 5EZIH 3Q6GL 1ID5I 2XBZA 3OD3A 4ZZKA 4MQ7A 3W57A 2VDRB 2WIIA 4BSWB 4DHLA 5F7HA 3ZYZA 5E5MA 5M7QA 4PLKC 2AJ3A 4JPWL 2MQGA 1UB6B 4PRPE 4BFNA 2QQKL 1J87A 1UXWB 5F9JA 1VKXB 3ULUC 2VAJA 4N20A 4NUJB 3LQMA 2GIYA 5DD3L 2NY5L 4K9EH 4XMXA 1ZHLB 4FFYA 1MHEB 4GRMB 2E7MA 1SXBA 3MJ9H 4YC2C 5FLUA 4J28A 3CZUB 2ZXEB 2D3VA 4D8PB 4DN4L 2OYLA 1S7SB 3Q05A 3SDDA 3EXLA 4PJXA 4QRQB 3P30H 5IHUH 3FRPB 1RUPL 3IFPA 3W2DL 3ZT7A 1RZGA 4CMHB 2B5IC 2R2HB 1IC5L 3HG1A 3NRFA 1AXIB 2CO3A 1A6PA 3VG9C 2FZ3A 2A9NH 3KPQB 1H3TA 5TDOB 1AGCA 4LSUL 4M6AA 1OP3H 3I9IA 1RL1A 1XCWA 4NJAL 5C07D 5FO9B 2FL5A 1CDIA 4LHUG 5LBSL 4JDTH 4APQB 1G9MC 1RJLB 5DMIH 4UT6L 1R3HB 4Y5XB 3IJEA 4HU2A 1IAIL 2ZONA 5GSVB 2DM4A 2A73A 3NSCA 3TO2B 5T1LB 4D9RD 3QZWB 4LAQL 5SX4I 2VGLM 4G7QB 2VITB 4L3AA 3VB8A 3AQXA 4JKPL 5T5NF 2E6PA 5EH1A 3QP3A 1TTFA 2FBJL 3DOSA 2VJ0A 3GMQA 5FF6A 3MLPA 4Z0BL 4F2ME 1RUMH 2WB1A 1KCVH 4CN1A 2IDFA 4KKPA 1IGML 5KSAB 1JHLH 3HI6L 2CR3A 3TWYA 4ZUVB 4HUWA 5AVSB 5TQ0L 3R1GH 5AVVB 4XZ4A 3RUGB 2UVEA 1MCEA 3MVSA 4AMXA 4YDIH 1WBZB 3KLDA 3GBMH 4HLZG 3UAEA 4AE0A 4Z3FA 2DTSA 2VDRH 2ODHA 3VUAA 2X4OA 1IUZA 1DLHB 2CIKA 4GXUM 6PAZA 3BIBX 5E6IB 2AJUH 1MI5B 4AIEA 3ZTEA 4MHHG 2QQKH 3LNEA 1ADQL 5HD8D 3NH7H 1LYQA 4ACTA 1KBVA 3UBXG 1KEGL 4QXUH 3MJ9A 1MJ7H 1KFGA 2GHWB 4K9EL 3RA7L 1NDMA 2WLIB 4JFYB 3W82A 3IMTA 1BMWA 3CVIH 3RL1B 1U8LA 2WLHA 4M5ZL 2AJZB 3FSWA 2BOBB 4ZG1A 1QLFA 2WJ7A 1RZKH 1A1MA 2FJGB 4RBPK 5DFTA 3T0EC 3INOA 1WZLA 4QRTB 2BOLA 3QYMA 1KTBA 4GP4B 1N59A 4HS3B 1HILA 3WFCL 1C08A 2X1PA 3DRQB 5TDNA 2A9BA 2BRQA 1S6NA 1CBVH 5C86A 4PY7A 1KGWA 1OXYA 1YNTA 4L8DA 4X6EB 2F0CA 3QRGL 3N42B 1OT1A 5GJSL 5I5RA 1ASPA 3PL6C 4TUJB 1WPCA 5D1XC 4Y0GA 2KDYA 5DMYA 5D1ZD 5KYXA 4JDTL 2UV3A 3S5ZA 2WD0A 2O5ZH 1NC4B 4FKHA 5I5IA 3FU8A 1LDPH 3P0GB 3ABZA 4J3OD 4LEOA 3VFSA 5IROC 5ICUA 2X9YA 2ZYRA 3GHEL 3QR2A 2K7PA 3B2UD 4YXKL 3O9WA 4BZ1H 5D1QD 5DRZB 2GK0A 4HFWB 1IC4H 1YEWA 3BWAB 1R5WB 4QAMB 4Z0BH 1UHVA 3QDGE 4ZSOE 2Q1EA 4DP4X 4CW1A 5HGHB 3F00A 3MCLL 4MAUL 4NUMA 3X13A 2MH4A 4LAQH 4RCAA 5C09D 1FNFA 3SOBH 4JKPH 4K94L 3NJVA 4JM4H 1BX2A 4P3DB 4UOJA 5TQ0H 2GFBA 2Z35B 4E68A 3EF7A 3DTXA 3LHAA 4AWJC 3L95A 3RNQA 2ZUTA 3HNSL 1TQBC 2AAVA 4HX1A 4PJ7E 4EQ2A 3L4YA 4KXDA 1LNUB 4QTHB 2ZCZA 4IRZA 2R9HD 2J5LC 3RPBA 2C1PA 3L4CA 4Q9RH 5BOPA 3C5ZC 5GGQH 2B59A 4XPBH 4LPTA 2CR0A 4PP2B 1MRFL 3F2LA 3WSQL 2KKQA 1CIDA 4NZJA 4F91B 5DJ2A 3MBEC 4NDMA 1KTKE 5D1QC 5D71L 1RLWA 4IGBA 2NY3C 3TP4A 4QT5B 3BQUD 3AREA 1N67A 3FTGA 5IT2L 5F1OB 2F15A 1JK8A 1H3XA 4ATTA 4O5LH 4F33A 3MLXH 2A7BA 2RD0A 3H7LA 4WU7B 4FQ2L 3PP3H 4OFIA 5DDHA 1DZBA 3GUTB 4ZFGH 4X6BA 1YY9D 2IPTL 5A2BA 4J5VA 2ZJSH 3GXMA 4TULH 3WU1A 2P8MA 5JDSA 1YDPA 1EAPB 4LBEB 5IHZA 1QSFD 4XMZA 3GQFA 1E67A 2GJ6E 3LAFA 4HCGA 3EOYG 5AOZA 4JO1H 4CADA 1QFPA 1BQHA 3APDA 2WWMC 3TVMB 4QWWD 1J18A 1KPRB 1NCCH 3I6LE 2WWMD 3SKNB 3CDCA 3QNXA 4EN3B 2MWCA 3UG5A 2OCJA 3GDBA 4DUXA 4N2GA 1EHAA 2AXGA 3FO0L 1LK2A 4POZC 4ZUTA 1G7JB 4XNUH 5GJSH 1CFNA 4S11A 1Z3GL 2XWXA 5JW4R 5MP6L 4C59B 5D1QB 4Z9KB 2V5RA 2MRYA 3BWSA 2BVQA 4ZFZB 2MNUA 3TO2A 2FSEB 3WIHA 4XCCL 4ICXA 1FE8H 4FA8A 3QUGA 4PJBA 3VD2A 3O45A 3MV8E 2FEEL 3IU3B 1L0XA 1PKQE 4ZMWA 1RULH 5EU5A 3VRJB 1ZLEA 4HZLA 3SE9H 4YDKL 2PYEA 1U58B 1BA9A 1OAUH 3NVQA 1W15A 3WEAA 3ARGD 3ALWA 5J13C 5HJGA 1W8OA 4RGNE 1AD9A 2C34A 2COQA 3CDGA 3SDXF 4HKXA 3Q1SL 1BZ7A 3JV6B 3ML8A 5L9DH 1I8LA 4N25A 3MREA 1F58H 4NNYA 1FP5A 1R46A 2R0LL 4K07A 4Q14A 5SWSD 2WYTA 5EG6C 3T8MA 5A6IA 3DVFA 1X4ZA 4BXSV 4HKZA 4Q9RL 4LOUD 3Q5YA 3PNWA 3KPMB 2JNZA 1ZHLA 2CLRA 1L3WA 3BN9C 4X7TA 5G55A 5DMKA 4NQCB 3FTWA 4PM1A 2QQLH 5HHMB 3D6GA 3G04B 4Z1PA 3GBNH 2NYKA 4IMLB 2BS71 1OK0A 3HLKA 5T1MA 3HC0B 3CK0L 1B0RA 4LPYA 4OZ4A 4Z3JA 4LVNB 2V5SA 2EE6A 3L1OL 4J2XA 1IRAY 5E00A 3FT3A 3IS0X 3IB4A 4H8QA 3VAEA 3WTUA 4KQ3L 2A9AA 1UH2A 3IXTB 5CGYD 1N8ZA 2VC2B 5LCVH 3IM1A 3ABKB 1G7LA 2NR6D 4LLYA 2GBUA 5JHLA 2EIBA 4YLBA 1H6FA 1NCTA 1P1VA 3NPSC 5DS2A 1I8LC 2DWDA 1N0LB 5T1KD 4EO5A 4JMNA 3ARWA 4WO4A 2DDQH 4LLYB 1G5AA 3SPJA 4K9EC 3BZEA 3QPXL 4WI9A 3WKQA 2IG2L 3KLSA 4Z0XB 1T3FB 3EYUH 4MMXC 3ATBA 5CINH 3BO8A 3NP3A 4PJAA 2ITCA 2HX9A 2VR3A 1YYML 2HFFA 5ITFA 3D8MA 5I71C 3ELQA 4XCEB 3U7YH 1XEDA 2C4FU 4OGZA 5IFJA 5BOZG 3BLPX 2CG9X 3U2JA 1QI5A 2EIZB 4JM2F 3ZTJG 2Z4QB 4NQSA 3MBWA 3D5OF 1JTOA 3PHQA 3QXWA 1NGXB 1VCBC 3CK0H 2HP4A 4S1SH 4UTAA 5BVJB 1EFXD 2QPEB 3OPUA 3SB3A 1Q90A 4FFZH 5CEZH 1RURL 1DSWA 1I1YA 1KGUA 4Z7QB 3RVUD 2XWRA 1UWGL 4X0KA 4YHML 4LO9A 1E3XA 1G7PB 1BGXH 3K5SA 2E7LA 3EXJA 4PJDE 4G5ZH 5IESH 2BS8A 4QCIA 3AWEA 1KBGL 2H0JA 1M42A 3NGBB 5F6HI 4B9YA 4LPVA 2AK1L 3BGAA 5GGUB 3MMEB 5TF0A 3DX0A 2X2UA 4X6CB 4Z7WB 3B8SA 4MCMA 2WIMA 1D5ZB 2HKHH 3K6NA 2PWFA 5H37A 5BRZA 4JRYD 2P52A 3FQ4A 2VXVL 3KLLA 3SQBB 3MV8D 5BO0D 3RDTD 3DO7B 4NENB 4NPYB 3SPCA 5CN3A 3U1QA 4NO5B 3FT2B 2L3BA 1CBVL 3GPSA 4IRSA 4RLDA 2F53B 2AQPA 4XN8A 5I18L 3AT8A 5EC1A 3QHZL 3ZKSD 4HT1H 3T8VA 3O6FD 3T04D 3FQRB 3VXNA 4PAZA 2OXGB 2ZQKA 1GKOA 4K23H 5FUZH 4N6QA 1DUYA 3RTQB 1ETA1 4L1TA 4NHUB 4GS7B 3Q2LA 4FQIL 4JRLA 3WCYA 4MQTB 1K6QH 1NFDA 3LRSB 2Y7MA 2DQFA 3O3EB 1KTJA 2BZCA 5BS0B 2X2YA 3NJKA 3C6SB 2ZCKH 3PQYE 3NSXA 1ZEAL 4KK8C 5CBAA 5IMMA 1PIGA 4AY0A 3NG5A 1N9PA 1OW0C 3MRQA 3DNKA 5D8JH 5EOQH 4PCKA 4M8VA 1N8ZB 2CWRA 2KI6A 3MNVB 2OR8A 5D7LA 1YDPB 1HCZA 3RWEA 1E9PB 3QUZD 4FLSA 2W88A 5JTWA 4PRHD 2KZ1B 3ARGB 3PDDA 4UT6A 3K1DA 3JT2A 2X3AA 4PGEA 5ISZD 2ADGA 5C71A 1C5CL 3D7PA 2MOGA 4JS7A 4LCWE 2FCBA 1CGTA 4LKXA 1GYVA 4E42B 5C0EB 3P3UA 5DHVA 4NJAH 2QGCA 4WNJA 2UZIL 3D39B 1F4AA 3PUUA 1JPGB 2UWEF 4AZ8A 2MKWA 5IVXB 4Z7UF 1CDJA 2O72A 3IDXL 4YXHL 5FUCC 3HPLB 3D9AL 1F45A 2WINB 1HXYA 2OM5A 5TH2A 1NCAL 1S9WA 4M8QB 1K6QL 1OPGL 3KLQA 1U8OB 2D0FA 1UD5A 5IJVA 5LGYA 4M4RB 2EAEA 1KJMB 1MVUA 3P9LA 2ZP9A 3FQUA 3BVXA 4CKQA 2EDFA 1WTLA 2DJUA 3IGAB 5I0DA 3VYNA 2P46B 2PCFB 4L9LA 3CTTA 2QKIA 4S1SL 3LSOA 1AVAA 1OAKH 3FUJA 5D1XB 4AUUA 2DBLH 5DD3H 2V37A 4OV5A 1EZLA 2J1WA 2VXVH 5E2JA 5TGBA 3RZCB 1WFTA 1I1CA 3K1KC 2ZUVA 5FB8A 4BCZA 4YHZL 1GH7A 3E38A 1B4LA 3HAEG 3MFFA 2GSIB 3HUJB 4KO6A 5CLZA 1S5HB 1SHWA 4MB4A 1ID2A 2K3TA 4OFYD 4ZQKB 3WJJA 2OYMA 4N0YL 2XXCB 3MA9H 1S8DB 4L5FL 4U7SA 5GS0D 5I15L 4XNAA 3UAJA 2LU3A 3GJFB 4FQCL 2P4AB 3CUPB 3PXHA 3E8VA 5FR3A 1R0AH 1FNHA 2OMZA 3QIWA 3K4AA 3CFEB 1A64A 2H32B 3IDMA 3PNWB 1S7TB 5BQ7B 3KNBB 4ZYKA 5E0FA 5CJQL 1MJ8L 1YEGL 3A24A 3D1MC 1J10A 3NOIA 2JELL 2AEIT 3FB6B 3HG4A 2VZ3A 1II4E 3UJIH 3KNBA 4ZYKB 5IBUG 2JSFA 1L9TA 1J8HD 4PRDA 3SBRA 3AREC 3KH4A 1EMTH 3VXUE 4IRSC 1DFBL 1ZIAA 5DZPA 1FL5B 5MEND 2HRPH 4FCAA 4JLRB 4HS3A 3LEVH 4Z7QF 5HHVH 2IXQB 3VQMA 2AQTA 2K4AA 3MV7A 4Y19A 3EBIA 4JG1H 2QHRL 5JA9A 4IBVA 2RCSL 1BD2D 5T1DL 1FORL 2E5EA 3WFDH 3DX8A 3P3RA 4P5KB 4ZW6A 4N0RA 5IWLC 2R0ZL 5KEZA 1U8KB 2J6EA 2J8OA 1KB5B 1G94A 4YHLH 5DJZB 2Y23A 1ZA3B 1NMCB 2WLNA 3NEXA 3TFKD 1T03L 3L3IA 4K2UL 4QOKD 4ZUSB 2CBPA 3ZX1A 1FVCA 1GY1A 2DWXA 4CVZB 5G2NA 2WMPA 3IGUA 5AKSA 5DFAA 5DMGD 1MDTA 1AJ7L 3EW3B 3WJMA 5D1ZB 12E8L 4WU5A 1Q38A 2WW8A 4PRIA 2IWGA 2P8MB 5EIVA 5JDSB 7FABL 2Z34A 1LEGB 4APQD 4W9FC 1T6WA 1IT9H 2UY7A 2VLJD 2VLRB 4GAAA 3RWHB 2PW1A 4DCQA 2ZSVA 4N5UA 3VQ2C 3ILEA 4QI3A 4WHDA 3TZVA 4M5ZH 2P26A 2PF6A 4I3SH 2Y07H 3I9GH 4ZOCA 3ATDA 1CQYA 4WDIB 4KH9A 3PPEA 5IQLA 4RETB 2RQEA 1FQ9C 3H85A 3ZUCA 5JOPE 4KKCC 4WUKH 4MJHA 4ZDHA 3QZWG 4GKLA 5FHAL 3SPHA 1TLMA 5GS0C 5EF2A 4EVNA 4PGDA 3V6FB 4HPHA 4APQC 5DK0A 4QRPB 3SN6N 3BSZH 4ONGH 2BPBA 3REWB 1EXHA 4Y9BA 1J5CA 1HXKA 3NUKA 3BRGC 2IPKB 3LD8C 3THMH 1E4KC 3ROOB 3DETC 5KBPA 2LVEA 4H1LH 2ZX9A 4WFHD 4IOSD 3NCWA 1ILSA 5C0AE 4L4JA 2BNUB 2FUQA 1R3LB 2OSLB 3O2DA 4DP2X 4JVPA 4FFWD 2XWBA 5I6KA 2BWDA 2CO1A 4Z7VA 4Y4HA 1KYOK 3D3VD 2XV3A 3LNIA 2XTJB 1X5HA 2IANA 2X6CA 4IS6B 3HBGA 4GKOA 2FJHB 4K0OA 2XWBB 4HU8A 1SPDA 2PPCA 1MCJA 2PXYD 4PIRF 5D6CA 3L5JA 4KUZH 3HKFA 2VDPL 4NLHA 4AQOA 2NY2D 3O41A 1UA3A 2UYLA 2IAMA 3E1F1 1H8SA 1E27A 2IALA 4OGXH 5I9QB 3SGJA 4JFTA 1DBBL 2ZOLA 2CXGA 2ZUWA 4XNYL 1D3CA 4MFHA 4NUJA 2Z9TA 4LL4A 1W16A 2YAHA 1CD9B 3UTTB 1BJ8A 4G11A 2YGQA 5CR1A 4U3SB 1CE6A 5HHPA 3LY6A 2DIBA 4ONGL 1UM6H 4X5LA 5D7JC 2IBZY 2VDKL 5JHDE 2CGYA 2Q3XA 2VLMD 4JPQA 1NCUA 3RWJB 1S3RA 2WN2A 2IQ9L 2F7OA 4OLXL 1SOSA 3FCSB 4BFOA 3VD5A 2GAZB 2CO4A 3ECVA 1OARH 4NKIL 3ESUF 3BUQA 4Q97A 2JK5B 4EDWL 1MCWM 3LVEA 5INDA 3DIFB 4GMSH 3U79A 4OAWA 4RRPG 5C0CB 3M1BA 2VR6A 3MRQB 2ZAHA 5J6HB 3HC4H 5BRPA 3OX8B 2DWDB 2GSMB 2K7QA 2NYYD 1EPFA 2OL3L 4R4BB 3ZDWA 4FGMA 3JWNE 4GG8B 3ZDXE 2FX9L 1VACA 3UTSA 1OF0A 2CM6A 1GJIA 3LKPA 3VXRE 5EEXA 1FAKT 4IKNA 4WTQA 1VGEH 2EADA 3TU6A 1DVXA 1DVQA 3DX7B 4JO1L 1UM6L 5DQ9A 3NQIA 4EUPB 4QTIH 3LKPB 4UTBA 3BN9D 3OR6B 2HN7B 4KRPC 1HEZA 4YHYB 2DS4A 2XRAH 5C2BL 3H9SE 2Z6FA 4OF6A 1BHGA 5DR5L 4CU8A 3BAIA 1NLDH 2CBTA 1CWVA 4OCYH 2A74A 3P9WB 1XH2A 2NNAB 1H0DA 4XNUL 5EOTA 4G8FA 2WLKA 4AIOA 5E2VL 4JJOA 2EVIA 5AKRA 4AYSA 1MHEA 1NMAL 4GRMA 2ZX8A 5C2UB 1JGUL 3S4SB 2FYYB 1MHHA 1FCGA 3SDCC 2IG2H 2IH3B 2VXQA 2WBXA 3FU7B 3UYPA 3VXQB 4PB0L 2R1XB 5KWYC 4KNTA 4RVBA 1ACCA 1QBAA 3KPSE 2DQTH 1BQRA 1VPOH 2D7QA 1E3ZA 2E9BA 5I73B 3PNRB 1TZHA 4MMXA 3IJEB 3SKUD 1A6VH 4U3SA 5JHMA 5G4NA 3KYAA 3EJCA 4WO4C 3CZGA 3M46A 5CD3B 3K6DA 1S7TA 2F1BA 2Y2WA 5BQ7A 5FUOL 2D4DA 1L6ZA 1IGMH 4GG6F 2NY0D 4WSKA 4JKKA 1URIA 1LVEA 3CLFL 3DA0A 4PFEA 4BFEA 5FGBA 1ZE3C 4HHAA 4LPXA 3WNIA 4G5ZL 1MCOL 3BP4B 1FUNA 4PTUB 2LQRA 3HFMH 3Q5OA 1ZLUK 1HT6A 3RDTB 4WY7H 1CXIA 1Z9OA 2JCWA 1BEXA 1S7SA 4IS6A 4OJDH 5B1JC 5FDWB 1OV8A 1SQ2N 5MEQA 1WWCA 2KQMA 1IAKA 5LGJA 3I6GA 1KJVA 5PCYA 3REVB 1YY9C 3L2NA 1EQWA 1S5IH 4Y19B 5ISZA 5J56B 1CLVA 3MZGB 4TVUA 4RWYL 5GRVL 4CADB 2IXQA 3DJTA 3SE3C 4FZEL 3QS2A 2G2NA 5GS0L 4LB8A 2HA1A 3BN3B 4LCIL 1FZKA 1TJGH 2RFXB 3TJEL 2NY1C 1A6TB 2XY1A 1QWNA 4UV7L 1UADC 4N8VB 1FLRL 4OZIF 3KWXA 3NFNA 4NRZB 1GGYA 4QRSB 2V3DA 4QTIL 1MCPH 1C8QA 1YEEL 2ZE0A 4PREB 4N8VG 1NAMA 1NDGB 1E9QB 4W4NA 5DUML 1VESA 2L7JA 3EJRA 4G8FB 1MAKA 3DECA 4IGBB 5C08A 1KIRB 1WO2A 2EP6A 2QTVA 4IK7A 4HUUA 5E56A 4EIUA 3VXRD 2YR3A 4F8LA 1AQ8A 1NLDL 2CBMA 4TLUA 5LWYL 3I6KB 4POUB 1KOAA 4WWKA 1KXQA 1QFUH 2ARJA 3O8XC 5KW9L 2O5YL 2Z31B 4MA8L 1PKQB 4BKSC 5EUOB 1XCXA 1I7UB 3F7YA 1M1XA 15C8L 4X6DA 3T0AA 3KLHC 3PCYA 4JANA 2WWOA 2A6IA 3LMJL 1M9SA 5I19H 1E2WA 1KV3A 1Q1JH 4HZLB 1BZ9B 5EU3B 1MNUH 1KBGH 4YL9A 1XL4A 2Y07L 5E2VH 5SWQA 2WVVA 1Q9OA 1RPQA 1QR4A 1MELA 2H8PB 3FSVA 4X98A 5DMJB 5ABAA 5IQ7H 1DDTA 3VM7A 3FAWA 3W0WD 3MLYH 4NBXB 2YXFA 3CLEH 4HWBH 4AC4A 4DOHB 1JBJA 1WAAF 4HWUA 5CMAB 4D0CA 3J2PA 3WFEL 2AQ1A 4HHAB 4M4RA 1BVKA 4NFBA 1AHWB 3U2SB 2EEBA 4J6RL 4AL8C 4CDHA 4IDJH 2QSCL 4BIKA 3O2DL 2N56A 4Z7WF 3CNKA 3M8OH 2DAVA 5ANHA 3PWPB 5I1IL 2EYSA 4AVHA 3OKEB 2OJ1A 1EEQA 3CDZA 4IIQC 3IPFA 2B4CH 2JTDA 2IOMA 1LO0L 5HTSA 5HHQA 3MLWH 2YPVA 4KHXH 4RQQA 3KYOB 4PJEE 5AW1B 2HKFH 4UMSA 3MBEA 5EWIL 4TQIA 4K7PX 4P9HC 1SF3A 4V1DB 2VL5A 2ALWA 2EC8A 3DSNA 3NFPB 3P4NB 4HPYH 3DX4A 3EYQD 5C0AB 4Z77A 2Q9OA 4LSTL 4EZMA 4WV1A 3TTYA 4KVCH 3VMPA 1BQSA 2P80A 4OD3L 3Q8BA 1FLRH 4XC3H 1JYWA 2B15A 5CEYA 3CZLA 5FGCE 3AADB 4FI7A 4I18C 2BY3A 2D7PA 4PW4A 2NY3D 4PJHA 3U82B 4URKA 4FQ2H 1NC2A 4NQSB 4HJTA 3KXFE 3RL1A 3ULUF 2OI9B 4NBYB 3TBTB 3RTLA 3TA3C 4E9SA 1LD9A 4I85A 4OT1L 1TT6A 3HE6A 4KK5C 5IMLA 4KK8D 2HN7A 3FRUB 5FFLA 1WYJA 4V2BA 1ZHNB 2GYSA 3GXPA 5AZ2H 1NBYB 3D9AH 4Y4FB 1NJ9B 1NKOA 3QHFL 3KPRE 1NDTA 3LN5B 1TTUA 3PGFL 2CJUL 4AK1A 2JJSA 1CL7H 5B1KA 1WLHA 4BKTC 3OAUH 3WN5C 2CPUA 3ME0A 4N0UB 4B7IA 2VSCA 4LSTH 3IXTA 2Y7NA 3DIFA 3FC8A 2R83A 3DVGA 2H3KA 2JK5A 1RU9H 3LS4L 3TT1H 5DUJA 32C2A 1RUKH 4WEBH 5T3XL 4BHUA 2CQVA 1DBKH 2J44A 3GS7A 5DEZA 4A6YL 5F0MB 4BFRA 1OM3H 2IBGA 4PJHF 1JZ5A 1T03H 1IGFH 4RFEB 3T0XA 2NNXA 3V0WH 3VE0B 4U6YA 5BOJA 1RK0A 5FOBA 5MEPB 4U1GB 4YO0A 2X05A 4TVSa 4YHOL 5ELIA 2BVOB 2NX5E 5F7KC 1OAXH 2YAOA 3PWPA 5GSVA 3D3VE 5ECJE 5GZND 3FTUA 3SPVB 2NY1B 1KIQA 2CJUH 2AGJH 5TTRA 4OGYH 1F58L 3KWTA 3BO8B 5SWZB 3MNVA 1AD9B 1IKNC 5EWIH 3TJHC 3HRPA 3BE1L 4V1DD 5E2UH 4OF0A 2OXHB 2JJWA 4HIQA 4S1QL 5D5ME 1HK6A 4GAGH 1HE7A 5SX4H 4JPWH 3ZTJH 5JNYA 4HGMA 3MA7B 1RU9L 3TT1L 1HZLA 2P47B 3ASOB 5IBTL 3CG8A 3IF1B 3OZ9H 1CLZL 2CJTA 1P4BL 1A14L 1MZYA 1TZHB 3C5SA 3DX8B 1N70A 1UWEL 3OL2A 5MEOA 2AXJA 1JPEA 4UQBA 2CLVB 3AY4C 4WRLA 4I87A 1UJ3C 1YUKB 2R69A 3MR9B 4CBZA 3JBG7 3WS3A 5AW7B 1B6UA 5EHFA 1I9JL 5T1MB 2BSEA 4NUGL 4NKQB 4KVCL 5LNGA 3L6FB 1OGAA 2EE9A 1OTUD 4Q9QH 5DFVD 5ICZA 4D7PA 1UKTA 3VQ1C 3W0WB 4HKJB 4LAJH 1IGTB 4P2RB 1M53A 5C08B 2CKBA 3KAAA 3LB6C 4JVWA 3EYUL 4LP8A 4MCYA 5K9QG 3T1FA 5JHLL 1RERA 4E9TA 3MNDA 3WNNA 2F58H 4NWTL 4O51A 1EAPA 1SXSA 2UZYA 1QKZL 4G43A 4RH4A 2WWNA 1PLBA 4FXGA 5DQDH 3UTPE 1P5UA 5AEAA 3JQOB 4ZMXA 4UZSA 1PEZA 2DEYX 2J5LB 4NP9A 5EEZA 1T1YB 1PKOA 2RTTA 1U93A 1OAZH 1BSIA 3B6SB 5EZJA 4GXFA 2E8ZA 4N2BA 4BEIA 4RMRA 3ULVF 2OMWA 2BSRB 5I8OH 5DJAB 2DQUL 1HH9B 3ESNA 3LPFA 4JZNA 2W0PA 1T0MA 4UIMA 3ARDA 2R2BB 5DZJA 3UZEC 4ZFZA 1HHJB 3S6CA 5F7EH 1EDYA 3CU7A 1HH9A 1RI8A 5D1QA 4UU9B 5ICXA 3RZWA 2IWKA 5AW4B 5IB4B 4ZUTB 3IGLA 5FYLE 4U1MA 1SN2A 1XT5A 4KPHH 2KHAA 5JPMA 2ENPA 4A55A 4BYHA 4G9FB 2VR9A 1UFGA 3GMOA 4GJTB 3TX4A 1CR9L 4AV0A 1E6OH 2PABA 4MA7L 4G7YH 3WO4B 1SOQA 1ESOA 1MCBA 1HE8A 4FQQA 4MZ2A 2NNCA 1KJ2A 1JPGA 4U6TA 4AZ8B 2G3XA 4GP8B 3BT2L 3P1VA 2EDEA 1OE2A 2NXZC 4QXTA 1YEKH 2WQ8A 3D51A 1A2YB 1MHHB 1OGAB 5I76A 1BEYH 3QCTH 3P9MB 2GG1A 4WI6A 5DGQA 1S7QA 3O2WL 4MAYA 2ZPKH 4RGND 5KVEL 2X6BA 3B9AA 1SEQH 4H8VA 3MRCA 2CDGA 3L48A 2WQRA 1MW3A 3BVVA 4NDMB 5I1KH 1MCRA 3IAQA 3TF4A 5J6SA 4EOWL 1E5BA 1QSFE 1EWHA 3G08B 3VWKA 4ZFOA 4OF8A 1GMEA 4Y7OC 2F5BH 1NEUA 1Y6MR 4WI7A 3SYPA 2HPOA 4PWGA 4JJ5B 4HV8A 4H0IA 3QIWB 3S3JA 5JR1H 2H2PD 2B08A 3B7UX 1F13A 4YDIL 4P4KB 3GC3A 1JRHI 1CYXA 2B7DT 5FC9A 1IAIM 2LOEA 1NMAH 1QD0A 3X3GH 4A7VA 3U7AA 1CT8B 1RMFH 1N26A 3MLVL 4NNPL 4WCYL 1J48A 1GGUA 4QRTA 2FX7H 3C2AL 5J1SC 3IDJB 3G5YA 3UZVB 2FB4H 2GJ6B 3IETA 4TSBL 4JRXB 1BQHG 3QORD 4RDQF 3MU3A 4JZNB 4YBQC 2QR0A 2G9KA 1YLBB 3JTBA 1JZ3A 1U8IA 4PJGE 5H8DA 3QK0A 2GK0B 4LGRB 1OOWA 4PRNB 4PI2A 3IDGB 1WGOA 3F01A 1NBZB 4HS6B 4J4PA 3SE4C 3TFKC 4BFJA 4AITA 2BSTA 3EGXB 4LEOB 1Z9LA 2NUPB 3D25A 1NEZG 2UX6A 3QDMA 4PV9A 5IK3A 3HN8A 5EULV