1XTPA

Structural analysis of leishmania major lmaj004091aaa, a sam-dependent methyltransferase of the duf858/pfam05891 family
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
246
Chain Sequence
GPGSMPRNLPISGRDTNGKTYRSTDEMWKAELTGDLYDPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAGMPVGKFILASMETATLPPNTYDLIVIQWTAIYLTDADFVKFFKHCQQALTPNGYIFFKENCSDRFLVDKEDSSLTRSDIHYKRLFNESGVRVVKEAFQEEWPTDLFPLKMYALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LMAJ004091AAA
publication title Structural Analysis of Leishmania major LMAJ004091AAA
rcsb
source organism Leishmania major
molecule tags Structural genomics, transferase
total genus 83
structure length 246
sequence length 254
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05891 Methyltransf_PK AdoMet dependent proline di-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xtpA01
4QTTB 3L8DA 3BWYA 5E9WA 3GWZA 5FHRA 4FT4A 4CXMA 3KR1A 3DMGA 2OXTA 3T7TA 2VDVE 1NW6A 5IH3A 3FUWA 4EQZA 5K0JA 1SVUA 3DH0A 2XVAA 3EVBA 1KXZA 3HCCA 3KQWA 4AZSA 1KPGA 2PSSA 2ZSUA 2YTZA 3OE4A 3FPFA 1KIAA 1WY7A 1O9GA 2PWYA 4PYQA 1QANA 1RJDA 3OCJA 4R8RA 1O9HA 1AV6A 3DXYA 2NP6A 2P41A 2NP7A 3PTAA 4GC9A 3SSNA 3CGGA 4ZTBA 2EJTA 1RI5A 5K03A 5P8WA 3PFGA 4AZWA 3CBGA 5E1MA 10MHA 4P7GA 4FGZA 1RJFA 4C05A 4C06A 3AXSA 2QRVA 1KYWA 4GOLD 1JQ3A 3DMHA 4V0RA 5T64A 2AOXA 4KDRA 4PYLA 3T7SA 4OQDA 3TM4A 3HCDA 3P2KA 4C4AA 1FP1D 2BR3A 4FZVA 2OZVA 2WA2A 3AXTA 3NVKI 5CUQA 2IPXA 3P9CA 4U7TB 2UYCA 5FWDA 4EVIA 5ICCA 1JR4A 3EEYA 5D1HA 2PBFA 1NBIA 5T6BA 3G5LA 3M33A 2QM3A 1HMYA 4X61A 4E2YA 4YV0A 3M6VA 9MHTA 4P7KA 4UOEA 1FBNA 1JG3A 1JSZA 1KHHA 2PX8A 3EVGA 2VS1A 3BZBA 3FUUA 3PX2A 2JHPA 4H0NA 3THRA 2LD4A 2Z6UA 1XJ5A 2O05A 2A14A 3OZSA 1SKMA 4GEKA 3MHTA 2UYHA 3TR6A 4OQEA 3G8AA 2FK7A 3C3PA 5EKUA 3EPPA 3VSEA 5DTQA 1I9GA 2O06A 3OFJA 5EHIA 2H11A 3KQQA 3WSTA 2ONYA 3MGGA 7MHTA 3ID6C 3DOUA 5G02A 2CKDA 3V8VA 4C08A 1XCLA 5GIPE 1R74A 4R05A 3UFBA 2IDKA 2XYVA 2ZLBA 2EJUA 3G2QA 4PCLA 3LGAA 3HTXA 4AUKA 4MWZA 1M0EA 5BXYA 4RV9A 2AOUA 3B3JA 4KW7A 4C07A 2AN5A 4ISCA 3CJRA 3Q87B 4G56A 3H2BA 1G38A 4PYIA 1ZQ9A 3R9XB 4QTUB 4ER0A 3FTCA 3NMUF 5HZMA 5DX8A 5ICFA 5K0NA 2ZIEA 3LPMA 3PB3A 1L1EA 5FA8A 3FYCA 4BLUA 3EEOA 2UZ4A 5EIFA 2IIPA 3KQYA 2ZBPA 4HGYA 4R8SA 3KQPA 3G89A 4E2ZA 2P3QA 2B78A 1R8XA 2EG5A 2QYOA 5LQRA 3LCUA 3GIWA 4M38A 4RTOA 3JWJA 3GRVA 5CVEA 1WS6A 4RVDA 3KU1A 3HVKA 2O57A 5HFJA 3IEIA 1RI1A 2PV0A 3KPVA 4M7RA 2ESRA 3A7DA 1WXWA 3K6RA 2ZIFA 2JH8A 2ZFUA 2PXXA 3FPEA 4PIMA 1I1NA 4WVLA 5EHGA 5LQNA 4YV2A 3OE5A 4KWCA 2JHAA 1M6EX 2EX4A 3TPZA 2NXCA 3OU2A 1G8AA 4IWNA 1JQEA 3S68A 2OYRA 2WK1A 4E32A 2FYTA 1G8SA 5EOVA 3GRYA 4X41A 2AOTA 5C0OE 5ICGA 5LQJA 5KQSA 1IXKA 4X1OA 3DXZA 4PINA 3TFWA 1R8YA 3E7PA 2VZ9A 3FPJA 3P9IA 1BC5A 5IKMA 1DCTA 2IDJA 4OBWA 3EVCA 2PJDA 2NXJA 3FUTA 3PFHA 5EPEA 3UJ7A 1R6AA 4RSRA 3UWPA 1FPQA 2VDUE 3NDJA 1EG2A 1HNNA 3OPNA 5CM2Z 3LDGA 4F86A 3QOXA 1P1CA 3I64A 3ORHA 2NNWB 2GH1A 5DT2A 4DQ0A 3EMBA 2IBSA 5CCXA 4MQ4A 3RIEA 4CKBA 3B7PA 2YXEA 2JJQA 4KRGA 4CTJA 3CKKA 1X1DA 5HILA 2AR0A 1VE3A 2PX5A 3SSMA 2E5WA 2IGTA 1G60A 5LQUA 5EEHA 2GLUA 4BLWA 3M6UA 3TQSA 3UJCA 3Q7EA 2FCAA 3LL7A 4L7VA 1NT2A 4DMGA 4DZRA 4MHTA 3AJDA 1UFKA 1QAQA 1XDSA 2NXEA 1OR8A 1P39A 3C0KA 5DTRA 1KPIA 3OZTA 2FHPA 5EVJA 3UJBA 1YZ3A 2QY6A 3HNRA 2AVNA 3B5IA 3KR9A 3A26A 3FTEA 4IKPA 1QZZA 3MB5A 2G1PA 2OPBA 1M6YA 5FTWA 3U81A 4RTPA 1INLA 4RTQA 2AOWA 3O7WA 2YXLA 3GDHA 3E8SA 4R6XA 3FYDA 1QAMA 3R24A 4RTJA 1UWVA 4X60A 2AOTB 3LKZA 4XUCA 4DF3A 4RTMA 3ANXA 3EVDA 3R6TA 5CVJA 4PWYA 2P3LA 1AF7A 1ZGJA 2OB2A 3P71T 4DCGA 4E2XA 5C1IA 3P9KA 3CJQA 3PX3A 4EMSA 5HIMA 5C9ZA 4GF5A 2GB4A 2ZWVA 3G7UA 4XUDA 3KQSA 3HP7A 3MCZA 4QPPA 1X1AA 3FUXA 4FS8A 5E8RA 3LBFA 4LG1A 3LCCA 3MQ2A 1SUSA 1JTEA 3ELUA 3FZGA 1YF3A 3JWHA 1NKVA 4GOMD 4O29A 1JTFA 4YUYA 5LQCA 2WA1A 2Y1WA 3HCEA 3HEMA 2K4MA 1NW3A 2HV9A 4QVKA 5EG5A 5DX0A 1ORIA 3DP7A 3IV6A 2PT6A 2ONZA 1YFLA 2R6ZA 5B1SA 3ELDA 1TW3A 4GQBA 4EKIA 5LQAA 3MCTA 5JUWA 1WG8A 3O4FA 5ERGB 3BGDA 4HTFA 2VP3A 3EVFA 5FHQA 5K0FA 2N47A 4K6MA 5FQNA 2I9KA 1ZGAA 1PJZA 2ZVJA 3OU7A 4F84A 4GOND 2G70A 4GUAA 1KYZA 3T7RA 1XDZA 1ORHA 5F2OA 3KR2A 3FPHA 3P2IA 3UJ6A 1JSXA 2ZULA 2IH4A 3TLJA 2GAFA 4RTKA 2GS9A 3BGIA 2ADMA 4PCAA 3P2EA 3G88A 4YUWA 4GOOD 4KIFA 1Q0SA 1SUIA 4BP3A 4P58A 2C7PA 2XBMA 1PRYA 1KPHA 3QOWA 1WXXA 2PGXA 3GGDA 5GOZA 2JHCA 3RW9A 3GU3A 4A6EA 1L3CA 1SQFA 3CVOA 4B17A 3REOA 5M5BA 3BT7A 1XXLA 3G8BA 4RYLA 2PT9A 3C3YA 3NW9A 5EKXA 1V39A 4YUVA 1YB2A 3MTEA 5CD1A 1EIZA 4OX9Y 5D1NA 4HG2A 3B3GA 5MHTA 4U7PB 2OKCA 1NBHA 4PYMA 3UBTA 3RODA 3KPWA 2ZIGA 3C6MA 2YUIA 2HTEA 1L3IA 3M70A 2IBTA 5DM2A 3LCVB 3EVEA 4FR0A 5E9JA 4CKEA 2OO3A 3A25A 5E2AA 4DA4A 1NV9A 5DX1A 5FWAA 2HR1A 4PYOA 3HM2A 1SG9A 5BW4A 5GIOE 1N7IA 1AQJA 2OBFA 5KS2A 1DL5A 1NW5A 1XVAA 2I7CA 5FA5A 1YFJA 3IYLW 2UYOA 5DRTA 3T0IA 2VDWA 2IP2A 3LBYA 2CWWA 4BY9E 2BH2A 3KHKA 2UYQA 4HTFB 4C03A 5DSTA 3CCFA 2DULA 1P1BA 3OZRA 5K01A 1R00A 2P3OA 4KIGA 4NECA 2EFJA 3EGEA 3M4XA 4EKGA 1T43A 3EVZA 2PXAA 2P8JA 3X0DA 3QV2A 4YMGA 1R18A 5CVUA 2P7HA 2G8NA 3GCZA 3AWIA 3HCBA 4FT2A 1MHTA 1RJGA 5DSXA 2G71A 1JQDA 4HGZA 2P1DA 5H02A 1NV8A 5FCDA 4YMHA 3I53A 4OA8A 3OFKA 2I6GA 3LECA 1P91A 3KR0A 3E23A 5E2BA 2ORED 1Q0TA 2AS0A 8MHTA 3GO4A 3LX6A 5E1BA 2ZCJA 3VC1A 1JG2A 2DPMA 2IH5A 4RTRA 3TKAA 3KPYA 3UJAA 1ZHFA 5DM0A 1B42A 3FUVA 3NTVA 2NYUA 4LWOA 1XDUA 3A27A 5K0LA 1N7JA 3LHDA 4GC5A 2Z6AA 3VC2A 5HIJA 3LKDA 5CVVA 3TRKA 4E70A 4IV0A 4ATNA 2ERCA 4YV1A 3ER9A 3TM5A 3B3FA 5JR3A 1G6Q1 3GXOA 3NWBA 3P97A 3ELWA 1NW7A 3DLCA 3FRHA 5EEGA 3GRZA 1D2CA 4R6WA 3P9NA 1N2XA 2PX4A 4DM3A 4ER3A 3BKWA 4IV8A 4X63A 2JH9A 3JWGA 3PT9A 1I4WA 4DKJA 2R3SA 3HA3A 4QQNA 3HA5A 5DM4A 3MAGA 3NJRA 4Y2HA 5LSAA 2AZTA 3R0QA 2ZTHA 3BXOA 1XTPA 3GNLA 3CJTA 3ERCA 5E1DA 4PGHA 4PYNA 4WXHA 2BR5A 1UIRA 2O07A 3LDUA 2B2CA 2BM9A 4M37A 5EQJB 4BP1A 2BR4A 5HEKA 4XCXA 2ZZNA 5K0GA 1VIDA 3G2MA 4LWPA 1FJXA 2YXDA 1RJEA 2Y1XA 3BGVA 4Z2YA 2ZWAA 2OY0A 2CL5A 2HNKA 3NVMB 5E8JA 1NE2A 4CTKA 1FP2A 3AY0A 3G5TA 3A7EA 3GJYA 4OBXA 4CWAA 1VQ1A 3GRRA 1QYRA 1XCJA 2PKWA 4FSDA 3E05A 3G2PA 1VBFA 4RVHA 3I58A 4RTLA 3EGVA 2GPYA 4E2WA 2YR0A 2P40A 4A6DA 2O0LA 3I9FA 2BZGA 5T67A 3TMAA 2KW5A 1O54A 2V7EA 3O31A 5HOQA 4HC4A 1WZNA 3HVIA 5EGSA 1ZG3A 4HH4A 3A4TA 1L3BA 4PYKA 1AQIA 1TW2A 3DR5A 5DLYA 1X19A 4ER5A 5K0CA 1BKYA 3ER8A 3SX0A 3GRUA 1X1CA 4FP9A 2PVCA 4LECA 2ZBQA 3UA4A 5K8VA 4RTSA 5EMMA 3ELYA 1EAMA 2V74B 5DWQA 3M6WA 1Y8CA 3UZUA 5EMLA 1YUBA 2CMHA 5GM1A 1IM8A 5DPMA 4C04A 4PGGA 5LR6A 1JG1A 1D2HA 3TOSA 3SM3A 4V0QA 2Q41A 5E9QA 3HVHA 1KP9A 5BP7A 2PX2A 2P35A 5F2NA 2BM8A 4MTLA 3PLAE 1SQGA 3K0BA 1DUSA 3BKXA 3C6KA 4QPNA 1RI3A 3KPUA 2FK8A 5EIWA 3FTDA 5FULA 3KKZA 4BLVA 2FPOA 2H1RA 5EZSA 3SGLA 4JXJA 1NW8A 3NDIA 5EC8A 1BOOA 5E1OA 4RWZA 5CVDA 4Y30A 4FSXA 2FRXA 3UA3A 4EK9A 2AVDA 3DUWA 2OB1A 3I5UA 4GBED 5KVAA 1KR5A 5U4XA 1D2GA 3SVZA 3KQMA 3UJ8A 3EGIA 5K09A 5CIYA 3DXXA 5GM2A 2H00A 4QDKA 5KYGA 3MTIA 3NWEA 4RVGA 2ZZKA 2HMYB 1VLMA 5DTMA 2XVMA 4QDJA 4QQKA 5DM1A 1VP3A 2CMGA 2F8LA 3FRIA 3M6XA 4ER7A 3LDFA 4PIPA 1VP9A 4PYJA 5BW5A 2QRVB 4HSGA 3FPGA 2I62A 1RI4A 3UJ9A 3V97A 4PNEA 4YUXA 2XYRA 5CCBA 3EVAA 5FADA 1EQAA 2C7OA 1U2ZA 5HIIA 4RX1A 3B89A 1H1DA 1MJFA 2P7IA 2B9EA 2QE6A 4E33A 4E30A 1X1BA 3UJDA 1IY9A 3VYWA 1QAOA 1VL5A 1EJ0A 2YX1A 1Z3CA 4KVZA 4DCMA 5K05A 2JG3A 5F2KA 3BWMA 1JG4A 5EMJA 3F4KA 3HVJA 3SMQA 5GWXA 3DTNA 3KPJA 1F38A 3D2LA 5EZQA 3ME5A 3DLIA 4AZVA 1BHJA 3DMFA 3THSA 4AZTA 3FTFA 2IH2A 2ZBRA 2ZZMA 1F3LA 1VPTA 4HRAA 5GP1A 3SSOA 2GA9A 3MERA 4E31A 3SXJA 2PWPA 3OU6A 4OA5A 5K0BA 4P7JA 1ZKDA 2AOVA 2B25A 4KDCA 1EJ6A 2PLWA 3EMDA 3KQOA 3SR4A 4YUZA 3P8ZA 4XUEA 3KQVA 4POOA 3BWBA 3PS9A 5FQOA 3JWIA 5HIKA 2Z6QA 2XYQA 2C7RA 2NXNA 5LQKA 3R3HA 2ZW9A 4AX8A 4QVGA 5DXAA 1YZHA 2C7QA 2AN3A 2IFTA 4MIKA 4ER6A 2PXCA 5ICEA 1TPYA 4M36A 4RTNA 2AOUB 3KQTA 3LSTA 3BUSA 5DRYA 4PONA 3G2OA 2G72A 5FUBA 1L9KA 2B3TA 3HA7A 3PVCA 5GINE 3IHTA 3DULA 3CC8A 4F85A 4RVFA 5KQRA 2AN4A 3BWCA 5K0EA 3HCAA 1RI2A 4P7FA 5DXJA 2YVLA 4CKCA 2HWKA 3TKYA 3HCFA 2YQZA 5EMKA 2PY6A 1G55A
chains in the Genus database with same CATH superfamily
3VKVA 3MSXA 2BFBA 3QLTA 2A5GA 3EE6A 4PICA 5LYYA 3WGUA 1WV0A 2AYYA 2QJRA 3AV3A 3T7TA 1P8AA 1NW6A 1UBGA 2X0KA 1K5DA 4X3PA 1M10A 3DH0A 4Y9UA 4DIUA 1X1RA 2XODA 4Q3AA 3ZD6A 2L18A 2EFEB 2GERA 421PA 5ED4A 3P52A 4JT9A 2ENWA 1NNI1 3NHFA 1YNSA 2HRBA 1Y6RA 1SK8A 2GWHA 4OOEA 5IAKA 1DJNA 4WIAA 2B6HA 3MUNA 3O8QA 1S96A 3PTAA 5JFGA 2ERXA 1SG6A 3M9LA 2ONKA 3K9NA 4E51A 3HUDA 1R0ZA 1U8EA 1UQUA 3PNLA 2CF5A 4MWSA 1RC0A 4LOKA 3JVVA 4NMLA 1X8LA 2BJWA 3PFWO 2B4YA 3GGCA 1P4AA 4IG9A 3RSQA 3HACA 3WK6A 2WJYA 1CJBA 4UBNA 5FPSA 2NSHA 5SY9A 5KYYB 4UU1A 3DHYA 2FZCA 1KAMA 2JKVA 5KYTA 1YJBA 2FF7A 1W52X 2R5WA 4P84A 1ODKA 1U9CA 5HGXA 1IN6A 3PNSA 3E70C 1ZK2A 3KNZA 4IHQA 5G3ZA 2GT1A 3RROA 3G2IA 4F97A 1TE2A 2DT5A 2GILA 4J75A 1L5FA 4E2YA 1C3JA 4K9MA 5CDSA 1CB0A 3ADDA 4BRSA 3RWOA 1UBOS 4AY3A 5ALWA 1FFXB 1KHHA 2EQBA 3FUUA 1Z7YA 5FOSA 3PX2A 5LMUB 1ZS9A 3Q9NA 4QU8A 4BRUA 3N59A 1E79A 3RS5A 4HAZA 4ZYZA 3ZVNA 3MPUA 4KQIA 3RUEA 1Q0ZA 1L5NA 3L8CA 4MXDA 3ZIAA 3U5TA 1RLTA 4BWYA 1JPNA 1R6DA 4I4TB 5EJGA 5IVHA 2ZJ8A 1P31A 4NMWA 2G9NA 3RS7A 1CUAA 4HFJA 2WD8A 1KRWA 5EXXA 3ZS9A 1KAHA 4MVJG 3TNJA 1XEXB 5CTAA 4Q4HA 4FD3A 3URKA 4ESEA 3PC6A 4K9SA 2CKDA 2FXVA 3UY4A 1Z2AA 3N74A 3UFBA 1X8KA 4QGGA 2WSBA 1FLAA 2P4UA 3S5UA 3LGAA 2G82A 1W5EA 2V7UA 3RVMA 4KB5A 1Z7EA 3RYTC 1WEHA 3O5AA 5AESA 3QEAZ 1P0MA 1G6OA 2KLBA 4D81A 3N2KA 2WP8J 2W83A 1BS9A 4G56A 4FSHA 1YRLA 2ZUFA 4K28A 3BBLA 4YPOA 4Z49A 2WSSD 3KETA 1P0FA 3R7BA 1YRHA 3OZGA 1QB7A 4TQUS 2PKRA 4WLEA 4G5YA 4EUEA 3I1IA 1KGDA 4WJKB 2EWMA 5AJTA 3VR5A 5I8ZA 3QVJA 4B3FX 3NJ4A 3PXEA 4ZGBA 2HSDA 4ZC1A 1MVOA 4TX1A 2QAGC 3U3ZA 1S0UA 3D6NB 3G9ZA 1CX9B 2QYOA 5HQJA 1T1GA 2WTXA 3ESBA 4Y0NA 3VC7A 4ZCLA 3KVNA 2IBMA 5KWJA 4U9HS 3E84A 2Y05A 3EFOB 4JVOA 4KR3A 1CJCA 1WDTA 1MHPA 2O8CA 2ZSKA 1LRKA 1E60A 1QHGA 4ALNA 2WWYA 3TNLA 4F72A 2PXXA 5IC5A 4C6RA 3U0BA 4OV6B 4I46A 5CJ2A 1FIUA 2ZAIA 2DTXA 1ZM2A 2IHKA 3D1LA 4OXYA 4PZCA 2PGLA 2ZJAA 1R7RA 1Q1EA 3ZN2A 2C7BA 2X5OA 4P86A 4BVBA 4EX6A 2B4RO 1E2MA 2HI0A 2MSLA 3EIFA 1FFWA 5TLSA 4RCYA 1YBAA 1JQBA 3C3EA 4W8HA 3R9WA 3ZY4A 2XTZA 2Z83A 1FP7A 5AICA 4OJTA 2ZCUA 1S2IA 4ZI7A 1GTVA 1P17A 1TT5A 4K2HA 1KSGA 4JX8A 1PWEA 1G8YA 3I1YA 5D3QA 5IASA 1NTOA 3A36A 3EXAA 3HI4A 3ILYA 4QYTA 5D00A 3WB0A 4KR9A 4Q4CA 4HWPA 3REFA 1T4MA 2AJCA 4IDEA 3H4VA 5B4VA 1J1ZA 2CDNA 2FPGA 3V4PB 2F3UA 4HAVA 3R23A 2GH1A 2I7XA 2IPNA 1PKEA 1V5FA 2RMKA 4Q4AB 3DMYA 3MTQA 1EHIA 2QDXA 4G41A 2QMZA 4YDRA 3ZE6A 1ZJ5A 1XCPA 4IJVA 2FMHA 4CUZA 1O5OA 4P35A 5IUJC 2GD0A 2GPJA 2Q8PA 3VYTB 4EBFA 4QEKA 1JSCA 4S1TA 1AIPA 1YGPA 2BE9A 4G1CA 4MVYA 2JFXA 4BXOA 1WUIS 1KI3A 4JI4B 1WKBA 2QUBA 2ZT8A 3NZEA 4NZMA 5CX1A 2H7YA 2FWIA 3AOEC 4PPGA 3NV7A 5KNDH 1DJLA 5IABA 1HTTA 5F73A 2H17A 1IC6A 3BCUA 5HF8A 3SM9A 2YBEA 1YZ3A 3ZU6A 1MX1A 2WWGA 1PTJC 3WDKA 4NZZA 1F12A 3TQHA 4OIMA 3WKAA 4G8JA 1YQTA 2ZAYA 3ESXA 3MMPA 4FGWA 4H4CA 2VBCA 1UBFA 2WYUA 2FUG1 4PGFA 2XBLA 2ZB8A 4RXTA 4N6NA 2R7LA 1V9CA 3ND6A 3VR4A 1HZJA 1NUQA 2XQJA 1QJ4A 4JBWA 4KQGA 4BYGA 5DT9A 4HDMA 4D8UA 1SQSA 5G40A 5C46F 1HX7A 2F9FA 1AF7A 1IXSB 4DCGA 2BHNA 2PK3A 4P3NA 5F78A 5I7VA 3FLMA 4JXKA 3DGFC 3IQHX 4FQ7A 4JROA 3NH6A 2UVPA 4XVCA 1EVQA 4KK3A 1Z38A 3H2ZA 4QPPA 5IJAA 4E13A 4BRWA 1IEQA 4CHGA 4WOBA 5CXXA 2FSVC 5JDIA 3K70B 1V95A 4X24A 4X8LA 5FUQA 3B1ZA 3IQFA 1SHUX 2I67A 1GUYA 2WD7A 1MGPA 3MBIA 2CXNA 4LZPA 4OKNA 1NW3A 2ZDQA 3E61A 1N5IA 4QVKA 4RK6A 3A28A 3AYXB 2AXNA 4QX6A 3T3IA 3WB9A 3MWDA 1GTZA 3OWXA 4KQEA 5L6MB 3ITEA 2EP5A 4HAUA 3SIWA 2CDRA 2HREA 3DWGA 2WZBA 4XH9B 1M2HA 4XPIA 3U9LA 5LP6A 4GWLA 4O4LB 1IOZA 1OAAA 3G7NA 3TBKA 5A4DA 2CCKA 2PYZA 2HF7A 1AGYA 2QQ0A 2Q9UA 2UUOA 2VT6A 2W98A 3G2LA 4GMKA 5BRAA 4BP9A 5LXTB 4NCBA 3GQBA 1JFVA 1RQNA 2BI7A 5E7IA 2AG6A 2CT8A 4JC0A 3P2IA 3P0FA 3E4DA 1WW3A 2C4UA 4MYDA 4ZVNA 5HDQA 4MINA 1SCDA 5BORA 3OZCA 1AT1A 5FLYA 4YUWA 1V6SA 4RGBA 5BVHA 4EPXA 4TUYA 4WOKA 2SECE 3F6YA 3W06A 3W8FA 4FYJA 1WXXA 1KQFA 4M0DA 4HYEA 1ONPA 3BL6A 5GOZA 1XP5A 3V6LA 2V6BA 3RTEA 2RGXA 3V2GA 4ZTUB 4Y1RB 4UNPA 4JJKA 4ZOLF 1W4BA 1P2BA 1KMIY 4D25A 1FNCA 3WMRA 2F1IA 2V45A 1T36B 4KXMA 5FBQB 3SZOA 3V42A 2W2MA 3ISJA 3NP9A 2HK9A 1KEVA 2E49A 2O48X 4RZQA 1P2DA 5C5EA 4R2IA 2YS7A 2OKCA 2CLOB 3LX8A 5LBTA 4RLQA 1ISIA 2E85A 3EOBI 5AVYA 1S2GA 5FUWA 1QKJA 3H2KA 1C0EA 3A25A 2WKQA 1N2OA 3HM2A 1SUAA 4JN6B 3T3GA 4D79A 4D42A 3QE0A 3LRTA 4TXNA 4W99A 2GPNA 3D4NA 4KX3A 4M2LA 3MD9A 3SJ7A 4O4IF 3RUHA 4WN9A 3UMMA 4KR6A 1NUSA 2WAXA 8OHMA 3EXHB 1KP3A 2H85A 4MA4A 1D1QA 3M4XA 4PG6A 3ROZA 3BL8A 3VDNB 5A3RA 4XQ0A 1T43A 1KVSA 2ORYA 1NQ5A 2VBIA 4HBGA 1GQ2A 1SBCA 2NU7B 1GGHA 2A0KA 1ZIXA 3OX3A 5A2QA 3A1EA 1QK5A 4TV9A 5D3ZA 4HGZA 2P1DA 4Y1GA 1OWPA 2VUSA 5KSWB 1MJ5A 4BP8A 1LWOA 3KR0A 1SXQA 1OJLA 3ZK9A 2WKWA 5CA0F 1IIBA 2PDAA 3OAAA 3KFLA 4QDXA 4TMXA 2X8AA 4CG1A 4DIBA 1N0UA 3HQ4O 3F47A 4RS4A 5EQDA 3K0SA 1WWKA 2DPMA 2EFDB 3C8UA 3T9CA 5E3JA 3NPAA 3UV3A 2PR7A 2PRYA 4DM7A 2ZVPX 1C7RA 1DX6A 3B9BA 3M6FA 3IUJA 2VHYA 3IB3A 1SR8A 4WA7A 4GC5A 4GZ3A 3OPMA 4FFVA 2O2SA 4L5IA 4OREX 4MR9B 3VFDA 2V4MA 4DILA 4DSUA 5KINB 3A8TA 4NQZA 4RD3A 3U3OA 3AR7A 5JR3A 1G6Q1 1YS9A 3C4QA 1WO8A 2HLDA 2IEGA 3O2NA 5CU7A 2XMQA 1RPNA 3V4ZA 1A2KC 3F2IA 4ZQCB 4P34A 1Z6PA 4PG7A 5DO9A 1PJ3A 2QG6A 2I0FA 3HJTA 2QZSA 3NX4A 4G5RA 1H6BA 3UF0A 2JK1A 5IK2A 1YWGO 3I9OA 3WGYA 2X3UA 3U26A 3R0QA 4KMRA 2J46A 3QOYA 1XTPA 3VZCA 5KWSA 5C51B 3ERCA 2QL9A 1EHYA 3UENA 2UU9B 4UVGA 1KQOA 2YYZA 1PVVA 3OZ7A 1JDSA 1ZO8A 3A3PA 4TLEA 5EA2A 5HEKA 2BHRA 2PD3A 3ASUA 4LK2A 4PAQA 1NXOA 1H65A 2BFFB 3IVXA 1RJEA 3MJSA 3QEJA 2GTPA 4CYMA 1TUIA 3HZZA 1F5NA 4G25A 4QTZA 3VAZA 2PNFA 3BYZA 3PE6A 2WW8A 3P26A 4G4JA 4HVTA 3UC5A 5C8ZA 4YIHA 5I9LA 4LRWA 1MH1A 1P74A 1VQ1A 3GRRA 3PQFA 1GZUA 3ZUGA 4DBLC 1MZPA 4K6CA 4TSRA 3D7MA 2JRLA 1J2UA 1TO6A 4DG9A 1SCNE 4BJ5A 3BICA 5JBNA 4W82A 3HRIA 3IDOA 1NDHA 1ZVJA 2H6EA 4XYMA 5HZHA 1JDZA 2XYGA 3A4TA 3IOCA 1JHXA 3LVRE 3BEOA 5BQ5A 2CDCA 2HAEA 3NEJA 3ZV5A 1BH2A 4JBGA 2VNSA 1ZXLA 3FJ1A 2YJ5A 5L45A 4KQCA 5KTSA 1NW4A 4TKVA 2HW8A 4IXMA 1E7RA 1H2AS 1JR3E 3ELYA 2JGDA 1AHNA 3A9RA 4NZNA 1D4FA 2X14A 4E11A 1QG6A 3TZLA 2QQ5A 2ZUTA 4IIBA 2GETA 1IM8A 1K8QA 2B9VA 1Z5GA 1IHYA 2QG4A 1T13A 1NXTA 2ZG6A 3O6VA 2ZSBA 1EVKA 1WVMA 4OHMA 4L78A 2WOOA 4DNFA 4WCDA 3HDJA 4ZAGA 3PLAE 1DUSA 1TD9A 3BKXA 3C6KA 4G9BA 4N5NA 1HT2E 4JP5A 5C8YB 2O8NA 1CVLA 1Q7RA 2WBLC 3KTAA 1N4AA 4LSWA 4DLXA 2W4MA 4JXJA 1NW8A 3T3PB 2ZB3A 4OQQA 3FNRA 5B3JC 3T1YB 1QV6A 1IN7A 1FJGB 1ZUHA 3R75A 1PGQA 4RW0A 4JXZA 1PJCA 1T3LA 3EZ2A 4EZEA 4RVUA 5B4TA 1NFFA 1PGPA 3K9BA 3QI2A 2EL7A 5ALFA 1P9OA 1YQUA 3OD5A 4RLSA 5EWJB 3UAYA 3PHIA 3L40A 2ISQA 2DUMA 2PCLA 3FMFA 1K92A 3Q0EA 1CFZA 1SOVA 4NZPA 4BVKA 3MTIA 5HOEA 2IZOA 1CF2O 3IMCA 2Y92A 1VP3A 4IMPA 5EIBC 4U6QA 4BNMA 5KNCA 1GGKA 1U5BB 2AFRA 2FB9A 3BMCA 3LDFA 3OHSX 3GOQA 2C83A 3JARB 4B34A 1W44A 3M9XA 5DNUA 2XB8A 2RK6A 4F2GA 5AJUA 4BV8A 2C9CA 5MFPA 5MGNA 5HGJA 1SOMA 1T29A 2D59A 2D62A 2D5BA 3NHSA 4O0LA 5DV9A 5IRCD 4BO7A 3T9EA 3LXUX 3PUKA 1P4GA 2ANBA 1PAUA 3RS0A 2FR1A 2LDXA 2R5NA 3UJDA 1T3GA 3ENWA 4XM2A 3U17A 5K05A 5L3QA 4W7SA 3E48A 4DV6B 4ZT7A 2CV0A 3VNAA 4GP9A 4NBRA 1M9NA 3FSRA 4P8RA 1A95A 2I65A 2HLHA 4XIJA 4Z1MD 1H0SA 3EEQA 3A6PC 2NZ2A 3KAPA 4HRVA 1CCWA 1UH5A 2IU3A 4FM9A 1JHUA 1XCBA 1ZU4A 4D4JA 3GAAA 1QUEA 3WLAA 3L7NA 3WL3A 2FN7A 2I1LA 2NW6A 3FVVA 4P2BA 4PTYA 4S24A 3N5CA 1YKFA 4PR0A 4Y2UA 3ENVA 3ZEIA 4KJZA 1JZTA 5C4IA 5J4LA 2R68A 2X9LA 2GCGA 4L15A 4BE4A 4D8YA 4W5QA 3ZJVA 3NTOA 3FHTA 4IL5A 2VQEB 5KNBD 2I2WA 1EFCA 1JHMA 2H0RA 1WNTA 3I6QA 1JIKA 3PP8A 4QVGA 5DNYB 1U8TA 2YNMC 1H3FA 2AF3C 1WETA 4KQ1A 2GAIA 5I3ZA 4BX0A 3LVBA 1FMTA 2BM0A 3FBTA 2QE7D 4DARA 4I1OA 2EKPA 3EUFA 3CVUA 2CNNA 2VAMA 2ZUSA 4Y1FA 5JWOA 4CLOB 1ZNZA 1B2LA 2LTAA 3IHWA 1T34A 1XX6A 4EENA 2BGRA 1I2AA 2V9PA 4K5QA 1TNDA 5K3CA 4N0DA 3PWZA 2QUHA 1E63A 1Y37A 5F7OA 1TCUA 3DGEC 3VHQA 1XD2A 4CTNA 4LFBB 1KOJA 4I2NA 4QTTB 3QNMA 3N8KA 2ODEA 3ECSA 4QXPA 1RPJA 2O3QA 1UAAA 1O95D 3OOJA 3UMBA 4RJLA 4HDRB 3W5SA 3TLKA 4PLHA 1PE0A 2OR3A 4P5EA 1E9EA 4MYRA 1PYDA 3UMFA 5JDCA 1QE0A 1LC0A 4HEA6 1FS4A 1L7RA 2NO1A 1AMNA 1KIAA 1S2MA 2Q3HA 5B3AA 1O9GA 2GSDA 2IQ5A 2IZ0A 4F38A 2KBEA 4GI5A 3WAKA 1LJLA 2OCYC 3C1OA 1P7CA 3DOJA 4GPAA 4DLSA 5AW2A 2SKDA 4AJLA 4Z6KA 3WRYA 4Z2AA 3V7UA 1E9RA 1OBVA 2ZJYA 2GCNA 1PFVA 3EDOA 2P65A 3MGAA 4HWRA 5TQVA 1T0PA 3D3WA 2O2IA 3MTDA 1KRXA 3KIPA 4F2PA 4WL0A 3AXSA 2QW0X 4HX9A 4TVBA 4KO1S 4V0RA 1JQ3A 2WM3A 1KOFA 1N2CE 4KLAA 3DLAA 4C0QC 1XZHA 4GICA 1KBZA 1NBAA 2IOQA 4PZLA 3RSZA 1U9JA 3QLUC 3AI2A 2Q5HA 4QTXA 2ILVA 1NRIA 1AKTA 4MHOA 3TSAA 1N2BA 4TKMA 3T3NA 5ETJA 3BMNA 4XIFA 3LA6A 4TTSA 3LTEA 3Q1KA 3W5CA 2D7JA 1FJ2A 1SCKA 4OK6A 3ZK7A 3M2TA 4HPWA 1H8HD 1C50A 2X2EA 2PIDA 4L3WA 5K8JB 5JS6A 1IK4A 4LBZA 2EFYA 4AXXA 2OGZA 4A8TA 4AY2A 4XLLA 3ZR4B 1U4SA 5KX5F 1SUWA 2IU6A 4H0CA 1JEEA 1JEYB 3GV0A 1MIOB 4YAOA 1EKXA 2NZXA 3BE5A 3BF7A 5BV2P 4CF7A 1I01A 2VJMB 3ROTA 1F4PA 5C52B 1EB8A 2W6ZA 5KUTA 1YI1A 5HE9A 4E5MA 2CL0X 3O75A 4MWBA 5JRJA 1U2PA 2JGLA 2DHEA 2YN0A 4F1JA 5LD2B 1RD4A 3ROFA 1RMYA 2JEYA 4R9VA 1CUIA 4K9NA 5GIPE 1F5SA 4WJZA 2PSEA 2YC4C 2YW2A 2XCIA 1N5JA 1F2UB 3TRDA 3ZE0B 4DCNA 1AUQA 4MS1A 4N01A 4IJKA 4L4SA 2BTEA 4O2LA 1BDJA 3AH8A 2DP4E 4YP9A 4K26A 4KXLA 3RPEA 3ZJTA 3AZPA 1Z06A 5FEUA 4DLAA 4P5DA 4RL6A 3AVPA 2FGJA 3D3JA 4RHYA 1GPUA 2JLZA 2HMAA 1ZVKA 1L2TA 4QUAA 3RLFA 3WLSA 1K6MA 3IQDB 5L3SA 2ZIEA 1YGYA 3ZHZA 3AR5A 1ISSA 1MAHA 4LI0A 4J3NA 4BMYA 3DDCA 1SEPA 1TVKB 1OREA 3S2FA 1W88A 3KQPA 1PX2A 1UMCB 4FUQA 4HO1X 5FI3A 3FZQA 1AQNA 1MRSA 1R8XA 1ULTA 4Z5XA 4O4JF 1MZVA 1L4BA 5CHEA 1EX1A 1P1IA 2O9JA 3Q8LA 1UXIA 1ZONA 4EATA 2E1PA 1FNSA 3MFYA 1SXJA 4NMXB 1DIGA 4KPFC 1ZNQO 3DNMA 5BMVF 4DIDA 4R1SA 2FG5A 1WXWA 4I9GA 4IO1A 5KAMA 3FPEA 2G0AA 4E5YA 2VQ6A 4YV2A 2SKCA 1M6EX 1HYQA 1RWBA 4TLDA 4JITA 1T0BA 4W7HA 3GCGA 3R4VA 5DHUA 4YXFA 3LI2A 3L6RA 2GAJA 3S68A 3CEAA 1JGTA 1RTKA 1CQXA 1EXVA 4TMZA 3ICOA 1ZRHA 3AY7A 3DZDA 1BOFA 1P2VA 4BKOA 1QK4A 4L9RA 2XV1A 4RQTA 1LEHA 5ALHA 2A9RA 4KBGA 3T4PA 3TRHA 5GONA 3UOGA 4Y6OA 1X0XA 3B3QA 1K06A 3FFAA 4M1YA 3HDGA 3UGQA 2Q1XA 4V03A 2WFMA 4KJXA 5LLTA 3NDJA 4KQ2A 4MB0A 3VSAA 5EE0A 4K1LA 3WFZA 5F3WB 4A5SA 1L5MA 2NTEA 2B4AA 1KMCA 1ADJA 4L3OA 1IXZA 2VYQA 1GNPA 4C78A 1WMAA 3GRPA 4JBIA 5JFTA 1NF2A 4KTVE 4N3BA 5HILA 3SSMA 5I4BA 1KI2A 1VRWA 3QH4A 3BQ9A 1U5AA 4Q47A 4R1TA 1MKYA 1QRDA 4R2JA 3WBBA 4CMAA 3IBSA 2R79A 3HCNA 5NLLA 3A6FA 1HNZB 2DBZA 4IEIA 4F7WA 2J9ZB 5HF9A 3M34A 2JFOA 4RESA 4MLZA 1M5TA 1HSOA 2XITA 3CTPA 4JYZA 2PUDA 3NVAA 1BS2A 1GG9A 1NXPA 2XE8A 4Q00A 3RI3A 4B4OA 1C8LA 5KYKA 2I54A 5C37A 1PKXA 1TTQB 4FHGA 2CVFA 3JPWA 3R3JA 4ZDWA 1NF9A 3RS3A 4X60A 1IHPA 2AOTB 3WO0A 4QD3A 4URHA 4ACAA 3LKZA 1CYDA 4S1PA 4KCGA 1OXMA 4PWYA 1NBOA 5C7YA 2NTYC 1WUKS 1QF7A 4X6YA 4B82A 2OZLB 3VNRA 1ZGCA 1D6MA 1F2VA 2W2KB 3LXMA 4JQCA 2QMOA 3Q2OA 2W90A 1OLUA 3FUXA 2YIDA 1RKXA 3MQ2A 4I3HA 4BFSA 5DHQA 3CX6A 4WCVA 1R0KA 1TCBA 3BFXA 3JWHA 4LV6A 1GP2A 1UOPA 1FDSA 2WA1A 3RR2A 1GA4A 3EAFA 2E48A 2EJBA 3ENKA 4CMIA 2YL2A 1LBIA 1Z37A 4CKBB 4DNQA 1LZKA 4O33A 5D87A 5ADHA 1RP7A 2X8JB 3GYBA 2FQ1A 2QLFA 1WG8A 5ERGB 1E7MA 4C3UA 2D54A 5KQMA 4JFAA 4NFSA 1KI6B 1DV1A 1HEYA 4N49A 4B6JA 3A06A 3OU7A 2WJPA 4RD0A 3TNDA 5EFZA 4II3A 5CB4A 3SY8A 2J9RA 2AEJA 3O47A 4Q7LA 2HHHB 2HQOA 4BPRA 2JAPA 3QMPA 4JSRA 4NZYA 2IX9A 3C45A 2H51A 2VK8A 3ZLUA 2GS9A 3BGIA 3JAKB 3MINB 3T4XA 4C4TA 2ET6A 3WFIA 4WWHA 4OAPA 4ESVA 3ZDAA 2B35A 1P77A 4MIOA 2UZIR 3WBFA 4ZEXA 4PIVA 3WQRA 3ZW9A 5E7MA 1BNCA 2IZ1A 2OXIA 1FFDA 2WNSA 1MO5A 5ARBA 4LF8B 1O03A 2EFHB 2JHCA 1E1YA 3FFTA 4OLHA 1PW5A 3IIMA 3TNFA 3U44B 1ZBQA 3U7JA 3ZBTA 1F2TB 4MTCA 1QO0D 2WIKA 4HDKA 3QQ5A 2OMKA 4J7CA 2DQZA 3ZZUA 1ID8A 4EYKA 3CS3A 4ZDKA 5HUJA 1NNSA 4FDAA 3OEEA 5HA5A 1U1EA 1F20A 3PDIB 4M87A 3L0ZA 1OE0A 2C2KA 3LC0A 3W8EA 4PRKA 4KR0A 3ZLJA 1L4LA 3TD2A 3JCZA 7ADHA 3D7LA 4G97A 3NORA 1A5BB 3G8DA 4PYOA 3K4HA 1TI7A 2HSJA 5T5QA 4EI7A 1VRCA 2GXUA 5I8WA 4LCEA 4QKQA 3LKVA 2PX3A 2ZYHA 4FMDB 4DOMA 2HPHA 4ZI7F 1II0A 1GGFA 2YV5A 5FTMA 3WTCA 4ASUA 2PUHA 1OBFO 1CLEA 1RCFA 2X1HA 1P1BA 3LS2A 4K9KA 4AROA 2YWJA 5GV8A 1E5TA 1MA3A 3GBSA 4KIUA 4OMUA 3X0DA 2F90A 1VMIA 1CKEA 3RFTA 2LW7A 2JAXA 1K63A 3IHLA 4LYFA 4N0MA 4XVQA 3PQ2A 5E3IA 5B58T 3U3JA 3WK8A 2Q4OA 3ZI4A 2NOAA 3SI7A 3QJYA 4GRIA 3BREA 3NC1C 4MUEA 3IDAA 5HCIA 3QVWA 1P91A 4UMEA 5E2BA 2HBQA 4DPLA 1OX4A 3JVUA 4FLMA 5GGYA 1C9EA 4M6WB 1OA1A 3D1JA 5HPYB 3VPXA 3W8RA 2OA0A 4BNIA 5GADl 3B9QA 4C1NA 1XVLA 3ETDA 3TTXA 1D7OA 2MT9A 2Y77A 4YMLA 4ZA2A 1M34B 2P9HA 5FD8A 4WZAB 2OT3B 2HCFA 1U2QA 4J4BA 4OM8A 3RHZA 5TX7A 3AF0A 2DHDA 3UUGA 2Q28A 4R1NA 4AMBA 1FDUA 4ALIA 4KV9A 1DWUA 4YVFA 7GPBA 2Q27A 3GXOA 1J0EA 5BQXA 3ELWA 2SCUA 4WZZA 4QDOA 4AICA 4BLPA 4MRAA 1WCXA 4K8RB 2SICE 3WGOA 1RXSA 4QDUA 3W5JA 1XHEA 1N2XA 4JOSA 1BGWA 1I0LA 2JH9A 3E7XA 3RYHA 3HBMA 1YTUA 1ACJA 3B2QA 3AILA 121PA 1QOQB 2RHCA 4LJ8A 1E0AA 3KYJB 3HO8A 5D85A 3L8EA 5IZCA 2R9VA 4J6EA 3ZYCA 1X38A 1G3QA 4MKHA 3GNLA 2DWUA 1FVOA 2B94A 1GU0A 3E18A 3KOWA 3QE4A 5F76A 4A6XA 4KYIB 3TB6A 2ZZNA 2YOGA 2R7AA 1U4OA 4Z2YA 2A9OA 3BS4A 1GZHB 1WB4A 2Z57A 2ZYGA 2YFQA 4H35A 4H6VA 4BNGA 4KRFA 4MWGA 2CHQA 4ZQBA 2P2ZA 2IP1A 3EGVA 1E1LA 2O2ZA 1BCSB 4DIEA 4Y6PA 3CTMA 3ROQA 4OQLA 1LU9A 4EB8A 3MWYW 4H1HA 4RKFA 4Z8YA 1L8OA 3AQIA 2F3TA 3M82A 1MV5A 2EJCA 3R5KA 4G23A 4RVOA 3W6ZA 2C3MA 3H7AA 3V8RA 1H2ZA 2Y0DA 3CSUA 4B71A 3KJIA 1TLTA 4TUYF 3UT5B 4KWIA 1ZR4A 2QY9A 4LECA 3T15A 1E2PA 1QMGA 2YDYA 3VMFA 2CXUA 2RK3A 5EMMA 4TLMB 5A4KA 3IAXA 4KE9A 1W2HA 3WRWA 5I9NA 4I66A 1UM8A 4BBAA 3GB9A 3P2OA 4ITVA 5T4BA 3WYEA 2DR2A 1ECJA 2W6JD 3KYBA 3LQYA 4IR7A 4KUEA 3TEMA 2VTKA 3TOSA 2P35A 2QU7A 4PXAA 4BC0A 2FMXA 1ZWKA 5K0TA 1NBEA 1QG4A 1Y9JA 1QLJA 1XQ1A 3Q12A 3FTDA 1NQXA 3PUWA 1QORA 1IHDA 4NE7A 5C7IO 2NPIA 4IDPA 4D0GA 3FRJA 2PLFA 2W2LA 4D82A 4S04A 2GBPA 4EA9A 2E4UA 4R3UC 5C35A 5IUNC 3HCWA 4IDAA 4A0HA 1WCYA 3R3VA 5AO9A 2MR6A 3EGXA 3NTUA 4L3VA 4EW3A 4FR2A 3PNBA 3NASA 5D7NA 1SY7A 4K9DA 4DG5A 1BXRB 3VOAA 4RFSB 1BRTA 2JLXA 2JFFA 4RA6B 1CS0B 3OFNA 2A0UA 4B43A 4NFHA 2OFXA 3M2PA 4NG4A 1IUKA 4UM8B 3WE7A 3DVSX 1TO2E 2IYLD 3DZCA 2TMKA 3FROA 3H3XA 3ZQ6A 4QUHA 2ZIXA 4GXNA 1QFSA 5E6RB 5AH0A 1OF1A 3CN9A 3LNTA 1OBHA 3HZRA 1RYHA 1WOMA 2I62A 3V97A 4AECA 2WICA 1JFRA 2XYRA 3NHRA 5CCBA 2VSOA 3RYIB 4REQB 4CQMB 1IBCA 1QIFA 5FPKA 2HMVA 2HJHA 4E30A 1VDMA 4LXHA 4EJ2A 5ERXA 1R5JA 1FNDA 1S8AA 2VKTA 2I3AA 4BMDA 3N8IA 4PNPA 5KTYA 2QRZA 3UFXB 3G6WA 5EMJA 1TYEB 5AHRA 3ADCA 5A3JA 3OCXA 5CDFA 3HFJA 1F38A 4RVNA 5I51A 2HCJB 2X7JA 3ME5A 1BHJA 3FPCA 2LCQA 5FWYB 4QGHA 3I9KA 4HDAA 4ZOAA 4G0YA 4R1PA 4ZO6A 4P7JA 1R15A 5AJYA 1BJKA 2GRAA 2HDNB 3KDPA 3KTOA 4ZRMA 5EINA 2F4NA 2POCA 4CFYA 2R1ZA 3A4MA 2GAAA 3MWKA 3BILA 4S35A 1C7EA 3R3HA 3WLEA 1T0HB 3BAZA 5B64A 5CBKA 2YICA 2LVBA 1O5TA 2ZSAA 4XSVA 3KQHA 1JFSA 3KCNA 3WOHA 1ZIDA 2BTQA 1UP4A 2JEOA 2WINI 4ZV7A 4MRNA 1XTIA 3U48A 4D9IA 5C7LO 2UUCB 3GDOA 3LZ6A 3Q3HA 5DRYA 3RFXA 1JQLB 3A3NA 1Z16A 4HGRA 2OFOA 1PZNA 4KPUA 4B4UA 5HUHA 3LO8A 1RAHA 2Y9MB 3K72B 4F85A 4FMCB 2YQ5A 1WMSA 1FZQA 5LQSA 1Z6TA 4DXDA 2XWQA 3AUJB 3JD2A 1OWOA 4MULA 2VAXA 4U9UA 2PU7A 4PNZA 5JJ5A 1NKSA 3UV6A 4IHKA 4JCOA 3EMKA 4KGZA 4BQPA 4LDPA 4IVRA 2FFQA 2CYAA 3MJRA 4GM4A 3IAUA 1XKTA 2YV4A 1RWXA 5BW6B 4JIMA 4KI0A 4NONA 5TT1A 1XZIA 3RU7A 1IG3A 1V6AA 2IYWA 1P1JA 4M83A 5KTPA 4IIDA 1R5NA 2AN1A 1Y1SA 1U2GA 2LIPA 5CMLA 2ZKIA 3RTGA 3VR0A 3WJ7A 2XUDA 2XAUA 2UKDA 3MPOA 4YMSA 5JZOA 3FJYA 3A14A 4H16A 4I50F 3RF7A 1RJDA 2XKJE 5GPBA 4C7JA 1IOWA 1VRVA 2CZCA 3LIIA 4W5WA 2IEZA 1ND5A 4IDGA 4PVCA 1BIFA 4XDZA 5E1MA 4F71A 3G2JA 3QXHA 4AN0A 1KDRA 1MF7A 4LC1A 4P7GA 1SA0A 4OM7A 4R7TA 1RJFA 5HS6A 1C5KA 5WRFA 3SEZA 1XD8A 1G21A 3QUTA 1Q6YA 1KYQA 1T5HX 3PDUA 2BGKA 1MEEA 4O4HA 4Z0TA 3R76A 2CFTA 3N76A 2WFAA 4KNVA 2CFOA 4JVNA 4LF7B 3QVXA 2GDZA 1DTSA 1N9GA 4CQLA 1AG9A 3M5WA 3UAZA 2DR3A 1X9GA 1OI4A 2C9MA 5DGHA 1JI0A 1L5ZA 2G40A 2KWIA 2CLDX 2XGGA 1DBRA 2Q9CA 1HKUA 3COSA 2BMVA 2KE5A 3CPSA 4JZKA 4P7KA 3WXBA 3GLKA 4C14A 1BKDR 5H9VA 4GSKA 4GHWA 5TT0A 2BZ0A 4H0NA 2VS1A 4W9RA 2VWPA 4RIHA 5JDIC 2PWBA 2HIMA 2VDQB 4XTCS 2CYCA 3KKOA 1GLGA 2YH2A 4U2DA 3QF4A 1KH1A 2R60A 4DUGD 4KP7A 3VGPA 1D9XA 5YASA 3VSEA 2PG3A 2VHZA 2FN8A 3R3YA 4EAAA 3OFJA 3K73O 5ALOA 1XN1A 3ECAA 1GDTA 5LP6C 5DOZA 1T6XA 1XK7A 5EJ6A 2IV3A 2GARA 3H1AA 1S1CA 2OQ2A 3F78A 3FVQA 1VCHA 4K2AA 4PCLA 4BNTA 1S3GA 2QMUA 4WHMA 3EOZA 2QV7A 4IP0A 4RJKA 4FB4A 1SULA 2J9FA 4E15A 2O5EA 2Q46A 1OAKA 5JSZB 4IHJF 2PD6A 3BEDA 1SHTX 3GJ6A 2BEVA 3HL4A 3P9RA 4L4UA 3EBLA 3LVQE 2ICAA 5BUQA 1VE9A 3G9TA 3VJKA 3ORQA 1YZVA 1LV7A 2J3KA 2HA3A 2RGAA 3IMKA 4JOCA 5DX8A 2QBYA 2H7XA 4M1MA 3QJGA 2JI7A 3O3OB 5ICFA 5K0NA 2J5BA 1M76A 3TL3A 3O92A 3EIOA 4MKGA 2MSCB 4LN1A 3FYCA 3ZHXA 4BLUA 4KX5A 1GRQA 2GPWA 5MN5A 5EIFA 3J81A 3DNPA 2QRGA 5SZHB 2QORA 1V26A 1QX4A 1VKJA 3H8JA 5HKLA 2G07A 1Z13A 5LB2A 2VF2A 4NS4A 1L0BA 5K8LA 3DDWA 3EZ9A 2GD2A 4M38A 3TXYA 2AW5A 4GR5A 9LDBA 1U8AA 1QO9A 3T4EA 3KZNA 4ZWNA 3TTWA 2PYDA 4W5JA 1NG1A 2ESRA 5SZKB 4FX2A 4Q4JB 3VOTA 1Z6ZA 2BGMA 1XMPA 2O2YA 1WVIA 3GA5A 1V41E 4L9AA 1SC3A 4NCIA 1UR5A 1H05A 3EODA 5ICSA 2F43B 4I1VA 2DWQA 1JQEA 4LRYA 2ZUBA 4FDTA 3VKWA 1QFZA 1RWMA 1NFRA 3CZ4A 3MGCA 1YBFA 3OQJA 5TQ2B 4DZTA 4E1BA 2FWNA 3D5QA 3CINA 3PUHA 5ICGA 1O0SA 4QE3A 2DKNA 5FRDA 4UTRA 2AV6A 4X7MA 4AMGA 4BPBA 3CSDA 1IBRA 2R4UA 3AGPA 1RHQA 3RSLA 5KEIA 1TA4A 5DNDA 2C4TA 2DCMA 3PEFA 4F4FA 3G6KA 3E7DA 3CYFA 4KDFA 5HMLA 1RABA 3ZZMA 4GEGA 4Z0PA 4RSRA 1CP3A 2V59A 2ZRAA 1VZ2A 4M0PA 3GLIB 1IXYA 1V35A 1YR8A 3IUSA 2CLEB 2JFWA 2V6IA 1YOBA 1PLKA 5JAUA 5DNCA 3HJUA 1YQGA 2Y66A 2PPLA 4AT1A 4C4OA 2MMGA 4P4NA 4DLRA 3IJEB 2ZUUA 4MWCA 2Z3VA 3VMMA 4JBYA 3RSFA 1Q7EA 2OBNA 4MQ4A 2D1QA 3V6MA 4G0WA 1GNTA 2VWQA 4L27A 1CDEA 1VE1A 3CLHA 3ISVA 4EFLA 4HEJA 5KNBH 3K9LA 4YNBA 1GARA 4EB0A 3L6EA 4JQSA 1E4EA 1PZHA 4MGYR 3T7JA 2P67A 4E3ZA 1QQTA 2HSWA 3RWBA 3MHPA 3WJAA 2FHPA 1L7MA 1QLWA 1K9SA 2IELA 3RAPR 4AXBA 2RB5A 2P2LA 1IMJA 4BE9A 3QWFA 1ZP6A 1I1OA 2G1PA 1OLXB 5IYZF 3UPDA 3SOZA 2ENUA 2B0CA 2HU2A 2OORC 3KV1A 1INLA 1OIXA 4N39A 2R1VA 2VYND 5EZYA 1CEQA 2OYCA 4P31A 4UHJA 3D43A 4EY4A 1R4ZA 1JPUA 2O7RA 4N3GA 1QH8B 4C3ZA 3K1AA 3NOVA 16PKA 3EWIA 1H5QA 1L8QA 2VPPA 3C48A 4RMGA 3VDRA 4XUCA 1JKFA 4TTQA 3ANXA 4XQGA 4CM8A 1SQ0A 1HNXB 4H0FA 3TRFA 2SBTA 1P9WA 5EUMA 3BMOA 4D46A 2OK8A 3DQPA 3IGFA 2FPWA 2WTNA 2H4FA 2ZAGA 2D5AA 4WGGA 3C6XA 4RS3A 2HF8A 2D1RA 4WNIA 4CLEA 2BCEA 3ASZA 3DCNA 5LDGA 4HPJB 3UW3A 3VRHA 3ZJ4A 5JVDB 4TYPA 4NYMR 3KZXA 2W37A 3B2NA 3P5BA 4IQGA 3AR4A 1CY6A 2Y1WA 3PNMA 3TOZA 4KR2A 4EF6A 2QTRA 1U3VA 3UYKA 5IC4A 5DM70 3I5MA 3QFCA 3AF3A 4UCFA 4YJ3F 4G1EB 5K4GA 2R6ZA 5B1SA 5I9SA 3U7EB 1T4BA 4DR2B 1PD0A 2ZYWX 5JUWA 1B1AA 4LNAA 4YP5A 4DLYA 1XJQA 2N47A 4PCUA 5LOVB 2WIDA 2ZVDA 1BCRB 2HXSA 1W46A 1I2ZA 1Z56C 2FUCA 1HKHA 1NBMA 2H1WA 2A0XA 2WV7A 4II2A 1N3YA 2H2IA 1T5LA 2PX6A 2VF7A 3ZZNA 3SC3A 2AE2A 4EHFA 2M1XA 3GAMA 3B13B 4NICA 1NZFA 4C0AC 2DFVA 1XXHB 3O4RA 3Q15C 2X40A 4IF6A 4E5DA 2IY8A 3SR3A 5A7HA 3T5BA 2Y0EA 4IDQA 3ZY2A 4Y2SA 1VCOA 4D96A 4L85A 4XWOA 4CM4B 2PGXA 1ST2A 2QWXA 2NO0A 5LA6A 1W75A 2HCTA 3A2LA 3OQIA 1Q20A 3FOZA 5M5BA 1U8FO 5FI5A 2VUTA 3G8BA 4HWSA 3DFIA 3F73A 4P4SB 1GPJA 2GEKA 2XEDA 4M88A 3TR5A 2QSJA 3FSGD 3H11A 2RCNA 3R40A 5CGZA 2CUZA 4JXXA 4UFOA 4NNOA 1O8BA 3B3GA 5H68A 2W8BA 2AEMA 1Z5WA 1YNOA 4LX0A 4Y7DA 2PH7A 2NU8A 5TS2A 3WIUA 2CC2A 1CDOA 1BE8A 1U1DA 3EFHA 3F90A 3EPRA 1CRQA 2NTJA 2REQA 3ZCTA 4RY2A 1P6QA 2HA6A 3SLGA 4P38A 4NH4A 4NR0A 1B0UA 4LHXA 4Y2VA 1VJCA 5AT1A 1AQJA 3V4FA 3HU3A 3U6KA 2VNKA 1NQOA 2DX7A 4TN1A 1BJTA 2UYOA 2PNJA 1HYGA 2VO1A 3GZNA 3OQPA 4LRSB 1I0ZA 4HB3A 3SLRA 5J2UF 4UAJA 3U7IA 2H1OA 2XOEA 3VH1A 4QHSA 5GONF 2FN3A 5BNWA 1ISJA 4JKYA 1W48A 2WWWA 3GFRA 5AJZA 4TLAA 3KSMA 3PDCA 1EP3B 1J9GA 5A1JA 2C4VA 2IITA 5BOSB 4BX2A 2HRQA 1UUFA 1XDWA 1V5EA 4OYHA 9ATCA 3PWTA 3WGHA 3ROMA 4MUMA 4C4ZA 1ECLA 2N42A 1SOUA 3ZGLA 4CL2A 1NV8A 1N8NA 3EW9A 1SCQA 2BKAA 3I53A 2YWHA 4G4GA 4L2IB 4G5SA 2PBRA 2CK3D 1AUVA 1Y82A 4IIFA 3FHLA 4XA8A 1Q0TA 3F5FA 1K2WA 2I6UA 5IS2A 2Z9BA 6NULA 4LSZA 1ZRNA 2A8YA 4PSCA 5K45A 3R7SA 1XWFA 3WMGA 2MTBA 1AUXA 3PHLA 4AZ3A 3FUVA 1TKRA 2OFFA 4G8BA 1QFYA 1W87A 4MUYA 1T4DA 3LHFA 4J1TC 4QUBA 1TYAE 3OZEA 4LJLA 1ZOLA 4E70A 3MS7A 4IIJF 3O2JA 2QLLA 4GLFA 4F3CA 3OMWA 3E15A 3K0CC 5IP5A 4YT8A 5AUOB 4JLNA 4FHZA 1XT6A 4HWOA 4LJRA 4HNVA 1S5PA 3R3SA 1SZJG 4IEFB 1ESZA 1M6VA 2R6CA 2ATEA 2W00A 3DDSA 3H99A 1X6VA 5FL7A 1ZD2P 1D6NA 4M1ZA 5FB3A 5TF4A 3VBCA 2RGNC 1ISFA 3FNFA 2E89A 1SCIA 1DTWA 3V3TA 5U9CA 3NJRA 3W5BA 1Y5NA 1Q95A 4XB1A 1B43A 4ZRDA 3T7IA 3SNKA 4ENTA 2G5CA 3F8WA 2OESA 2ZKLA 1ZK0A 1YZUA 2EIXA 2VHUA 4IUBS 5KMGB 3PCRB 4UTXA 1L7OA 3EUWA 4MJLA 1NVUQ 1VMAA 1Y7LA 2ID4A 4INJA 2YXDA 3HU5A 5K0GA 5ALDA 1V7ZA 4K03A 1X7XB 2EZTA 3CM0A 2XMDA 4LXXA 2ZWAA 4HB0A 4EG0A 3IUYA 3ZV4A 3GA0A 2CNWD 4CWAA 1D6JA 5IPFA 5LBUA 3EZ6A 2IUSA 2PUJA 4FSDA 2MSEB 4GO1A 4DUYB 4RVHA 3RVSA 1EUQA 1R0YA 4O1IA 2FFJA 3MJEA 2X9NA 4F8YA 4K6GA 4F9EA 4QBKA 3W5DA 4DDVA 1KK1A 1RWVA 1V7CA 4MVJP 1TFUA 3IVGA 2VKQA 4P33A 4R68A 5EJIA 1GCIA 1XRQA 2FUG6 1G7RA 2JGNA 2RB4A 5TB5A 3D6HA 4NWIA 1EU1A 1U0RA 5CDTA 1MT0A 4V2UA 1XRSB 4B6GA 1L3BA 4L5AA 1OPRA 1YH3A 2H4WA 5DLYA 2P75A 2ABWA 2OZPA 1SVNA 4DL9A 5J59A 2AFHB 2Q2VA 1GAXA 1E66A 1OYVA 1BE6A 3I2KA 1NLUA 2JGRA 4L1KA 3SZ3A 3UA4A 4Q9DA 2V74B 2IHJA 1O6GA 2RH4A 2ZETA 1D2NA 5FKJA 4D4KA 3H1PA 2ZJ1A 4I1RA 5GM1A 4N47A 4PLZA 4CNBA 3HY4A 3PL5A 4PGGA 5ALUA 4LQDA 1TYBE 1QP8A 1D2HA 1G5TA 1WZUA 3CE9A 3WGJA 1UK6A 5BSMA 4X8MA 3UG7A 2CMDA 1GUAA 1P29A 1ML4A 1N0IA 1PWZA 1K6IA 2BOVA 4MTLA 2G6TA 2H9AA 4W63A 1W19A 1LA2A 2BFNA 2X8LA 3BK1A 4X7PA 1PVOA 4KOAA 1A4XA 1EM8A 5EIWA 1T9HA 3UPUA 2CNOA 2A92A 1QVVA 1VKOA 2W5UA 4RELA 4P2GA 5E1OA 4RWZA 4CLDA 2FRXA 4D4IA 1QVWA 2XUOA 2ZJBA 3L7IA 4PVDA 2H5JA 3K30A 5C18A 1PSDA 3W1VA 5F5LA 4Z8XA 2QL7A 2YFHA 2G7ZA 4QYIB 5L3RA 1NOJA 1AY0A 1G98A 1OXSC 2PZAA 1XB2A 2IXGA 4XYGA 3RS9A 3D6JA 2O8BA 1XRMA 3SJAA 2VQDA 5GM2A 5JADA 2JIBA 4LXGA 1W49A 4CT4B 2JJ2D 1BXKA 2C9BA 2JH3A 3BD6A 3DE6X 4ND2A 5F3RA 4ER7A 4TTTS 1G3IA 1PJ4A 3MTGA 1ZBDA 1EGAA 1LY1A 4RIFA 4YACA 3VYVA 1EWYA 2WU4A 5C3MA 1F1JA 2PMFA 3VNSA 3EUEA 4ACBA 4TYWA 3GVXA 4XQCA 5A5GA 1E61A 4DMKA 1JMVA 3AESB 1U2ZA 4YASA 4YRIA 3B89A 5M04A 2GZMA 1MABA 1MBZA 3GDWA 1KJYA 2DF8A 2EWVA 3IL2A 4DR4B 2XWSA 1J07A 3BMQB 5H3HA 2F1KA 3WRVA 3NBFA 2EW2A 3BQNB 5M29A 2RC6A 1FUIA 1PQWA 3NC0C 1N2SA 3NIFB 5DHFA 3D2LA 3UXEA 3JTEA 2XX3A 4IYRA 1CLUA 1SO8A 5LLDA 4MGHA 1AV7A 3KWMA 4M9CA 2J4DA 3PR1A 1DKLA 4I7EA 1TJ5A 1DMRA 3QVSA 1SXJC 2QN1A 1TQ4A 4PPFA 4OA5A 1HL7A 3QWHA 4BNLA 5JEDA 2B25A 1OTXA 4KDCA 3WWEA 4WNYA 2GF0A 2B8WA 3BWBA 4H77A 1RADA 5T4HA 4NAHA 1G20E 3I4LA 1QIHA 2JK0A 3VVMA 5KYYA 1AO3A 1DFHA 5BT9A 5HUQA 1QHIA 2OGTA 2VUHB 3RT9A 3MUEA 4OXXA 5FFNA 2TMDA 4WCFC 4XW2A 4AYXA 5B2FA 4OIFA 1VG9B 3S1AB 4D9BA 1MD9A 3LNCA 5AW7A 3D7NA 2B3TA 4Z7QB 1E69A 4TWAA 1LPNA 2AN4A 2BHTA 4HX2A 4UEQA 3RARA 2PKYX 4BV2A 1YRQA 1UXJA 5K0EA 5L95A 1FFXA 2PR2A 3B38A 5SY4A 5LZ4A 1P7PA 1UKAA 4G9GA 4A8PA 3EDMA 3KOZA 2R751 4H18A 2V3CC 3RC9A 2XZPA 4M4SA 2FW6A 2D0IA 4I4TA 5ALKA 3MF4A 1M0TA 1QTIA 1SVUA 4WERA 1YAHA 4Q3NA 4ZOLB 3FTNA 1GCGA 4A16A 4BIMA 5IYZA 4B6FA 5B12A 4KKVA 4WY5A 7ABPA 2C1ZA 1XEXA 2HGSA 4HZGA 3W6NA 1JPVA 3RT7A 1B3RA 1FYFA 4XM1A 4WK6A 2A9QA 4FTWA 2QYTA 1QANA 2WWTA 3DO6A 5BT8A 1PS0A 3DXYA 3AW9A 3GZ4A 1RLIA 2B83A 4FFDA 4HD8A 4UE3S 5GMOA 2CDBA 3GGGA 4XSGA 2IT1A 2GJ8A 3ZCSA 2OQRA 2QN9A 3IURA 3LH5A 4L4XA 10MHA 3D31A 4FGZA 5EYPA 4RF2A 4LRXA 4BN5A 2P27A 1OXXK 3G7SA 3W04A 3COVA 1DAFA 4FFPA 4FXOA 5CVVA 2QX6A 3P9SA 4O4IB 5I7FA 2F55A 1JYSA 1L5HB 3IDQA 3JQGB 2QXTA 1I6WA 4L57A 4RQBA 3DAOA 4CGZA 1QH1B 3HNOA 2EQ5A 5BN4B 3I12A 1CSEE 3O4GA 2A5JA 4B5LA 4H2DA 5IT0A 1PS9A 4UHEA 1FBNA 3OJOA 3N7UA 2AMYA 4OQFA 1WX1A 1FVFA 2C4KA 3EVGA 1QYWA 5CPBA 5K4HA 1D1PA 3EFOA 2CXPA 3MWEB 3NM6B 2Q2QA 3GDGA 4NYIR 2Z1MA 4IH4A 3E22B 3RC3A 1LPAB 2CVZA 3B6ZA 2R0QC 4FONA 2RGGA 3BH6A 5CA0B 2PUVA 3MWFA 3R5TA 5CIWA 2J59A 2VNHA 5A06A 2X4LA 3W4KA 1UKYA 5ENVA 3NBAA 5EHIA 3C5HA 4M55A 1NDUA 5BYBA 3D8UA 5BPHA 1M8PA 1ZUD1 1NJ6A 1DEKA 1BX3A 5K3FB 3PSAA 1V5WA 1XCLA 4HNSA 4KQ9A 4PSVA 1V11A 1Y0BA 3WNVA 1NVDA 1HDXA 1QE3A 3MS2A 4ENUA 2CLHB 3OCVA 4MWZA 2XNDD 3IXQA 4XVUA 1NN5A 1Q92A 4CZ2A 1YO6A 4O1HA 1CJVC 3U5ZB 2D4HA 1ZSNA 4WEQA 3JQ7B 1RWQA 1L1RA 4G5OA 4A7PA 5BWOA 4RZIA 3N3BC 1EQ2A 2FJ0A 4N9QA 2OFWA 4XLTA 3PGJA 2FWBA 1IIRA 3LQRA 4MAAA 3R7NA 1NM5C 4Q4AA 4L51A 1Z0FA 2P79A 3LCRA 4KAXA 1ZYUA 4MWTA 4JOBA 2XB9A 4Q6BA 1NW9B 1Q1QA 3RGGA 3OJFA 3AUSA 2EOAA 1QZXA 1XMIA 2ZBPA 4C2AA 4WOJA 4R0MA 4OHKA 4Z4QA 3G89A 3H5LA 3IPCA 2HEGA 4Q3CA 5JNVA 3NWPA 2QTAA 1W4LA 3QEKA 4IMJB 3LCUA 1SIUA 3GRVA 3Q7SA 5CVEA 5A4IS 2IPMA 5FH9A 1AQ6A 2DT8A 1RLUA 3M8KA 4DY4A 1KDTA 1SKUA 1Z7BA 1MAWA 2HD4A 2PV0A 1AE1A 4Q37A 3JY6A 1OH6A 3F7MA 3A7DA 2PANA 2GNPA 1KDOA 3DNFA 1H85A 2JH8A 2P0EA 4OU5A 4EPTA 4NCKA 2BDEA 2Z4TA 4XCVA 6AT1A 5EIBD 3JD0A 1ZESA 3M5DA 5I9TA 3PQDA 4XDGA 2YXPX 2V5UA 3LW8A 5G1PA 1CZNA 2IVFA 5EQTA 1RE0A 4DXHA 5KVQA 5LQJA 2F8MA 1K5GA 2LPMA 4OP3A 5HZKA 1ZUNB 1BE1A 5FX2A 5GZ1A 1JAYA 1IFXA 3DWIA 2PZMA 4ND4A 4XGQA 2PZLA 1ZSYA 1FRNA 1R3UA 2XDAA 4RK7A 4WA8A 5C8VA 4OBWA 4D4HA 1I3CA 4UEKA 4AJKA 1QRRA 1GN9A 2G6BA 2PU5A 3Q2IA 1HYBA 4W1PA 2BFDB 1MOZA 4BASA 3URMA 3SZGA 5I47A 1F2DA 2NNWB 2ZRFA 3BH0A 3NALA 2WTBA 2BGTA 3CPJB 3O1IC 5ALQA 1AN9A 4WKBA 2XE7A 4ZOQI 4P9NA 3NYQA 2JKYA 3MC1A 2EBHX 4OEHA 1X1DA 1C7ZA 2BLLA 3HGQA 4O4LA 1G60A 1KIMA 1B93A 3G5AA 4XTRA 5CYGA 1HOTA 3H4MA 4RKRA 1SUFA 1Z7GA 4RKQA 4H7FA 4PSAA 3MFQA 4TMFA 2QW8A 4ZKDA 1CQZA 4HXFB 4H17A 3R8XA 4ZDJA 2YNMD 2AVNA 3FFBA 3KR9A 1OASA 1L6RA 4MEBA 1Z07A 2IF0A 3WAJA 3GP5A 4AUMA 1Z3IX 2XHZA 3U81A 1D1TA 1BSVA 3DFFA 1YS2X 1RVDA 3MXTA 1V5IA 4HDNB 3AF5A 3F96A 4RAQA 3CG4A 1UWVA 3R09A 2XH8A 4HPXB 3PJEA 4Y1RA 3OPXA 5IH7A 5F9MA 1W47A 2OCXA 2QZZA 4LI3X 4KACA 1IBMB 1T2NA 2OB2A 3HY3A 4I19A 3QKWA 1T36A 3HA2A 2QP9X 3RGWS 4EKYA 2TSYB 2YHUA 5TQ0B 1FTQA 1ZOOA 1SXHA 5BY2A 1QIDA 4C1BA 2CVHA 3MCZA 1X1AA 1A9XB 3IEMA 3CR3C 3PF9A 3NIDB 4XKJA 3S40A 5CPFA 3N0XA 2EJWA 2R47A 1DCKA 5LM3A 2C61A 1GA1A 1QX3A 3ED5A 4H6WA 3H8SA 3BK2A 3U7RA 4B4DA 1RQLA 1ZOIA 1QIGA 4J8PA 4AKHA 2ONZA 3GLVA 1GRVA 2A30A 5KNDA 3HKCA 4LWZA 4GQBA 3W4IA 1HM5A 4ZTZB 1K89A 4UBKA 2YJGA 1VZ3A 5AKKA 3I9NA 5ALEA 1N6PA 4GKJB 1HZZA 1KFJB 3DL2A 2PEZA 4JJZA 5JG7A 3EXHA 4Q3EA 1N6KA 3HC7A 1ZH4A 1TQHA 4WLNA 4BUZA 3D64A 4X7BA 3H8WA 2JI9A 1JSXA 4AN1A 3DBOB 2NU7A 2O7QA 2FWAA 3BE8A 5FNZA 4JHXA 2C00A 2CEAA 2JB9A 2YVAA 3JWPA 5LUBA 3X2SA 1JUDA 1Q0SA 1KVQA 1FA9A 1N5DA 2FY8A 1DKMA 1QDLB 1JL3A 3ESRA 4BCDA 2ZI9A 3GGDA 4A5OA 2GBIA 4V3CA 3QY0A 1TUEA 3FWPA 2MWMA 3WWOA 1LPSA 4GPZA 4L9SA 4I8XA 4UTPA 1E1CB 5I7EA 3RC8A 3P45A 1X7WB 1FTYA 2WF9A 3EG9A 1DQNA 1J0XO 4HYYA 2HPVA 3MLEA 4TLCA 1TL7C 4V0LA 3VZDA 4F9GA 2PO7A 5BR4A 1HFKA 2XF2A 2QNBA 4MR9A 1YR2A 2QMHA 4YRFA 1UPUA 3W9SA 4OHCA 1JT9A 4MUAA 5CDGA 1QH0A 1WKVA 4B3MB 2C5LA 5DNEA 4D41A 4BFTA 4Y9SA 1H2BA 1MR3F 5E2AA 5JXIA 4LV8B 3UKOA 5JI3E 2GK6A 3PGXA 1HORA 3L0IB 4CF5A 5AW4A 2XTAA 5DP2A 4CEJB 2R6AA 3E53A 3I6ZA 1WHSB 3PC8C 5A4JA 2YZ2A 4S05A 1RE1A 4N8DA 4QWWA 1G0NA 1VGRA 1Z35A 2CMFA 3ZH2A 1UIMA 3CCFA 3O90A 3P94A 1IE3A 1KZ6A 1YRYE 1Q77A 2AF4C 4G0NA 5ENZA 2XXJA 3T5AA 1Y6ZA 3U4GA 3QXGA 4HQNA 3KB2A 3NKLA 5KJCA 3ZU5A 1RRCA 4Z4EA 1RKVA 1D0SA 1SIWA 1JYFA 3QV2A 3VSCA 1SU8A 1E94E 3QV1A 1TJNA 3GCZA 3INTA 4MKFA 1J25A 1G19A 1MHTA 3CWZA 4I1UA 1VPLA 4J0FA 3BRWA 3DKRA 4HXYA 5FLKA 1U1FA 5IT4A 4GI2A 1GCAA 1A7JA 3WL6A 2IEDA 4MYCA 2GESA 3CZCA 5DGXA 3BWEA 4G26A 5DEOA 3WKEA 5HK9A 1O9BA 2VNJA 4IMIB 4URUR 4EP1A 2PKCA 2WSLA 3JRNA 4L6CA 1PJTA 4X45A 1V71A 1ZNYA 4HRYA 3TZKA 1W4ZA 2IH5A 3L41A 3PNOA 3WLMA 3DFMA 1BN6A 4QUGA 3NTVA 2Y9PB 3N3AC 4B9AA 3Q3GE 5HRCA 5GVRA 4OAQA 3WGIA 4MW0A 1I4TD 3GUHA 1P7ZA 5KX5B 2HDWA 3TRKA 4PPYA 3ZKWB 1B6RA 1EA5A 2GTHA 4IZOA 2CE2X 4NYJR 5AP9A 2Z1NA 1V3VA 1ZY2A 2NZYA 3CNEA 4JHLA 4NBKA 4CUKA 1XNJA 4O1MA 4BO5A 4R9SA 4EVQA 1RXEA 2VHVA 3L5OA 2HJGA 1UC5B 3G17A 4R6WA 1A96A 1V37A 2IOFK 2PHZA 3UV7A 3OKFA 2JARA 3HA3A 4MCHA 2PZFA 1BH6A 2PD4A 2WTAA 4YN3A 2JL1A 4ME6A 1DEAA 1VFNA 3T5MA 1M72A 4UEWA 4ZVRA 4C76A 3A1VA 1O77A 4TSKA 2KS6A 5DBOA 1V8DA 2JIPA 5G4LA 1SH7A 2W6NA 1T2VA 1EK0A 3ELBA 1JB9A 3JPYA 3OE7D 4PGHA 5C8YA 3LPCA 1H2HA 4WXHA 1VMDA 1QPBA 3O1LA 5EQJB 3ZGXA 2PKXA 4BP1A 4E14A 2BR4A 1OBCA 3FAKA 4HR7A 5JNSA 1LDBA 1OH5A 4UTNA 1XMOB 3W9YA 3VJMA 4NH0A 2WWXA 4BQSA 1ZUIA 3BVPA 5KSOA 2GJKA 1NE2A 4P98A 3T3DA 4UUPA 3GJYA 4IDNA 4Y6GB 4D8WA 2FWRA 4CIBA 5JY1A 2VSQA 1T9GS 2J9XB 3DHEA 3E05A 1GPH1 1E2FA 4DSTA 3EF1A 5BV8A 1SUDA 2NTVA 1VE6A 4O4JB 3K5IA 5CNIA 1HYEA 1IDN1 2R48A 1K4MA 1ZJZA 2C29D 2VF8A 5DVZA 3L6OO 3U9SA 4AKTA 3EBOA 2O5VA 4KHZA 2P4SA 1UT5A 4ZIRB 4MP3A 2C4HA 1N6OA 4KKXB 3COPA 1J0DA 1ONBA 1BGXT 2XBUA 1FMCA 3HYRA 3HBLA 1IB0A 3JARA 4Q82A 4DSAA 2UXBB 4F6LA 1E4OA 1EP9A 4LZZA 3SG0A 3S1LA 2GFIA 2ZRPA 2HU5A 3FX2A 1SQ5A 1M7GA 3GLQA 1SFRA 2ZBQA 3WK4A 2OVBA 5JH7A 4QO8A 2OC9A 1EAMA 2Y4OA 1U31A 3M6WA 3R7FA 1L5GB 3A10A 4EZBA 2YMQA 5LR6A 1GM5A 3CLUC 2RE8A 2NADA 3Q3VA 2VJKA 3HVHA 2LE0A 2PX2A 1OGJA 2Y27A 4Z0NA 1GQQA 3HB9A 3CLSD 3AEQA 4M7OA 3HYNA 1SVLA 4P0TA 5AM4A 1ZN9A 1MOPA 2QUZA 5JXWA 5SYMA 1RYDA 1OUMA 3HJCA 2FPOA 2KPOA 4L8WB 4B6PA 5EP3A 4CL3A 3TK1A 3M3PA 3QYAA 3AUTA 1T9GR 2H4JA 3ZLTA 5IZ4A 4V39A 3MT0A 1P1FA 2W8ZA 3UK2A 4EK9A 2RARA 1ZW1A 2OB1A 3I5UA 5EE5B 1DX9A 4CKZA 2DGDA 2GYUA 2ISCA 1SXPA 4PO3X 2PH1A 3IC5A 3IPRA 3GROA 4DDMA 2D7DA 1QDEA 1JHVA 2R6R1 5AI4A 4UZSA 1PGNA 2ZRGA 1MDFA 2Z43A 1KYVA 1DTEA 2IOFA 2Y1EA 3L02A 4W1QA 1V9SA 2VHWA 4DQXA 2Z09A 3QFHA 2J08A 3ZDDA 3OKPA 3RHTA 2VPTA 5AKHA 2QRUA 1NWHA 3QW4B 1OPXA 5CA1B 1P45A 2PQ6A 1U28C 2V6JA 4LAFA 4NCHA 5FADA 2CFSA 1USUA 4DBZA 1Y3DE 1IHUA 4R01A 4S0XA 4B3HA 3WYNA 2JBAB 3E27A 3V2UA 3E9ZA 1TZKA 4DEYA 1KTIA 2XWBF 4XR9A 2VOJA 2F2TA 1MQ8B 2F00A 2H52A 4GMDA 1I8TA 1MC4A 4A9AA 5E6UB 3DUFB 1I9CA 1XLVA 3O0DA 4ZKEA 3SS8A 3TLGB 2O8DB 1RYZA 4ZO4A 2FPXA 3TYXA 2AYZA 2IGBA 4C7OB 4LZWA 3ETEA 1Y4DE 4RDHA 2BFOA 2C2HA 1P81A 1IJFA 4D56A 2WQ7A 4LVUA 3RHFA 1FDVA 1BA3A 1NPYA 4HXEB 1SBNE 1WU7A 4W7IA 5CH8A 1ADGA 1K6JA 1EFPB 1FFCA 2FOIA 1CQPA 5K99A 1V0JA 4GE0A 2VT3A 4JKIA 2O7VA 4R40A 4XUEA 2R66A 1N5OX 1OYYA 2OG1A 3FKSD 3UG6A 3WGGA 4BQQA 2BGNA 1C30B 1EX9A 2NXNA 4H1UA 1PT6A 4GDFA 1E3TA 1G3MA 2AN3A 4CM5A 4EO9A 2AWOA 2J7PD 1DBIA 2RI0A 4W9NA 2PXCA 4ZAZA 4EGQA 1JDTA 1TK3A 3IRUA 2R7MA 4Y0AA 3QTBA 3L49A 4D4GA 4JR1A 3N2KB 4OGGA 3SEFA 1Z45A 3NGXA 1LSOA 1Y1PA 4U0KA 1JWBB 4QXMA 1BE0A 1YUNA 1UXOA 3DE2X 3C39A 3R6WA 1J8QA 4YJKA 5KQRA 1TAGA 2COKA 2GHTA 3GRFA 2YVLA 2Y4NA 1XU4A 4YRGA 1K7CA 1XCGB 3RH0A 2WAYA 3A6ZA 3HXLA 4OMFG 1R0SA 1HE2A 4BFXA 1RKBA 3GWZA 4CXMA 3UK7A 1JEYA 4EW6A 1CY4A 3IP9A 1AMUA 4ARVA 1LTKA 1MIOA 1LJ8A 3GJ5A 3OZAA 2ZXUA 4QGBA 2XVAA 3EVBA 4FOPA 4ZZ2A 3NHMA 5AIAA 3OBIA 2A33A 2VP2A 4G1FA 2C9DA 4XD7A 5LIRA 1U4NA 4JY7A 4E7PA 3N8DA 3U0VA 2WVJA 3DAHA 2A3NA 2G04A 5HKKD 4EEXA 5A62A 1O9HA 3PVZA 6YASA 5FIUA 3GCWA 5G1NA 1HT1E 2V5VA 4U7JA 2RHGB 2WLSA 1QHHB 2PKQP 2IHUA 4DWOA 4ZTBA 1RI5A 2WJAA 1D5WA 1BXZA 2AFIE 2H92A 3AFIA 4OX9B 5AXDA 5KU7A 4B40A 1G8PA 3HUTA 2G8LA 3ZWPA 3QFTA 3ICWA 3QPWA 3BJMA 1CZHA 1KYWA 1ULZA 2FGKA 5HTOA 1TT5B 3LBNA 2ZIWB 4S1VA 3T7SA 3UTDA 4U8GA 4YRZA 2J8ZA 4CN9A 2WA2A 4OHXA 1VKZA 5BN3B 1FX0B 1ORVA 3P9CA 2X5XA 4XQ9A 2YV3A 5KCZA 4GP7A 4X61A 2B92A 1VBMA 3OHMA 4QBGB 2PZ8A 1UZUA 1HC7A 3A1FA 1NU8A 1FTGA 1TTHA 3ITNA 3HSYA 2W6PA 3MHTA 1UDBA 4JVLA 4B44A 2NLOA 3CURA 2BKXA 2XUQA 1P80A 4Z4CA 4OXIA 3AT1A 4BLTA 4DJEC 2XMRA 4LJSA 2WFZA 2XUZA 1YZFA 3I5XA 4BXOB 3SFTA 5DTQA 2YWEA 4BOYA 3WGLA 3Q8WA 3L7CA 3ZXXA 1AXGA 2GZ2A 5IAJA 2Z9DA 4ZXPA 1XLTC 2LWIA 2NUAB 3MGGA 4RH1A 1N6LA 3WY9A 2GHQA 1A8HA 2XYVA 4NZOA 5L7YA 2H29A 3CRRA 1CE8B 5A4AA 2G4LA 2CSUA 1SPXA 1H3NA 4J43A 4OHOA 3QVOA 1EDBA 4DV5B 2O14A 4FW8A 2PCJA 3MELA 4HF7A 1QYVA 3IP8A 3WGZA 4BNUA 1P5ZB 2CUTA 2V8OA 4ZZIA 2E5LB 1DJMA 2QKYA 3EEBA 4GMGA 3VR2D 4G2NA 4B73A 4OMDA 1C9YA 1OZHA 2KYRA 1JB1A 2GJ4A 1R9GA 4JLSA 3CKMA 2Q5IA 4RNCA 3T6KA 4FYWA 3LBAA 1C0PA 2KJQA 2IIPA 3ONDA 4NE2A 1ZNWA 4JK3A 4OHBA 5E95A 1PL6A 4PAGA 2D8AA 2Y99A 1MGOA 3ZIAD 2WWIA 2RBKA 4TT8A 4CW7A 1LX7A 3VNVA 4ZEOA 1A98A 5JW6A 2FX3A 2IWRA 2H1IA 2O52A 4NHEA 2EF1A 1HEIA 3WSWA 2HU8A 2PEYA 2VUIB 3QM1A 2GK3A 5CH3A 4UFNA 5FJJA 4IQ0A 5IM5A 1I7SB 1HDOA 1Y1TA 3C41J 2AK2A 3EA4A 4X92A 1I1NA 1OHHD 2V8BA 2HKIA 3AU9A 3COYA 4G1BA 4LTDA 1JFTA 2EX1A 5AKGA 2EX4A 2ZUEA 3TH5A 1SGWA 2ETXA 3PRHA 3E35A 2XGMA 1C9DB 3GQBB 3K9HA 2OYRA 1UCFA 5AXBA 4U5XA 5ELXA 2XZDA 3IRVA 1EFTA 3F1LA 1BMDA 3DVQX 2AOTA 4QSMA 1A8IA 1GOTA 4WKPA 1NOKA 1TKBA 5CT5A 1LV8A 2REXB 2F48A 3OM8A 4LBVA 5INTA 4A15A 1UBSB 3VJRA 3TFWA 3C7DB 3KJFA 4BNZA 2QD5A 4KQWA 1USVA 2OZLA 4X3CA 2I2XB 3KO8A 3UWPA 4I1PA 3N2IA 2W2KA 5DYNA 4Q1VA 4D9JA 5COBA 2OHOA 5I7HA 4E4RA 4XDHA 2ACEA 3UUEA 3ZZ1A 1T4CB 3GBVA 4MI9A 4RPCA 1MN6A 3KM0A 4ODIA 4HV4A 3FYHA 3IIIA 2I6FA 5TMEA 5ENDA 2N46A 1CQWA 3JQ8A 1USGA 3JQBA 1WY5A 4CKBA 2B1IA 4MZDA 3ORFA 4URFA 1EK6A 2IXDA 4RE5A 2X8JA 1ORRA 4FUTA 2V4UA 3P0IA 1RIFA 4ZCMA 3OC0A 1T8WA 3WS7A 5DBIA 1L4EA 1PDVA 4BLWA 3UJCA 1Y81A 2RHWA 4DZRA 1ZINA 1MIHA 3C0KA 5HXAA 4RE6A 5TV2A 4UM5A 4ROSA 3OJ0A 3GEDA 5EWLB 3E3MA 4IKPA 3Q9UA 2J0SA 4LISA 2ORWA 3JAKA 2FPPA 2QVBA 3MINA 3V2IA 4B3JA 3GBPA 3DOOA 2Z8ZA 5KQLA 2AOWA 5A6VA 4KC0A 3E8SA 1OLOA 3DVLA 2Q3BA 4QLBA 3R9IA 1HT3A 1UEJA 4J0EA 3KYDB 2Y0CA 4OSEA