1XTPA

Structural analysis of leishmania major lmaj004091aaa, a sam-dependent methyltransferase of the duf858/pfam05891 family
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
246
Chain Sequence
b'GPGSMPRNLPISGRDTNGKTYRSTDEMWKAELTGDLYDPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAGMPVGKFILASMETATLPPNTYDLIVIQWTAIYLTDADFVKFFKHCQQALTPNGYIFFKENCSDRFLVDKEDSSLTRSDIHYKRLFNESGVRVVKEAFQEEWPTDLFPLKMYALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LMAJ004091AAA
molecule tags Structural genomics, transferase
source organism Leishmania major
publication title Structural Analysis of Leishmania major LMAJ004091AAA
rcsb
total genus 83
structure length 246
sequence length 254
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05891 Methyltransf_PK AdoMet dependent proline di-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xtpA01
4RX1A 2HTEA 1D2CA 10MHA 3EGVA 3G88A 2PXAA 1NV9A 4DMGA 2I7CA 4E70A 5K0FA 3MHTA 3EVDA 4MTLA 2NNWB 5ICGA 4IV8A 1RJEA 5FA5A 1FP1D 5EKXA 4PYKA 4RTMA 1NW6A 4FT2A 3OU2A 2PXCA 3FUWA 1X19A 3FPEA 3CVOA 3GCZA 3JWIA 5D1HA 5CD1A 3E05A 3IYLW 4DF3A 3VYWA 5ICFA 2IH2A 2BZGA 4FS8A 3KR1A 4HC4A 3DUWA 2P7HA 2ZZNA 1SKMA 1QAQA 4GF5A 4PYJA 3FYCA 3UWPA 4R8SA 3A27A 2C7QA 3OCJA 3RW9A 3UJDA 4HGZA 3EVFA 3MQ2A 2N47A 3DULA 2B9EA 1RI2A 4DKJA 2A14A 2BR5A 3TM4A 2PBFA 3LGAA 2GLUA 3G8AA 3M6WA 2BM9A 3TMAA 4GBED 4PYLA 2AOTB 2AOTA 4PINA 1OR8A 3H2BA 5FHRA 3A25A 3M4XA 3C6MA 3OE5A 5E2AA 3DP7A 4RVGA 1L3IA 3AJDA 3I9FA 5E9JA 5K05A 2LD4A 5CUQA 2OPBA 3LKDA 4GC9A 4XUCA 2B3TA 2V7EA 1T43A 3HTXA 3UJBA 3IEIA 5B1SA 2PGXA 5FTWA 3TLJA 1X1BA 1JG1A 3E23A 4OA5A 2OZVA 1RJGA 1NW5A 4GOOD 3HM2A 2UYOA 1Z3CA 2QRVB 4AUKA 2YXEA 4RTJA 3HNRA 3OZSA 4LWPA 5T67A 5MHTA 5D1NA 2FCAA 4H0NA 4PONA 2FHPA 3RODA 3KQQA 4QTUB 2VDUE 1VP9A 2Y1XA 3UA3A 2YX1A 3KPWA 2EJTA 4M38A 1ORHA 5LQAA 3DMHA 3P2EA 5LQRA 1KR5A 3DXYA 2PT9A 2Z6UA 3OFJA 4ER6A 2ZWAA 2CMGA 3BWBA 5T64A 3SGLA 3CC8A 4F86A 3ERCA 2NP6A 3OU6A 1Y8CA 2OB1A 4KRGA 2NXCA 5DM1A 1ZQ9A 4GQBA 5CCXA 3M33A 4BP1A 4E2XA 2HWKA 3BXOA 3EVBA 5KVAA 1ORIA 2ZWVA 4RVHA 4RTSA 2OB2A 2BM8A 3FUVA 4E2YA 2V74B 4KVZA 4V0QA 2ZIEA 4U7PB 1KYZA 2AR0A 5DWQA 3GRZA 1VQ1A 3ELDA 5DX1A 3EGIA 2EFJA 3UJ7A 3PFGA 1KHHA 2PSSA 1FP2A 3A4TA 3D2LA 3LCUA 1YZHA 1PJZA 2K4MA 4KIFA 5FA8A 2VS1A 1TPYA 1BOOA 2YR0A 5GM1A 3I5UA 3HCEA 4RV9A 1QYRA 3KPYA 2HR1A 2H00A 5EMKA 3HA7A 3I64A 1SQGA 2G72A 1WG8A 5GIOE 3P2IA 2R6ZA 1FPQA 1HMYA 5E1DA 5FWDA 3B3FA 3DMFA 2O06A 2OO3A 3DLIA 3LPMA 5EMLA 1JR4A 2JH8A 5E2BA 5ERGB 5EMMA 5LR6A 1AF7A 2PVCA 3Q87B 4P7JA 1ZKDA 1INLA 4QQKA 2HNKA 5E9WA 1O9GA 3UJAA 1MHTA 3FTEA 1R8XA 3DLCA 3C0KA 3EVGA 3FTFA 2P1DA 3JWJA 5HILA 3U81A 3ER8A 4E2ZA 3DXXA 4MHTA 4MWZA 4R6XA 3RIEA 2ZIFA 4P7FA 3OE4A 5FUBA 1QZZA 3HVIA 2CMHA 2YTZA 1UIRA 3UZUA 3BWCA 3KR2A 4BLUA 2IH5A 4DQ0A 4C03A 3BGIA 3UJ9A 3EMDA 1DL5A 5HEKA 4ER0A 2CWWA 5K0JA 2O07A 2GH1A 2O0LA 3UJ6A 3P71T 1NBIA 5CIYA 1M6YA 1NV8A 4B17A 1XXLA 2ZW9A 4M37A 4Z2YA 1JSXA 2G71A 3FUXA 4RTRA 2OKCA 1L9KA 2ESRA 3HCFA 2JJQA 3T7SA 2ZBRA 3KR9A 1F3LA 2VP3A 3KQWA 1IXKA 1AQJA 1XCJA 2UYQA 2P41A 3P9KA 4E33A 1R18A 4QPNA 2AN3A 3BWMA 3TKAA 3EVZA 2IDKA 1EJ0A 5DM0A 4E30A 1VLMA 2BR3A 4R05A 5CVUA 3A26A 2HMYB 3DOUA 1NKVA 2DPMA 4EVIA 4A6DA 2BR4A 3GDHA 2GAFA 3R24A 3NWBA 5GIPE 1XDZA 3OFKA 1I4WA 4HTFB 5CVEA 2H1RA 4PCLA 2XYRA 3B5IA 3TKYA 5EEHA 4OBWA 4O29A 1WY7A 1R74A 3BZBA 4GOND 3FRIA 3HCBA 5FHQA 3TOSA 5JR3A 1ZHFA 2EX4A 3P8ZA 5LQJA 1XDUA 4YUVA 3I53A 1SG9A 3GO4A 5FCDA 1ZGJA 4PCAA 3MAGA 3F4KA 4GUAA 3LBYA 1AQIA 3FPFA 3G5TA 5DXAA 4CTJA 4RTNA 3WSTA 4HTFA 5GWXA 1VIDA 2I62A 3OZTA 2ZTHA 4FZVA 4QDKA 2P3OA 2F8LA 3HEMA 1JG2A 4RVDA 2ZSUA 4HSGA 1XCLA 2ORED 2O05A 3EGEA 4KDRA 1V39A 5FQOA 5EVJA 4F85A 3NW9A 4KDCA 4G56A 2OYRA 1JQ3A 5M5BA 2HV9A 3P9CA 4IWNA 4L7VA 3NVMB 4XUDA 3O31A 4YUYA 2UYCA 1VE3A 1Q0SA 3C6KA 3E8SA 3G2MA 1NBHA 1G60A 3NMUF 3GJYA 4R8RA 4MQ4A 2ONZA 3G2OA 3R0QA 4YUWA 2IBTA 4BY9E 1NW8A 4X63A 1BKYA 1G6Q1 2AOUA 4EMSA 1G8SA 1KPGA 3SR4A 3E7PA 1WXXA 5EHGA 1SQFA 3BT7A 2IH4A 4GEKA 1UFKA 4CKEA 3BWYA 3AXSA 4X61A 3IHTA 5EC8A 1XTPA 3KPJA 1YF3A 5KQRA 2FK7A 4LG1A 2ZULA 5HIIA 1VBFA 4NECA 5K0NA 4KIGA 2G8NA 4FR0A 3V8VA 5DLYA 3NTVA 4GOMD 2H11A 1JTEA 2PKWA 2YUIA 4P7KA 1YUBA 2ZBPA 5C1IA 2BH2A 3EEOA 3R3HA 3SVZA 5EGSA 3GXOA 8MHTA 4QQNA 4K6MA 2GS9A 3KQTA 5K0GA 3LKZA 1KPIA 4RTPA 1EJ6A 2Z6AA 3NVKI 3DMGA 3KU1A 2Y1WA 5E8RA 3SSOA 2C7PA 1IY9A 2WA2A 5G02A 3HVKA 4DCMA 3EEYA 2PJDA 2R3SA 1O54A 3LDUA 4M7RA 3Q7EA 5H02A 1WS6A 3EMBA 3L8DA 5ICEA 4CWAA 5KYGA 3MCZA 4OQEA 5GP1A 1XJ5A 3PX2A 2ZCJA 1L3BA 1KIAA 4XUEA 4YMHA 4R6WA 2IFTA 1KYWA 4AZVA 4A6EA 3VSEA 4PYOA 3M6XA 3K0BA 3IV6A 1P1CA 4M36A 3BGDA 2JHCA 3NWEA 1X1CA 4ATNA 2OBFA 1X1AA 2GPYA 3FUUA 3LDFA 3T0IA 2WK1A 2ONYA 1JG4A 3LCVB 5BXYA 3P9NA 3DTNA 3GNLA 3O4FA 5DT2A 5DXJA 3KQSA 5BP7A 5F2OA 3SXJA 5HZMA 4KW7A 3PFHA 3PS9A 1B42A 3KHKA 3ER9A 2I6GA 1XDSA 3GIWA 4ISCA 4OA8A 3TRKA 4AX8A 5E1OA 4E2WA 3O7WA 5EMJA 5JUWA 2C7OA 5EZQA 2VDVE 4YV1A 2QRVA 3FYDA 1L3CA 2PX5A 1G8AA 3GGDA 4PYIA 1R6AA 4RYLA 3MTEA 4XCXA 5DTRA 4C05A 5BW4A 2IGTA 3B3GA 1EG2A 2AN4A 1EAMA 1HNNA 3CJTA 5CVVA 5E1MA 2PWYA 2G1PA 3THSA 5GINE 4AZSA 1X1DA 3A7EA 1I1NA 1QAMA 3SSMA 4C08A 3KPUA 3KKZA 3FPJA 5K0BA 2I9KA 3KQYA 3M70A 5DTMA 3TR6A 1KXZA 4WXHA 1M6EX 4ZTBA 3KQMA 4PIPA 4AZWA 3X0DA 4DA4A 9MHTA 3JWGA 4GC5A 3PT9A 5U4XA 2KW5A 3EPPA 5EG5A 3UA4A 4E31A 3EVEA 1MJFA 1YB2A 3C3YA 4QTTB 2P3QA 3HA3A 4C04A 1VPTA 4X41A 3P9IA 4RTKA 4FSXA 3LX6A 3LL7A 5DRYA 5EKUA 1KPHA 3I58A 1JQDA 1XVAA 4MIKA 5EHIA 1ZGAA 4V0RA 1RJDA 2B2CA 1P1BA 1JSZA 2B78A 5EIFA 5LQNA 4CKCA 2O57A 3GRRA 4OBXA 1UWVA 4PYNA 4X1OA 2PT6A 3HVJA 4PYQA 5BW5A 3EVCA 3QOWA 3QV2A 3FZGA 1IM8A 2PY6A 2XYQA 4YV2A 2AN5A 3LECA 3TQSA 5K03A 4DZRA 2ADMA 2OXTA 2NP7A 1SUSA 5EPEA 1QANA 4PGGA 1NW7A 4QPPA 2AZTA 2QY6A 4BP3A 4RTLA 3ELWA 3ELYA 3M6VA 2PX4A 4CXMA 3R9XB 3GRUA 3CJQA 3LCCA 2PX2A 3HCDA 2IP2A 4LWOA 3FTCA 1QAOA 3FTDA 3KR0A 1TW3A 2VZ9A 5K0CA 5K0LA 5K8VA 1N2XA 2P3LA 2FPOA 5KQSA 4KWCA 5K09A 4P58A 2XYVA 2JH9A 5T6BA 2B25A 2PLWA 2Z6QA 2ZBQA 5CM2Z 5K0EA 1JTFA 5LQUA 1YZ3A 2IDJA 4FGZA 2ERCA 2QYOA 3G2QA 3LSTA 5CVJA 5E1BA 3DH0A 3HCAA 4PIMA 4EKGA 1R8YA 2NXJA 1DUSA 3ID6C 3VC1A 3BKWA 3KPVA 4EKIA 5C9ZA 4YUZA 3UBTA 4HH4A 3TFWA 5DM4A 2ZVJA 2JHPA 3G5LA 3GRYA 3S68A 3BKXA 1ZG3A 3FUTA 3R6TA 3AWIA 2DULA 4DCGA 4AZTA 3HCCA 3QOXA 2AOUB 2P8JA 2QM3A 1FJXA 3T7RA 3A7DA 1M0EA 1JG3A 1SUIA 4PWYA 2GB4A 2AS0A 2IPXA 4FSDA 2PWPA 4Y30A 5HIMA 4EQZA 2UYHA 5E9QA 3PVCA 2XVAA 4C4AA 2C7RA 2OY0A 2UZ4A 3EVAA 3HVHA 4ER3A 1D2HA 1KP9A 5HFJA 7MHTA 2FYTA 4RWZA 3OU7A 1Q0TA 3G2PA 3KQOA 5FWAA 5C0OE 2P40A 3FPGA 4PNEA 3G7UA 3HP7A 5DX8A 4BLWA 2ZZMA 1R00A 3NJRA 4P7GA 3B3JA 2AOVA 2AVNA 2YXLA 3GWZA 3HA5A 1RI1A 1L1EA 4HG2A 3AXTA 3LBFA 3NDIA 5FQNA 4UOEA 1YFLA 1DCTA 1AV6A 3PB3A 2G70A 4BLVA 5DM2A 5EZSA 5DSXA 2ZIGA 2P35A 3PX3A 5CCBA 2NYUA 5E8JA 2P7IA 1WZNA 2CKDA 3PLAE 3KQVA 1TW2A 1BC5A 4HRAA 4RVFA 1N7IA 4PYMA 5HIJA 3B89A 1RI5A 4QVKA 5DSTA 4CTKA 4OX9Y 3VC2A 3TPZA 4HGYA 5EIWA 3SSNA 3DXZA 1NE2A 5LSAA 2IBSA 5DRTA 1PRYA 5GOZA 5DTQA 2JG3A 2NXNA 4E32A 5HOQA 3MB5A 2YQZA 3CCFA 3JWHA 3G89A 3ORHA 3B7PA 3THRA 2PXXA 3BGVA 3TM5A 2ZZKA 2XVMA 1VP3A 1F38A 5ICCA 1O9HA 2NXEA 3AY0A 4IV0A 3KQPA 4JXJA 3SM3A 2Q41A 4FP9A 4CKBA 4POOA 3DR5A 4QVGA 4OQDA 1EQAA 3P2KA 3GRVA 3CJRA 2WA1A 3C3PA 3GU3A 3NDJA 1I9GA 3LHDA 3P97A 5P8WA 5HIKA 5EEGA 5EQJB 2VDWA 1EIZA 3ME5A 5FULA 4U7TB 5F2NA 3ELUA 3M6UA 5FADA 1P39A 1N7JA 3CBGA 3CKKA 2PV0A 5LQKA 4C07A 1NW3A 2QE6A 4WVLA 1G55A 4F84A 4RTOA 1G38A 2YVLA 3MTIA 3REOA 4DM3A 2FK8A 3G8BA 4PGHA 1U2ZA 2EJUA 2FRXA 2YXDA 4FT4A 4Y2HA 2XBMA 3LDGA 3OPNA 5EOVA 1D2GA 2PX8A 3FPHA 4YUXA 5GM2A 2CL5A 2ZLBA 5IH3A 3BUSA 1H1DA 3UJ8A 4ER7A 3PTAA 1RI3A 1NT2A 1WXWA 2AOWA 3ANXA 2GA9A 5DX0A 3UJCA 5IKMA 1YFJA 1FBNA 3FRHA 4LECA 3CGGA 1BHJA 3MERA 4RTQA 3OZRA 4EK9A 4ER5A 5CVDA 5KS2A 3V97A 4C06A 1RJFA 4IKPA 2EG5A 4QDJA 2AOXA 3UFBA 4X60A 2JHAA 4RSRA 4YV0A 2ZFUA 5K01A 2E5WA 5LQCA 2IIPA 3MGGA 1SVUA 4YMGA 3MCTA 1JQEA 4GOLD 3T7TA 1RI4A 2AVDA 3K6RA 5DPMA 1VL5A 5F2KA 3SX0A 1P91A 3SMQA
chains in the Genus database with same CATH superfamily
1QRRA 3ZGOA 5J43A 1NMQA 2DQSA 1E4VA 2CWDA 1Z88A 5B6IA 3TUJC 2FKAA 1P7ZA 3DEHA 4IEIA 5C8YA 4TMVA 1E8NA 1GCAA 2ZRMA 2J09A 3MMPA 1GZ5A 2VJAA 1O1YA 4FK8A 4OH7A 1YQEA 4F4HA 5HW0A 4OXNA 5I51A 1NG9A 4BO9A 3I9NA 2OZLB 6NULA 1QTIA 3LBIA 3VR3D 4M8NE 3JRXA 4B3BA 3S2ZA 2PMEA 3A4MA 4IQ8A 3ETLA 2R47A 1K88A 4NARA 1Q2UA 2YV1A 2GPSA 3WKAA 2Z3VA 3DAFA 3A27A 4PGAA 3JX9A 4J4TA 1E9FA 3TFOA 1I13A 1RZ3A 4Z53A 4WXRA 3DOHA 3ZZTA 1OWNA 1YS1X 1PQYA 5LUBA 4AC9A 3O3CA 3GAAA 2BN4A 5BOSA 3BRCA 4Q01A 3GA0A 2QVLA 3RT9A 3FMIA 2OXCA 4JBXA 5IJ9A 1V96A 2CW5A 3OHSX 4UPVA 5EIHA 4NYJR 4PHHA 3HEAA 1CPYA 1AKWA 3L6UA 3FXAA 3PUVA 1KDVA 2LCQA 1K06A 1ZI6A 1W5TA 2JVKA 1EDOA 3C6MA 3ILSA 3NBZC 4YT5A 1VMIA 5CUQA 5B3LA 4GC9A 1KORA 2J3DA 2V7EA 1DV1A 1DBPA 2AW5A 1C1DA 2Y9MB 4X0EA 5DI9A 4YT2A 1C9MA 1JG1A 4OI2A 4IUBS 2BGNA 2EKPA 2MSCB 5IJ9B 3AM5A 3UMMA 3QP9A 5HKAA 1ND5A 2QSZA 4GBJA 2F8MA 1RRMA 2OUKA 3GBSA 3KZKA 1IXSB 2BFMA 3GD7A 1EWTA 4A9AA 1TYDE 2WHYA 2X5JO 4KBFA 3D6NB 7ABPA 2XRZA 3X43A 1EWQA 5CPFA 5EP3A 2HEIA 2IYFA 4P80A 3UA3A 1AKEA 5CDGA 4A23A 3U19A 4OO3A 2DZDA 1JMYA 3WDLA 1NHWA 2QMUA 1IN1A 4G41A 4DC0A 2UZ1A 1JW9B 2WM9B 4Z4QA 1XG5A 1NKTA 2BFAA 1K92A 1M7GA 4I9UA 1HMPA 2VYVD 3CEHA 2PZAA 3TSAA 2P90A 1LI7A 2HA2A 3KYCA 3OIYA 4PC3A 4CIVA 3S8YA 2DB3A 4E4YA 2GUWA 5C8DA 2R48A 3M33A 5ADHA 1NL3A 1JIIA 2MOKA 2YZGA 2GTIA 5EE9A 3VVLA 1PGJA 2M6RA 3RVLA 2V74B 2OHOA 3U4QB 2J3IA 4H1TA 1F48A 3FYUA 1TEHA 4CV2A 5DX1A 1L7AA 4HGPA 4MR8B 3V5NA 1ISGA 4BMOB 3LRPA 5LQJA 1IHOA 1DTEA 3K05A 3WKDA 5ITZB 1N0IA 4MX8A 4OB6A 3WHLA 3U39A 3ZWWA 4OQ4A 3VU1A 4EY8A 4RV9A 1NVTA 2FEWB 2H2IA 5FNZA 3GLKA 3TAHA 2HN9A 4OGLA 2R1TB 2GPBA 1TE2A 2GF2A 3LA6A 4A26A 3WYEA 2G67A 1B6TA 1AKQA 3HUEA 2Z5LA 3DMFA 4O2AA 5KU7A 1XF9A 4NDZA 3ZWYA 3G9QA 3KAKA 3VV3A 1Z7WA 1MB2A 2F17A 4N48A 4LFCB 4U39A 1JSCA 4XQ9A 1INLA 1CHDA 1GSOA 5F9MA 3HWSA 1D2RA 2FMHA 3JWJA 3RREA 3FTFA 2QQ5A 1AY0A 1GFZA 1PWZA 1ECCA 3E8XA 1QCCA 4C30A 4HAWA 2G40A 2HIGA 2EDCA 3W79A 2E5LB 3EGXA 3AZPA 3LUHA 1UMKA 3O3MB 3LHKA 3BWCA 4ZYXA 2Z30A 2ZK7A 6REQA 2XCRB 3FZYA 3JZMA 2O0LA 1BIFA 1CIVA 1FW8A 2JKZA 1A1VA 4MWOA 1AUVA 2OBNA 2QBYA 3HNPA 3R6DA 3O4IA 3F3SA 4LYFA 2WIGA 3VU9B 5BV1A 2C94A 4FHGA 1Z17A 2QVGA 5JY6A 4MV0A 4ODIA 1E2PA 1LWNA 4PZDA 4RHEA 1VRVA 3CPSA 4R1TA 4RBNA 3N0VA 1E8DA 2Q8QA 4D0SA 4FMCF 4GXNA 4BO6A 1VHLA 1RWOA 2JCYA 4LQDA 1LGYA 2VP9A 1OFIA 2C4KA 4G4SO 3ROTA 3NCHA 2RBKA 3CR7A 5AW5A 1T2CA 2DBVO 2WG1A 2C0CA 4HTFB 1Z2AA 3MC1A 4DADA 1BWSA 2PMFA 5KHLB 2QNIA 1U81A 1K6XA 4ROTA 4PC6A 2FWIA 2M9MA 1DO2A 2QP4A 2VYNA 2YNMD 4IJVA 4IFBA 3U4IA 4XGRA 4EUKA 1WULS 4RDIA 4HYYA 1OFHA 1PTJA 3LIPA 4IWXA 4WH0A 4AYWA 4CV1A 3R8XA 3JTMA 1KKMA 2B4YA 4LJ9A 4PCAA 4KP7A 3WRXC 4MGHA 3EXIB 2IY7A 1ZUHA 1E2BA 1SQ5A 4RTNA 4P6VF 1ABBA 4BFUA 2G1AA 5CLJA 3PNOA 3HDVA 5TDHA 3YASA 5TQ2B 3G3EA 4HXFB 3AVYA 2MR5A 1Z63A 1A5ZA 2OAQ1 2QORA 1OXBB 1SCKA 2VRCD 3OE7D 5JSYA 5K0SA 3HP1A 4E51A 3NDRA 2GZHA 2H4HA 2MSLA 4G56A 2DU8A 1E9SA 4KDCA 2OYRA 3EIQA 1CVIA 3UATA 1LUAA 4XUDA 4EIWA 5INTA 1PNOA 2G0NA 1VE3A 4OAQA 2VYQA 2BC9A 4DZTA 1O95D 2EV9A 1C4WA 2B9VA 2DUWA 4MYDA 3ZHTA 5C7OO 1EA5A 3R0QA 4OIFA 3LPCA 2W2OA 5L3RA 2Q2VA 4HX5A 3IP1A 3MAJA 1G8PA 4S1VA 3WXBA 4L7QA 1IZYA 1NN1A 3DAGA 4E1VA 4P32A 3DFMA 3SXUB 1XTRA 2BBTA 2FEOA 3S55A 4X20A 4B3FX 4HDOB 3OM9A 2LRHA 2GBIA 3CMCO 2Z2KA 4X44A 2VNAA 4L1KA 5KC8A 3OJXA 2XQFA 1OVGA 3F1LA 1K1EA 1TD1A 4RMGA 4UNSA 1FSZA 1WZCA 2XUFA 1L4GA 2G6BA 2XUQA 2ZIAA 3KZCA 4J9VA 3WGJA 3G2HA 5L7WA 3NTXA 3JAMA 2FRDA 3DKPA 2QUKA 1CUFA 1QDUA 4JNKA 5JJLA 2E87A 4WDRA 5JXHA 1WKVA 2DQZA 1QGED 1GTL1 4NBWA 5CJJA 3NAMA 4G07A 3WFZA 4W6ZA 2XZTA 4XA8A 2GN1A 4PG4A 1Z39A 1YA4A 5F4BA 5HFNA 3JR7A 5EE1A 4GI1A 3OTIA 2Z8XA 5H02A 1CFZA 3EMBA 3K9QO 2HSZA 4PHCA 4OQEA 1DQYA 1A9XA 2XA1A 1CQIA 1BQEA 1MABB 1N5LA 1R7RA 2WUWE 2WW8A 3L7BA 4OLAA 4HDRA 2W2KA 1G7CA 2NU9A 5ITSA 1RS0A 4QT4A 3LXMA 1XMVA 2YRFA 3C6BA 4R6WA 3GGCA 4KSYA 1KYWA 3GA5A 3HN7A 2K6GA 2X1MA 3RSZA 5DWDA 4X7RA 4DLRA 2G7MC 4ZYYA 4M36A 2QTMA 5CRIA 1GP2A 3FMVA 3RUIA 5AWFC 2BSXA 2PFGA 3UWOA 2C03A 3P20A 3HY4A 5F5XA 4P86A 4BGEA 4L5AA 3NOVA 1AS2A 1ATZA 1ECPA 4V0NA 4BVLA 1C3LA 4X8OA 3NJ4A 1U1DA 1U9YA 5IAJA 2ZJ2A 3GBPA 1SK9A 3B9BA 4ZDWA 3RBXA 1PS8A 4N0EA 3WGGA 1QPGA 4RNDB 4BJ1A 4P3OA 4D9CA 4RANA 1I2CA 2Q5IA 4RVSA 5AIBA 2A5GA 3S29A 2CMFA 3KJFA 3WLNA 5CD9A 5C53B 2OV3A 1EWVA 1WXQA 3STTA 4M55A 3RE1A 4G1FA 1W1UA 1EG7A 5DHTA 2PX5A 3RHSA 1VPLA 4K6OA 5BN3B 4YMWA 1YBAA 3SC2B 3D6FA 4JUBA 3DWEX 3K5HA 3PQ8A 4Z1MA 2HL6A 3N9IA 1QAMA 3T1NA 3C3JA 3QPUA 3MYYA 4C2AA 2JLAA 2EJVA 4ND6A 4A8JC 4DMLA 3ETNA 2ASEA 1GZ3A 1CF4A 4B4VA 1OA1A 3GBVA 4Q1DA 3QF7A 3PT9A 2AJBA 4NY1A 3EPPA 4MKGA 2D62A 1FA9A 1A88A 3EVEA 3FNQA 3M9XA 4LWZA 1LDGA 2QTFA 4LSZA 4L28A 5SICE 5HKLA 1CQZA 4ZCMA 2DBYA 2H1SA 3I6IA 3P9IA 2QDXA 2LGJA 3CNQS 1UEIA 2D5IA 2SKCA 3GEPA 4PYRA 3RHTA 3ASVA 5EJ7A 3OKFA 2OV6A 1R5JA 3R7WA 1C3XA 2BGUA 2C42A 4MI9A 3WJ7A 3GUCA 1UR5A 1OXTA 2ZJ3A 1ONBA 1D9XA 2V54A 4REQB 3AEQA 5C31A 2E5FA 3CCCA 2B4TO 3T5PA 1ARZA 5JJ5A 2BEJA 4L85A 2ZIZA 3B6JA 2HU5A 4CDNA 3GYGA 4QHSA 2CFCA 2FP4B 2X14A 2XYQA 4QBHA 3FMOB 5HGJA 1NSYA 4JIMA 3CVJA 1CR6A 5TMPA 3UXMA 3UXEA 1KAMA 5I9IA 5JXJA 4U2KA 1NM5C 4BN4A 2I7VA 4QECA 3M6VA 2PX4A 4L8VA 3RV4A 1Z8NA 4GKBA 2ZB3A 4TQAA 1HFWA 1ITZA 3UUGA 4GOXA 1P1JA 4HEA6 4IF4A 2GBPA 3C5HA 3G0CA 1X74A 2XH8A 3QHPA 1YR8A 1H3EA 1HBJA 1PR6A 4HL6A 2MSWA 5AIAA 3DBHA 4PLTA 3KKNA 2NPOA 4J4HA 2J9XB 4GKAA 4Q3AA 1DTSA 2ZE7A 3CZRA 3AF2A 4IL5A 5E7QA 4Z8YA 2G76A 3WGNA 4Q4AA 5C4IA 1AKNA 4H4EA 1YZ3A 2W83A 2H0QA 3CPHA 1EQUA 1RHJA 3NNDA 5DMHA 3ZDFA 1MA0A 8ADHA 1MFZA 2ZR8A 4YAOA 1I01A 2ZRGA 4QUKA 4Z8XA 3KPVA 5SZJA 2E9SA 1NVEA 1VI6A 1U0JA 5CG1A 3LT5A 1NZDA 3TB6A 1M1NB 3LVFO 4X20B 1QHNA 2V96A 2IT1A 3AUFA 3UT0A 1DBRA 1DB3A 3ZHYA 3F74A 4CKBB 4Z2AA 4RK1A 1THGA 1ID1A 1ENOA 3SQWA 4DMCA 3EUEA 2QPLA 3HXMA 1Z18A 3O1IC 5A1TA 2X7HA 4IOMA 4UBJA 3D2AA 2I6SA 1XZBA 2PZGA 4R7TA 2ACKA 2BKXA 4XGNA 5D87A 2PWPA 3RSCA 4QUAA 2W8BB 2IPNA 3RYFB 2Q5JA 13PKA 1GQ2A 2OY0A 2D13A 1DU4A 4WMLA 3R9WA 3EVAA 1W581 4ES6A 4ER3A 7YASA 4N4AA 5HFJA 1GM5A 2FYTA 2VQDA 1Y3HA 1QIHA 3AW8A 1OLUA 1LF0A 4M9UA 4JODA 4BLWA 2JFPA 2FDCA 3DS8A 3C4VA 1NR1A 2D06A 1P75A 3EY9A 2C61A 4YRMA 8ABPA 4G4GA 5B7GA 2E0IA 3MD9A 4YRJA 1QHFA 1VSBA 1QVVA 1RVV1 2G5GX 4NJEA 5IDWA 1HV8A 3MLEA 1XDBA 5J63A 5ENDA 1NQ5A 5B1DA 1K86A 5DSXA 3OQVA 3KZMA 4MLZA 4P3NA 1AIPA 1R0ZA 2I78A 2QX8A 3NWOA 2P2DA 5CCBA 2MDTA 2XQVA 1N0VC 2R5FA 4B6OA 3GN1A 2O2XA 4EWLA 4DV7B 1N7IA 3WR5A 3K15A 1B7GO 3WWOA 4D3DA 3ZLBA 1QKKA 1B2RA 7GPBA 3NDPA 4EF6A 1OFGA 3LW7A 4GXTA 4NG4A 5EIWA 3T7KA 4RZQA 2QTTA 2DETA 5LSAA 3CX3A 5KYKA 5DK4A 4IVQA 1EBUA 4KQXA 3LU1A 4YJFB 2EW2A 3O8NA 5DT9A 2NO1A 4KRYA 4UPDA 3VTFA 2VSYA 1EE2A 3TLGA 3Q0EA 4HB2A 3KTDA 4H1WA 3NNNA 1MNAA 1T4DA 3KLBA 4CQMD 3FLBA 2NZXA 1WXFA 3RVQA 1XMJA 2XDQB 1BVUA 3GJ4A 1U7PA 1NLMA 2BBWA 1NFRA 2FXVA 2NV2B 1DKPA 1G20A 1R9NA 5AVWA 3GJ8A 3RF6A 3NDJA 3P97A 2IOHA 4KUHA 1ULZA 1J8QA 3DWIA 3GPBA 2BOVA 1L5GB 1X87A 1CY7A 1KVTA 3PEVA 5EP1A 5FULA 2AFVA 5EJ5A 4ZT2A 1PYOA 1S3FA 1XZAA 3M6UA 3H8VA 3WL7A 2GFHA 2OYSA 1AK2A 2BFCB 2FG7C 1VSVA 2PV0A 5EQDA 3VQTA 4WVLA 1G55A 1M2EA 2Q3CA 3OWOA 1F5SA 3OJWA 4JFAA 3ZHBA 4EFMA 4ZMRA 1VSQA 1NDQA 2X2EA 4EUFA 3RFFA 5AO9A 4EO9A 2ZDGA 4P4LA 2GLXA 5HJEA 3KL4A 3CLTC 1DKNA 4EHHA 5DLPA 1AQNA 1H4VB 4G0YA 1SIWA 3DZIA 3UJ3X 1XTSA 2Q45A 1KETA 3QMWA 2NTJA 1A72A 1SMKA 1Z5NA 2PZ8A 1E9BA 3FETA 1XPOA 2H3EA 3H86A 3C1AA 1RWKA 2E48A 1NT2A 2RJ3A 3VHQA 5HKKD 3PUKA 4EUSA 3C1TA 4GQIA 5CFLA 4EDHA 4OYRA 4PHFA 3CGGA 3I28A 3BA6A 1U2GA 2YXPX 1M6NA 3VR5D 3OZRA 2IE0A 4NOJA 3OEYA 4ER5A 1QF6A 3C5WP 5KS2A 4A92A 2GK4A 4JT2A 2IHBA 3E2MA 2HI0A 3AQIA 4ZT7A 3ZQ4A 1FX1A 3U6BA 5DF1A 2PGAA 1MTOA 4PAOA 5LQCA 4HNRA 4B80A 3GQBA 1NRWA 2RHCA 1UDAA 3NANA 1V5EA 1A7KA 2OV2A 1TLTA 4GPBA 4ZOLB 4WHMA 1KI6A 1VKOA 1YR3A 2I7CA 2LZ0A 1NQXA 4I1RA 1C2YA 5DASA 4X6XA 2JK0A 3K73O 2FW7A 3JZIA 3IQXA 3MWEB 2C82A 1ZI9A 1Z5GA 1Y8RB 1QIJA 3C6ZA 4ZGBA 1UKCA 5LM3A 1HQCA 4IUDS 2ZI5A 4I4TF 2RI6A 4OHRA 3WLHA 4C21A 5AJVB 1N36B 1BHSA 4KEAA 2FSVA 5DYNA 2MINA 2Q9CA 2QG6A 3JQAA 4Q4DA 3FFBA 2BFOA 5A4DA 5CDTA 4HOYA 4PU0A 3GLIB 1T4CB 1DG1G 2D74A 4K9OA 4F4UA 3QFFA 3VJRA 3L0BA 3Q2OA 1I7QB 5J2TA 4NICA 3MRSA 4J8PA 5IBRA 4FW8A 3ZG6A 4H7KA 4C5BA 2Q3BA 5JATA 4Q4AB 3AFMA 4EJ2A 2FSGA 2ZE6A 1IG3A 2OP0A 2PUAA 3RS0A 1DDIA 1YTLA 5FA6A 4P81A 4R8KA 3R5FA 1L3IA 1N5IA 2NG1A 2NT4A 1AKVA 1NZJA 2GHIA 3QSYA 5F3DA 2PGXA 1E2FA 2OENG 5E38A 3IBYA 4I5IA 4B73A 4BP8A 3D8RA 5JAZA 5JZ9A 4F93B 3NHUA 2OXFA 2FE1A 3NLLA 4F2GA 3MWKA 1RWQA 3QHAA 4Z9YA 3WNBA 3N39C 2QQFA 1BXGB 1G8FA 3FFAA 4RD6A 3AKDA 5FOQA 2D5CA 2FMXA 2QRHA 2XJ9A 5I4KA 1XR3A 4MINA 1IY8A 2EFHB 3DMHA 4OQQA 1DIBA 4KWHA 1ADYA 2BF4A 1DBIA 2V1UA 1L7EA 3IALA 4ER6A 4TLEA 1YHYA 4YAIA 2ZAYA 4AG5A 4Z4FA 3AETB 2Q0XA 4PC2A 4XLZA 2OB1A 5HZHA 2R87A 2RK3A 3ZIDA 1PLJA 1H9AA 4RV5A 1C7ZA 3D0OA 5LKRA 1L8XA 3FCXA 4ILKA 2VC2B 4BNYA 1Y9EA 3SLGA 2Y0EA 1WTAA 2NUBA 3PK0A 2PUBA 3TQQA 3VC3A 1GKUB 2QVYX 3T1YB 5TSDA 2EIXA 3PFGA 4M9SA 4JYZA 1N9ZA 1YKGA 1VG1A 4M89A 3A3YA 4P2GA 4US0R 2PMDA 2VXOA 1FNCA 2P4QA 3OCWA 4BWVA 4TMKA 2XE7A 5BN3A 3LFTA 4E5VA 4EW1A 1S02A 1YE8A 1W4CA 4F3RA 3PVSA 5LZ9A 1QP0A 4E1BA 4JH0A 2BW0A 3P2IA 5FWDA 5FTLA 3NPMA 4LE2A 2K5UA 3DLIA 3GT0A 1ZIXA 3HWRA 1HOTA 4W5RA 1VGVA 3BH6A 4KZKA 2ORIA 2F64A 4FCCA 3JQ7B 2JAWA 3SJAA 4IX1A 2NZ8A 1W94A 5C18A 2DPXA 3JZAA 5ALPA 3LE8A 4ZVLA 2G0AA 2R5WA 4AY3A 3ER8A 3W2GA 2HREA 2HJGA 1S3IA 1J00A 4RD3A 3ILYA 1VFNA 3O94A 3UHOA 4KH1A 3EDMA 1SKAA 1QRTA 4KV9A 3GFSA 1NLFA 2E89A 2CMHA 4IHJA 5CG2A 3HR7A 1I3OA 4JC8A 2WD7B 2H18A 2XKBA 1I4LD 3H5TA 4X1KB 1FLVA 1QFSA 2HQBA 3O75A 1BDMA 4J1SA 4O4LB 3UJ6A 3G5MA 1T36B 2XSZA 3V7NA 4DWOA 3GVIA 2ZW9A 2JFWA 4R2WA 4M37A 1HE1C 1XEAA 2PXHA 4W5JA 3RLIA 4CLOB 3NYIA 3UB3A 4R1OA 1AS0A 4U1RA 3H6KA 5TGDA 3TMKA 3A37A 3N2KB 3RKRA 1I4DD 1F3LA 4QM6A 3OFVA 4HGQA 4BWGA 4RIHA 3UAYA 1AZTA 1RXYA 1TM5E 3E9ZA 4TXLA 1Y98A 2FFHA 5DH9A 3TKAA 2HJRA 4FWIB 3W7BA 3ZTWA 1VLMA 1V6AA 3PQ7A 2GYVA 2IBMA 1KI3A 3R9IA 3IDZA 2P5SA 4RWEA 1L4EA 1MXHA 1V9SA 4P53A 3QIAA 3KJHA 1TO1E 1MB9A 1XDZA 5CVEA 5AXCA 2HLDA 4DDUA 3N2KA 2Q2NA 1U0GA 2RHLA 1GEGA 3BH0A 1R74A 1CZNA 1FDOA 4N8DA 3H6HA 3D2BA 1XTZA 3C2QA 2PMKA 3WLMA 1YQUA 4H27A 2WWRA 4DMMA 3F4KA 3W5CA 3FGPA 3U4HA 1WOYA 2OQIA 2I62A 3O92A 2PQMA 5BSVA 1NW4A 1JU9A 1M8PA 4MVJP 4BGUA 6ABPA 1G1AA 2GZDA 1E1QA 4TRNA 1NBMD 1XKTA 1O95A 1TFUA 5DBGA 3W5BA 2O59A 4R7ZA 1RZRA 3U1BA 3PBKA 2YHIB 5BWCA 5JDCC 2IXBA 1S7GA 3EUFA 1XRJA 3TTXA 3LQ2A 2WPDA 4YDRA 2Z6UA 3T4XA 5CGZA 5AW4A 2VRCA 3IT1A 3OE7A 4G9EA 5E4TA 3UG7A 4OI0A 1PK7A 3DBRA 4ENWA 2R8ZA 3RS9A 2WKWA 3N8NA 4QOJA 5KEIA 3IQIX 2XOKA 5TIIA 1BE6A 1ADGA 4KV7A 4CF3A 4JP3A 4EX6A 1KBZA 1Q0PA 2BV3A 3AHFA 3WLPA 2C3UA 5EHQA 1GQYA 4TRRA 1F14A 3H4TA 3U17A 4G4IA 4PC7A 3HJCA 3P2MA 4NYJQ 4V38A 5KJEA 5IT4A 5KQRA 2HHHB 2BKAA 4DRXB 4XW2A 4EG7A 3UB4A 4WLUA 2UVQA 3IBCA 1IEQA 3HLKA 3TIXB 1PNRA 2FUCA 4L5CA 4R16A 1FFXA 1M7BA 3OTHA 4L2IA 2FN9A 4FBGA 1QVWA 4Z0PA 5LWQA 5B6JA 4ARVA 3AETA 5EFZA 2CNWA 4DR4B 4IHQA 3DO8A 3CFYA 4TWZA 5TJ9A 1K89A 2HA0A 4GKJB 5FBVB 4UVGA 1QMGA 2HA6A 3R5KA 1NNSA 4MZXA 3RV3A 4C7VA 1QYIA 4X8LA 1WS6A 3KETA 2WJ3A 1RXEA 2ZU6A 2O8EB 4BJHB 3VU9A 2R1VA 2DR2A 1TUBB 1VI2A 4JBWA 3MJTA 5AJTA 2ZJYA 2XNHA 1IOLA 1G8YA 1SPBS 1UBOS 1UFQA 4XUEA 1VRWA 4YB8A 4YMHA 3CB2A 5EIEA 3EH1A 3OPYI 3GCDA 1SEVA 2A67A 4AZVA 1IJFA 3BMNA 2C98A 2PHZA 2V9CA 4E5SA 2GN4A 2SICE 2AQKA 2PQ6A 2ZTMA 2F55A 4BNMA 3P0JA 5CDYA 2QM0A 1QQ6A 3VOAA 4N18A 3P19A 5GJCA 3RU7A 4S1OA 2ONYA 5A1JA 3D7KA 1JKJA 3DBOB 4FEGA 5JBIA 1U02A 3ZY4A 3CLHA 4OQXA 2AZ4A 4AFNA 3GNLA 4ZVMA 5DXJA 3C87A 3WNCA 2NPFA 2CJFA 5F2OA 2JZOA 3JD1A 2RARA 3W5AA 2P67A 2YY7A 4GPTA 4AY5A 3VTAA 3KJIA 1W6UA 1V2HE 3EFOA 3RR2A 1M2OB 3FYDA 4A3SA 3WBBA 4BS9A 1R6AA 3FWYA 2PANA 1DDGA 4OBEA 4KLZA 1Y6RA 1U8XX 5GINE 1WMBA 3LDHA 4EYEA 5ED0A 5J4KA 3L8EA 4BZPA 2QTLA 4ZGGA 3ORSA 3V48A 2QX6A 2XUHA 2I4TA 3KBBA 4NK5A 1P0CA 2V03A 4XM2A 5JRJA 1Z5ZA 4PIPA 2V6JA 4L16A 2C1ZA 2VHZA 5JAMA 1YI0A 2EP8A 4E31A 4UXJA 1A2QA 3HYLA 3DCNA 5AVUA 2QZPA 3C74A 3FR7A 1KKLA 4UBNA 3QWIA 4H4DA 3KB2A 3SXPA 3PHCA 5EFOA 1KSFX 2MSKA 3WYAA 1G42A 4IQFA 1XO1A 2JI4A 5CX1A 5FOSA 3K2EA 3CH7A 1V25A 4EA7A 1ZSNA 4QOIA 5DHFA 4ILEA 4KQGA 4B71A 5IDQA 2ZJ6A 4PHTA 1DQSA 2NVUA 5JCOA 1TM1E 2VJKA 4ND1A 4OHMA 4GICA 3W2IA 3II6X 2CJWB 4PQFA 1T3GA 2Q2OA 3QFSA 1F8YA 2Y0PA 2JHGA 2AN5A 1M34A 2DFNA 2WF7A 3VPGA 1Z74A 2P5YA 2HPHA 3JWEA 4FW9A 5F77A 4FFPA 2OXTA 5HUJA 1E3QA 1RPAA 1YMVA 2X5KO 3K9BA 1MQSA 3FVVA 1SHLA 5JMTA 4F7DA 3R9XB 4FFWA 4C7OA 4ZCQA 3UQZA 1VYUA 5DHSA 3T1TA 1XGKA 4PAMA 4RF3A 4KUGA 1Q7BA 1YIDA 1R9GA 1K7FB 2C7BA 1N5KA 4WUVA 2IELA 4Y9DA 3WGVA 4DA9A 4XVCA 3M5DA 3EY4A 5ER9A 3VO2A 4DDTA 4ZJZA 1L5MA 2R8YA 1UBMS 5EZ5A 4I4TB 4Z4HA 5K4HA 1COWA 3EXEA 5THKA 4ACAA 3V8BA 1SBCA 2F3UA 3G1TA 4NKRA 2FJ0A 4Y9TA 3AUAA 4BEBA 3EA4A 2YWEA 3Q85A 4EAAA 5EJ6A 3EVTA 5CM2Z 3Q3GE 3UEOA 3QLTA 4HCJA 2VRNA 4QU9A 4X3OA 2IZ0A 3HCAA 1K75A 3A11A 3CA8A 1ULAA 4C4TA 1SOVA 3KDAA 3U7RA 5CYPA 1CXZA 1GA6A 2HSWA 3AHIA 3VC1A 3VSAA 3ZNOA 3KFVA 1XA3A 5KTPA 2NV6A 1H85A 2QOEA 3DD5A 3BFJA 1E6UA 4X5OA 4OHOA 4HNUA 1U0TA 1U1FA 4TS3A 3IESA 3S5UA 3TINA 3GI1A 2D1TA 3JZDA 2WTBA 5DK6A 4ZANA 2VCHA 1NVMB 2ZRLA 4Q4HB 1T5SA 1MX1A 3PLNA 1E2LA 1BW9B 1KGDA 1VE6A 4M7PA 4MQUA 3HUFA 1V4BA 3LCRA 4WZBE 5F78A 3OICA 4QBTA 1Y1LA 2ZWOA 4EQZA 2O19A 3X1MA 2W9XA 3EA0A 2IW3A 2Q4TA 2E37A 3R3ZA 1N5JA 3HVHA 3OCYA 1D2HA 3KWJA 3I6BA 3NRCA 1DC7A 2I71A 3PEEA 2O8BB 3B53X 2QL5A 3KQOA 3WC4A 4ZQEA 4DA7A 5DN9A 1BSVA 3G7UA 1QRAA 4KIJA 2HM7A 1I4TD 4CCYB 1QO9A 2QD1A 3EZ9A 4CBVA 3X1XA 1E1KA 2P65A 3DOIA 3AUYA 1L1EA 1HFEL 4MW1A 4E13A 3MWLA 5ANRB 4YHHB 2C4WA 3BSWA 2QW1A 4L8FA 4NYMQ 4AUNA 3CVUA 3K0CC 2D0PB 3IX7A 1ZM9A 4RXMA 5AJXA 3RC3A 2NYUA 3QFHA 4L50A 1KERA 4QAJA 4RVFA 1BX3A 1E7MA 2JJ1A 3B89A 4JELA 5DDIP 4IRUB 2IE8A 5H3CA 3P4XA 2AZMA 2JBAA 2RHWA 3R0JA 1ZFNA 1A7AA 1R2QA 2HLNA 3AIMA 3K1JA 3O2JA 4QKQA 3D4OA 4LZAA 1NC1A 3OH8A 1XZEA 4Q21A 4BEWA 1EI9A 2GBGA 4LDQA 3VAAA 1DMSA 5CEFA 2NXEA 4OQFA 1YCGA 1ZNYA 2QUZA 1ZCAA 3O26A 2AQIA 2Q41A 4FP9A 5H7XA 1NW9B 1F8FA 1H8ED 2JGAA 4MEAA 5EJIA 4DV0B 1EQAA 2Y9PB 3FNEA 3GRVA 4X85A 3C3PA 4O3MA 2ZE5A 3IB3A 4QUHA 4F3YA 4P1ZA 1UM8A 4UTZA 2WDPA 3BTUA 1FFCA 4HGOA 1QHIA 1WSDA 2XRYA 1Q6YA 3FVQA 5JSKA 3SJ7A 4Z4IA 2R7AA 3DEKA 3WX0A 3BTSA 1OWLA 3TOCA 2ZCUA 4OMFG 3CUSA 3RS4A 1W44A 1NX6A 2B94A 2V3WA 3W2EA 4EFNA 3R76A 3THXA 3WHPA 1M6VB 1SUEA 1U94A 3N3BC 2Y93A 4PV7A 5DYIA 1U80A 1U8YA 2YFKA 2C0QA 4I0WB 4M49A 3PPXA 2ZAIA 2G07A 1N2IA 2XJ4A 3G8BA 3OIDA 4IS3A 3IEPA 1F4PA 4TKMA 4ZC1A 3QEMA 5FUWA 2A94A 3IKLA 5JNRA 2EKLA 4GBMA 4WOBA 2Q4EA 2QF7A 2RGEA 3JWPA 4BAUA 3FPHA 1I1HA 1NBOA 3LA8A 3TBFA 3TW8B 1RI3A 1C8BA 5JQGA 1ZOSA 4TMTA 3PC8A 4TYQA 1YB5A 5IKMA 3FTPA 2VDRB 3ANLA 4LXIA 1R4AA 2ZI6A 3PVZA 3S4YA 1UXKA 3ZE6A 4DCOA 3MERA 1SELA 1UKEA 4UMFA 3REQA 3FZQA 2Q1WA 1L4BA 5DHAA 4F92B 1J21A 4JHLA 4BC1A 4MW6A 3SX4A 4C06A 3Q3JB 4ZQBA 5HKKA 2ZBUA 3ONEA 3STVA 4R98A 3UFXB 5IHXA 5ICMA 2BEKA 2IIPA 1I6KA 2WQ6A 1WCV1 3OD1A 2GZ3A 3AUTA 5ENZA 2VHVA 1PYDA 2XAUA 3SX0A 1PJBA 4O4JB 3TUIC 3EGVA 3USZA 4AWBA 4MO2A 2PXAA 5J4HA 3MHTA 2VP6A 3INGA 3DVSX 3PU6A 4NU6A 3UV6A 1B1CA 5JI2E 5K6AA 4PCUA 5IZCC 3GUZA 1QFXA 2W6MA 2QNBA 4YRBA 4ON9A 3IOMA 3IKVA 3CVOA 4RENA 1WAMA 2AFHA 1YR1A 1R4NA 3D8UA 3KD3A 4Q02A 5G40A 3ZH2A 3TDMA 2BHTA 3VH1A 5B64A 3N2GA 5BUCA 3ITNA 4PFKA 4V03A 5L53A 5KB3A 4E07A 3DTVA 1GQOA 2ZI9A 1MRNA 2P75A 2A1TS 1DDOA 3AHEA 1WPRA 2CDBA 4E09A 1OX4B 1VMKA 4JLKA 4DLZA 4AW9A 4ZVOA 1V7QA 3WMGA 5ADUS 2VJDA 3CX6A 2OZLA 1XC7A 5G4KB 3A9SA 1VMEA 4QRHA 4YV7A 2O2CA 2F67A 4MYUA 4DLLA 1YFZA 5LDHA 4UHDA 2IKSA 3EPKA 2V0GA 5AW8A 4PINA 4R5MA 3HWX1 4FXPA 1LRKA 3O0DA 1G5HA 3NOQA 4RPCA 1F7VA 1X7WA 2VHYA 5A4KA 3H5VA 1IC6A 3OE5A 1AKYA 1U8UA 4J3NA 5FI3A 4EMBA 2X41A 2QP9X 4FFRA 1V2GA 2QTRA 3LUFA 4B43A 3I34X 3N2EA 4MW0A 1P9WA 3IEIA 1A71A 2GCPA 3ZN2A 3OQNA 4BNTA 1FQKA 1LA2A 1TO6A 4RS4A 3QXCA 4XRGA 4DPKA 2EZUA 1JNXX 3OZSA 1N8SA 5ULLA 3PRHA 2PS3A 3KXLA 3HR4A 1F51E 4OKIA 3RODA 4UUBA 2R1VB 4HFMA 5A03A 4N6NA 1DUVG 1GPBA 1D4AA 1JILA 1TA0A 3GGOA 3IE0A 2O2YA 1XRLA 1IQRA 3K70D 2WSLA 3TLBA 1SBZA 4OGFA 2WUEA 4F9FA 1ZESA 1YAJA 2Z3WA 1JR3E 4ZMBA 1DFGA 3CC8A 2O9JA 1RFLA 1E92A 4MQMA 3MGKA 1QIFA 4KRGA 3NKFA 1XZJA 3L6EA 4Q82A 4BNJA 2HC9A 3O90A 5CA0B 1QQBA 4QXRA 1PG2A 2O3SA 3OWHA 4IAOA 1SB8A 2GRUA 3IODA 4Q3OA 1P1HA 3A2LA 3GGPA 2X9LA 2Y27A 3FUVA 1G3RA 4E2YA 2HJSA 1C0LA 1E3JA 2HNBA 2P2ZA 3KWMA 5DLEA 2WTEA 3ZPXA 5AW7A 3NQ41 5CLGA 4ESVA 1J42A 1E2UA 4RUKA 2F1OA 2B0CA 1IJKA 1KHHA 1PT7A 4RZ2A 3A4TA 4URYR 4Q05A 3QNWA 3UFXA 5FA8A 4XB1A 1T1RA 1BOOA 3B7WA 3KVOA 4HAVA 2IU3A 2PO7A 4H7DA 4L8WB 2RB5A 2WP0A 4QSMA 1T2FA 1Q19A 3ZOZA 4DM4A 4GL2A 5FL7A 2PSJA 4OUDA 4BE7B 3VR6D 3L4BA 1GG8A 4F2DA 5FPKA 1JU3A 2DCUA 1MVOA 1ODFA 1OI7A 3EHDA 3KEMA 3PF9A 2IYNA 3RH0A 4EG0A 2AHRA 1M1XB 4NCIA 4LF4B 4I6EA 5E2BA 3TL3A 4EO4A 2HCRA 4CF5A 3QYAA 2WD9A 4LOIA 1M7HA 3MWJA 1LRJA 4RLQA 4B6JA 3F97A 4DS3A 1HEIA 1LJUA 3SZOA 1ZM7A 1C3VA 2P1DA 2EVWX 3AFIA 3OEHD 1WNTA 1JZSA 5AVTA 1FDSA 4RZ3A 1T4MA 2JFUA 4ZQGA 1GN8A 1R6BX 3A70A 4Q34A 3AVTA 2ZIFA 1A4RA 3LHIA 4RHTA 4F8EA 1QDLB 2YTZA 2F62A 3FBGA 3OOYA 5A05A 1KQNA 3MHPA 3ZCVA 5CBPB 2FZWA 3W8RA 4RLFA 3AC0A 3M3DA 3HH8A 4R54A 4F45A 4JQOA 1EE1A 2H8GA 4JYAB 2ZRFA 4UD6A 2JAHA 3PJDA 3MMNA 3QXXA 3K9CA 2ESRA 1NQOA 1ZD9A 3MMXA 4L3OA 4E5UA 2HRRA 2ATIA 4EYQA 5JPIA 4MRMB 3SYLA 4JLPA 1E6WA 1S8NA 2QT0A 3P9KA 1IRIA 1ZIPA 3GEHA 4JU9A 4LBWA 4N0DA 4DV5B 1Y3CE 3QITA 3DOEA 2JA1A 2REQB 3LY8A 4MDHA 1WUIS 4Y6GB 1SVSA 1N2HA 2R8OA 2R6HA 1TPZA 3AYXB 2XWJI 3G8CA 1UAGA 4MW5A 5JVDB 3PG5A 4J0CA 3BF7A 5I7UA 1TA9A 5AUQA 1ELOA 2OQRA 3AUSA 1GCIA 5FI1B 4X62B 1ZVVA 1E9RA 2EF0A 3HKEB 1O97C 2YRXA 3TOSA 1RYMA 2DHCA 4AJPA 1NMEA 3A4LA 3V4OA 1D03A 1WDMA 3DCJA 3KEFA 3NM4A 4OJKA 4U4AA 2QLJA 4XFKA 1KMQA 1ZGJA 3CRRA 5JLJA 1P33A 4F21A 1Y3AA 4GUAA 1OROA 5DXAA 2OFXA 2P62A 3AERA 4RE5A 4Q66C 2C9BA 1ZA2A 4FZVA 3IUMA 3O1LA 4FMBB 2PIDA 4JKIA 3RAJA 3U44B 4K9SA 4WX2B 4JMLA 3ACDA 4XXHA 1D8TA 1JG2A 1IWPB 2RHHA 4QXMA 3SS7X 5BT9A 1XDDA 1XCLA 1OQAA 1E7SA 1VA4A 3EGEA 3FDZB 3OJLA 4AZ0B 2IEDA 1TCUA 5EINA 1UZMA 3GUUA 4EPVA 5JNSA 3STUA 3NVMB 4K6KA 3O4VA 5A3RA 4RGYA 721PA 2DQYA 4UZEA 3CT6A 4NWIA 3UT5B 4D26A 5CVCA 1DELA 4TS9A 2RG1A 3IUQA 3S8MA 4GFDA 5F4ZA 4YUWA 4M83A 4Q16A 5ALZA 3ASYA 1W47A 1XD2B 2Q5OA 4O2AF 3WK5A 3EZGA 3LX8A 3KUCA 3U7EB 4L15A 1TRHA 3M9WA 2J3KA 5JS1A 2W11A 5EQTA 1O8BA 1W7AA 1UFKA 4DPLA 1QHGA 1JS1X 2R86A 1P7CA 2AV6A 3DCIA 3AHJA 2WUDA 3WIBA 1JFFB 3PITA 4H3SA 1S1MA 5CH3A 2RI0A 4MVJH 3FPBA 4TMYA 1LFDB 1ZOOA 3AVPA 3OQJA 3RS7A 1BYUA 2PKRA 1TEVA 5JAUA 1ZZEA 2BBOA 4RFSB 1YE5A 1OU4A 3K30A 3Q9SA 3M6LA 1UWKA 1WCIB 5I7WA 2IK8A 1THMA 3K72B 1PK9A 4QATA 3WNVA 2KWIA 2OFOA 4B7ZA 2VG8A 1JTEA 5C1IA 3W04A 4O6VA 1IOVA 2DWQA 1UPTA 4UEWA 5CT8A 1GUAA 3KQTA 3G8YA 3H4IA 2RCNA 2BBSA 5SY9A 3WWCA 4RTPA 1EJ6A 1JDPA 4QSHA 4ID3A 1BYIA 3N0RA 5CX4A 3O21A 3NDBB 3D4LA 1RIIA 2KLBA 3UMSA 5ALIA 5EZYF 6AT1A 2Q99A 5H8WA 3BXZA 4G0OA 5EJ2A 4QL3A 3VPCA 2ZITA 3MNFA 2QL6A 3BXPA 1N2CE 4E12A 5BQXA 2OMEA 5ED4A 3L8YA 4J7AA 4GX5A 1QS0B 4KOAA 1RNLA 4B79A 1GTZA 4OYYA 2UYGA 3AI1A 3HKDA 5I7EA 2B83A 4Q4LA 1CB7A 1NJ6A 1CUGA 1ZCZA 5H16A 3ENVA 1QYCA 1R3UA 5IJAA 4I1IA 2LCIA 1PL6A 2PZFA 1X1CA 3FKQA 2HCBA 3MTJA 1UEJA 3DMYA 4K1XA 5HGXA 5THXA 2I0FA 3C3MA 3E8MA 4NBRA 1KBOA 3IAS6 3RUFA 1GRCA 5E3HA 2BM0A 3GJ5A 1G0OA 4PGFA 2H16A 3QMPA 4E21A 4EJSC 4O2BB 5K0ZA 2PGLA 2GZMA 3O4FA 1ZOPA 2GCOB 1GNVA 1ZL0A 4PZCA 1NSTA 4MGYR 3PS9A 4FHZA 2X6TA 3UT6A 4BQOA 3I61A 1RRPA 2YXBA 2GZSA 2NO5A 4JP8A 1E7RA 1YRAA 1MMFB 4JLVA 3GGDA 1ZJ5A 4Q15A 5DTRA 2O3RA 3PENA 2YWXA 2CYAA 4JMPA 2PZEA 1AJEA 2OR3A 2XODA 4RPIA 3AK4A 1S96A 2FWBA 3TX2A 4CT4B 3A4NA 4UD2A 3KKZA 1QSGA 4W8HA 3MTBA 1F3OA 2FPPB 4HNHA 1QQ5A 1XVIA 3R4VA 3HJHA 1SVWA 2YJTD 4PXAA 1U99A 3W0LB 3WBFA 3X0DA 1LDYA 4GC5A 3CRW1 1KZ7B 2B1IA 5CP8A 2JCVA 4HLCA 2IEBA 1PR2A 4H17A 5I01A 4M4SA 1M73E 4RGQA 5C8VA 4BRUA 1Q44A 3UMRA 3LL7A 2VPIA 1VDMA 4Q3DA 3VR2A 5JQWA 3VPAA 1XD9A 2JRCA 3ZW9A 4JLOA 2J0SA 3A58B 3LDAA 2OM2A 1B0ZA 1RJDA 3OQ6A 4MIYA 5EIFA 1PIWA 4Z51A 5L51A 1VECA 3OCZA 3QA9A 4GXQA 4IH4A 3HVJA 2OCLA 5BW5A 4TSRA 1B43A 2OLKA 2R8EA 5LQDA 2W6ID 3CH5A 3WQQA 2B30A 4ZHQA 4HDMA 1AQUA 2RGDA 3DONA 4K6FA 2VDKB 3VYRB 4TKVA 2NP7A 1M8KA 2DHRA 3I5YA 2C1XA 2QI9F 4FLFA 5BW8A 1ND6A 3U3JA 4PLYA 3DG9A 3VZBA 3FDZA 1RW4A 2OGUA 3BGSA 5K0CA 3VI4B 2R96A 1X7WB 3GFFA 3P0FA 2FPOA 3L49A 4N65A 2BJHA 4I3HA 4DCVA 3H0CA 4UM9D 4W5QA 1R27A 4YP6A 2I4NA 5T6BA 1UK7A 1UJBA 2PLWA 4J3FA 3AQ4A 4LOJA 4ZO9A 5J4YA 3A4IA 2IDJA 3M2PA 5TE9A 2ERCA 3G2QA 5ALQA 2VTVA 3NHMA 5H5JA 3COYA 2EARA 2WPDD 4J4BA 1GTRA 2C4HA 4D45A 1GTJ1 2FEKA 2NUAA 4GDMA 2QYTA 1JR6A 1T6ZA 4EKIA 2BFPA 4MV3A 3L7YA 5DM4A 4ZKDA 3A10A 3GRYA 4EPTA 4D41A 3GFBA 1TK3A 3QOFA 3R6TA 1WF6A 3EC7A 3VDNB 5DI3B 4BP9A 4I2VA 5JVDA 2GN8A 3ZHXA 4HFNA 4Q47A 2TMKA 1LU9A 1TA4A 2GVNA 1E66A 1XX6A 1PI3A 2FPGB 3A7DA 4S12A 3SF8A 1Z2NX 2REQA 1SBTA 3H0KA 2V9ZA 1U8AA 2FFJA 2A9PA 3AU8A 3X2EA 2D1SA 2W37A 3R20A 1Z16A 4BZWA 5B55A 3ZLUA 3LRTA 1LNSA 3EUAA 4DCJA 2G17A 1A5AB 3DE1X 4K40A 4RXUA 2TRSB 3DAHA 1J1IA 4G9BA 2CCKA 2HCFA 2O7NA 3PWSA 3FOWA 4NCHA 4QLOA 4RFVA 1U2GC 1TLLA 3H3XA 4ND5A 2VJPA 3UBMA 5C5DA 4RMHA 4X00A 3VH3A 4BLVA 1HSZA 2W6PA 1NMXA 4NPHA 3VJKA 4OLHA 2CKDA 3UAXA 4DNOA 5AUNB 1UKAA 4XYMA 3PLAE 3H9BA 3REQB 3NTUA 3HYTA 4DRYA 1PNVA 2WUVA 3QVXA 4ZI7A 4B3GA 3P9QA 2IVZA 2VUUA 3KT3A 2M6KA 4UHBA 1MENA 1UT8A 1Z56C 3AVQA 3IIIA 3JYLA 4I3GA 3UUFA 3I4CA 2HWWA 3DXZA 4LVUA 3BFKA 4DDMA 3GZNB 1Z83A 4WCDA 3TH5A 2JG3A 1G17A 1EX7A 1U28C 4UNRA 5KOJB 3KLOA 4FE3A 3O2SB 3KCNA 3B7PA 1Q74A 3BGVA 2AJ8A 3ZBPA 5JPCA 2GM4A 2ZZKA 4DT1A 1N3YA 2Q5EA 3LRXA 4Y1GA 1Y33E 4HBZA 4LCJA 2EL9A 1YZTA 1SVLA 1RXIA 3EXG2 1OXUA 1T8PA 1YGPA 2PWZA 4ZT3A 3QTBA 3GJZA 3LHDA 4GSYA 5ALJA 5FTKA 1QU3A 4ZIRA 1EBFA 2F2TA 5C3MA 1CCWA 2QG9A 1TF5A 4TTTS 4B6QA 3H2JA 4IDEA 4GZLA 3O7MA 2NPIA 1KYXA 4PM4A 3WRWA 4HH1A 4K9PA 4KQ6A 5BQPA 2J5BA 3R40A 4MEJA 3FOZA 2R5NA 4P4UA 1CY4A 1G5TA 1KQGA 2HF9A 3REOA 3UG6A 2P9TA 2O23A 1DRWA 3G02A 3ZIAA 4AJIA 4B2PA 4K9QA 3RRMA 2OHHA 4UQOA 5J5AA 4MVXA 5IH3A 3VKWA 2JKYA 5CLHA 4CLXA 3GLRA 4YCAA 4FUQA 4EBBA 1JJ7A 3D02A 4Q1BA 2BGGA 5D3MB 2YWBA 4M54A 4B7CA 1XK7A 2IHKA 3RI3A 3SYMA 2VP2A 4R8MA 1YRHA 3B6IA 2WJGA 3FMFA 1ZBQA 3X1JA 1T24A 3URMA 2Q9UA 4L75A 3AR3A 3NBYC 1KO8A 1EUDB 1VCIA 2JK1A 4MUFA 4QDJA 3L7LA 4X1IA 3V1MA 2Z5VA 1NXXA 2G9QA 5MGBA 2E5WA 5FWXA 1AOXA 1LD3A 5J2UA 1TJYA 3PGMA 2CKMA 3FOAA 3LVRE 1O6ZA 3D9QX 4JLAA 3TLYA 3WWEA 2QXYA 4RX1A 3BFVA 4CIWA 5B37A 1T1SA 2ZROA 3G88A 3R74A 2QM8A 4DMGA 2PQ2A 1Y5MA 3FG9A 2FPUA 3JQ7A 4B8YA 2UVPA 4NMLA 1OZFA 2VNJA 1JHUA 5GV8A 821PA 2WWTA 1ECFA 3FPEA 4BNXA 3PEWA 2FN3A 5FJJA 4U7DA 5E2IA 3ZS8A 3H87A 5EJAA 1VPWA 2H1HA 3AKZA 3UC5A 4BMVA 1UINA 3KVVA 1SKMA 4QJ4A 5CHEA 1DEOA 3K9FC 3AF3A 3PTZA 4F9EA 1NBMA 3WIEA 4MJLA 1FNDA 1U0FA 1FDWA 4U0JA 4URUR 2RGYA 4AY6A 5IULC 2R6AA 2JEYA 3FY4A 3AMVA 1BDIA 1Q83A 1VI5A 2CVPA 2PNFA 4LOKA 5EWLA 3M5PA 3ACBA 3TO5A 1CJCA 4TYNA 3TM4A 1PGOA 1EJ2A 2XGGA 4OP1A 3M6WA 3GAFA 3RFTA 2ZJAA 4IG4A 4HVCA 1TAHA 2O5CA 1GADO 1DGQA 1R6XA 2IF0A 3GLHA 4H0FA 3A2KA 4M8SA 3EXEB 4TYMA 4I4TA 3OOSA 5LDDC 5J47A 3E58A 5K05A 3BEOA 3KEQA 5JJBA 2B8WA 5LOVA 2AFRA 3AF6A 3U5TA 1U7DA 5A4MS 5B1SA 1A9OA 3CB4A 3BMOA 2C9ZA 3HY6A 3M7IA 4DBLC 1NQWA 1VSTA 4WASA 2HK8A 1OILA 5J2TF 4D0LB 1WMDA 1Y63A 1DWOA 1MQ8B 2YXEA 3DQZA 5LMUB 1Y4AE 3Q7QA 4H0NA 4RJ2A 4BZQA 3I62A 4Q1AA 3T95A 1U90A 5KNCH 4XSHA 3Q0TA 3COJA 2UUOA 2Z57A 2G7ZA 3F98A 3P94A 3QYJA 4AMYA 3GGGA 1MX9A 3KPWA 4YCJA 3RVDA 5AM2A 1R4ZA 4HQFA 5J3JA 5FB3A 4XAQA 1Y48E 1LNZA 1NMYA 4U6SA 4D0GA 4LHEA 5I7HA 1GPKA 1PR3A 3BWBA 4BO1A 1Y3DE 5T64A 5JU6A 1XRPA 3K8YA 3K9NA 4HP8A 5IJXA 2EC5A 2CLDX 1QJCA 3GEMA 3E27A 1N2BA 2GYWA 4IHKA 2GILA 3PGA1 1M8GA 4BP1A 3SQXA 2X0FA 3U40A 3WRVA 3PQ5A 1T9DA 3L7KA 4RTSA 5E4YA 1JQAA 2APJA 4UHKA 1Y6JA 3HDHA 2G0TA 1DVRA 3ICWA 5EAIA 4F9GA 2O2JA 4XVUA 2EWVA 3GH1A 1E3WA 1U2EA 4DNPA 2GCEA 2R6R1 4PO3X 3NOXA 5SZHB 4TVOA 1J70A 1XYVA 2GAJA 1XRSB 3WLIA 1ICEA 2MU1A 1TOAA 4EQ6B 3TUZC 1CLEA 2J4FA 3CLUC 2G72A 2YRWA 5HCUA 1S6YA 3ZCXA 4HDKA 3OIUA 4AUEA 4BX2A 4F7WA 4QLBA 5HQTA 3WV4A 4MP3A 2VPQA 3RGWS 1SZJG 1LBQA 1YIAA 5FOWA 2R65A 1AGYA 4MQBA 3MJVA 2EZ8A 2HNKA 2GK6A 1O9GA 4XVHA 5E9WA 3UJAA 1N75A 4B7AA 1XZNA 2I2AA 2OGTA 1U1GA 1Z6GA 1JFLA 3CZQA 3VVMA 4E2ZA 5ADVA 2OT3B 1C80A 2JARA 4WLVA 4I6JA 4GM1A 1RJ9A 3MCWA 3OZWA 3EPRA 3GPCA 5FUBA 4N39A 5DIFA 3VR6H 3GQBB 4MYRA 4BEVA 2C2KA 2YVAA 1QPBA 2Q27A 3D7NA 3IAFA 4NFSA 4OVKA 3UZUA 2XIQA 2HQ1A 3TWOA 4C03A 1GQSA 3BL8A 1EVKA 4OK6A 5LNK1 1XPUA 2HHAA 2CWWA 3ZV4A 2VAPA 4YONB 1NV8A 3I6ZA 4JJ7A 1II9A 2QROA 3LLCA 2HMTA 2GM3A 3SVTA 2O8FA 4WFQA 3L77A 4RH0A 1GPAA 1RPZA 2F59A 4I81A 5HCNA 9ABPA 2R2AA 2NZ2A 4GM4A 1EVJA 4IOKA 4X6YA 2FRDC 5A04A 3ZUPA 4MMZB 2OLJA 2WHQA 3RVOA 4NHEA 3A26A 3F71A 2QLMA 3LC7O 2L82A 3WFJA 1CEXA 1FFXB 4F56A 1WCIA 2XYRA 1XVLA 3LMKA 3NM6B 4O25A 2YUTA 2BMWA 4C1BA 1QKIA 2EW1A 1PBNA 3K96A 3PA8A 3FRIA 3A1UA 3BJZA 3QPCA 1JEJA 4MS3B 3RB8A 3RFUA 2Y66A 5FAKA 5CTAA 3OCXA 2XR1A 5FCDA 3EZNA 4C3VA 1YMUA 1YTUA 1XZKA 3C16C 3C3BA 3FSGD 4OH1A 3FPFA 3P9ZA 3L8CA 1WX1A 4QE3A 3L4BC 5F1OA 1ISHA 3A9CA 3OZGA 4JR1A 4XOUA 3LNCA 4F5YA 3L7MA 3H13A 3QV1A 4FILA 4KFRA 2FUKA 4U00A 1FE8A 2F48A 3DL7A 1TAGA 4ZO7A 4D8UA 2DERA 1TKCA 2KX7A 3AKEA 3R3YA 1V39A 1SD1A 1R9MA 1XKLA 4KCGA 5AKEA 3SKYA 2QPOA 5HG0A 1Q7RA 2NUPA 3DKVA 4J91A 3QJGA 3S8EA 3CCBA 3S1AA 1DWQA 1DJNA 2OM6A 4KXNA 5AHXA 3VNSA 3WP1B 4MQ4A 2IYZA 4EFKA 5AHOA 2C5FA 2AEFA 1SU8A 4GD3Q 1AKUA 1HDOA 1JLLB 3K5WA 4XYGA 1G8SA 1P17A 5BN4A 1RP7A 1YU6A 1PF7E 5EHGA 3HXOA 3P0RA 4CZ2A 4RE6A 2GJKA 2SKDA 1VL1A 3OOJA 2DG2A 1O5TA 1VL2A 3HB4X 1DAHA 4CDGA 1L7PA 4Y6RA 3ZY2A 5FH9A 4NESA 5L3QA 1JG6A 2DLCX 2HEGA 4LG1A 1L6IA 1O03A 4KQKA 2IZ7A 1UP4A 4HQKA 1W4LA 3N0WA 1Z5OA 4RKFA 1L4LA 3AGQA 4WZAB 3NTVA 1XSEA 2JGEA 3RYFA 4ENQA 1ZJ4A 2PGNA 1OBFO 2HA7A 2QTBA 3CLSD 4I5GA 4OJMX 5TMEA 5BNZA 4QASA 4N7BA 3WGYA 4CG1A 4V1CI 3EEOA 1H93A 2GS9A 4OSPA 2RJNA 3M3PA 1TT5B 1QLHA 1SEPA 3DMGA 5LWHA 4DIEA 5FPSA 1T4CA 3DT9A 3HDQA 1N3IA 2QXTA 4KWTA 1IUNA 1UH5A 3C7AA 4A2CA 5ALVA 4UUAA 2X4IA 4WN9B 1E98A 2D1QA 3B9PA 4BV3A 3HB7A 4XSGA 1K5DA 4MS1A 3ULKA 4NL4H 1TM4E 2NZVG 1A4XA 4CU5A 4F3NA 5CDFE 4GSKA 2JFQA 2XLBA 1M2GA 4YH1A 3M6AA 4N49A 2IZ1A 1YJAA 1Q3HA 1MGPA 1T1EA 4MIEA 1Q7TA 4P4NA 4X1KA 3L8HA 4YRGA 1V26A 1NM5A 4IQ4A 4OMUA 3Q2IA 1RDFA 3DBHB 4K8RB 1KI6B 1QH8A 1FW6A 3LI2A 5HE9A 1ACMA 2Z5FA 4BXOA 2CB9A 2XYGA 4D4LA 2W93A 2WK1A 2CFRA 3OZBA 4MKHA 3V4LA 4JL5A 2B20A 1CUDA 2JFHA 3A6KA 1HOXA 1QGZA 3HKBB 1T6BY 4DR6B 1XZFA 2FPMA 2OECA 2ZB8A 2JATA 4A16A 1I3NA 4AJLA 3H9UA 3HBFA 3KALA 1N77A 4S2UA 3D6AA 3D6UA 4OMCA 2WJHA 4P34A 2Q3FA 5I47A 3K35A 3F8TA 3EXFB 4DG8A 3B1VA 3S1SA 3L4KA 1I30A 4OA8A 2FVXA 2ZYSA 1LSOA 1R6TA 2BMFA 4MUEA 5DV9A 2JGJA 2VDVE 1NRXA 1WB9A 1KC3A 5LLDA 3PJRA 3GEBA 2VO1A 4OI1A 1H69A 4BKPA 4REQA 4F5WA 1L7RA 1SG0A 3KQUA 4IJKA 1PNQA 3DKRA 4TN5A 4FC7A 4LZJA 2DTEA 4A7PA 3RVMA 2VATA 1JLRA 4PF1A 2FFAA 3HCOA 3K1AB 4U6QA 5JCJA 5IK2D 3D5TA 3IEXA 1W4AA 3R5XA 4MW4A 4DTIA 4R0MA 2OK8A 3QEBZ 4NATA 1MKYA 3KEOA 1EP3B 1BCRB 1IE3A 1MJFA 1TC1A 2X8WA 1I80A 2CFTA 3O8LA 3FGOA 4FNMA 2VJMA 1TM2A 4O59O 5ALWA 4EHAA 4N01A 1PG0A 2B21A 5AW0A 1P9LA 1P7WA 1ISSA 2LKCA 3ISJA 4RW0A 5AKHA 1NP3A 1J2UA 4LY6A 5EHNA 3AM1A 1HE5A 5DOVA 3HS3A 4R1UA 2XECA 3H1BA 3TL2A 1Z2PX 2PFSA 2QYSA 3PPWA 2AG8A 3AIKA 3BJMA 2XT9A 3RVSA 3UW3A 5B30A 3KJEA 1IG0A 1UWVA 4LJYA 1G3UA 2QE7A 3IS3A 3QK7A 2DPGA 3LF1A 1A4IA 2IITA 2YWCA 3PEUA 4D4MA 1H65A 1NU8A 4Z54A 4YJFA 4B9EA 1V1JA 3IAEA 5JI3E 3K6SA 3AR7A 1TCVA 4BBJA 5J1SB 4CXMA 1N4DA 2ACVA 4IVPA 2VP0A 1K7SN 1A5SB 4YJ2B 3MS2A 4A0SA 1SFRA 1V7CA 4N3GA 1YR6A 4AAYA 1SRQA 5BMVF 2YOGA 4MO9A 5EWMB 5JC1A 1KO1A 1CUIA 4AQYB 5K09A 2Z56A 3BK1A 4TUYB 2IHUA 4P33A 5ALDA 5JSZA 3BZUA 1FXWF 2B61A 3V4ZA 2ZYTX 1CUVA 1Z9BA 4DYVA 2GBLC 1FZQA 1SUDA 2A4MA 3MBKA 2Z9BA 2IQ5A 3ISTA 4KXXA 1OPRA 4N3AA 4Q03A 3T41A 3V1TC 3L4JA 3FI0A 1L5OA 4L5IA 4QQFA 5BT8A 4GZMA 1QTQA 3LPDA 3DZFA 3ZU2A 4LGYA 2TMYA 3EMVA 5C51B 1N6LA 3CIOA 1GPYA 4UTVA 2G83A 3Q7TA 4CQJA 1UBRS 4HAUA 5FOTA 5PGMA 3W6PA 4AN1A 2B1QA 4J9UE 4U5QA 2GO1A 3DEZA 1TQ6A 5I7SA 3LG2A 1Z6YA 3A1EA 2PL9A 4OL0A 4XD7D 4JI5B 2IPOA 3GP8A 4ZRDA 4LBZA 3RYHA 4NU5A 1IYZA 3QKTA 1XYYA 1T91A 1ZK3A 3K4PA 3KTAB 3OU7A 4MNTA 4KMSA 4OI4A 3TZCA 4BBPA 3ZWPA 3A1NA 1K5PA 4CL0A 3QUQA 1OYWA 1IXRC 1NN5A 3VBCA 1K3TA 5FBZA 1ETUA 2MMGA 3B3JA 2VHJA 2G77B 1T36A 4Y18A 2CNWD 2YXLA 2G9ZA 3NPAA 1OXSC 1TYCA 5F3RA 2ECPA 4LI3X 4CEHA 4H7EA 1XWIA 1JLKA 1V47A 3PB3A 4UDOA 4BHTA 2DX7A 4MVJE 4KXLA 1CQWA 4CKWB 3O9VA 2N46A 2P35A 1VL8A 2PUHA 3K16A 1E6CA 1F2TB 5D3QA 4L4ZA 1EUQA 1TL7C 3S1AB 4YJ2A 9LDBA 1SA0A 3MRXA 4HGYA 4OHUA 4J75A 5ALXA 2VLIA 3P2OA 4PRZA 1F0YA 2V4MA 4D56A 5DTQA 1YE3A 5K0TA 5M04A 5F1YA 1PFWA 5B2ZA 2QU8A 1D5WA 1MAWA 2IEIA 1JU4A 4YFYA 2ONCA 3JQDA 5TQ2A 2I3AA 1BEUB 5A02A 4RK4A 3IIEA 3IB6A 3Q0IA 1U1IA 3K5PA 2HQOA 3BULA 3I2GA 5CXSA 3VGPA 2NYRA 3E9MA 1LWOA 1UDXA 4L74A 2FDRA 2BWJA 2W6IA 4TTIA 3UCFA 4YMIA 1LXCA 1ESMA 5AHRA 3TQOA 3ZEIA 3S5JA 4BMYA 4KMOA 1KOJA 1ZQ1A 1KQPA 3D6VA 1MJGM 2VOJA 2XTMA 4O4JF 2Q7DA 4DLTA 3ME5A 4F06A 4OUKX 3OT1B 2CZQA 2VJMB 3G0HA 2A58A 1VTKA 1HUQA 5KYUA 5KYVA 2HU8A 1RC0A 3RO7A 2ODWA 2FV8A 1RPTA 3MQFA 5IVIA 4Z9XA 2OWDA 4DM3A 1FDRA 4AT1A 3K1AA 3QTTA 3ZV5A 2R6JA 1A2OA 2FR8C 4FOLA 1OFUA 2ZVQX 2WHEA 3FGZA 5TLSA 4UNNA 1D2GA 2PX8A 5F12A 2YW9A 5GM2A 4YUXA 3T12A 4ER7A 1VGRA 2PSDA 3JAKA 5FUVA 4E6EA 3IJRA 5GMOA 2FR1A 3I2HA 2ZBDA 4U2CA 4FYWA 1J2RA 2AUMA 4DJ5X 3CUYA 4KQMA 4JB8A 3L01A 3EOAI 2YFQA 4ZZIA 1H9BA 3WZMA 4HLUA 1Z62A 1GAXA 2ODEA 1JHRA 2C3YA 3ITEA 3F5MA 3M34A 1RJFA 1G3QA 1C0KA 1YO6A 2NVWA 3EXAA 1CRQA 3PEFA 2VK4A 3KLPX 5ITZA 4M7OA 2PGDA 5IVDA 3SDZA 3A6ZA 3WMRA 8OHMA 1FU7A 3UWDA 2YIMA 1M1YE 2P9CA 1WW3A 3L4SO 3DO6A 1G21B 3RVJA 1P91A 2QR2A 2CGEA 4DMKA 4MWGA 2I03A 3ICPA 2YYZA 1FP4B 1ORDA 2CMKA 2PYIA 4DIOA 2XF2A 4BGDA 1HR0B 4KNYA 3ILVA 2QGNA 2AYXA 3BRWD 2QLFA 3JYPA 3K6JA 3R0IA 1E4EB 4QICA 1M2VB 2D00A 4HRXA 5NULA 4FD3A 4LRQA 5EQFA 3JQ9A 1M83A 3D7LA 5IWCA 4YRKA 3B51X 1T2VA 2WYWA 3PC7A 5AVOA 4BLTA 1V1MA 1EM8B 2H4FA 3QBTA 1AZWA 1IEWA 2WC1A 4MS1B 4TSKA 5KYXA 1TT7A 1U2DA 3VR4H 1N8NA 1Y1QA 2VSNA 2PRSA 3H83A 4B5LA 1VIAA 5I5EA 1ULTA 3TTYA 2D8MA 2CMDA 2GSWA 1WHSA 2D1FA 1E9DA 1ZL2A 3EARA 3HADA 1X7HA 4QT0A 4ZAYA 1YQTA 4C4XA 2XW6A 4HZUA 2VTDA 5FWYA 4N41A 3GJ7A 1MO2A 1MOQA 3UHJA 4TWRA 3WLSA 1JB1A 2GN2A 3G8AA 5HZGA 2JJ8A 3IOCA 1UUFA 2I2DA 3GVPA 2QRPA 4OPMA 4RJTA 2WRZA 4EJ0A 3R3JA 4TZTA 1GPJA 3JQPA 4MVJM 4YJGA 4AYTA 3DDUA 4X84A 5L40A 2KQUA 3WKBA 2C99A 4X71A 1QMPA 3A2MA 2AI3A 3L82B 4YASA 5T4BA 1W5AA 1DOHA 3UJBA 4OFXA 5JJCA 1KC1A 2NAFA 3BAFA 3W3AA 4HNSA 2GZRA 3P9RA 1X1BA 5AI0A 4TSFA 3R9XA 5JSHA 5EYPA 4A0FA 3CZ9A 3TD6A 1DRKA 4L78A 3DM5A 4UU7A 2X58A 3A1SA 3E9EA 5BN4B 5REQB 3UAGA 1NT4A 5HKBA 4MWEA 5F33A 3N1UA 4FZ5A 4NYIR 1WSWA 4OIMA 5AK3A 3SEZA 1B73A 1J90A 1N1EA 1IBSA 4EJFA 1TYEB 3F96A 3IIKA 1J0AA 1VP9A 5A7GA 2W6ZA 2WY2D 1JBKA 2QLTA 4N7MA 2EJTA 3CV3A 2L18A 1B16A 3IQDB 1PV2A 4UBMA 5AKXA 5A6VA 5KAMA 2LNDA 2VBGA 4DUGA 3EAFA 4LBVA 1RD4A 5T8KC 4Y2VA 1XCGB 4AJNA 4KVGA 2EYQA 4FYXA 2FJPA 1F8GA 1GPUA 3MELA 5DM1A 4FE4A 2JFBA 5CA1F 3FBTA 4F4FA 5IYZF 1IUPA 1HQKA 4GR4A 3VPXA 3RSLA 2Z4SA 5C8YB 5HPYB 1YKSA 3KBOA 1KMIY 2DWPA 3RU9A 3HBLA 4UNPA 4W7IA 5C35A 5EJEA 2H2HA 5KVVA 1O0BA 4GRDA 2BM8A 3LO5A 1L8OA 3T5TA 1KYZA 1VQ1A 1RCUA 2D5AA 3W1EA 4LXYA 1QWSA 1KDYA 1UC9A 2H07A 2BKEA 1VHTA 1SZCA 2V6BA 3G13A 4JITA 1V7ZA 4UHJA 1JEQB 2P2CA 2K4MA 2ADFA 1MLDA 2UYYA 1TPYA 4CFYA 1C1YA 1XXHB 3VYSB 1SXJA 2RIRA 2OORA 4MK4A 3TEMA 3EA5A 3O4JA 4JC0A 4RGVA 2ZWMA 1SQGA 4NYIQ 3C97A 3VKVA 4BFLA 4RCYA 4GPD1 1MB4A 1GZ7A 3BJIC 4OKNA 3TX6A 1NJ1A 2D2EA 2A9FA 4MITA 2QPTA 3ONNA 4G36A 4FU0A 4LXTA 1I8TA 3HB0A 4MUBA 5EUMA 2PUFA 1CJSA 4LHSA 3DKKA 3Q3IA 4I7EA 2O20A 1AZSC 4FFSA 4RU1A 1NP7A 1UBCA 3STYA 5KVSA 3CUTA 4C29A 1BVYF 1UXOA 1E5QA 1GTMA 4H1UA 1PL8A 3KG2A 4A0RA 4TL9A 4X8HA 2ZB4A 1AQYA 2BAGA 2JJ2A 3WJAA 4KAFA 1CQJB 2GM9A 4UHEA 4KPFC 1NFQA 2R751 3PC4A 3BK7A 5I7VA 2GNPA 4DAEA 1E77A 4WJZA 4EHIA 2GH1A 2GX6A 3RANA 3LQRA 1ZMRA 2G71A 3DFZA 1PKXA 2DPLA 3WY9A 4PNPA 1NUAA 4DQVA 4HYQA 2MHCA 2XMDA 3KVYA 3QMVA 1DARA 2JJQA 5HS6A 2ZBRA 3T7SA 1H0SA 4JUAA 1GKKA 1CY2A 2PD3A 3ETHA 1DOZA 2A3NA 4RCVA 2EF1A 3F4BA 2YMQA 1AA9A 2QAGA 3I04M 3EDRA 1XMIA 2P9ZA 3ICVA 1SQ0A 2HO5A 4DLVA 5JZVA 4QJ3A 3TLCA 2HUPA 1WHTB 1PFGA 1HDZA 1YDEA 4DQUA 2ZG6A 3IVGA 4E5PA 1HRDA 5KJCA 4ZYZA 3RUCA 3DDCA 4FTWA 3CRVA 2RKBA 1YS4A 5F9FA 1DSSG 1XXHA 2WQZA 4MUKA 1O57A 2R9VA 2H1RA 1KVRA 2HFKA 2PJUA 2RK6A 4LPKA 4RA9B 3VO8A 1C4XA 1HURA 2JZCA 1TUIA 1WPQA 3OT1A 4OXIA 1CETA 5C1OA 1E1RA 3UCEA 3BVPA 4IIVA 1X6VA 1GUDA 4G0PA 1O6GA 4PICA 4R7GA 5K51A 3WB1A 2ZJ4A 3GYBA 2Q4BA 4PSVA 3KT8A 4K7JA 9LDTA 5H9WA 1K0UA 3DEYX 2AYZA 4LGMA 4UUPA 5DGCA 2IZZA 3BN3A 3EBPA 1XYGA 2PU7A 3K2IA 1COWD 1R3DA 3T0GA 4HAXA 4K9RA 4R2HA 3W6UA 3OBIA 4HSGA 1YSCA 1CUHA 1RYEA 4M0CA 1EGMB 2DJ5A 4AN4A 3L02A 1C9YA 3AIOA 1Z34A 2D1RA 3CZ4A 2REOA 4UNIA 2QJWA 3OG9A 3PJFA 4BB5A 4GPIB 4UZFA 4QZVA 3GWGA 3TSOA 3KKKA 1V1RB 2ERYA 1E5LA 2D0OB 2YN4A 4CM8B 3H3FA 2NXWA 3WS7A 2IIQA 3G2OA 1TLFA 1K4KA 2IVFA 4DIMA 5JDCA 3RTGA