1XTUA

Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump) and cytidine 5'-triphosphate (ctp)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
b'PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable uracil phosphoribosyltransferase
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 70
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtuA00
1DKRA 1ECGA 4LZOA 1A96A 1DQNA 4M0PA 2GEBA 4FYMA 4LZNA 5E38A 1QK3A 1O57A 4RQAA 1QK5A 4F8EA 1XTVA 1GRVA 1I0LA 5KAPA 1WD5A 1ECJA 1A4XA 2JBHA 1IBSA 1W30A 1P17A 1OREA 1TC2A 1Y0BA 1U9ZA 4IJQA 1QK4A 3GEPA 4QYIB 1A95A 1TC1A 4RAOA 3ACDA 1A3CA 2PRYA 1I0IA 1HGXA 4LYGA 2DY0A 2E55A 4S2UA 1O5OA 1AO0A 1G9TA 3LRTA 5HKLA 1L1QA 3NAGA 1CJBA 5IPFA 4M0KA 1G2PA 2JKYA 3QW4B 4LZAA 3OZFA 4RADA 1DQPA 4JITA 1UPFA 3ACBA 1ZN9A 1V9SA 1QB8A 1VDMA 2XBUA 3OHPA 2YZKA 4MB6A 1I13A 4ZFNA 4X44A 3DMPA 4RHTA 1XTUA 3MJDA 1A98A 4KN6A 4QYIA 2H08A 1I14A 4P86A 1VCHA 2WNSA 5BQPA 4P81A 4RAQA 2HCRA 1ECCA 2H07A 3ACCA 1Z7GA 1BD3A 5K51A 3N2LA 4WMLA 4OHCA 3S5JA 4M0UA 1STOA 4RQBA 5ESXA 1ECFA 2PS1A 4WN3A 4RACA 3DEZA 1BD4A 1L1RA 1PZMA 3DAHA 3GGCA 4P84A 1R3UA 1QCDA 4RHUA 4QRIA 1A97A 1GPH1 1OPRA 3OZGA 4P3KA 4RHYA 1P19A 1DBRA 1DKUA 3EFHA 1UFRA 1I5EA 1JLRA 1D6NA 2EHJA 4P82A 2AEEA 4TWBA 1XTTA 5IAOA 3HVUA 3M3HA 1QB7A 1UPUA 4RV4A 1ZN8A 5BRNA 1P18A 3H83A 1JLSA 3GGJA 4PFQA 2C4KA 1NULA 4X45A 2H06A 1BZYA 4RANA 1G2QA 5ESWA 2FXVA 5BQOA 3G6WA 3O7MA 4Z1OA 5BSKA 1QCCA 1P4AA 1OROA 1FSGA 3KB8A 3LPNA 2JI4A 4RABA 1G9SA 5EUCA 5HIAA 1MZVA 5KAMA 1U9YA 2P1ZA 1ECBA 1HMPA 1VSTA 1ZN7A 1YFZA 2VFAA 2PRZA 5JV5A 5JSQA 4LYYA 1NONA 3MBIA 4PAWA 1XZNA 1J7JA 2JKZA 4P83A 4RHXA 4JLSA 4P80A 1XZ8A 2IGBA 1LH0A
chains in the Genus database with same CATH superfamily
4M37A 3OCYA 1RI5A 3EXG2 1TECE 1G5TA 1XR3A 4PE5B 5MN6A 1LWNA 4RH3A 3W6UA 4F11A 1IVYA 4J2TA 4BLTA 4DQ0A 5B12A 5LIRA 5LN1A 1YZQA 1MZPA 1EWVA 1DPFA 5E7QA 2QIPA 2YCBA 5EXEA 5IAEA 3H9GA 2FRVA 2C77A 3F4LA 4RY2A 2RC6A 2H8GA 5FJIA 3IUMA 1G8HA 1ETUA 1B0PA 1HGXA 2CN1A 5KYWB 3BMCB 2IWHA 4KVGA 5EZYF 2W6JA 3I8OA 1KY4A 3A58B 5FTKA 4B2YA 1L1QA 3E48A 2V9PA 4PG4A 2Q5QA 4WSOA 2QTBA 4HAXA 3S1SA 4OQXA 4LRUA 1KDPA 1FF9A 3FVTA 4G63A 3RYHA 1PK8A 2BHRA 3IUQA 4RYLA 4YAEA 5FO1A 4JD5A 3BH0A 1D1QA 4PGHA 3I0ZA 4TZ6A 1REQA 4BECA 2WQ7A 1E1DA 5KTYA 1TAUA 5E6UB 1UOQA 5AW0A 1K86A 3QKSA 1JDZA 3B85A 4Q6BA 4FDUA 2ODWA 1GQOA 5IVHA 4OAOA 1SUIA 4TYYA 5TC4A 3FYSA 3M8KA 4HQOA 1N6NA 5FLKA 4LF9B 4OP2A 1GSIA 1USVA 3ACCA 4XAQA 1HDCA 4YCNA 3LQKA 3MTBA 5LSAA 1U1IA 1KDZA 3A6GA 4Z4GA 1IPEA 1GFZA 1V71A 4HQFA 4AUNA 3H1FA 4E15A 5BP7A 1I7NA 4KSCA 4V3BA 3FDXA 3OTGA 1KJYA 3JQ6A 2IGTA 4G0XA 4HUJA 4UE6A 3TMKA 4UTVA 5IRCD 1PDVA 3VZRA 2QSZA 2ZK7A 1YVUA 4FDLA 4YRAA 2LIVA 2FWRA 2CWDA 3O3OB 3QXGA 1G6KA 3B8HA 1JZTA 3FDIA 2ZAMA 2NU7A 3B7WA 4RZUA 4GOKA 1LRLA 1L7XA 1I4OA 1Q22A 3E82A 4MAFA 1IN7A 2W8BB 4X6UA 3OA2A 1UKAA 5AW3A 4LQCA 3PUHA 2GXAA 2QR2A 2HQRA 1SZPA 3BMNB 5COAA 3HZHA 2PZFA 1ZM4A 3FHOA 3KQOA 2KM1A 1Z75A 2P11A 3HR7A 4GP7A 4YAKA 1DIHA 2HJVA 3DM9B 2JARA 4EEKA 1TZBA 5T41A 1PUIA 3NRBA 1GLNA 2B5OA 4HMOA 2ZW9A 4LGCA 5EJ6A 2WJHA 3I42A 1I30A 3H86A 4HB3A 1F20A 1D1TA 1HI9A 2EQBA 2WD8A 3CLTD 1K1EA 3LQYA 4JXKA 2NAFA 4DJFC 121PA 4UU7A 2BJWA 3WL5A 2IIQA 4H7JA 2QR5A 1QP7A 2PZ8A 4DNOA 2R87A 4TZKA 1LRKA 2GBCA 3HFRA 4J16C 3UXHA 1N9GA 3HCWA 3PIDA 1EXMA 1RM0A 2AR7A 4KYIB 2NVUB 2WFMA 4HHEA 4INJA 4I5FA 3QVTA 3WQQA 3ZU4A 3DYIA 4D4MA 3M6WA 3HFGA 2RDMA 1RYFA 1IBKB 1I1QB 2CWWA 1EB9A 1EDOA 5FL7D 4CIBA 2HYIC 3P4UA 1JDBC 3A11A 3ANXA 2CDAA 2W6ID 3QELB 4L74A 5F1KA 4YRJA 4KBFA 4R84A 2W7TA 4N01A 4YN3A 2LDXA 2QENA 3KBOA 1L4EA 3W9YA 1L7EA 1WVGA 3PUIA 4BX2A 1H5UA 3MWYW 1YDMA 3OEYA 3QUBA 4DCGA 1PGQA 2EARA 2GWRA 3EXHB 4OREX 4A0QA 8ABPA 5FA5A 2E3JA 3QPCA 1RLJA 2BY4A 2YC4C 4E5YA 3NTOA 5KJ1A 2R1TB 1J6UA 2F3SA 2HLPA 5EXPA 5FYQA 5EMMA 3W7BA 1Q20A 4JJGA 1B8PA 1TD1A 2CFIA 3QNUA 2C3YA 5JH7F 2JGDB 5I9TA 3FDZB 2V54A 3WGGA 2VC2B 4D9MA 2O1XA 3O75A 1R50A 5HS6A 1QTRA 3MOSA 4BKPA 2QQFA 4NYIQ 3PIRA 1T24A 2VSNA 3DKPA 3E5RA 3ELUA 3H2KA 3MOIA 5ALLA 5THKA 4HNVA 2A1UB 1K4KA 4OUDB 4X65B 4ANFA 1CR0A 1WHTB 3WGHA 1F2UB 1DCKA 3IOEA 3AHFA 2WAYA 3L6CA 5DXAA 3DV0A 4HKTA 5ICEA 3SQOA 4R0MA 1BKSB 3AYZB 5HDBB 4C43A 4ZT4A 1R7RA 3ZCSA 3KIPA 4MV4A 1PQUA 1E1CA 3RC9A 3V4FA 2VRNA 4FZ5A 3HJHA 4NMXB 1SU8A 1Z6GA 4MGHA 2R6DA 5CK4A 5AI6A 3M6VA 5FUBA 2ALJA 1AE1A 3G2OA 3LHFA 1LK5A 3WIBA 2PCJA 2R8YA 4MWEA 4ZI5A 1A5SB 3MJ4A 3DBLB 3DE6X 4HLCA 2Q50A 4IZ6A 5F5XA 4LJRA 1QF9A 4K7JA 5JZBA 1RC8A 3L93A 1OLXB 2W2OA 4L5YA 2ANCA 1ZJYA 3DOIA 5EN4A 5HWSA 1OA0A 1QQBA 4H6PA 2P0AA 3B52X 3NORA 2JASA 3QENA 5A9RA 4UPDA 1EM8A 4IXMA 2EKZA 1FP1D 3T7KA 2YHAA 1M6NA 1TE2A 4KE9A 2CLSA 2NSYA 1D6NA 3D3KA 3GJ4A 3RFFA 3OKFA 4OU5A 3AI7A 2OYCA 1CR1A 4NMHA 3WYCA 3F71A 5KYXA 2C2WA 2B1JA 4DARA 1HK7A 1HV8A 3N5CA 1NUUA 1UT5A 2QUBA 3SCZA 5C37A 1OYWA 4FYXA 4PHTA 2ZRDA 4KLCA 2UZ1B 1GILA 2C3OA 3GEHA 4IP0A 4LCEA 4DR7B 4K9SA 1I24A 3PUJA 4X5OA 2C84A 3ZIAD 4EY8A 3R0JA 1ZN2A 4OQNA 1DMSA 4Q4JA 4A6EA 2QS9A 4D8YA 3U1BA 1VPEA 2QM8A 1AZLA 3SF8B 5T67A 3CRRA 4A7PA 3RSOA 2BUAA 3J80A 1U9YA 1DXQA 3RVJA 5A5VA 1PQPA 4BMNA 2HR1A 5ICSA 3PTLA 3ESDA 1JZSA 4R0NA 3WMGA 5FPSA 1PEAA 1QFJA 4MUBA 1IY1A 3VTZA 4P83A 3NWEA 4WASA 4L9WA 2H4ZA 3ZJUA 4XA8A 1Z7WA 2HI0A 1XKQA 1U3GA 2WNIA 5CH3A 4O2AF 5LOVB 3GRAA 2QZ9A 3HB4X 1AN0A 4V24A 1AHHA 3ER9A 2PO7A 4DL9A 4W82A 4ETNA 1BMFD 1LZKA 1LD3A 2QPOA 3OP1A 2G5PA 3DXZA 1XTIA 2W4MA 2WU0A 3BWBA 3ED1A 3ZI0A 3GXBA 5EP4A 1L4YA 5LCXA 3TYXA 3BGVA 4Z54A 4YPOA 1Q3TA 5CDFE 4U8GA 1I1NA 3S2EA 4C30A 3WMFA 3WYNA 3UGTA 1BJRE 4AY5A 4I1RA 2ZUFA 2ZLBA 4B5KA 3RFCA 1BU8A 2WM8A 3RLFA 1SBYA 1YIAA 4DWVA 2BMDA 5F3WB 4R6WA 1NASA 2Q3MA 3L8EA 2ISQA 1YA4A 2BFCA 2GPAA 1EFUA 1Q7CA 4R31A 4KWHA 2IYWA 3K9LA 5FR2A 4BQOA 4YUWA 1E7SA 4J29A 2JHAA 2VP4A 1K66A 3LLUA 1Q95A 4Y1GA 2Z1DA 5G3YA 2HLHA 3OQMA 2CXRA 3QBEA 2YZKA 4TYNA 3C3JA 4WERA 4G5HA 1Y6QA 1TVKA 2EJCA 2ERYA 3SS7X 4CEJB 2BLNA 5AKZA 4PN3A 3GWGA 4BEWA 1SK9A 5HQ3A 3MPOA 1S02A 3WV4A 4CIWA 3S2GA 4ZTZB 3DMTA 4EKYA 4MR9B 3GAFA 3ZX5A 3TL6A 4EA9A 2JKVA 1PBTA 1KMNA 3AM4A 3QXXA 4BE9A 5AVVA 1BD3A 3KQVA 2UXDB 3OMXA 2BD0A 3AF1A 2MIIA 4GYWA 4JWTA 1OH5A 4GI2A 2XWSA 1B93A 3D8TA 1M3SA 4I46A 4P33A 4E2YA 4MUGA 5JFTA 2FEMA 3TTWA 2PZEA 4EG0A 4JODA 2GTIA 3A06A 4M9XA 1N0IA 1KP2A 1NE7A 2VNKA 4BZZA 5JRZA 2IKSA 4RIFA 4MW1A 3VR4A 3W8RA 2J9GA 3IQXA 2LTAA 2IHTA 1Z0IA 4J0EA 1KQPA 3L7IA 5D01A 4B3FX 3I9OA 3F5FA 4L0QA 4N39A 4MI9A 1SVNA 1HDIA 1XCGB 4E5DA 2DECA 3B3QA 3NHZA 2ZJ2A 3GRKA 4RULA 1UJ6A 4L9AA 1ZCZA 1T36B 4RGYA 5EESA 2BEWB 2WUDA 1VCIA 3V8EA 4J1NA 1W581 5GM2A 3CZPA 4QYWA 1GDDA 3H9BA 2OCYC 1DRWA 2E89A 2OSVA 5D1HA 3SSNA 2OYRA 4D4IA 4KFCA 1B42A 4AIIA 5J2TF 2RH9B 5L3QA 4HRXA 5D3MB 2NO6A 1SCKA 4BTVA 1LDBA 2Z5LA 3DP9A 3GAZA 2Y0BA 5EJ2A 4MRPA 4HTFA 1C3OA 5ENVA 4EJSC 4FZ3A 3K09A 4F45A 3TMAA 4CTOA 1JQKA 1IBLB 3KSDO 1WMAA 4IIJB 2CSXA 4JT2A 1T9KA 3MWFA 2AOWA 1SB9A 2Y93A 5FOVA 5FI1B 3VJKA 5BYAA 3RVKA 3HB5X 1U94A 3OT5A 3QOYA 3DWGA 3E1GA 1E59A 3L7OA 3ABQB 1PJZA 4DKXA 1Y33E 1L6IA 1SCJA 3OFJA 4LWQA 4OLHA 4RIEA 4WLVA 1C8BA 1XU9A 1PF7E 2HTEA 4FSXA 1R6XA 4MRAA 4ZXPA 5IJ0A 4GSKA 2Z58A 3MAGA 4OBXA 4CQMB 3KETA 3SD7A 1P39A 2QJWA 2RFLA 1MC1A 3NJ8A 3F9IA 1DC6A 4A73A 4UBOA 4B7ZA 4DGQA 4FFPA 1O89A 2Z8YA 4Z0TA 2X5NA 4PO1A 2D1TA 1WR8A 1QRTA 1RFGE 3U0BA 1GNTA 2B7CA 2R3SA 3B48A 2C7PA 2AOUA 4NE2A 4BUZA 4WVLA 4TS4A 2ZAIA 1OAKA 4QATA 1B3RA 5K8VA 4U7HA 3IQZA 1VSBA 2DR2A 4EHLA 4JHLA 5HK9A 3NJ4A 4HOYA 5JBQA 4N49A 4B3XA 4NSNA 5G0UA 1E64A 1W44A 3OQHA 1YTLA 1ZOOA 3AL0C 4EF5A 1NVAA 3RVLA 4OI1A 2VYFA 1J9EA 2E4WA 1JHOA 1THMA 1AKEA 3QLTA 3W2TA 4DIUA 4OK6A 3REQB 5CBKA 4B40A 4BPRA 4HQ6A 5GTDA 2IZ7A 1N5JA 1XE3A 3AZOA 1V35A 2B4TO 4OIFA 4RVGA 8ADHA 3MA0A 2JIQA 4N7MA 4D2IA 2VF4X 3NIBA 2QIOA 3NHKA 4TXHA 3R1IA 3EUEA 5JG7A 1FZQA 3U3OA 4OHCA 1XVUA 2EW8A 4G5YA 4K9NA 3BSYA 1Y8QA 2WEKA 4YQZA 1GZHB 3BTUA 1TA0A 3CIFA 3LWDA 1A8UA 4DADA 2EP7A 2GVDC 3KYCB 7ADHA 1NYLA 3ZV5A 3OA0A 3PVSA 3AT1A 3R8XA 5HP4A 2OESA 1SHTX 1TB4A 3TSYA 1E1QA 5ESRA 2J45A 4E6EA 3QU7A 4YROA 3W9UA 4CM4A 4L76A 2QRVB 4ENQA 3G89A 1VRVA 4F4DA 4IJWA 1WMEA 2Y2UA 1V5GA 4KIGA 5ITSA 1YR8A 1HT1E 4RBNA 3A28A 1WV1A 1TNDA 3F0TA 1VRCA 3NQ41 3FTDA 4HNSA 3CN9A 4JB2A 3WKBA 3OPYB 5AHOA 3JATB 3FHJA 3VBEA 3PUZA 5AVWA 4B3BA 2GZSA 2CLHB 1H05A 3U44A 1XGKA 2ZCJA 1Y1PA 2AH5A 2OGUA 3HSYA 1TD9A 4CUZA 1JBQA 2CXHA 4EA8A 1BCRB 2YTZA 3DGFC 4P3YA 4URYR 4L7QA 2NUTB 4HNAB 4NMWA 4X97A 4DLBA 1DL5A 1NUSA 2R1ZA 2WD7B 1GT91 3FUVA 4ND8B 4LVCA 3VHXA 3ZKWA 4EKGA 3ONWA 2PAFA 1CRQA 4D0SA 2JBAA 4DBVO 1IN6A 2VZ9A 5A5DA 1L4MA 5IASA 5DVZA 4CEHA 4RVSA 2W42A 1EVLA 2RKBA 2WMNB 5DIZA 3LTNC 3TMYA 4XIGS 5I3CA 1ULAA 1DTSA 1YE5A 4KQWA 1K4YA 4IDFA 3HRIA 1KEWA 1V0JA 4AZ0B 3B36A 3GZNA 1S2NA 2VK4A 1M2HA 3TB6A 2AJBA 2QRMA 1BAPA 4Q7MB 2Q5FA 5AVTA 4PLYA 3RQIA 4B17A 3PQ2A 4H6VA 2P2SA 1G7TA 3NT2A 1VJGA 2XGJA 2VQ6A 3F96A 4FE7A 3K05A 1LBHA 2XMBA 4TVKA 1VA4A 1XJQA 1ZL2A 3MGCA 4QBKA 1EJ6A 1OXTA 5BMVB 1J1UA 4EI8A 1Y8ZA 1XCOA 2JJMA 3IERA 4G37A 4O4IA 3DO6A 1XFAA 1JMYA 1JKJA 1EHYA 1OC2A 3Q2OA 3H1TA 1G2PA 1PT5A 2HWUA 2I3DA 3STYA 3UHPA 1TJYA 3RTGA 5ENDA 4OEHA 3VX3A 2ADMA 5ED0A 3FF4A 4ESOA 4DOMA 4RFVA 3UYLA 3OIGA 3S44A 2XBUA 1ZVQA 3OFND 1P60A 3QPBA 3X1ZA 3H18A 3WLNA 2VATA 1Q5PA 1YT5A 2H7YA 1MG5A 5TVKA 5IP5A 1LBTA 3IPRA 3MGKA 4DR1B 3ILXA 1M83A 1Z08A 2D5BA 3AVVA 3WK4A 3FYUB 1VPLA 4MV9A 2OLKA 2X9QA 7MDHA 1W5FA 4KPUB 4QDJA 2CNKA 2GA9A 2HK8A 3WNQA 5DKFA 5ALUA 2Q5HA 3K7EA 5A1TA 2FLKA 2ZYUX 3E7FA 1T1GA 3JQAB 2ZEJA 4LTMA 2IHYA 1W47A 1JHYA 1U8UA 1YZGA 1Z8NA 3BAZA 1NJ1A 4G97A 1P2TA 3MRSA 4H9GA 2E82A 5C7OO 5SYAA 3FWYA 3OICA 2EV9A 4GYJA 4X64B 4H1HA 1C1DA 2XKAA 4EUKA 5E3JA 2QPTA 2DBQA 3DWIA 4WLUA 5CFNA 4WBSA 2DR0A 3R24A 4GWGA 3O8CA 2RCNA 2P9ZA 2FW8A 4IIEA 1ZAYA 5AW9A 4CT0A 4AMVA 1ODIA 2PGOA 2QX8A 3UAZA 1RWMA 1P0PA 3F4BA 2Q7OE 3TVYA 2IZ6A 2ET6A 4DMGA 1EQUA 1P9LA 1WXFA 1SKAA 2VDPB 2PG3A 2QZJA 2A9KA 3MQ4A 1O95A 3BAFA 3MD9A 1E2MA 1LBQA 4O0MA 4X45A 4TMZA 2Z9BA 3P9RA 4PIMA 3WNDA 4MP8A 4C6HA 3QEBZ 2PSDA 1FL9A 1MP0A 3E4DA 2ASEA 2EZTA 5FA8A 3ZHTA 5DJ5A 4B45A 1RWPA 2RONA 3HB1A 4B31A 4ZCIA 1OVMA 2HSJA 3HXLA 1FTYA 2WHQA 1KETA 1W0CA 4M9CA 3RUCA 3SZRA 3W3AD 4QKQA 4WFJA 1A77A 1ZM9A 3DDSA 2QUKA 4L8LA 4LHXA 4S1OA 4RTNA 4CF5A 1FDIA 2VDVE 3OG9A 5FI5A 3SYKA 5IHPA 4TKUB 1M2OA 2FH5B 2XQKA 4R2KA 1J39A 4EFKA 5I01A 3F5SA 3UHFA 3ESAA 3WK5A 1NVKA 5JH7A 3A4IA 1MVOA 4OJMX 5DWVA 1SXPA 2ECPA 2GZMA 5AHKA 5JDIA 1UF9A 3BMQB 3L4SO 1WOMA 2EFJA 4R1NA 4BL5A 5JSZA 4OLFA 3AP1A 4ZDWA 3W6NA 4E2XA 5JCOC 3GMTA 1NA5A 4PW0A 4RZQA 2H0QA 2PUDA 1CYEA 1P9WA 1WW2A 5K8UA 3RFTA 1KK1A 5KQSA 1DRVA 4CQLA 2HBYA 2FPOA 4IAOA 1FQWA 3IKVA 3HJGA 2RHGB 1ZRMA 4BGEA 1NMYA 4JYMA 1ZY2A 3ACDA 2DB3A 3I73A 4NK4A 1D4ZA 1Z4PX 2GN8A 4N5NA 4LYGA 1CFZA 4RNCA 5B7GA 1XDSA 2YJ5A 3TGWA 1Q7RA 3DKIA 2C5LA 4TTSA 3TUIC 1K9VF 3RRZA 3UM9A 3O8BA 1KEVA 2DMRA 1ESZA 4CMKA 1T4DA 1CZNA 2DFLA 5G40A 1CY6A 1SUEA 2R4TA 3QW4B 5BT9A 2I2FA 3JRWA 5JAUA 2RE8A 2GETA 1RT9A 3BGSA 2E48A 4GSLA 1GSOA 3EUAA 5FDFA 3F3YA 3G2QA 5JNUA 1AS2A 5CYPA 3IVCA 3QWFA 1G21A 4XYEA 3U49A 3V97A 1MG0A 2UYGA 3PYLA 3BBLA 1MJGA 3MWEA 4DLYA 4ZZ0A 4KFRA 3KEFA 1ULTA 1ZOSA 3LHKA 1S6YA 1XI2A 3MYYA 3NVAA 3LYLA 4AO6A 4MDFA 3FUWA 1EHCA 5DGTA 1USGA 3TLCA 3L77A 3HLTA 1B41A 2DWUA 2WMYA 1MNQA 1WSBA 1Z73A 2E5WA 2XUGA 3NUZA 4MTLA 5AI9A 4IYJA 2QNIA 1EGMB 1RABA 3SYTA 4DV3B 3ZUPA 2D7DA 4XIJA 2JFXA 3CUEF 2WWVD 1DGQA 1H2HA 3DOHA 1NUPA 4DCUA 1T9CA 4YNBA 3W6PA 1BMQA 4BDTA 3EVEA 3WQHA 1UADA 1RI3A 2M1ZA 3VR5D 1XTJA 2C3UA 4YMIA 2VWHA 2ECKA 4NV0A 4QODA 3VC2A 2UYHA 4NOMA 1YK1A 5JCXA 5BUCA 1LLQA 3A3NA 3WL8A 2HHHB 1R88A 1XTRA 2H2DA 2L82A 1J8DA 2R6HA 4ARBA 4B7XA 4B3IA 4B7AA 2QYOA 3VDMA 3ZD8A 5BV2P 2YIMA 1IIRA 4IFEA 2QVXX 3LY8A 4YX9A 3G3EA 1XZGA 5K2OA 1F17A 1C30A 1QYCA 1AA9A 3DBHB 5BSUA 1IN5A 5D84A 5GGYA 5JU6A 2IYQA 3G8DA 3WIUA 2OT3B 3GJZA 1DI0A 3IA2A 4UZSA 3O91A 521PA 4EOGA 3LX8A 1EDEA 4FR5A 1XHEA 4NABA 2AHRA 1NBMA 1MIHA 3STHA 3ONFA 3AERB 3E9RA 5JARA 1IZ7A 1R9GA 2GASA 4PSUA 4UQLA 4WK4B 3ZR4B 2V7XA 3OOSA 1K88A 1CD5A 3SEFA 2CW5A 2X6QA 3EY9A 3GL9A 3KNZA 3V4OA 5BYKA 2PMDA 1ZUNB 3MPUA 3LKVA 3G5MA 4OP1A 4ZODA 1A4UA 1D6SA 1HORA 4NHOA 1RJGA 1XC7A 4FPXA 1E1MA 3TECE 2MDTA 3D1JA 2V4ZA 3R3WA 1P2VA 2PQ0A 4RLSA 4RM3A 4XRGA 1GGKA 3UJDA 1F51E 4F85A 5HDQA 2YV2A 4I1VA 3JYQA 4GX0A 2I67A 1N2OA 3QX3A 4ENUA 2PZKA 4Z0HO 1SKUA 3ENNA 1TJNA 4NU6A 3DTVD 3RDPA 3OZBA 3COJA 4DMKA 1P29A 2B8WA 2AC2A 4N3GA 3GLRA 3N0RA 2WIBA 4CQJA 1BDHA 2HJRA 3DVRX 2B94A 1WW8A 4RVOA 2HU5A 3PVCA 2Z3WA 5LC1A 5LQSA 4KMOA 4BKQA 3UJAA 2LUOA 3I9V6 1GITA 3G02A 1M74A 3O92A 4Y2HA 1T0HB 2DPXA 3C3BA 2AHOA 1NZFA 1J09A 2O20A 3OBIA 4QSMA 3A7DA 3DR3A 4DDWA 1GPWB 2BGMA 1PLKA 1PR0A 2QLMA 4QO8A 2GX6A 1MOPA 3LBIA 1U3WA 5A4AA 1NGSA 2YVUA 1JR3D 3BD9A 2NM0A 4GMXA 4F92B 4C7OB 3AKDA 2DBYA 4PLFA 4NCNA 1TAGA 3ER6A 1O5OA 4OQQA 4K3VA 4UAUA 2J3EA 4X1YA 4ZRMA 3U4GA 3BBPA 4F60A 4OVKA 1XJ0A 1V4VA 3CRQA 4NJEA 4Q9LA 4N6OA 3O1LA 2O52A 6YASA 3MRVA 2PJZA 3DYBA 2WE8A 3OZFA 3C14C 2HADA 1ZD1A 3IBCA 2X4IA 1Z8DA 5H83A 3QU9A 1ESNA 1P1JA 4DQKA 5LYJB 4RYDA 3HJNA 3DEKA 3WIEA 5AXBA 3DMFA 5C31A 1CWUA 4NCHA 1NY6A 1NLZA 4J1TA 5KNBD 4KN9S 3NEAA 2BONA 1V9LA 1W4ZA 2HA5A 2Y2VA 3DMPA 3ABSB 4CHGA 1I2BA 3OD5A 1COWA 1QIFA 4Q3DA 1F8FA 4UVHA 1E20A 1Z13A 1H69A 1Y1SA 4GX1A 3T3DA 4YJ3B 3G9UA 5TIIA 3VPGA 2XDYA 2IPMA 3DNPA 2CLEB 4AS3A 2RHRA 5BVHB 1WW3A 4DEXA 2HPHA 1EUCB 4PLZA 2AOTA 3TF5A 1U3FA 4I8DA 3QG1A 3TZCA 4AURA 1OB5A 3L7BA 1U9IC 4AUKA 4JCOA 5ETJA 3TW0A 5LLDA 1NNEA 1NVVQ 3DAPA 4QBHA 4KDCA 4BWVA 3LC1O 5EGNA 3RSGA 4B09A 2JAOA 1W25A 2WF8A 3PQEA 3K92A 4KP7A 5HUJA 2QL5A 2O0MA 3IKJA 3P32A 4G67A 4PY2A 2ADFA 5HGXA 2ZE5A 3U4CA 3MSXA 1FUKA 1RHQA 3W8EA 3WRWA 4R1UA 1LLUA 1E66A 2ZSDA 4QVKA 2AFIB 1ZO8A 3M3HA 3SBDA 1T2DA 1W87A 3E3AA 4WN9B 5UKDA 1MW8X 3KVYA 2Q4BA 3VKHA 1A7UA 3PNOA 5B1HA 5DU2A 3H2BA 2H5EA 2DAPA 4V2IA 4C7BA 4P22A 1FMLA 5G4LA 1JEEA 1D6JA 3R77A 4AP5A 3B6EA 4NS4A 4Q93A 1YS9A 1W2HA 1RAEA 3I76A 3RRBA 4DIFA 4IRUB 3OWHA 3FTCA 3EDMA 5IVKA 2Q3BA 1G9SA 1NL3A 1U0SY 1K5GA 4YALA 1LFAA 2XJ9A 1GCAA 4PR3A 3RUDA 1U5AA 2PTHA 4MLDA 3BKXA 1A9YA 1L4NA 4FNGA 3NHUA 3K9FC 3VVMA 4GZ6A 2WU8A 4CN9A 3K0AB 3FE2A 5KSWB 2RAFA 3FSJX 2CVPA 3ND6A 2H31A 3BIWA 3EA4A 3IAEA 4I14A 3DS8A 3HB9A 2Y1XA 3HJRA 2AA3A 4UCFA 2L17A 4DMLA 5MN5A 1NN3A 3Q9LA 2QF7A 3PRHA 4Z3KA 3JAMA 2YWJA 5CDHA 4JMPA 3W2GA 1Y7PA 3E35A 3R6WA 3PPIA 1G0OA 3L2OB 1K06A 4J7UA 1UDCA 4DNFA 4FUQA 1C9JA 4HP8A 3GEPA 1PTKA 4S3MA 4AJ4A 1QHXA 2X15A 1E6UA 4U2KA 2O0KA 4Q3OA 1OBVA 1VIYA 3NWBA 3PBKA 1MBZA 1FPMA 1U8TA 1UK6A 3EF3A 4JGIA 1U7UA 4HX2A 5GZ6A 1M73E 1KY3A 2OWDA 3HG7A 4NU8X 4INAA 3HH8A 1PZFA 3FKQA 4ZAWA 2IEDA 1Y6JA 1YRHA 3N2ZB 1A8SA 1U7TA 4AG6A 2PNFA 4PLTA 4BGDA 4KSBA 1FJXA 4R69A 4HVTA 1C0PA 1YUBA 2VPWA 2FFAA 4EPWA 1GUZA 1FLDA 1RLOA 4PC3A 5T7BA 3ZW8A 4D25A 1NLMA 4GMFA 5LMZA 3O6VA 2V3WA 3EBLA 1QH0A 3LBYA 3N8NA 3ZNNA 1A4IA 2AQIA 4MQ6A 4Z3OA 1Z2NX 1DRJA 2ZM6B 5ED4A 2C5GA 2L19A 4BMPB 3O8OA 1BX0A 1T5TA 1X3LA 4G5FA 1N9ZA 1A5BB 3G68A 1N2JA 4KTTE 4M22A 3H2SA 4OHUA 1UBGA 3IMKA 3W05A 3KKLA 3EVAA 4QAQA 4BVKA 2P2DA 1U3TA 1U6JA 1MOZA 2QQGA 1GEEA 1NZDA 2DY1A 3CX8A 1DO8A 2OAQ1 3DCNA 3F7NA 2FNAA 4I4TB 1OBHA 3DAHA 3LX6A 3AW9A 3FROA 5CDGA 4I55B 1M66A 2WT4A 2J4DA 4FQ7A 1Z16A 2ZIWB 3K0FA 4K9KA 1QP8A 2VBFA 3UHJA 3H5AA 3E9QA 4XX0A 1MR3F 4Z86A 2O0HA 2X22A 3G0OA 1ADGA 2C2MA 2I87A 2YMQA 1E3WA 4YWJA 4OK5A 2QT0A 5CAEB 4B81A 1KBZA 1G6OA 1SKYE 5GWXA 5PNTA 3W4KA 1B7GO 4IH9A 3TIGA 5CB4B 1XAJA 1AD2A 4N9QA 1UBEA 1OX6A 1OOEA 2ZRLA 4NBLA 1PJ8A 4WJZA 2B3DA 2B1QA 1YTUA 4DM3A 3FFXA 4MEJA 4WY5A 3ID6C 2COEA 3IJEB 3PEUA 3TTYA 2CNOA 2JCBA 1IBRA 3V4RA 3R9WA 4V2UA 3E58A 3GLKA 3HMKA 3IRUA 2W6QA 2AJLI 1LW6E 1TMKA 2C4NA 3DOJA 3ZY5A 1FP7A 3GJ8A 1BRMA 1JE1A 3BWDD 4RPHA 1P2BA 1ECBA 2VPYA 3Q0TA 4Y2UA 4ZGBA 1SUPA 1BH2A 2COUA 3NM4A 3I6YA 3L4EA 5J63A 1AOXA 1OLUA 4RZXA 4ALNA 4C4SA 1B2RA 3EXFB 3FJYA 1I3NA 2NYUA 3MM4A 4BXOB 1KI2A 1IU9A 3RIGA 5KTPA 1H2AS 3U7QB 1C4XA 2W4QA 4HGQA 5JASA 2PYIA 3Q6NA 1JEOA 3WI7A 2BWJA 4ARVA 4N40A 1J8QA 4DREA 4E3WA 1SOUA 3P7MA 4LSZA 2PWZA 1DCFA 2TECE 1KPHA 2ZYIA 5CG2A 1F8GA 4D45A 2FFHA 1SOWA 3DLAA 3U7RA 2E4ZA 2WJYA 3W79A 2GCIA 2K2QB 2P30A 1E2PA 2YWGA 3SI7A 3IP9A 4LZZA 1XAGA 3A2KA 2HLNA 2X8JA 1GN9A 3RKSA 4A6DA 5AW2A 4DY4A 1E2JA 3FG9A 4ZCTA 1ML3A 4OHKA 4EL5A 3JYPA 3K0HA 2QLBA 1KAGA 2VPQA 3MWDA 1UP6A 4OV6B 1HEIA 4FGKA 2A88A 3QXJA 4DV5B 1U8ZA 4AVYA 4B3JA 3T1TA 2VJBA 3NM6B 4DUYB 4OQPA 1PDOA 4UHKA 3M70A 4NICA 5HIMA 1AURA 2XTMA 1XOIA 3HKEB 3UMFA 4KI7A 1C9YA 1QO0D 3WGTA 2R6FA 4MKHA 1E8DA 4BVGA 1FNNA 4GZMA 4OQEA 4IMPA 4DYDA 1WXHA 1AXRA 2HZ7A 3DB1A 3QVXA 2O8BB 3RABA 1FFXB 3I4FA 3KXPA 3ZGZA 4ENRA 3SSMA 1Z5GA 3OHSX 2XUOA 3G2NA 3MJDA 3P45A 2V96A 4KQEA 3UO8B 4F93B 3BJRA 3BWEA 4ZO7A 1CIPA 4Z4FA 3ZI4A 4N8DA 1KAEA 1O4WA 1F60A 4MV7A 1I7SB 3IVAA 2IK8A 1ZICA 2FSPA 2ZT7A 4AB1A 1DELA 1GQYA 1QAMA 2Q49A 4Y0AA 5H4GA 1C4OA 4TSRA 2TMYA 1NLFA 1WS6A 2EGHA 4LJ6A 3QG5A 3Q1KA 5F78A 2VUIB 1V1RA 1MDFA 4FSHA 2YMLA 4V38A 1WVMA 4IUCS 2OOKA 2QA5A 4RACA 2MSEB 2YRXA 3VR2D 1QC5A 1LRJA 3GNQA 4FZVA 4YP5A 5KYYB 1GA1A 2HPAA 4RMIA 4RH1A 3PFWO 1R3UA 3VPSA 2B34A 2CC2A 4HZUA 4GC5A 2LV8A 1U9JA 3RVDA 3SFTA 5KSZA 4BO4A 4NR0A 1C3LA 3TW8B 2ZRQA 3O4FA 4KRXA 1K7EB 4MA5A 3DFMA 2CUNA 3KKQA 4BHTA 3A1UA 4DEVA 1YXMA 3P26A 5CX4A 2IUSA 3BA1A 3U81A 5CA1B 2WM3A 4AU1A 8OHMA 1RLTA 3UWOA 4OBEA 5DRTA 4MSUA 4XB1A 2H0AA 3L04A 2W70A 1EK5A 2P79A 4BIMA 4E5KA 1UODA 1LPMA 1MRNA 2VIIA 4I4LA 4K81B 3IBGA 4TV8A 5FNVF 5H3LA 3KQQA 1C7EA 4X3OA 3X0DA 4CBVA 1NF3A 3SXPA 1WDKA 1Z5PA 4KQ2A 5IBPA 2IU6A 4KQGA 1B0ZA 1YDEA 2QAGB 3S1AB 3SJAA 2CJXA 1GUDA 3FUUA 1O94A 3WWYA 3KCNA 5CNJA 4U9UA 5AKJA 1HX7A 1X13A 3KQSA 4DDTA 1MIOB 1TZMA 3QTBA 2QAJA 3VOTA 1UXOA 3Q10A 5HIAA 2EBFX 4FIZA 5JO9A 2WWHA 1P2FA 4TVOA 2FW1A 1LQ2A 4ZT2A 5JIBA 4Z53A 5G4KB 2KSQA 4YJGA 4GICA 2VF2A 5IDVA 4OHZA 1YFZA 1Z6YA 4PICA 3VU3A 3PP8A 3ZHCA 3EAQA 2JGIA 4ECAA 2VK1A 2TS1A 2GYUA 4QFBA 1V1MB 4MV6A 2E4UA 1XMXA 1ZLYA 4QGSA 4OXIA 1ZOPA 4UBKA 1D9XA 4BZPA 1AO3A 4P36A 3DOCA 4MV5A 1YC5A 4KJZA 4TUYB 1I5RA 4BQRA 2F48A 1KJJA 4HMQA 4Z8XA 1Z38A 2FCAA 5SZIA 2WG0A 4H4DA 2V1XA 3PEWA 4MW6A 2HCTA 1Q7EA 1R8SA 3L5KA 4I3GA 4KZPA 4QUKA 3TZBA 1ZD3A 3ETEA 4JYZA 2IXEA 2XSZA 2IHNA 4I9HA 2XOKD 1Y5NA 4B76A 5GIOE 3CCBA 1ODFA 3NFRA 4RO0A 3K8OE 621PA 3KYDB 2AGVA 2G0AA 1E4EA 4IHJB 2DG2A 2PLNA 1BE1A 1HF3A 5JS2A 2BEKA 2PL5A 3OIVA 5EIXA 2A1IA 3AETA 4LFAB 1FDTA 3TD6A 5JWRA 3W3AH 5HZHA 3KZOA 1KZ4A 4H7DA 4UM5A 4G0YA 1SCUB 2W6NA 3HYLA 2BTOA 3KHTA 1HY3A 1PHRA 1K8QA 1ZJ6A 2D00A 4TTJA 3ZJVA 3PNVA 1VHDA 2XZDA 3BHIA 1BJTA 1UPFA 2YMPA 2CXPA 4JAVC 2IHJA 1WUTA 3HQ4O 4UHCA 3ITKA 1MT0A 4XW2A 4DYHA 4DDVA 5H3HA 2ATIA 3EDOA 1RPJA 3WBFA 1GTRA 2QM7A 1XVVA 2L0XA 1CY0A 1SC1A 1ISPA 4Q16A 3BS4A 5C8DA 3H11A 3ZTWA 1UFKA 2IXBA 2RAPA 3FI0A 1R0ZA 3IVMA 2IHZA 3RLIA 1F6DA 4LNAA 3FVQA 1NG9A 2W00A 4TSFA 4UTXA 2F4VB 4PHCA 5GVRA 3GEDA 3Q8MA 1I4TD 3OJCA 3I05A 3BM5A 3TBFA 3QA9A 1M6VA 2IP4A 3RSFA 2CJPA 5IKOA 1A71A 2ZI7A 5TV2A 4TN5A 1QH8A 4GAEA 3DLPX 3M6AA 1XZDA 4JL8A 4N3BA 3WHIA 4BNJA 3CLUC 5EP1A 2V6IA 4HV4A 4DR3B 3VHQA 1I5OA 1E2HA 4KQMA 2IYEA 2J9RA 4I36A 3G79A 2R8OA 1GGJA 1TZ2A 3OI7A 4AF6A 4LBWA 4XGNA 2HJSA 1WCV1 2MCFA 3JVDA 1OPRA 2C0CA 2PL1A 4IS3A 4XXHA 3EA5A 1JQJC 2Q7XA 2H7CA 3ZK9A 4F6LA 4L73A 3OZSA 4WHMA 1H9CA 5C7YA 1EUQA 1DAGA 1UT6A 1DDOA 3BB1A 1NU6A 3PUYA 3RJZA 3ZS8A 4CQNA 1P8AA 3COWA 4ID3A 5EIHA 2DH6A 1X9IA 1ZESA 4NDAA 3TR5A 3AF0A 3WKDA 4C0SA 2XW6A 3OCJA 4F21A 4YJHB 4MRMB 5L7WA 1T1EA 4PTLA 3RS2A 1BOFA 3TDMA 2O8DB 1CDDA 2PMEA 4K6HA 5CLFA 5C8YB 5TEVA 2CNBA 4O1MA 4RVFA 1OU0A 4LFBB 2C5FA 3N0TA 3ZWMA 3HA5A 4DQLA 4E4YA 2PJRA 5EVJA 4IHAA 2DM6A 5EZ5A 5BPHA 4M1TA 3SOPA 3GP3A 4MQBA 4K1XA 2Z6QA 3LT5A 4TVBA 5B55A 4WKPA 3EIFA 4FYHA 5AVZA 3FI9A 3GJXC 5DGIA 2FV8A 3E05A 3DOOA 2VNSA 4MR8B 3ZWQA 3BJIC 2BJHA 4KCGA 5JJKA 1KO1A 3C97A 4W5WA 4ATNA 5BN1A 3I9LA 3EQ8A 1ZH6A 3FBTA 1GYPA 2QD5A 1NPYA 3I52A 2ZRBA 4HGOA 1CUHA 3ZQ4A 3PGVA 5EQJB 3ZLUA 2P6RA 4MPRA 4IS2A 3NUGA 3OX3A 3D8SA 3R0ZA 2JI7A 2WICA 1E1RA 2WU3A 4JZKA 3SE7A 1O6ZA 1HLDA 2P4UA 4Q1CA 1E2BA 2ZSFA 1GAXA 2GN1A 5J3JA 4IL5A 3SR3A 3V7FA 4FWTA 4C7JA 3ZDCA 1U0EA 3WSWA 3AVYA 1P17A 3C70A 1UP4A 4JUFA 3IXQA 2BFBB 1F2VA 1RIIA 1DV2A 5TVGA 4CM8B 4J0QA 3IT0A 2P3SA 4Q15A 1Z0ZA 1LV8A 3OX4A 3ZG6A 3LRTA 4H3KB 3DDNA 3IMFA 5JVDB 1MO3A 3GGOA 2Q5LA 2GN4A 3KJEA 1AKNA 1UKVY 1YJAA 3QLVA 2WKWA 2AYYA 5FOWA 4ZEVA 5ES4B 1RPZA 5BN4B 3C8UA 2YX1A 2G25A 5ALHA 4ABYA 4AYTA 4KHPB 2JFQA 3OBBA 2GZ1A 3GVIA 4WDRA 1FS5A 1QYXA 1VG0B 4GXRA 3D3WB 4XRRA 2D4HA 2JW5A 1QXSA 1PI3A 1SPBS 1IJKA 1DTWB 3ANYB 4KKXB 2FP3A 2BI4A 3QE9Y 2H7VA 3TJRA 1ZK1A 1P7ZA 3E15A 5CFZA 3STTA 4M6WB 5IN4A 2ACKA 1SVMA 3N76A 2DYKA 3QJ5A 4YT2A 3H0KA 4WI1A 1JFTA 1FSFA 1RDFA 2FJUA 3EIOA 4BNUA 721PA 3JVEA 4EKDA 3NHPA 1MAHA 2I66A 3JD1A 1YHZA 4JEUA 4JELA 4C6RA 4DLUA 4G9BA 4DY6A 3FM9A 4TL7A 2ORED 3A6KA 4QLOA 2PUHA 3GFBA 4Q1DA 3HBLA 1KTIA 2PS3A 2ZG6A 3AR3A 4KAXA 1ONNA 4QWWA 3RSQA 3PXEA 3HB7A 2XUQA 1S3GA 2VDLB 5CCEA 1E1LA 2D1YA 4DIBA 3KZVA 4FGJA 5CXSA 4BO3A 1T2NA 5EOVA 5HCIA 2C9DA 3F9CA 1IJBA 1LKZA 1SIWA 2CYCA 3KR0A 4D42A 3QPUA 1Q0ZA 1R0XA 2RGBA 3PEYA 1E62A 3T06B 1YS2X 4RY0A 1KI8A 4HVAA 4X6LA 3V46A 1J06A 3IEKA 4IRMA 5AHXA 5KNBH 4FGZA 4KWCA 4R8VA 4MUMA 1XQXA 3HP7A 3HYSA 3R5KA 4O2RA 4WKNA 1XMOB 1L7PA 4EJMA 1CUSA 2OXCA 4GLJA 4PO3X 1H8ED 3IFSA 4A5SA 1UXJA 2BFEB 1MAVA 1XZCA 2XTZA 1Q0LA 1Q14A 3PI6A 4GMDA 3OIYA 3UCFA 1MB4A 4AUEA 5KYNA 4BFVA 3TINA 1GADO 3ISVA 1JNYA 4MQ4A 1X0VA 1P3JA 5CEJA 3NHSA 4KIWA 1RJ9A 1MQSA 3B3AA 2XUIA 4MKXA 3ZEAA 3FPBA 1U7PA 1T5DX 1E98A 1Q0QA 3UC5A 5E8RA 3FPAA 3Q0EA 1OMOA 2G70A 4ZDKA 2IF0A 3WRVA 3K6SB 2X4GA 1X8KA 4DCVA 2V7EA 4LECA 4YDSA 2WC1A 5A5GA 1PSWA 5IM5A 1R0BA 1Q83A 4M1ZA 2R1VA 2R44A 4LE0A 2YJ6A 4HGZA 4O4LB 5KSPA 3NXKA 4BVLA 4EP1A 4MQEB 4WZZA 1US8A 1W29A 2XYHA 2GAAA 1NMQA 3C87A 3LLMA 3CBQA 4M7OA 6AT1A 5E1OA 3B3FA 1GQFA 1RRCA 2WUWE 3LG2A 4H60A 2WTAA 3ORFA 4ND1A 2V6MA 1YS4A 2AG8A 3O8NA 3W6OA 3WB9A 3GZJA 2I7DA 2C8KA 4Y2XA 2JCGA 4P7KA 4C76A 3IV9A 4O02B 1KMHA 5BQXA 2NZYA 2B9EA 4QYMA 3AIIA 2PX2A 5GADl 3F8TA 4B85A 2GBLC 1NBIA 4KO8A 3PTAA 5I47A 4C5AA 5JSFA 4C2AA 1QK4A 3ZYCA 5I4IA 2JZCA 2OCPA 1SR8A 3LE8A 1N4AA 1AHNA 2AMJA 1CY4A 1G17A 1TIKA 2Y67A 5ILQA 1UAAA 1RM3A 1XCLA 5DRYA 3UICA 4XPIA 1DC8A 5HM6A 1AO0A 2Q6IA 5DNEA 4YLEA 2PFSA 1LQUA 5HGJA 5ITWA 3A1CA 3KPYA 4UMVA 3HU3A 4NU0A 4P6VF 1MX3A 3PRKE 2JGKA 3QIAA 4C3VA 2DWCA 3LPLA 4EVQA 2BKAA 3ZCPA 4LDRA 1ZFNA 1UJ4A 1TF7A 1PNOA 1BN6A 5CR9A 1OH8A 2VWQA 5AK5A 1SWVA 3Q3VA 2BTQB 5ER6A 3UB3A 5SZKB 5KNBA 2FWBA 3W0LB 5HVNA 5A6VA 2F3QA 3HVRA 3K2EA 2IY9A 4R4JA 4MINA 4FGUA 3A9VA 3X1XA 4BKRA 2XEXA 5JAQA 4BGIA 1QGZA 2YV3A 3IULA 1JG1A 3EQ7A 3MINB 4IZOA 1J99A 5E7MA 2PSJA 4HX9A 2O8FA 1T13A 5K5EA 5LUAA 2OENG 3WZLA 2WNSA 5JJLA 3G2IA 1BGVA 1PU2A 2PKEA 3BCHA 4UTOA 4CGZA 3D0QA 4PRLA 3FB1A 2H07A 2BFFB 2MSDB 5GONF 3K20A 4BFUA 1LA2A 5TPWB 2ROQA 4ADSG 3H5LA 1ZH4A 3UFXB 4DFDA 1O87A 4BN5A 3HTXA 3GFRA 1IM5A 1SQ6A 1WZEA 3NATA 1JJFA 4RWEA 2FRXA 3IRVA 3GJQA 1UWLA 1VYVA 1QJ4A 1X19A 4LG1A 3R20A 4HNUA 4QM7A 1NBOA 2IXDA 1PJRA 3KZCA 4IGAA 1JJAA 4RHYA 3SFZA 1VI5A 2OILA 1EVEA 2REBA 4JASB 3I9KA 4AW9A 2AG5A 1H6BA 2AKYA 4NARA 1R5OA 1XZAA 1IY8A 2QEQA 3OEWA 4B4DA 3EGWA 5ELXA 3AW8A 2W0SA 1YQUA 4LSWA 2WY2D 1PD0A 5MF6A 1P61B 3UJHA 2OM2A 3WG9A 1YVEI 3ZCVA 4KR2A 2CVHA 1RQNA 4MP6A 2XVZA 1RSZA 2D2FA 1ULBA 5D85A 4FFNA 2Q1WA 4FDTA 4E2ZA 2O9JA 1PW5A 1C41A 5CJ2A 3CEMA 4YQYA 4UNSA 2H57A 2H5IA 2FPRA 3A10A 4GH5A 3ZV7A 4BVBA 2ZYRA 4LBZA 2WIAA 1X1RA 3DZHA 3W77A 1OT5A 2CMGA 3F3MA 1L5RA 3QW2A 2OECA 4PHGA 3H9JA 2GRAA 3E23A 3PGXA 1RMQA 2HIHA 3L1IA 5A03A 1R4NB 1QV9A 4KV7A 3ZJTA 1H1DA 1Z26A 3L6OO 5CU7A 4XB2A 5EJMA 4F5YA 1HWYA 1F8XA 5FT9A 1YJXA 1ABEA 4PRZA 4DWJA 2VPPA 3AJDA 2M9MA 4OOFA 5ER9A 5TQ0B 3RVRA 1SM4A 3LDUA 1ZX1A 5ADHA 1PFKA 5KCZA 1AQLA 1P5FA 1AF4A 4KO1S 2GSDA 1RZRD 5ALPA 2UVPB 1CY8A 1FNDA 2CJYA 3T61A 2Z4SA 1I6LA 1PWZA 3BDIA 2VAPA 2JFHA 3C7DB 4A2WA 1A96A 1C9KA 2F8LA 1HSZA 2OG2A 4M9ZA 1SCNE 1IY9A 4R5HA 4RMJA 1SUDA 2R85A 2VDNB 4P2GA 5FPPA 5JSKA 3WSVA 2XVYA 3ZGNA 5IZCC 5ES3A 1YS1X 2JBHA 5ERXA 1V1JA 4CHTA 2VBIA 2VJNA 4K2AA 2M6SA 1U8EA 4DAEA 1A50B 1XX6A 3CSSA 2GTHA 4G0QA 1IXZA 8GPBA 1UR5A 4O1HA 2DY0A 2IS2A 3L7KA 4MUYA 3G82C 2ZJYA 1Q21A 3CX6A 3AEYA 4LRSB 2UUBB 2IDMA 3U40A 1RVDA 2Y92A 5I45A 1DARA 1KDVA 3T9EA 1C3XA 1S8OA 1CEQA 3OEHD 4DYVA 3NETA 2G4LA 5MFZA 2PU5A 3SHTA 4KR7A 1TZKA 1CZLA 4U5QA 1IXSB 5AVKA 1Y8AA 2L69A 4QPPA 5C8ZA 4BEJA 5L8VA 2X5JO 3WLRA 2FP4A 2XAUA 1VKZA 2CHUA 3E3MA 5U9CA 4E46A 2XQFA 2F3UA 1N75A 1N9GB 1PJQA 1O9GA 2NZJA 2V1UA 4ALMA 1HNWB 4M0DA 3VZBA 1H0HA 1TM3E 1Z68A 2OFPA 5FD8A 2CL5A 4LRTB 2GEFA 3U9SA 2GD2A 4EPTA 2PIDA 1RRPA 2REOA 2VP9A 3VTKA 4CRWB 1JWBB 1GTG1 1WB9A 3VR3D 5JYBA 2PUJA 1I3CA 2JK0A 1JMVA 4H0NA 1BS1A 4DR6B 1W0JD 1EDBA 1RWVA 4Z2YA 3MMNA 1TI7A 4IDEA 4Q4AB 4JK3A 4GYKA 4HUQB 1RQ2A 4FFDA 2KX7A 4M9QA 4X6YA 1YBFA 5FNVA 3ROMA 3P9IA 2X8WA 5BUSA 4PZAA 1VHLA 3DJYA 2OCDA 3EG5A 4P98A 1MV8A 2W6ZA 3AUFA 2BTEA 1JEQA 3CEAA 4WXYB 3ROKA 5C51B 3IURA 3HN2A 1UK9A 3IB6A 1W9MA 2PV0A 3BFPA 3FCOA 1V37A 2HMYB 3E9DA 2J6CA 1HDZA 5CITA 4F46A 3ZE9A 4ND6A 2WWWA 2VK8A 1ADBA 1SHKA 2FWJA 3EISA 3PFFA 3WMRA 3D0OA 4QOGA 2X9GA 1YKSA 2PZMA 2WZDA 3JQ9C 3CNNA 2AEMA 3D5EA 3JQEA 2H63A 1HKHA 3LWNA 4DLPA 4JEIA 1QYWA 4P08A 3FTQA 2ZBVA 1U2PA 3BRWD 1PV2A 3QEKA 1RRFA 1BXRB 4W7IA 2QTWB 2AE1A 4ZCQA 2NV0A 2XMDA 2V97A 3SKVA 3K9QO 2VXBA 3E8SA 4LGMA 1ZW6A 2DPMA 1DUIA 3SX0A 1ECLA 3M6FA 4NYJQ 3R8FA 3GDOA 3LPNA 1CQJA 2BEUB 2C92A 1MB2A 1I6WA 2OORC 4DDUA 4MQLA 4YLYA 2HPVA 2J09A 2VP2A 2VSYA 2FX2A 2G08A 2X2FA 4F3YA 2W58A 3EMDA 4UHFA 4F8YA 1BC5A 3DVAB 2JJ2D 1NVBA 3ZUGA 1X7GA 4FOOA 3T7CA 2C3MA 4L02A 1GV0A 1QNLA 4F84A 4HPXB 3SZLA 4C7KA 3T3MB 2Q9AA 2GYVA 2Q6VA 2RSLA 5A0VA 2XNHA 3ASZA 4U2FA 4MS3A 5CLGA 3DKRA 3PV0A 2JFNA 1BGWA 1PGOA 1WVIA 2FFQA 5E2IA 4CLXA 1HMYA 2J30A 1C1YA 2BZ0A 2QMEA 2V7WA 3T52A 4XDYA 1W88A 2YY7A 2CZQA 1Z6PA 2ESRA 3C8DA 3KPUA 3LDHA 1CB0A 1H1LA 1NOKA 3RW9A 3RU7A 3UG6A 1UBNA 3UH0A 4C0HA 1QFXA 3RS7A 5EWJA 1GNPA 2QXTA 1U9CA 2E55A 1E2DA 1ARZA 4QREA 2FG5A 1T1JA 2HD4A 1YR6A 4DR5B 2AD1A 4JP1A 4QC2A 1T2UA 2CGEA 2I3BA 4HB0A 1U0JA 5TF4A 3IJPA 3GD5A 1ZVKA 3RT7A 2HDHA 1Q0PA 1EWRA 4PX5A 5DYWA 5SYNA 4CLOB 1L5OA 1VDMA 2WSLA 3DL4A 3GUCA 4FOLA 4A92A 4F4FA 2WTBA 2OHXA 5K3EA 3DEFA 5M3BA 3RAFC 4J4HA 4B6RA 3KFXA 4DABA 3OQPA 3FD8A 4CQMD 1U8XX 1XPUA 4U2GA 2A84A 3JR7A 5TQJA 4IBOA 3ROGA 7AT1A 1SXIA 4JH0A 4FDAA 4FFLA 1IBMB 5COBA 4Q4HA 1V16A 1GCOA 5BSTA 3BYZA 6ADHA 3BULA 3NHFA 4I5IA 1L4FA 3W2HA 4IUBS 3K0CC 5HKOA 3BTSA 1Z0JA 2O14A 3N2LA 4WKOA 3W04A 4K0KB 1C5KA 2TSYB 1BFUA 3PDIA 5ESXA 2FR8A 3VH4A 2UUOA 3VR2A 1EE9A 4ZCMA 5LOVF 1GR0A 5DZSA 1JHPA 4XIIA 2CLFB 1ZH0A 3CPJB 4L95C 4PS1A 1Y3DE 2IYPA 4PFSA 4GGOA 4UASA 2PBZA 4ZALA 4JI6B 2D0OB 4G01B 3EGXA 5I9LA 4ZC8A 3KSRA 3WGZA 3RGWS 4R9NA 4F5WA 4PFKA 3DSRA 2PUVA 3ZE7A 1GQQA 3ZWVA 5CNMA 4AICA 1Z36A 3Q7QA 1OXMA 3AHCA 3GNLA 5K03A 4RVNA 5KI6A 5KBYA 2Z4TA 3KSAC 3UUFA 4G0UA 1FP4B 3T9DA 1R8QA 3QNWA 5L53A 5HUQA 4TRNA 2NVOA 3DBRA 2Y1WA 2GLXA 4TTRA 4LHWA 1BWPA 4KQFA 2ZSJA 3DLHA 4EHJA 4LVUA 1ODCA 3MB8A 2ODEA 3P9CA 4NNPA 1CLUA 4UCWA 4E7PA 4ETIA 3RRFA 5B7QA 1Q2UA 2PWAA 3VKGA 1PWYE 1Z4NA 2CZGA 4C2UA 3CM0A 1HT3A 3OIWA 1R0KA 3EEBA 2GKOA 1L3BA 1XJ5A 4V39A 5DHPA 1R8XA 2YH2A 4EFNA 2FW7A 2X3FA 1EINA 3E9CA 5FWYA 4KU4A 4CFSA 3Q9UA 1Q77A 3GNSA 3NV9A 3PHBE 2YVQA 3BC1A 3BKWA 5JFOA 3M83A 3B12A 4HB4A 1QRRA 3EB9A 4EAAA 5K20A 5DTIA 3W9BA 2CE2X 2JEYA 5F21A 1ZVMA 3V4VB 1I2MA 2H1CA 3AUXA 3KKPA 1ZBDA 1NYRA 3ME5A 3NHBA 3O4GA 4ZOCA 1AIPA 1T9HA 3EF1A 2BHLA 4BKUA 4DLTA 3WYDA 2EYUA 4U00A 4YRLA 1ULHA 2DQKA 3NT4A 4ITUA 4OMDA 4WY2A 4EI9A 1S7CA 1ORRA 1WULS 1LXCA 1U3UA 3M9XA 4KOEC 4E22A 4Z4HA 2BCJQ 1XDZA 4NECA 2RK3A 1T1SA 2JPDA 5JHHB 4ZVTA 1AGRA 1NNUA 1E6MA 4OKSA 4GRAA 1KSJA 3D6MA 2SNIE 1ONOA 1IY2A 1W1UA 3SXUB 1KEZA 3IKMB 3KJNA 1T3SA 5IC6A 4DCNA 3GI1A 3FOBA 4NHEA 5TS3A 3W5AA 1CZUA 4L75A 1KRXA 1I4WA 1XD2B 2BE7A 4Y8VA 3WGLA 1WXQA 2WMDA 3UUWA 4MHTA 3QYPA 3TCKA 1OIWA 2FHPA 3H7IA 2X8LA 3GN1A 3O3MB 3BX1A 1DG3A 4Y0NA 4QICA 3F78A 4RVCA 3UCEA 2IVFA 3CVOA 3WQRA 3ANNA 4M1WA 2PD4A 2WM9B 4QRDA 3SIPA 2G28A 3ZZ1A 5FBZA 6PFKA 2A8YA 3GJSA 3M4YA 4B8YA 1MC4A 5KTKA 3OO1A 3IV7A 3QHAA 2J4FA 2WHRA 4DRXB 5I4KA 2EFDB 1TYBE 4X93A 1QHHB 1CIJA 1Z4JA 3N7TA 5E9WA 4R2HA 3OC0A 3ZLTA 5LMUB 4EITA 1TKAA 3D8BA 4W6QA 2RAUA 5FHRA 5A9SA 1EXNA 1GZSA 2RCYA 2G36A 4MICA 4BYMA 4F3KA 1EDZA 2IH5A 4B4VA 3WLAA 2C9BA 3CH6A 1EXWA 5CIYA 3AY6A 5FUMA 5LQUA 2IZOA 2QOEA 1VC2A 3IAFA 4EF6A 1VKNA 2DETA 3DG9A 5JALA 1XZBA 1JQ3A 2G9RA 3GBPA 3BGIA 2J32A 2PIAA 4LS3A 3HUFA 4IXDA 1TVMA 2H9AA 1KWKA 2WHEA 1SXJA 2YXLA 3PL1A 2J4CA 1FNSA 3BG5A 2P9FA 4G24A 4ALJA 3EQ6A 3INYA 4B48A 5K8LA 1LPNA 5T3UA 1ULSA 3QYJA 1U4OA 1TADA 1E1NA 2NUPA 2HQSA 4RV4A 1SA0B 2GJ8A 2W8ZA 2COKA 4IQ0A 5G0TA 2IY7A 1OB2A 2PX4A 1JFRA 1TZJA 1M76A 1NJ2A 1KU0A 3AF2A 1FMCA 2B37A 3M33A 2HQ1A 3OCCA 4HCJA 3G8BA 1V41E 1M8GA 4ZVUA 3RTDA 3G59A 3KT6A 1TQ6A 4Q3LA 5A7FA 5L7TA 1ZR4A 4BRUA 1BZYA 2BEVA 2XZOA 2H85A 3D6VA 1SHJA 2P9YA 4DLAA 1NBEA 3OJLA 4Z1OA 3KAJA 2Y1FA 2V9ZA 2WA1A 4M0CA 3LX4A 5B6PA 5JQGA 1U5BA 2NU6B 1IZ8A 2HMUA 1A0OA 3PSHA 4BLSA 2V7BA 3U7GA 3SQWA 2QN9A 4H1TA 4X6XA 2P3OA 3LUCA 1QP4A 1JI3A 3CCFA 1DC3A 3N74A 5G1OA 3VGJA 1CQXA 4WZBE 3LNTA 3O4HA 1X1CA 2OC9A 4DJJA 2K87A 3T1QA 4L6IA 1KAQA 4LN1A 4M8SA 1E5DA 4AF7A 1XZ8A 2VT7A 1Y8QB 3DV9A 3FCAA 1TJ5A 4UM9D 1R74A 2IBSA 1HFJA 1SQSA 4PG6A 1IK6A 2RJNA 1XVIA 3FCYA 5TS2A 1X7DA 4CL2A 4M7WA 5BWBA 1H6AA 3GNTA 3VUEA 4ZYLA 4EECA 2XE7A 2HMAA 3EJWA 2UZ4A 3VR5A 1LVUA 1E0SA 1RPNA 2AIRA 1SHUX 3FW1A 5AKXA 2FHSA 3L0IB 3FKSA 3TTTA 5KQMA 5EQFA 1M2NA 4KEAA 1X9GA 4MQFA 3G7SA 2RHTA 2ZWVA 2OQRA 1NW4A 3Q7TA 2ZDHA 4CF6A 5IUNC 2R6AA 3OEED 4AO8A 1OASA 4B74A 1AV6A 1QGOA 2FXIA 2B1RA 3SSAA 1NR5A 3G9ZA 3LF1A 2C2OA 2OFXA 4TOIA 1QONA 1VKRA 5D2CA 2Z6AA 3CSDA 2O3SA 3KO8A 4NH4A 1HO3A 1VYUA 3C5EA 1PGNA 1F0YA 1JF8A 4OUKX 4CG0A 4F5EA 1EVJA 4OP3A 1GFIA 3MB5A 4TTVA 4YDQA 4ENPA 4ZHSA 3U44B 4YJDA 1QRAA 4FQ8A 1WY7A 4RCZA 2I91A 2QZSA 1SCBA 3BMOB 2Q28A 3EAFA 3PF9A 4V0KA 5A6SB 4TM7A 3FSEA 4E5VA 3EVBA 4OB8A 5A1JA 2AFHE 5JS8A 5MDHA 5HNKA 5LQAA 5C1DA 3E5HA 1BU5A 2P6MA 3QX7A 5AJUA 3D9QX 4ZZ1A 3KLNA 3KZXA 1T0PA 1WNFA 4LKOA 4U8HA 2BSAA 1NBHA 5FBQB 3CG0A 3OO0A 5KYWA 3BMCA 3DEYX 4W5OA 3BJZA 1XLVA 5AK6A 3FKJA 3NOOA 3VC1A 1J97A 2EATA 4Y3UA 1A72A 2WVHA 4C4TA 1D7AA 2V7QA 3AYXB 4AKIA 1XDWA 1WDMA 1MV5A 5BSVA 1RMYA 3ZKAA 4FMBB 3GZNB 4CIVA 2O7QA 3DE0X 1AKUA 3DE4X 1XDDA 2V3VA 2PBFA 4MVXA 2XTNA 3KHKA 4QEZA 4FKMA 2X7XA 3JQBC 3DTTA 5TQVA 5E6UA 5HYVA 2CVOA 2FEOA 1G41A 2Q6KA 4EGFA 2Q3EA 3DMRA 2OAEA 2H52A 4TLBA 1M10A 1V5IA 4V0SA 1H22A 2VAXA 3HGQA 3KOUA 4JL6A 4AQYB 2J1LA 2EOAA 5BMVF 5AVXA 1H8EA 2UVDA 4ER5A 1I0ZA 4O4IB 4YCSA 2I4LA 1NATA 2VYND 3K6KA 3PQ3A 1A69A 3TSCA 5F76A 1JG3A 1N0UA 1Q1ZA 2X77A 4LVOA 2FG6C 2X2OA 2EJWA 3BILA 3RADC 2B1GA 3G0HA 3N2IA 1UKBA 1WRBA 1QYIA 1G7RA 1TZCA 4K1LA 2WPDD 3IXLA 5SYMA 4AY3A 3FGZA 1P4AA 3ETGA 5HILA 1I94B 4FR2A 1TLLA 4Q3EA 1T3ZA 3PD1A 1SOVA 5BO5A 5IVPA 3VZQA 2ZR0A 2QMHA 2XNSA 5EE3A 1A1SA 3TI9A 1PX0A 5F1PA 2P5UA 4JUIA 4W1PA 1ZMTA 2GM5A 2W8BA 4NENB 3U16A 4AJOA 3MTAA 3SJCA 3SE0A 1U1GA 4MW0A 3BMNA 3KYBA 2X76A 4B32A 2IUUA 2QI9C 2VG8A 4MV0A 4ZAZA 3WBJA 1IVSA 3PFCA 1N6KA 4EJFA 3WK6A 2WF6A 1NU8A 2WIFA 1JVBA 3TOZA 1Z34A 3FNIA 5JNWA 2ZXUA 2PA0A 3DEIA 3FGPA 4UBIA 1DKLA 1DX9A 2I54A 3WA7A 4I1PA 3UAXA 13PKA 5AOCA 5FTJA 3WRXA 3ZDXB 4C06A 4OJNA 2ZJ6A 4MI1A 1PT6A 3TZLA 2JGLA 1IBSA 3GD7A 3OZVA 1VLMA 4AJKA 4E11A 4Z1MD 1KDOA 3KHUA 3PRYA 2EG5A 3A4MA 3R40A 4Z51A 1TYCA 2QDKA 4X8LA 3TNJA 2E0IA 4WCFB 4L22A 2G40A 1IWBB 2J8ZA 3BVPA 1TKRA 2NVUA 3GP5A 3IIMA 1JDPA 5LZ9A 2JCSA 3A14A 3DPSA 3ETNA 1K0UA 4FI3F 4OTZA 4ZVKA 2JIMA 1AUVA 1EP3B 1K3UB 4MGYR 3WMXA 4RTRA 2OHFA 5IEJA 1EPUA 5IMSA 1H8HA 3NYQA 3P94A 2PZBA 2Q8PA 3JASA 4AJNA 1O0SA 3QELA 4QJ4A 3L7CA 1NUHA 1EUDB 3LVRE 4X71A 2FMUA 3LWBA 1F14A 1QCYA 4CM3A 1DQZA 1FNBA 2YWXA 3DE2X 2WA2A 3GV0A 4FN4A 1WABA 3O3NB 5T8KA 3UXMA 1F2TB 1C1XB 1JH9A 5EHNA 3EXHA 2ERCA 3K70C 3T12A 1MH1A 3T1YB 2V7TA 1CNMA 3E5NA 3A6DA 2IFTA 1CHNA 4FGSA 4F4JA 4WW0A 3TFWA 1W59A 4WXPA 1C7IA 2QRKA 2R1TA 4IG9A 3PRJA 3KQPA 4PRKA 1N2GA 4F56A 2IHKA 4D0LB 2WIKA 2R6R1 1J0CA 1R12A 4PX9A 4PX3A 3FY4A 2VDJA 2JI9A 3E61A 3T3HA 5K3BA 2QL9A 3DFZA 1CE8B 1L3IA 1N7HA 2JGDA 4MVYA 3FDZA 2ONKA 4DIEA 3ZV4A 3CX7A 4DSTA 4QG3A 1TYZA 5CG1A 4R83A 5L51A 4QYXA 2VWGA 4IXNA 3FNFA 1J7KA 1DXOA 4GBED 5AR1A 1YB6A 1NOJA 2VAMA 4P4UA 1HURA 2A1UA 1UM8A 4OUDA 4E94A 1KKUA 5FWAA 1X7HA 1WHTA 5EZSA 4MA4A 1F2UA 3E7WA 5JBIA 4H3SA 5EQTA 1Y9DA 3Q85A 1X7ZB 4MYSA 4R41A 4TWAA 3AVXA 1AQJA 1R16A 1IOLA 1SU4A 2VP6A 4HH0A 4QT0A 1FDWA 2QUAA 5E9JA 5FLYA 3WFZA 4ECEA 2XA1A 3FIUA 2J7KA 4MUIA 2ZPUA 1OD6A 4QTZA 5IN5A 1CYDA 2X5XA 5G53C 3RBAA 2WAMA 1HOTA 3UJBA 5DYTA 3ZWCA 2PZAA 4O3MA 4PQRA 4BO9A 1BEUB 2FW6A 2X0KA 3AFGA 2GGSA 3ZGOA 2FMFA 1CTQA 5ADWA 3EXIB 2CSUA 1E79D 2QQ0A 4QIHA 5HFAA 1DCTA 1JJIA 1TVCA 2AYZA 4KJXA 3ZXIA 1C0LA 2VSQA 2CYBA 3FWHA 1OLXA 1NVTA 1RNLA 3WKAA 2R66A 2XOEA 2H1IA 3WMEA 1R64A 3GMSA 4HDMB 8AT1A 4FJ2A 3LC0A 2OZLB 4IJVA 5K0SA 4ARCA 1ZP6A 5KHLB 1Y1TA 1Q57A 3JWGA 1ODKA 3CB2A 2WWFA 3M4JA 2XH8A 4R1PA 1N7JA 5EUMA 1TK2A 2PX5A 3AHHA 3P2IA 4PAGA 1YQXA 2F1KA 2QXUA 5MGBA 1RZRA 5JSQA 1OFUX 4FHZA 4DHWA 2EBUA 3UXYA 4MKIA 3UXEA 3EH2A 2A3RA 3O8QB 1J23A 2CL6X 4QDTA 4YJ2B 4D4GA 1EI9A 4FS3A 3GHHA 2P78A 3S8MA 3SIXA 2UZ1A 4TQUS 4KE8A 1DE0A 1O9BA 3L7DA 4A5OA 1DQNA 2A6PA 4BJ5A 4G2TA 3WGNA 1Y3HA 3K70D 1Q44A 3DW1X 4NYJR 1G5RA 1YR9A 5F51A 4LK3A 1RZ3A 1MENA 3OLZA 1JDVA 4K9LA 2PVCA 5K8CA 4M86A 1YB7A 1QORA 1CY1A 2QRGA 3SF8A 3IP5A 4L8YA 4JFRA 2FPGB 2JAWA 2YINC 4IYRA 2YWBA 3PUWA 3ZLVA 3KLPX 1X1AA 1PN3A 1XEWY 2W43A 2ZIGA 4QYSA 2I7VA 3MTQA 1GO2A 3A6HA 5AW4A 4QPDA 3OLCX 1Q6YA 4P92A 2ZBGA 2YYSA 3CW2A 3ZX4A 3HXOA 4P0QB 4IDNA 5U1PA 2EKQA 3SR0A 4YV2A 3SVLA 1IIBA 4LPKA 5DCLA 5LBUA 3SIWA 1Y8RB 3L49A 3VKWA 1EFPB 3PS9A 1JEYB 4UDYX 2GVNA 3CMCO 3ELYA 4RZ2A 1L8XA 2DKOA 3QMMA 5DM2A 3HA2A 3M82A 2AMLA 3NMUF 4FEGA 2H1LA 1KYIA 5F4ZA 5A5FA 2DUJA 1FQOA 1JIKA 2I8LA 4H3VA 1EAYA 2Q21A 4G5GA 5KKAA 1FXWF 1ST3A 5EQDA 3WL7A 3KSZO 4Z9BA 4I3HA 1Y5RA 1YCFA 4EW1A 2PJUA 3SEAA 4BZWA 5E3HA 4RCVA 2D3TA 3II6X 3LHIA 4NPHA 2PKYX 5BOSB 3SHOA 2E5LB 1X6VA 4TV9B 1WPXA 1ITZA 5TMDA 1PHPA 3I6MA 1L5NA 4Z7JA 2BKEA 1ZM7A 5AK4A 2MYUA 1KOFA 2FE1A 4YACA 1O6CA 1ZIDA 3BWYA 1YZNA 4BQNA 2C78A 3D2BA 4HDQB 2RK4A 4EYEA 3UVEA 2PD3A 5IC4A 1WUIS 1CSEE 1L4LA 4ZCPA 4CEJA 2PL9A 1M5TA 1Q1AA 1SCIA 1U0GA 2LBPA 2NTEA 2W6MA 3H8SA 1P91A 2JH3A 4RV5A 3KOOA 4Y6RA 5A0FA 1T91A 5B1EA 1WLYA 4BO8A 3DT8A 3AR4A 3S70A 1CDZA 4LY0A 4MR9A 2A94A 4OOEA 1Y6FA 3VBCA 2CZCA 2QTRA 2BR5A 3KLMX 4PHFA 2NVWA 3AFMA 1NP3A 4EMSA 3GVHA 4Q82A 1QG6A 2WWRA 1CQWA 2A86A 2QGZA 2IXTA 5I9MA 4YRMA 4WXMA 2JCXA 4JJKA 1JKIA 5FPQA 2Y6VA 2PT9A 3LC7O 3DUWA 2JIPA 5LYJF 4O2BB 2YJTD 3DFKA 1WY5A 4Q37A 1SKQA 1XXHE 7REQB 1L5VA 1LTKA 2VJYA 4O3FA 1JIVA 1OX4A 4KKVA 3D8HA 1YQ9A 3HNOA 4JLAA 4YAOA 1K3TA 4YT5A 2NV6A 4BAZA 5C1BA 1AHPA 3RK1A 2GZ3A 3M4XA 1Y98A 2F6RA 3UT0A 5A04A 4EB3A 1CRZA 2HCBA 5ICFA 4YASA 5CB6A 1D8AA 4EGQA 4YJ3F 4Q7KA 2CDRA 2I0FA 3GJ5A 1FVHA 1T36A 4PCAA 1I32A 1UC9A 3UYKA 1XK6A 2BEWA 1GL6A 1A9SA 1PG0A 3D7NA 4C0JA 5KWJA 1RWNA 1AUXA 2J5BA 2JZNA 4GP6A 1H2RS 2JATA 2WTXA 2XCQA 5FIUA 2QKYA 4BP9A 4F6CA 1FUEA 3VKUA 4C4OA 2HMSA 1OGJA 3A3OA 3C6XA 3QI7A 2TMDA 1BVHA 1GRVA 3ONNA 5D3MA 2P7IA 3GHYA 3H1BA 2O3UA 2P8JA 5KINB 1OE0A 2I6SA 3B1WA 2FUKA 1NFFA 2LW7A 1W30A 1SUSA 3FVRA 4TYQA 1M54A 4ZMBA 1Z0DA 3LXRA 4IIJA 5B1DA 3KAKA 1HQDA 1BDJA 3B5JA 3LDFA 3NYWA 4MPJA 4S2EA 4DCCA 1W96A 1QGDA 2PAAA 3KWFA 1UM9B 2WD9A 3GCXA 3HMQA 2X1HA 4Y6OA 2PUCA 2H0RA 1ZINA 2PT6A 3C3EA 2P8SA 3CEHA 4P58A 2V5VA 3D7KA 3JWEA 3VZPA 5LMCA 3QGMA 3UKOA 1GAJA 2WKQA 1LVHA 3IGFA 1XZQA 4J0HA 1DKOA 5FH9A 5FUQA 5KZMB 5KOJB 3PA6A 4CQMA 5HZKA 1GTL1 5B4UA 3Q88A 2BT4A 2RHWA 4PFJA 2EWMA 2F8MA 4FN5A 2DLNA 2H4JA 4JYCA 1YFKA 1GT6A 1HE8B 2DVMA 3BZUA 4YMTA 5B1YA 3DMTC 1KI3A 2RB5A 2VSXA 3O21A 4Q3CA 5DULA 3QMPA 4LOLA 3GDWA 2X23A 5AHRA 4Z3DA 1FDRA 4AJHA 4A0GA 4Z6KA 4US2R 2PEYA 4YO8A 3DAFA 2ZUTA 2B36A 3VAAA 2P9JA 2DBZA 3PU6A 3G13A 5IANA 2V3CC 2JGJA 3LFHA 2PWBA 4WNYA 3T3IA 1GNRA 4QECA 3NIDB 3RGGA 4TMWA 1XRRA 4L72A 4R8MA 5C1PA 1SU7A 1TKBA 1YIDA 3OAAA 4JC0A 3PITA 2OV6A 3BJMA 5ALSA 2Q2QA 4K6FA 1JB9A 2YYZA 4ER3A 3JSAA 5TGTA 3I6BA 5KNDD 1CX9B 1ZNWA 3EDQA 3GFQA 3MELA 3ZZMA 4B6JA 3AK4A 1MQ9A 1NMSA 1T6NA 3LBHA 1PBNA 4IDDA 3IDQA 1OIXA 3RNLA 4RA9B 1DBRA 4KLNA 3REQA 2QNBA 2O8VA 2IUYA 2X0DA 5GY7A 5JISA 4IVNA 3EGOA 3T3GA 1UFOA 2MOKA 1DCMA 1KFEB 4DBLE 2F1JA 4DQDA 5KYGA 4DLNA 4DQUA 5B30A 5JS6A 3FGNA 3TPFA 3N8GA 4UEWA 5JPIA 1IUPA 1FMTA 2WZCA 3DMGA 3ZVNA 4DGSA 4Y1RB 3HJAA 3TI7A 3AJEA 1XA3A 3OU7A 4V0QA 1Z45A 2J9ZB 1E3EA 1GQRA 4LZLA 3KVRA 4LHSA 4US1R 4MEAA 3KYCA 4XSGA 4KMRA 4UHEA 3KQHA 1QZUA 4XGIA 3N28A 3KE8A 1G8GA 3K09C 4H1UA 3B7PA 3TVDA 2R8XA 3WHPA 1YR1A 3OE1A 1NVXQ 2QRVA 3MT8A 3ZBTA 4LOAA 1RYNA 3SYMA 4ASUD 3IVXA 4RJIA 2VF8A 3T5BA 1YJ8A 3CNOA 4KODA 1HFWA 3AUSA 1NJFA 1ZI9A 2IPNA 4G1EB 5KU1A 4F12A 4ZKDA 2D06A 3BT7A 3OPYA 1A76A 2BE9A 3JATA 4BNHA 2FPSA 1DLJA 5EJ8A 3EZ2A 2DSTA 2DU8A 1AZSC 3KUKA 4FOSA 2O7RA 4I4TF 2LCIA 4E14A 3CTPA 2FUG1 2BF7A 3PDWA 5FXMA 1MJNA 3KJHA 3L4BA 3QOWA 2ZR9A 4I55F 1WMBA 1TRHA 2GERA 1EFRA 3SSOA 5C52B 1C3EA 1U7DA 4MS1B 3BD8A 1BCRA 1B76A 1R9JA 2JLCA 2NUTA 4HNAA 5LWHA 2PSFA 5AKGA 1RP7A 4KPFC 1VBMA 2WD7A 3MJEA 4ND8A 4W5NA 1TT5B 3H9EO 1N2CE 2DWPA 2IU3A 1L7QA 4MJXA 3RF6A 3RUPA 3KQNA 4DUZB 3OIDA 4CMCA 3NFYA 5CB4F 2QUJA 4CF7A 3ZU3A 1I10A 2HJHA 3W5IA 3M5WA 2EJBA 1Y9JA 4WPGA 3KPJA 1PJLA 1ZCJA 1P0FA 1T0UA 3GB9A 1S01A 3I6ZA 5ERYA 1YKGA 4PINA 3U6KA 4AS1A 1K2VN 2HIAA 2QUIA 4YRTA 2ENUA 4NCJA 4AZ0A 2ODPA 2O3JA 3EXEA 4KQ6A 1ND5A 3DFIA 1IEXA 3T8YA 2ZTSA 1E0AA 1YU6A 4PYRA 3LCJA 3CJQA 4HDKA 2Y76A 3CZMA 1JBEA 5CT5A 1VCOA 3JPYA 1L5YA 3VTAA 2R7NA 4GXQA 3QXCA 2R7AA 4LNUB 4PLVA 5AK3A 4ALLA 4HRAA 3N70A 3FFAA 4EMBA 4LF6B 3TKAA 3BFVA 2F59A 5BMVA 3MJSA 1C3VA 5IJWA 3Q7IA 2YFHA 3KKOA 3A9UA 3NBQA 4I50B 4R16A 4L4UA 5IAJA 2D2XA 3T9AA 4BLUA 4QDOA 5L40A 3MJVA 4ALIA 1IXRC 5FQNA 2JFVA 1MGPA 1JR4A 1OJ7A 1MOQA 2O05A 2OCLA 1V6CA 4K05A 4LGVA 4IH1A 3OLVA 1HZZA 3E2PA 3FOWA 5HZGA 2ZXFA 2C3PA 4FYKA 1AMOA 3WNVA 3F97A 4L9SA 1OAAA 3E9NA 3NGMA 3N5KA 3SY8A 4BFLA 1BROA 3TLAA 4HEA6 4TZTA 4WLFA 3HYRA 5E4JA 3TXXA 5DNYB 3OM0A 4AJ9A 3NIGB 1LSJA 2VO1A 4RDIA 4NFSA 2HCFA 2HLDA 4RLHA 5D51S 1Z5OA 1M2WA 4ZYYA 2C5BA 3KQMA 3QVLA 1PFQA 1U0LA 2E1RA 3FYUA 1CJUC 1GHTA 2OVFA 3IHKA 4XQEA 5DYYA 4KPUA 4DVJA 3OH8A 1OAOC 3C3DA 4N5MA 1UJ5A 4CETA 2GBPA 2YW9A 5HF8A 3U26A 2VCEA 1EQAA 3FLMA 2IEZA 4XTRA 2J0QA 1OYYA 2ZUDA 2ZWOA 3EN0A 1CQIB 5ALMA 5I7SA 1FLNA 1G8FA 3JQAA 3JVVA 3KWLA 2PGDA 2YZ7A 4JROA 1FRZA 4NFLA 3MS4A 4DMRA 4RTJA 4ZPXA 4GM1A 1KBOA 4CODB 5JNVA 4GW3A 1HLPA 4TMYA 4UBMA 2ZYGA 1ZW1A 4LDQA 1X7YB 4TMXA 3NH6A 4EPYA 1RKXA 2HMWA 1E58A 3H5RA 2EL7A 4YWHA 1N2CA 3I37X 1AGNA 2I6UA 4Q1AA 4TL6A 4JC8A 1HETA 1SKYB 2I8AA 2G9NA 2VF7A 5DI3B 4DSZA 5IWCA 5LIPA 4DQXA 2JIDA 2AF3C 2HJ9A 1XZJA 2Y1OA 5DHFA 2E37A 2QV7A 3ZY2A 2ODQA 3D7MA 5D00A 3TIFA 4AWBA 1C7ZA 1CBUA 3TOXA 5F9FA 2GCGA 2I1VB 2XADA 1XZLA 2R11A 4LHYA 4YMLA 4Q01A 1L5LA 3U9TA 4HDSA 2M2IA 3RS9A 3PKZA 1UBJS 1ZGZA 3TNYA 2OBFA 4D81A 1UBHS 1QU3A 1TYAE 4LY6A 1JDTA 4B3CA 3OEEA 3RSZA 1E60A 1CUXA 1BMTA 2ID8A 1QUEA 2SKEA 3IMCA 3K2BA 2QTMA 2QRNA 4CM9A 2GXUA 3SIRA 1N92A 5DN6D 2B3TA 4DT1B 4U3JB 4ZU3A 1FP6A 2ZRKA 3AB7A 3OCVA 5CFPA 1CFJA 2EGGA 3OURA 5GJVC 10MHA 1N25A 3GJTA 2JKYA 4FHEA 1NW6A 1L6RA 2Z57A 4G26A 1WD7A 1JALA 3WBBA 4Y9TA 3BMQA 3GARA 4YP7A 5H9WA 3Q9NA 1BEEA 4U0KA 4W8GA 1KRWA 1CW2B 4RF3A 1XD8A 1HNXB 4MV8A 4FYIA 1YA6A 2VJMB 4JP3A 4G5XA 3V8BA 4IDPA 3BWMA 4IHQA 3CPEA 4WZAE 5KQRA 2UZIR 1KH3A 3GDFA 3KOWA 3F1LA 3GZTB 1J0XO 1I13A 1VE9A 2VT6A 1E7QA 3FYCA 3ROFA 1ZZGA 4M0EA 2VAVA 1WNTA 2HMTA 4WY8A 2IJGX 3OQ1A 2JLBA 2XF8A 3E84A 3H5OA 3GJ7A 3JZIA 1PD1A 3UCXA 4LI0A 4XQ0A 4Y98A 3M1LA 3DDHA 4Q02A 1VGRA 2APJA 4D3FA 5H7XA 1EWYA 2Q8QA 4TUYF 2A0UA 3WLJA 1FFAA 3E8XA 4HADA 5EWLB 3A1NA 3P2OA 2EKDA 1WL8A 1KJWA 4KIFA 1J49A 4S1VA 4QT4A 3I04A 1C4KA 1ECFA 2CB0A 3BFKA 4DRYA 4QJIA 2IS1A 3IEUA 1PZGA 1KJQA 2Q6OA 5JT1A 2FWIA 1K3FA 1D4AA 2XWQA 3PXAA 5FI0B 5TDHA 4DG9A 4PYJA 4AZ3B 3GGGA 1WP9A 1QCDA 3DE5X 4MVJD 1R0YA 2ENWA 4DANA 2ZI4A 1QRDA 2YUIA 5DP1A 5CX1B 4C1NA 3MQFA 2IEBA 3BPSA 3KUUA 4X41A 1ZRSA 2FPXA 3TJMA 3WKEA 4EYGA 5BUZA 2IYLD 5J23A 2G8NA 1DHRA 2QJTA 4DVGA 2MINB 1VSUA 2V0GA 3G5UA 1C8LA 4RMNA 1AJEA 1O95C 2NACA 1PCXA 2G1PA 4UHHA 1ZHOA 4JP8A 1QIDA 2WJAA 2Q8NA 3U7HB 2JIOA 1E3JA 3V8MA 3QEOA 2GM3A 3CO0S 4OX9B 2HSWA 4ILEA 1JR3E 1DJLA 1OX5A 1NE2A 5C3UA 2BMJA 2BBWA 1E9FA 1W1IA 3H11B 1KI1A 3FF1A 4NBUA 4PBRA 1OI7A 2BMWA 1E6LA 1E1YA 5DTEA 1ZOIA 3RT1A 3EDRA 3TB4A 7YASA 3N0XA