1XTUA

Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump) and cytidine 5'-triphosphate (ctp)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable uracil phosphoribosyltransferase
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 70
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtuA00
4RAQA 1TC1A 1U9ZA 1WD5A 2P1ZA 1A98A 1BD3A 1ECGA 3GEPA 5KAMA 1I14A 1ZN9A 1ZN8A 3DAHA 3GGJA 1XTVA 1I0LA 1XTUA 1STOA 1QK5A 1P18A 3ACDA 4P82A 4JLSA 5ESXA 1QCCA 1D6NA 2EHJA 2HCRA 1DBRA 3HVUA 5K51A 4X44A 1UPFA 1A4XA 4TWBA 1HMPA 3ACBA 4LYYA 5ESWA 2YZKA 2FXVA 2PRYA 1YFZA 1AO0A 1CJBA 4RHUA 1QK3A 1ECJA 4RHXA 2JKYA 4OHCA 1P4AA 1XTTA 3GGCA 3EFHA 4RQAA 3OZGA 2XBUA 1QB8A 3ACCA 3LPNA 1IBSA 2JI4A 4Z1OA 1NULA 1PZMA 5JSQA 1XZNA 1L1RA 4MB6A 2IGBA 1QB7A 4JITA 3G6WA 2VFAA 4RAOA 5BSKA 2AEEA 4LZAA 1L1QA 4QYIB 4RANA 1U9YA 1OROA 2H06A 4WMLA 2GEBA 1P19A 1DKRA 4PFQA 5BQPA 1GPH1 1J7JA 3LRTA 4P83A 5E38A 5KAPA 4QRIA 2PS1A 4LYGA 1DKUA 4M0KA 1OPRA 5IPFA 5EUCA 2H07A 3KB8A 4P81A 1ECFA 1JLSA 5HKLA 4RV4A 1BZYA 3QW4B 1MZVA 1VDMA 1G9SA 1UPUA 2PRZA 4LZOA 3OZFA 1R3UA 1HGXA 1P17A 3MJDA 3N2LA 4RADA 4RACA 1DQPA 3H83A 1NONA 1I13A 3OHPA 4P80A 1ECCA 5BRNA 2WNSA 1W30A 2JBHA 1OREA 1V9SA 4ZFNA 1I0IA 3NAGA 3DMPA 1Z7GA 1XZ8A 4QYIA 1JLRA 1UFRA 3DEZA 1I5EA 3S5JA 1G2PA 3O7MA 4WN3A 4S2UA 1QCDA 2H08A 1DQNA 2DY0A 4RABA 1G2QA 1QK4A 1LH0A 2E55A 4RQBA 4IJQA 1GRVA 4M0UA 1VCHA 4PAWA 5HIAA 4KN6A 4LZNA 1A3CA 3MBIA 5BQOA 4F8EA 5IAOA 4M0PA 1A96A 1O57A 1Y0BA 1G9TA 1A97A 3M3HA 4FYMA 4P86A 1ECBA 4RHTA 4P3KA 1VSTA 1TC2A 1ZN7A 4P84A 2C4KA 4X45A 1A95A 4RHYA 5JV5A 1BD4A 2JKZA 1O5OA 1FSGA
chains in the Genus database with same CATH superfamily
5CLFA 4ZCPA 3TUZC 3P9XA 2HMSA 3B6ZA 4BO6A 2WE8A 1E2NA 2I4LA 4P5EA 2M32A 6YASA 1WKCA 2XNHA 2F3SA 2RAUA 3TR0A 3EA0A 1H2YA 1VDZA 3ZE0B 5I7OA 1WSBA 1QORA 4EHBA 1I32A 1P74A 1MAUA 4CGYA 3W8NA 4RJTA 4EEKA 2C07A 3C8MA 4HXFB 4EBBA 3TTXA 1C4WA 2X6RA 1GZSA 1QSGA 3H7AA 3BL8A 3KPUA 4XVQA 3TVTA 2CHEA 1XRQA 1J99A 4R0MA 1N3LA 5ALIA 4G0YA 2WWWA 2WZQA 2UUBB 4CCAA 3JYHA 4CDGA 4B2LA 2QN9A 2F1OA 4FYIA 4KTVE 3OCVA 4RZIA 1TT5B 4CTNA 3ONVA 3EWAA 2ECFA 5CYOA 4EPVA 3BYZA 3OQIB 4ZARA 3CF2A 2J59A 2ZJ7A 2DPYA 2PKXA 3MUFA 3DP9A 4IIJF 1KEPA 1VLVA 3IR6A 3EY4A 1XZCA 1BXGA 4DIUA 3SR4A 3AVOA 1ADYA 1NF9A 3ZHBA 4ZJYA 3R4CA 4IQFA 4C0LA 4ZOLF 5AW0A 5I9NA 4DLSA 3HMKA 2C2KA 5BV0A 3K0AA 4AF6A 1QZZA 2LPMA 2TS1A 5EL0A 1TJ5A 1GQRA 4JJEA 1EQ2A 4DIBA 2QROA 1XHEA 3ISVA 4DA7A 1LX7A 3LYUA 4I1SA 1C29B 1X7WB 5FAKA 1K7CA 2VR1A 1GGEA 2QOEA 1DKUA 2CEKA 2DSNA 3BMNA 3Q0TA 1BGXT 1UJCA 3D8RA 4DKXA 3VYVA 2ZR9A 1OSNA 3I28A 4UCXA 2YY5A 2FB9A 3K2QA 1L5QA 4JT9A 5ADWA 3ROEA 3ZDDA 1JW9B 1M5UA 2EIHA 2ZR7A 4XB1A 1NLUA 2A14A 2EJCA 3JWPA 4HUJA 4ARZA 3BTVA 1N0VC 4B6GA 4ZYVA 7REQB 2DERA 2IXGA 3KB1A 1TCCA 2A2ZA 3VNQA 3AZPA 4EZEA 4BVGA 4GFDA 3FSGA 3H83A 5GWXA 5HOQA 3H3XA 3TLJA 3VSDA 3ZUPA 1BDIA 3TW4A 3GP5A 1SCUA 1ONPA 2JVKA 1ZUNB 1NA5A 3FUTA 4MR7B 2QT1A 1JU4A 3GVCA 1UJNA 4INOA 3RRMA 3NAGA 4G9BA 4PVDA 4ODIA 4DWJA 4HTAA 3L6OO 2D7JA 1Y80A 4LXIA 3ASYA 4D0NA 1YUBA 2H63A 5KCMA 2WHEA 2X0DA 2G88A 1KJJA 3FFXA 1WIWA 2FWIA 3L84A 4ZO8A 3TW0A 3K9HA 3PUKA 1U0JA 1DQNA 5KYVA 5C5EA 1SUPA 1Q1ZA 3B9BA 2R60A 3GLRA 3JWHA 4R2HA 2EX0A 2XA1A 1LD3A 1IM8A 5LB4A 5G53C 3X2FA 3VFDA 1OGIA 1Q1BA 1POXA 2OFPA 2ZVPX 4ZRDA 4JEMA 4KQHA 4M0FA 3NC1C 2M98A 2PS3A 2JAWA 4R1SA 3OLWA 2IY9A 1G98A 1GT91 3OX4A 3DZIA 1YR3A 1XCGB 3W8EA 2XMBA 1GZUA 4YALA 3FCEA 3GLFA 3I39X 3MM4A 3RDPA 5FPTA 4Q39A 1MXHA 3V80A 2BH2A 3KCNA 5KNDA 1H3FA 4QODA 1ULAA 1NZJA 1QO9A 1Z6AA 5LYYA 1SCKA 1OKKD 1HDGO 2R66A 4FEEA 4XWYA 3STHA 2GXUA 4D9MA 1ZK1A 2UUCB 2ZAOA 3HFRA 4TT8A 5LQUA 2OWEA 2QU7A 4DMCA 3NVKI 5BMVA 3C39A 3K9WA 1XA3A 2JI9A 2WG1A 1G5FA 1DAFA 1XK7A 3N2NA 1RNLA 2OAQ1 3MOGA 3MGGA 3JQCA 1XTQA 1J0XO 1YHZA 4KMRA 3UF0A 4GRIA 3V8RA 3T5CA 4UMDA 1C9DB 1GG5A 1QG4A 3CV3A 2WV9A 2OBXA 3BD8A 3F47A 3F7OA 4EVQA 4CEHB 2ZM5A 3QEJA 1ZVVA 4IJUA 2QL5A 2QRVB 2ZSIA 4PSAA 4YFVA 3ET5A 3K05A 3PK0A 1D07A 4DQXA 1AO0A 5DM70 1QIIA 3M81A 4MR8B 2ERCA 4TS3A 2P30A 4IG9A 3AXSA 2JZNA 3NHZA 4JA0A 4ZQIA 5THQA 3WK6A 2MOKA 3F5FA 3H16A 2GA9A 1G59A 1UEXC 3AYZB 3KXPA 3PITA 2BI8A 2Y0BA 4RQAA 4AYXA 2QA5A 3LLSA 4E5SA 2H51A 1OIVA 1ODFA 1U0GA 3QV1A 3QSGA 3PSAA 1V6CA 1I2AA 4MGKR 2DWPA 1PVOA 3B6MA 5K0GA 3FW1A 1FZQA 4BYGA 4YAKA 3V9PA 4JITA 1QWSA 4RGVA 4A1OA 4YAJA 3BWDD 4NBWA 2Z98A 1GADO 3K31A 4M1ZA 4BVAA 2VNIA 1N6HA 1DFIA 1CQWA 1PYGA 3GFFA 3U4CA 1I9GA 3OMLA 4TTJA 4Q9HA 4B6EA 4M87A 4V0QA 3ZLVA 3WWCA 4CZ2A 5FL3A 3AB8A 2DP4E 4FSDA 1N8TA 3D3EA 4TTTS 1VKRA 4BLOA 4IGEA 3M4JA 4BX8A 2IIPA 2W6JD 1HE2A 2B37A 2ZIVB 3C3DA 3EJWA 1HORA 3CZ4A 3OO0A 3CVJA 3H5WA 5DRYA 4LKRA 4EB8A 3F73A 1EFPB 3IAXA 2ZCUA 4KQWA 1GITA 2ESRA 3G7SA 3OTGA 4RIGA 1PKXA 2GASA 3T99A 3VKFA 3UMCA 2WJYA 3RLFA 5GAJA 3UQZA 4JJIA 2OC9A 2V9PA 1FXWA 2YVLA 1ZXXA 3EXHB 4ZHQA 3P0JA 4ND8A 1NPDA 4Q47A 3SXPA 2NM0A 3VH4A 1GR1A 2HPAA 5JBQA 2VWGA 3LC2O 4IDQA 4PYLA 4DMRA 2BVNA 4MRVA 2WB4A 2EW1A 4HAZA 5A05A 5JHGB 4HDKA 3DNFA 1Y4ZA 2CJPA 4MQFA 1ZI9A 1N2JA 3KQQA 1ND5A 1TOAA 4BJ6A 5GIPE 1OB2A 1LK7A 1S2OA 4F3TA 1U7XA 2GSWA 2FZKA 3ICCA 1WF6A 1A76A 3OQPA 2O0LA 3Q3CA 4NTZA 5T4BA 3RYHA 3SLGA 3NAQA 1F0PA 3I73A 5I7AA 5I9TA 2BMAA 4O4JA 1V5EA 2O23A 2H65A 1VKOA 1TUEA 3CRQA 4LJ9A 3G0HA 5DJ5A 5EZYF 2GB4A 1KJNA 4RQBA 1RWMA 2JDID 2WFZA 2ZYIA 2PKQO 1KI9A 1ZNXA 4J0FA 4AN1A 1PU2A 3KSAC 3JVIA 4Q9IA 5TGZA 121PA 1UJBA 4MULA 4H7PA 3RYIB 3BWCA 1G8KA 1QAQA 4QDJA 1OUMA 3IJPA 4UD6A 2UXCB 5AW4A 5JVDF 4QLOA 5IT5A 5AUOB 2AMLA 2V6GA 3E9CA 4TQ9A 3GNQA 1CJVC 2WP0A 1QPGA 1ISHA 3DDNA 3EMDA 2FQXA 1IBCA 3K9FC 4F5EA 4JGBA 1SIUA 2YFQA 4CKBB 1P5ZB 1LDEA 1UC9A 1XQ1A 3I42A 3SHFA 3VZQA 5D1NA 3WP0A 5TNXA 1F6BA 4H7FA 1I1OA 5J2UB 3TPFA 1PEYA 2ORIA 1T8YA 1XTUA 3DLTA 3C6ZA 3NV7A 3S28A 3T3HA 4LK3A 1FDSA 4TLAA 2J87A 4NOJA 3ROKA 3WWPA 3ICOA 2OBFA 3EZ6A 3Q0EA 1WD7A 2QRGA 1VCIA 1DT3A 4KIFA 3AR3A 2VK8A 4OP1A 1HE5A 4ZQHA 4GWGA 4Q21A 4BJHB 4BQIA 1MO5A 4RY2A 4ZKEA 5JEEA 4KYVA 4KPGA 4X84A 4K8OA 1OV6A 2GLUA 1D6SA 1JAHA 5L7TA 4MCAA 1T4GA 2ZYHA 5AM5A 1M0WA 4MZDA 1Q5PA 1GUYA 2FP4B 2FYTA 4KKXB 1HTTA 4E11A 5IWAB 1DTWA 1Z56C 3EVAA 3PGVA 1UBJS 2RJOA 3VKVA 1W36C 4IR7A 4P3YA 3VJLA 1EXNA 4GZ5A 4BASA 2Y76A 3HCOA 3LHIA 4MMXB 3GI1A 3SYTA 3USES 4RX1A 4X1IA 3SIXA 1RHMA 2YHSA 1EINA 2VBFA 4HGOA 5H68A 5CB4A 3KVVA 3DYIA 4JS0A 4P22A 1P33A 3E5MA 4QGFA 1XELA 4YUYA 4LEIA 1WLSA 3BICA 1HWYA 3K6KA 2FCRA 3M4XA 2BEJA 3OLVA 4NWIA 4PM4A 3V8NA 1IXYA 1NX9A 2MMGA 4IJVA 2BEWA 1KOLA 1KO1A 4BKQA 4BLTA 2PS1A 1WXDA 1C8LA 3ZDYB 4OYRA 2P0EA 4YRNA 2H0QA 1WDMA 1LPPA 1Y8ZA 3VGPA 1G0NA 2GKGA 1TJPB 2NGRA 3AR2A 4ZMRA 2B7LA 4CW7A 1H2RS 4XVCA 1NR1A 3P32A 2Q50A 1DJMA 3OEYA 4H59A 5KMGB 4MWCA 3ADKA 1AE1A 1HTWA 2JJ8A 2HXGA 5I5GA 4EKNB 2RKOA 4NARA 2RGEA 2OCGA 3GUVA 4P3XA 4ARSA 3UBTA 4DMUB 3HKBA 2DSTA 3BB3A 3LG2A 4ID9A 4PZCA 1PJBA 3X0DA 2BM1A 2IY7A 3O8QB 4M9SA 2CFCA 1JFVA 5CNMA 3LZCA 2JAHA 3P4XA 4QBTA 1U2TA 5IVIA 3C48A 3D5EA 1P75A 2ORYA 3VO9A 3PYMA 3RT1A 4URVR 3EHEA 4WIAA 2H4FA 3EF1A 4G85A 1GG8A 2C97A 1TYBE 2NXJA 1RQPA 3ILVA 4G4JA 1Y6GA 3UT0A 1NFQA 3RREA 1P80A 3PXEA 4YRCA 3WA6A 4B6FA 3F97A 3PEFA 1IXZA 3LW7A 2BMWA 4GRDA 3LZ6A 5K01A 1TJNA 4H0CA 4X91A 5K6RA 1RXSA 2PUDA 2GM5A 3DW3X 1DEAA 1SCDA 5FB3A 4EABA 1L4MA 3KFVA 4EPWA 3CPHA 4L7VA 3CVOA 3IOEA 3E7WA 4I19A 4IV8A 3QVXA 3EISA 2C7BA 3I92A 4HLCA 4TKUA 4Y2PA 5EIHA 1M8JA 2GRJA 3DZKA 2G09A 2KYRA 4HQOA 4O2BA 4X54A 2ONJA 3VPDA 4JJFA 3R9XB 4C01A 5F3WB 3F7MA 3D8NA 1DIHA 3VU9B 2F4VB 3VOTA 3EIUA 3Q1KA 1Z0SA 4NCKA 4PQGA 5KNBD 4X3CA 3QU2A 4AMUA 5DNCA 3W5VA 4LK2A 5A5VA 3HCWA 1N0UA 2ZUFA 2WPDA 1QF9A 2PD6A 3RANA 2X4IA 5JSYA 1NUTA 2UKDA 4H6XA 4MK4A 2JFGA 3AJ8A 1JHRA 3KAJA 4UNPA 4G0VA 5JZSA 2OM6A 5B58T 1ORDA 5I4CA 4Z3OA 3VHQA 1L7QA 2WBLC 2PQ6A 4ZDKA 4J9VA 3DVRX 4P08A 2ATEA 2ODQA 3A7DA 3H4TA 1IVYA 3DM5A 4LF7B 4BPBA 3L8ZA 5ALKA 3C98A 3I5UA 3N0VA 1WVGA 1JJAA 2O7RA 1L8OA 2R6JA 2WLTA 5F1OA 3VVBA 4F56A 3LGXA 5BSHA 3HI6A 2VJBA 4FFBA 2J9RA 5LIRA 1V4BA 1VB5A 4WBSA 8LDHA 1YASA 1YA6A 4KE8A 10MHA 2AVDA 4TZ0A 3VSBA 1VJCA 5KTMA 2NVUA 3OZEA 3D8SA 3RIGA 5GJBA 1XZDA 1WCYA 3MOIA 5LN1A 4QUBA 2IUEA 5C5IA 3JWEA 2NO5A 3GOHA 1Z4QA 2RGXA 5L3VA 3KALA 1M33A 1U1DA 4ZD6A 1EIZA 3F3MA 1V7QA 1RBMA 1NJ6A 3PFNA 4UTZA 4OG2A 3V1NA 2RHTA 4ZCSA 3G8YA 1OV4A 3P9SA 2VF2A 4WFKA 2AK3A 2WYOA 5ICFA 1TL7C 3IKMB 1IY1A 4XYMA 4QAJA 1XYVA 4EHFA 1XVTA 2PMBA 3IOYA 5IP5A 5DP1A 5EZSA 3TEMA 1FK8A 5AKXA 3SZOA 3K9BA 3D6TB 2YFYA 4DWWA 1XZGA 5DBGA 3H13A 4UNNA 1C1HA 4BLSA 1ZVMA 2KLHA 1NX6A 5LZ7A 4JUDX 2G9RA 4RD3A 3LFTA 4X8LA 3EBOA 2O9JA 3QHPA 3QOYA 4JI8B 4BEWA 1IQ0A 4J3JA 3AESB 3Q9SA 4C0KA 3MZ0A 3R09A 1JPJA 2QIPA 4HNQA 1C8BA 1HBJA 2ZJ3A 1DT5A 1RP1A 1V7PC 3INRA 3QTTA 4I3GA 4M9XA 1X1SA 3EUWA 4Y9RA 4YP6A 5FXMA 1X7DA 1VSQA 7ABPA 1DAIA 1EG7A 4FUTA 1YAJA 5IF9A 1T9HA 4RZUA 5DTQA 3PJRA 1V9SA 5G1OA 1HE8B 5I8ZA 1KSGA 1E7WA 3SG0A 2YZ2A 1TZMA 5BN3A 2FK8A 3G8BA 5TEWA 1ICIA 3U9SA 4YJHA 3MUEA 3AKZA 2B1QA 2HV9A 5AOBA 1XTZA 4FYWA 2Z2XA 4GECA 4L5IA 3S1AA 1I5EA 3T7JA 1JNXX 1YACA 1A2QA 3LWDA 3IXMA 2Q5IA 3RSOA 2EGUA 3IODA 5E1BA 1HDEA 3SD7A 4B9AA 2CD7A 5K3OA 1QHHB 4CM4B 5HKKD 3W34A 1JH8A 1E3IA 1IVNA 1Z5PA 2AXEA 2CB0A 4CNQA 2XMZA 1ZZGA 4PO8A 5FA6A 3TZCA 1O6ZA 1GYPA 5AI9A 4Z9BA 3VR2A 4NV0A 3WQSB 1U80A 1MG5A 4N12A 5DBOA 4AZ0B 3LIPA 1YZGA 3QNUA 1OI3A 1UBMS 2ZT6A 3M6WA 1AZLA 4K8RB 5I9BA 4J1TA 5D5HA 4BLQA 1E5LA 4OM7A 4E14A 1FQWA 2F1JA 4OAOA 5AUNB 2DFKB 2R85A 1I2CA 4X9XA 3V2UA 4D02A 1T4CA 1GTG1 1ENPA 1JIUA 1P6XA 1Q0RA 2B35A 3DFKA 5E6UB 1K98A 4X65B 4FWBA 3BXEA 1UJ4A 1W5FA 1SVUA 1XTSA 3G79A 1SC9A 2QW8A 4OIMA 2GDZA 2QP3A 3R0XA 5J58A 2GSDA 2Q45A 1JDZA 3U3OA 1KYXA 3PJEA 3N2ZB 3PVZA 1HFKA 2I03A 3OPQA 1DQSA 1QH1B 1G4UR 1XNGA 2R4QA 3WLTA 5B1YA 1M67A 1CF9A 1J7KA 4QDZA 2I7DA 2J48A 3MJFA 4IDCA 4TV9A 2QDKA 3UPUA 2B8TA 4UEJA 1O6CA 2ZSHA 5F7ZA 2GRUA 2TMYA 4N3BA 3WHKA 4BN5A 3IJEB 1MRNA 4PHGA 2ECQA 4UBLA 4XLTA 4GW3A 2D2EA 5JTUA 3T4PA 5E4FA 5IWCA 1TT7A 2CDNA 3A2LA 3DCJA 3DEKA 3OMWA 4HH0A 3RUIA 1ZQ9A 1H8ED 1WX1A 3C5CA 2IUFA 1MUUA 2OZPA 3U7JA 5JSQA 4Q4AA 2CKMA 3W6OA 4F1KA 1MEJA 2JAPA 3CRRA 2RONA 4AWAA 4C5AA 3C70A 4CL8A 3TM4A 3UK6A 3NWOA 3QGMA 2Y1GA 2YNMD 4GX0A 2V7BA 1FDUA 2BV3A 1OX4B 5AM0A 4AK9A 4BN0A 1ZK0A 4HB2A 4KN8A 3PUJA 4B34A 4F92B 5K03A 1XR3A 1Z2PX 1ZGZA 2D8AA 3AHEA 5D01A 1Z2DA 1ISPA 1YUMA 2FUG1 3QKSA 3NHSA 5DX1A 2YCBA 2R1UA 2ZPUA 3OMXA 3ZEAA 3A1TA 5MGNA 1SVSA 1QFMA 4MPJA 5GZ6A 1MEOA 1HYBA 1K8RA 4ZO6A 4LHYA 3ZYZA 2QT0A 1NOJA 4Y98A 3ZDAA 4G1CA 4YECA 4FIZA 3WHPA 3DV0B 4XPZA 1WUJS 2IOHA 3MB5A 4B8ZA 1P6QA 2B30A 2ISSD 2OCBA 5H70A 4GZLA 1C14A 3OJCA 4GBED 4IKOA 2EF0A 3B6KA 4MV7A 4AJIA 3RS3A 3RFUA 2WFLB 1SXJD 3D1VA 1ZSYA 5I01A 1Z74A 3H18A 2ZR0A 4Q9KA 2YN4A 4RVHA 5I7VA 1UK6A 3TIVA 1PLJA 1OA0A 1XZPA 2DWUA 4NG4A 1Y8QB 1NLFA 3U9TA 3ITDA 5AOVA 2A9KA 4S05A 1C8KA 1I80A 1YS6A 2M9MA 1O89A 3SOZA 1HFEL 1NXTA 5HTKA 1SB8A 3AEZA 1H1TA 4YCSA 1CC1S 2IKSA 4D57A 1CDEA 3FKQA 2MYUA 3OQJA 4E12A 1JIVA 5AM1A 3C4VA 4KRGA 5KDOA 4PAWA 4D8XA 1NVAA 2K4MA 1C0IA 1SWWA 5C3UA 4EVIA 3P7MA 4MAAA 2XIJA 5LKAA 2L2QA 1NI4A 4GPTA 4YJGA 1I1HA 4L5YA 3MTGA 1A5SB 2PBZA 2VSNA 2QP9X 5AJXA 3LY7A 1CSEE 2FXIA 3K94A 2Z4SA 5AI4A 4JB0A 1FY2A 3VTFA 2NUAB 3H1AA 3DVLA 1T4MA 5FQNA 4EFNA 2XEXA 5FPSA 4J7AA 4QPPA 2C2MA 1W19A 2RHLA 4MKHA 5AOAA 2ZTMA 2WTBA 1O0CA 2P8SA 4FR5A 3HNPA 1NY5A 5JXJA 3RVJA 2Y93A 4EITA 3GLHB 2X0NA 3EQZA 4M38A 1JIXA 2C0PA 4G84A 3CR8A 1FSFA 1NF8A 4B74A 3ZE8A 4GUDA 3L7KA 2QAIA 4I4TF 7MDHA 1NAIA 4JENA 4OHFA 4KXXA 2QN6A 4HWPA 4WESB 3WK9A 1KOJA 4I5FA 3TF5A 2WJZB 3DLPX 2ET6A 4OK6A 3AVUA 2EU8A 4EB0A 4OOEA 3ESDA 4R5HA 1PJCA 1P7WA 1PT6A 1WABA 2JCXA 3AUFA 3FZYA 4KQGA 3V4ZA 3ZHYA 1QGZA 3LPCA 4LZWA 4R9VA 1HLFA 1A8PA 4UD2A 2VZ8A 1NQ5A 3JVEA 2RIPA 3CSUA 1QVVA 3O4RA 4H2DA 1U7WA 1E3DA 4TSRA 4OD0A 1HFJA 4B87A 1X9IA 3L6EA 3ZI0A 3HKEA 3F5DA 4MVJF 1AY0A 3I1JA 1WW2A 3II6X 4G6ZA 4GYKA 2C4TA 4M49A 2M6KA 1FTSA 3VHXA 4R2IA 1QUFA 2VTBA 3UK0A 1GPKA 3GZJA 1WA5A 4RJIA 4QXMA 3SMQA 3I5XA 4M55A 4JI5B 4ARAA 5HFNA 1J1IA 3HDGA 1UL1X 4KHZA 3NYQA 4YT8A 2Y27A 1J9ZA 1GXSA 5JZBA 2H2AA 5B2ZA 4YLYA 5AFSA 2E5LB 2A59A 4RH1A 1EVQA 3U40A 1VBNA 2Q1SA 4PLZA 4MHSA 2KJQA 1Z5UA 3GV0A 3JD3A 5DLQC 3RBZA 1RI3A 5DB4A 5L4SA 3B20A 2NV0A 4QHTA 4YCNA 1SHTX 3VJRA 4JXZA 3VNBA 1WBJB 1AURA 2NTEA 1W85A 3EVNA 2IZ1A 3IHKA 2PUAA 1S4MA 3WYNA 1FLVA 4LDPA 3I76A 3NT5A 2YASA 2A1TR 4DIEA 4EHHA 4PF1A 4WLEA 3V1UA 2V0NA 2JZOA 3DG9A 2VYVD 3M1YA 1CK4A 4HI0E 2C5SA 4BNYA 3KZCA 1LPOA 3CUWA 1YDEA 2ODEA 5IUKC 3IBFA 4CM5A 5CCEA 1VLJA 3U80A 3MELA 1V1MB 4BV3A 2PCLA 2Z56A 3OHPA 3PL1A 2Y9PB 3DMTA 3RVKA 4EGFA 3IJRA 3CLVA 4DQKA 5HP4A 2VJMB 2I78A 4PAMA 2FWRA 2V5AA 4YMVA 4YASA 1JFSA 4LBZA 1PJQA 4UAGA 4E21A 1EU1A 1PL8A 1R7RA 3IDQA 4PE5B 5DH9A 3GA7A 3GD7A 3JQ6A 1UFRA 1UXHA 3EA4A 3PPIA 3QYJA 1HYHA 3P26A 2WZDA 4RK4A 2X42A 3WC4A 1QCDA 2QUAA 2MU1A 2JL1A 2RH8A 2ZS8A 4FMPA 1MBZA 2FPGB 4POOA 4U8GA 5EUBA 4UTRA 4F4CA 1ZD2P 1Q0LA 4BP1A 3OQMA 4R0NA 4PLHA 3KXKA 1U6KA 5G2OA 2BFWA 5F52A 1ZONA 1MV8A 2Y1OA 2M6RA 3OM8A 1W5AA 1MH1A 2EWVA 4MTLA 4NE2A 1XEXA 3RS2A 4ALLA 1XZHA 3OUZA 3KOWA 3M2PA 3RRNA 2P7IA 2ZYGA 3B1FA 1N57A 4KO3S 2QRUA 1UBKS 2G1KA 3LT5A 1LW6E 1S2IA 1PZFA 1XNJA 4GI1A 1LX6A 1AQ6A 2CXNA 2GKOA 3CCCA 4JIMA 5M29A 3CUTA 4M46A 2HREA 1DTEA 2QRPA 5T57A 3UT5B 5IK2A 1NR5A 3H9CA 2HW8A 5A7HA 1Z45A 3IB3A 5E1MA 5ENVA 2L19A 2ZWIA 5H4HA 3TDMA 1CZOA 4EI9A 5JNRA 3VOBA 3LFUA 4O08A 1NBOA 1XSEA 2Y68A 1AF4A 2GMWA 4ZT5A 5EE5B 4EQ6B 4RA6A 4QARA 1YRYE 5CCXA 4UEQA 2CXQA 3UV6A 4EECA 2HLDD 2QMZA 2J07A 3I6BA 3CY6A 3ZWDA 2PUJA 3LOUA 4NNOA 3EC1A 2FXVA 3PP8A 2OZVA 2ZSJA 3BFVA 3VR6A 2H16A 4JODA 1K7XB 2OESA 4DXHA 4YXWD 2GETA 4GZMA 4KGVA 5KQPA 4QG7A 2Q5QA 1RWQA 1GYRA 2B5WA 1T6BY 2XB6A 3PPYA 4IAOA 1MZPA 4L2IA 1MHPA 3IBYA 4W5HA 1LC3A 3R5JA 2KBEA 2YR0A 2I4RA 2R68A 3L6BA 5EKDA 3L1KA 4YEDA 4AY4A 5LJLA 1K5GA 4NU8X 3TFWA 3GEDA 3WVNA 2ILTA 2WJ6A 3M2TA 4MGHA 3T54A 1U9YA 1E18A 4R2KA 1H4QA 3IB6A 5MGBA 3EULA 4MRSA 2XCSB 1E2MA 1E4YA 1V6AA 1J1UA 4A2WA 4NZ9A 4PZ9A 3LP5A 5BQPA 1Q3HA 3KKLA 2BCEA 5L40A 2O2GA 1PS8A 3EZFA 5CD9A 4DSTA 1U8FO 5LXTA 4P83A 5ED4A 5C1OA 2C3MA 1DLIA 2N1BA 3LO8A 4DLYA 1JEQB 2WJWA 4DUYB 3TLBA 3QVWA 4IIHA 1A4RA 3GXBA 1P4HA 4GPD1 1YI1A 5IPFA 4AZWA 5CAEA 4BNJA 1LC0A 2VQSA 3FVWA 2CLOB 3HE3A 2QN7A 4JOQA 3DEIA 4LKOA 4HRVA 4LF5B 5F2NA 4ER6A 3A32A 3DHNA 1NP3A 4LXYA 4PNEA 3Q7SA 4ZCRA 3X2SA 2JA1A 4TTVA 3FDZA 2ZUVA 1H2XA 1XTPA 5IULC 4LMBA 1GPNA 4JSYA 4X00A 5DW0A 5CT4A 2AYXA 4JLKA 5FADA 4DNQA 2Z6VA 4LSMA 4XX1A 3ZDQA 4Z7OB 3NB0A 3W5AA 1XEWX 3FAZA 5ALWA 4AUKA 2TRSB 1ISRA 1Z8FA 1D1QA 3HA7A 3CEJA 4DLAA 1DEKA 1W4AA 2EDCA 2EQBA 3DWFA 4B17A 5JAPA 3ZHXA 5KNCH 1XVVA 1O97C 3NFYA 4EVRA 2OSVA 3BIOA 5A9SB 4GMHA 1PT8A 1KI8A 3EX7C 4G5QA 1AQYA 3HR7A 2HTFA 3OUTA 3DOOA 4WWHA 3FG9A 3V4RA 1JDJA 3D7KA 4FOOA 5LBUA 2ZIEA 1X1AA 3VNUA 3DFMA 5BXYA 3OHMA 1V47A 1OBCA 1GRVA 1UFKA 4K05A 4V0KA 3PUWA 4L9WA 1YQ9A 2AC4A 3KYDB 3GNLA 5J59A 4QU5A 3SC3A 3EC7A 4URXR 3P71T 4GGPA 1PEKE 1CF2O 3LY8A 4RPCA 1I7QB 1NSTA 1QYDA 1V37A 3M6FA 4XFKA 4YJDA 4FHGA 4ENRA 8OHMA 2C3YA 1BMDA 1E96A 1M8FA 4KE6A 1Y5IA 1KFCB 3R7SA 3WRYA 1S0UA 5JBNA 5LDDC 3FDFA 5FBHA 2AOUB 3ABIA 1RDFA 4W8OA 2HZBA 1GQQA 1HL3A 4RTRA 2HUPA 1GJRA 2X8BA 3ENZA 3WYCA 4G86A 3BWYA 3U4GA 1X80A 4OFZA 3DTVA 2CNLA 4L9RA 4ZOQI 1QFXA 1MX1A 2C9BA 2DBZA 5ALZA 1QO0D 1XFDA 3F74A 4AIIA 2YVKA 3MJCA 2C1EA 2CUKA 2OCIA 1QGED 3SYRA 1A7KA 2FWNA 2R8YA 3BHNA 1EBFA 4N82A 4HVTA 4H7JA 4RKYA 2JI7A 2DFNA 4X7RA 4AZ3B 4GKVA 1V16A 3WDKA 3K73O 4DABA 1UQRA 1O4VA 3VPXA 4MRRA 1QK3A 5CT5A 4KLCA 1TZBA 1SVMA 2Q9CA 1E6KA 2EL9A 3DZFA 3JQRA 3BRWD 1AK1A 2FPSA 3L8EA 4TLLB 1I5OA 3V8PA 2HXSA 2NYUA 2Z2IA 5A5EA 1ZUHA 3CO0S 2KSQA 5AT1A 2Z6UA 3VU3A 2DBVO 3F2IA 3LT0A 4H9GA 2D3WA 2BGWA 2GCEA 2JRLA 5JFTA 2BFDB 3RWMB 2OQ2A 1X77A 3KEMA 4CU5A 1IZ9A 1OFUX 5BSFA 1RM0A 1FJ2A 5HBGA 1OZHA 3B60A 4YAGA 3CE9A 1GOTA 3RO7A 3UB2A 3TW6A 2RG7A 3GPCA 1N6NA 3SYKA 2A0KA 2PDAA 3F1LA 3A3OA 3LC7O 4Q05A 3ETEA 3L6RA 3Q7IA 1ZFNA 2AWOA 2FMUA 2YDXA 4FFLA 4IQ0A 5C52B 4RTKA 1C1XB 3NH9A 3ECAA 5C4GB 3WDLA 2VZ0A 3DGFC 1SG9A 1PT7A 2G77B 3FLAA 3KD3A 3MW8A 4QX6A 3HBNA 1N9ZA 3ZOZA 1S7CA 1OI2A 2DHCA 2QGZA 2GAFA 2R97A 2ZT7A 2PYDA 4Z0HO 1FFWA 1H5QA 1YCFA 3OJWA 3PPWA 2GVZC 4FCVA 2FG5A 1YS1X 3QW4B 4JB3A 2XH8A 2ID9A 1RXYA 5JNUA 1E9EA 2G40A 3CUUA 4L3WA 2AN1A 3NALA 3BT7A 3AP1A 1SUIA 3FJ1A 1L7DA 1OBOA 3U7FB 1QIHA 4B4VA 5SZKB 1P1IA 1G8YA 3LPLA 4XVRA 3IQIX 4F4UA 1ZD8A 2FZLA 3CO5A 4PSUA 2FSUA 1YRBA 3AQ4A 4X64B 2A3RA 1TCVA 3IFSA 1F3LA 2FFJA 4YQEA 3L8FA 5F2OA 3ZU4A 4MI6A 1QX3A 4DMGA 3LFHA 2FWMX 1M8KA 5JWHA 1FYXA 3EGXB 3OF3A 2BP7B 3S8YA 3D8HA 3N8KA 1D5CA 1CJCA 3WL7A 3AWIA 4MRNA 4MV4A 3L6UA 1FIUA 1J25A 2GAOA 2OCYC 2Z57A 4G5FA 4C2BA 2W22A 3TQOA 5CB6A 4JI2B 2W8BB 2FPPA 4LX8A 3P5SA 3TK1A 4OI0A 3ORYA 4IG4A 4XFDA 3IVGA 5BNTA 2VRCD 4NCNA 3GFVA 1NSYA 1RWXA 3EIHA 3W1EA 2RI6A 1SEPA 5HK8A 3COYA 4EF4A 3MJTA 5J4HA 4G0QA 1VSTA 2QUKA 4BE7B 4U2GA 3DDCA 1BWQA 2EJTA 4M86A 1DO8A 5L7YA 3UCFA 4YYEA 4RO0A 4CM1A 2OGWA 1FF9A 4AX4A 1CUFA 3EAGA 5LA6F 1DIAA 1GUZA 1MB9A 2A78A 2X9VA 2P3QA 4I6JA 3FFWA 4MV6A 3THRA 3WYGA 4ZEVA 2EP5A 1RM5A 3INNA 3NBMA 1BMFD 4CLDA 2CLKB 2AYZA 2JBWA 3WYEA 4WEOA 1PUJA 1OA1A 3RC8A 2BR4A 1J20A 1J0DA 4LSGA 2BBSA 2XUDA 1RRFA 4K2AA 1KY3A 1RW4A 3DF9A 4N54A 4WH0A 4UM5A 3IAS6 5JRDS 1YXMA 2CLMB 2OD9A 2NU6B 5CEJA 4E4RA 2C7PA 2DB3A 2QSYA 1FXSA 1L7BA 4MUGA 4ZAZA 2X9QA 4DBZA 1L7PA 3ER9A 1YFZA 2VHJA 5ALXA 1PR9A 1RBQA 1ZL2A 2J3KA 2AXPA 2G9UA 1MAWA 3V1LA 5AH0A 4ZU3A 2D2IA 1SXPA 3EHDA 4AVYA 4IIGA 4DR5B 4GM4A 1ATZA 2A57A 2ZRKA 3CLUC 4WHMA 3I9FA 3LBHA 3PI7A 1L9XA 3CWZA 4LV6A 2GZSA 5BQ5A 2WQ6A 1M1YE 4G8JA 2I8AA 1WUHS 2XBLA 3JZDA 3LF1A 4IO0A 4LWOA 4F1JA 1I3MA 1JKIA 4QYIB 3G0OA 3K1AA 4ASUD 3ZY3A 1ESNA 1FUUA 1SD5A 2WWFA 2WHPB 3EIQA 1D7AA 3ICPA 3VR5D 3M0EA 5TLSA 4DQUA 1QS0A 5C4IA 3C1OA 2Y1LA 3QFTA 4IGKA 3QYPA 4BNKA 3FI9A 1JTFA 3MJSA 3L4SO 4IS3A 5D5PA 1VKJA 2Q2OA 4BAGA 2Z6QA 4BXOA 1X1DA 1YZVA 1L5WA 2JGDB 3DTTA 4PFKA 1ZCAA 5GP1A 3ZHCA 4XWAA 4L72A 3K20A 1U1FA 2B4AA 4KXMA 1ZHFA 2Z1NA 1HDCA 2XXAA 3NT2A 5LKRA 5FOTA 4RTNA 4RM3A 2R1VB 4DUPA 4ZPXA 5BRJA 4MHOA 4I4LA 1H6BA 4B33A 1L3CA 2ZFUA 4HT3B 4I50B 2BD0A 1LI5A 2VP4A 3SLKA 3NVMB 5L6MB 1II8A 3TCXB 4U0JA 2YJNA 5IN5A 4E07A 1DQPA 3L4JA 2A5FA 4DLTA 2AKAB 5FBRB 3ZTTA 4BFCA 5IBCA 1BWRA 1N2CB 3OU2A 3VVMA 1I24A 1FP6A 2RD2A 3THYB 1UKYA 4DQ0A 4ER5A 1NFRA 4ENQA 2B1RA 3IEVA 1PI3A 4TS4A 3QEMB 3GAFA 4OGWA 1T9KA 3SXJA 2KX7A 3KYCA 3LUGA 5K0JA 1S3SA 3K1TA 2FPXA 4WV3A 4HFJA 1BE8A 4G9GA 4XJXA 1SJ9A 2JHCA 1W4LA 4DRYA 4N01A 4JOBA 4NZYA 1CZLA 4TMZA 4EX6A 3VAZA 2J9FA 1DEHA 1GL7A 1OGYA 2D06A 4X1OA 5GPBA 2I6TA 2P6RA 4LRUA 2BKEA 4MO2A 3KOOA 3S3TA 4KYIB 4R8MA 4TTPA 1TQHA 1Q0UA 2PGAA 2W4QA 5AI5A 1IONA 3F4KA 4ARIA 4G5GA 1DRVA 1J0BA 2CFIA 1AB5A 3CPJB 4GSYA 3ESQA 4EG6A 1OBVA 2Y1KA 4NMLA 4DDUA 3P0RA 5HE8A 3LGSA 1FB5A 2E37A 2HI0A 5F2EA 3A1EA 4P86A 5BN4B 4TLDA 4XLZA 4KOEC 4CTKA 3P52A 4PRKA 1EVIA 2PL9A 1P0QA 2YIMA 2PTGA 2D1YA 1L5VA 5KTSA 2MINB 3BQMB 4BLRA 1AHNA 5CW1A 1FMCA 2DLCX 2FMIA 3T06B 1ZIOA 4N6GA 2FPIB 2JFFA 3O91A 3VTZA 1G5IA 2IXEA 4C20A 2XRYA 2PT7A 3KKQA 1AVTA 1MIOA 5DK4A 5IBPA 3RAPR 2QDXA 1QGUB 5AMXA 1J2EA 2V96A 5B2FA 4ZVSA 5A3JA 1V1RB 3D3KA 3GJ6A 4LDQA 2GR9A 2V59A 4LQLA 3VR3D 4Y6LA 3VC1A 1E0KA 4CQMB 4CQMD 3ZN2A 3IUYA 4I66A 4XD7D 3W2TA 4BE9A 1XDDA 3D64A 2V0GA 3FJYA 4MW2A 2BEUA 4RFVA 4CI9A 1W2WB 3F8SA 5IKOA 4Q02A 4R9NA 1QFJA 2IXAA 5DLDA 3ZVRA 2DT8A 4H4CA 5TQ2A 1KXJA 1RFLA 2W93A 3KM0A 2QT9A 3TCKA 4CFZA 5BP7A 3D5TA 2BHTA 5K7SA 2PUBA 1G7RA 2GNPA 1MOSA 1IM5A 3VAYA 2G36A 4TUYB 1SBTA 4QBHA 5E3IA 2Z5LA 3PT5A 1MVOA 1M76A 2YC4C 4UZSA 3COZA 3UXMA 4L85A 4WA7A 4NBNA 1EXVA 4Z4QA 1X1RA 3AF5A 4KQ6A 1LQTA 1Y1QA 1U1IA 2HQ1A 2JD2A 5AVOA 3FVTA 3AIIA 3ND5A 3V2HA 3NTRA 4D8WA 2Z4TA 1WXGA 1ZD4A 4BFUA 2NAFA 3ELDA 3DC7A 3R0JA 1R6BX 4TZKA 4U2CA 3L0YA 1SCQA 5T64A 2QVGA 3AL2A 5HZKA 3MWDA 2ZRLA 2O5VA 1HOTA 2V3VA 4JQZA 2ZVQX 4P81A 2XYPA 3CPSA 3HVIA 3HS3A 5DBIA 3F46A 2CN1A 4D3SA 3GZTB 5K6AA 4FB5A 1DMSA 4EHKA 3DMTC 3ED1A 3G13A 4H0NA 4J91A 9MHTA 1KQGA 1FFXB 3ONDA 4RM2A 4G23A 5JNLA 5DXAA 2A92A 2XDQA 3HM9A 3NX4A 1QP8A 3OZBA 3C6KA 3O4JA 1OH5A 1CQJB 1U7PA 2FQWA 2JD1A 4LBYA 1THTA 1Z88A 3PF8A 2JANA 1FFGA 4M88A 4X6LA 2VT7A 3LT1A 5C5CA 5C37A 5TF0A 5AICA 3UUWA 5BNWA 3BAFA 1S2LA 4RE6A 2OZLA 3FTDA 1H5UA 3O8DA 1Z68A 1SU6A 3GVXA 3DMGA 3BD9A 1UJ2A 4U39A 4LF4B 4GR9A 1CZHA 2NV6A 3CCFA 3WK7A 4GOJA 5BYBA 1J21A 2OCLA 5C1IA 4UTXA 3ZBUA 4Z4FA 4S2UA 3GJ7A 2PYIA 3DUFB 3QKUA 5AXBA 2CLDX 2PYZA 3HA3A 3O0DA 3LBYA 4PYOA 5J1TB 1KYQA 2VOEA 1MF7A 4RGYA 3HWSA 2SCUA 3EOZA 2F7SA 4MAFA 4LFBB 2PG3A 4US2R 1U90A 1EFCA 4LPSA 3KQTA 5F5LA 3O8OB 1W4BA 2OB2A 1ARZA 3FIJA 1Q92A 4XUCA 3X1DA 4ETMA 1S2GA 3DD1A 3SFZA 1E1QD 5JJ5A 4V0NA 2C2HA 5DN6D 4PG4A 1S8OA 2OHOA 4LCBA 5LQSA 3B3FA 3IPLA 3NTVA 3OF2A 3DKVA 5FOWA 2PSHA 3UW3A 3IP3A 2BZ0A 4E31A 3FPAA 4WFQA 2Y92A 4DCSA 2V7VA 2VYQA 3FCAA 4D43A 4QYXA 3KELA 4RCZA 4RPHA 1PZEA 1W5EA 3BAZA 4R4JA 1TJYA 3B9QA 5A2QA 2D8MA 3KHTA 3IMGA 3UTDA 1A98A 4MW9A 2H92A 3SS9X 3WLMA 1IN8A 2VT6A 3B78A 3FHOA 2D4AA 2UVQA 2WUFA 3KYBA 3QI7A 4M99A 1DAOA 4MDFA 1E7QA 2VDNB 1H0RA 1FLAA 3OZWA 4MLCA 3N75A 4IXNA 3IEXA 4L0MA 5FI5A 2AD5A 2J9ZB 1BCSB 3WGKA 1CEYA 1VIMA 2V4UA 2P91A 4HQRA 4EUFA 4HNGA 4PX2A 1LJ8A 4MW1A 5IARA 5BNIA 1N6PA 3DCNA 4JBYA 3E61A 4PX3A 4D46A 4IL5A 5A02A 5TY0A 5EQFA 3WO1A 1KI4A 3PDHA 2WLSA 5CK4A 1YU6A 1Z8NA 4Y2JA 5EHZA 4UNIA 4BZQA 3P8ZA 3SJAA 5HQ3B 1T0PA 5DGDA 5FTMA 2X3YA 4B31A 1SZDA 4TQAA 1FBTA 1GPMA 1WAMA 2ZJ0A 3V7NA 2XD4A 3VBCA 4TM7A 2VWQA 3WADA 2OWDA 3LK7A 4R1LA 4ESEA 4OBXA 1JTVA 1EZ4A 2FWBA 3U7IA 2FQQA 2YIVX 3EAFA 2P9YA 4GNRA 1JQ3A 1M8PA 3NJ4A 2XTJA 2JIBA 4N7JA 3U7QB 1P4SA 3V4FA 1Z6TA 4MLPA 2H4XA 4NCJA 4WUTA 4H3SA 1SZJG 3RS5A 3PQDA 2FUKA 1DRUA 1RWNA 4ALJA 2J5QA 2AEJA 1QRUA 3GLTA 3PXDA 4TZ6A 4IKPA 3KKPA 4QRIA 4CN8A 4HDQB 4YRSA 2P9JA 4K9NA 5JZOA 4C7OA 2FJUA 4JCCA 3H1TA 4FDTA 4P4NA 4TL7A 1FX0A 3MRTA 4DPKA 1O95C 1WHTA 1E5TA 3I12A 3KLNA 5KVQA 5TQVA 3UXEA 5C80A 1B7GO 2I6UA 4NE7A 2P9FA 3JQ8A 2IH5A 2ZE8A 2OP0A 2W00A 5AKEA 2XUZA 2C2BA 1UPBA 2I1VB 2AFIA 3CLKA 1COWD 2WIKA 1GFWA 3GQBB 4IIEA 2OAGA 1SCAA 2XWBF 2AN9A 3Q5DA 1N5KA 4NJEA 3V5NA 4CUZA 3DMNA 4AD8A 4D4JA 1DZIA 2K5UA 3DJYA 4NE9A 3W3AH 4Z9XA 4CF4A 3KPYA 3EF0A 4ROTA 1TVKB 2OTCA 1M2VA 2REOA 2BGLA 3CZPA 2I3AA 3MTJA 4LCEA 2WY2D 2MSCB 2RGUA 5BSGA 5I3ZA 1JHQA 2HT6A 4OBEA 1AMUA 4EK9A 1JIIA 4ZOCA 4DLPA 1U7TA 1WHSA 3BCRA 4H15A 1SKYB 2PBLA 1AXRA 2G7MC 2OD7A 4WZBB 1PQYA 2XLCA 3WLSA 4QNRA 1P9OA 4EQZA 3SNHA 4PANA 2BBWA 4BO9A 4KXNA 2E4YA 1U0LA 1WRBA 4DIFA 4QKQA 1W6UA 1JDUA 3E7PA 1B8OA 3PT9A 2WM3A 1G21E 1U2ZA 2Q1XA 1ZRSA 2RGNC 3OKAA 2GUWA 1EGQA 1LW7A 2IUTA 1SPXA 4KDEA 4M0EA 1PV1A 4RFLA 3ZDZB 4JFAA 1GCOA 1G1MA 1UK9A 2DQZA 2G07A 2B34A 2VH1A 2WF6A 1GR0A 1XVAA 3HJNA 5TMEA 3SZMA 1N32B 5H3HA 2CF5A 2GN0A 4D8UA 3PNKA 3H86A 1XXHE 4NX2A 2PRJA 4GSKA 4IMPA 2ZXUA 1Y1RA 5CEFA 4XIYA 5ALVA 3CA8A 2W11A 4RVOA 3UK7A 3VGJA 2PH1A 3GVIA 5C8DA 4AY3A 5IJ0B 2AD1A 1ACMA 5K9ZA 3TYXA 4QXOA 1B26A 1REQB 1O5IA 3AVYA 1S3FA 2BFEA 4MKXA 3N59A 1R0XA 3RSGA 1YZFA 4DLUA 1VE7A 4AJKA 5FEMA 2O5CA 1QYRA 1Z28A 3BWMA 3KJXA 5FEUA 2JLVA 1J2JA 1GZHB 1VA5A 2VSQA 4IDBA 3OKPA 4BL5A 3RS0A 1CUHA 2GAAA 2GUGA 3KZXA 4G37A 1SVNA 5D85A 5HF6A 5FTJA 4E7OA 4M53A 4D82A 1SMKA 3KVRA 4OCZA 4OKNA 2A6PA 4RKRA 4D81A 1CS0B 3I05A 1F2UA 4BP3A 3OIYA 4EL0A 3WL5A 1LPAB 3PS9A 3ZCTA 4B6OA 5ITZB 5J4KA 2VNSA 2C5EA 1VLHA 3BWXA 4K9SA 4KH0A 3UATA 2A0XA 2Z3ZA 5J5CA 4DLKA 2VK4A 3VNRA 4Q66C 4DSAA 4F3NA 5DNEA 3ACCA 1IEQA 2Q49A 1SOMA 1SU7A 1NXXA 5DLYA 5IJXA 3IJ5A 3A6GA 5LQCA 3UY4A 4IP0A 1QO7A 4PRLA 2XVXA 3QE0A 4HZIA 1N2BA 4AMYA 4ARCA 4KRXA 3SAJA 1ST3A 1E7YA 5EFZA 3JVVA 3DBLA 3KLPX 4F9TA 1NZFA 5CVJA 1CFZA 4R3UC 3GNSA 4MVXA 3GJ4A 4LE2A 2CD9A 2WE7A 3G9UA 2XOKA 2FEXA 1MTOA 3MUNA 4U7DA 3OE7D 1AA6A 2I3DA 2PAAA 2GK4A 3CH7A 4DAEA 3ZVLA 1B73A 3H11A 4IYRA 1RHJA 4CQNA 2LDBA 4IUDS 1OB5A 2AF4C 9LDTA 3HB0A 3LCMA 4K87A 1MC4A 2QQGA 3ELYA 4FCTA 5BR4A 1KOGA 2BL4A 1EA7A 4WASA 4MZXA 5IBRA 4DE5A 3WNDA 1TDJA 2ZB8A 1H8HA 1NC3A 3BCSA 2C20A 3ECSA 5CXSA 5ALRA 4E15A 4HOYA 4MP6A 1OVGA 3I61A 5FHQA 3QVUA 3OJOA 3R5XA 4H31A 4FX2A 3G5MA 2IYWA 2Q29A 4BO2A 4CXMA 1CY0A 3QUBA 1VL0A 2BFBA 1NZDA 1PG0A 1Q7TA 2IHUA 1QIEA 3OA2A 4QQRA 4DS3A 1RMTA 1J5PA 2WOOA 1MC5A 2G4LA 1T13A 4OUDA 4YV7A 3UWDA 3K96A 2VATA 4RBNA 4LJLA 2O3UA 2VHEA 1J33A 1EFLA 4JJAA 3IULA 1JJ7A 5AVXA 2ES4A 4LNUB 4H0FA 3K92A 4PHTA 4WN3A 4LUCA 3IL2A 1RVV1 3HFGA 4QASA 4QELA 3UFBA 4BQNA 4WK2B 4ATNA 1DBPA 2ATXA 1PR1A 3NR2A 1HA3A 2NU7B 1SXGA 2VAPA 1NNSA 3GAAA 5BO5A 2JLXA 1IU9A 1E6MA 5L3QA 1X1BA 3E9NA 2ZE7A 2WFMA 3K9CA 1MGPA 3R3SA 2BEVB 3ANSA 4L3OA 2I29A 3OX2A 4LWZA 3ILYA 5D3KA 4E0BA 3TDNA 1YNOA 2A9RA 2F59A 2IXBA 3HJHA 4FGKA 4OIFA 1ORVA 2W6ZA 2D1QA 3HV2A 2O6HA 3K8YA 1D1TA 2J0EA 1KORA 3FI0A 3NBFA 1N78A 1R10A 1KYTA 1MW9X 2QTLA 5FFNA 5A62A 2H17A 4TLBA 5JDCA 5JSFA 3NXSA 2QR3A 4LJ6A 4XQ9A 4KXLA 2PFSA 1WW3A 1VCMA 3HZZA 1C8VB 3GIDA 1II0A 2J4CA 4NFSA 5AM4A 4URUR 4DR3B 2QHXA 4F7DA 1OI4A 1XD8A 2WI8A 1JFLA 1CVLA 3JS5A 4MJXA 3ITEA 3T7KA 4RVCA 3RU3A 1JDBC 1YS2X 2P27A 1X39A 1CX9B 3T1QA 5KOYA 2A1TS 5JJCA 1JHUA 2P65A 1GL6A 2V6BA 1UK8A 1GVNB 1SOVA 4BMZA 4B6SA 2IW3A 3NJRA 1JHVA 2GCOB 4MVJH 5DYIA 3WIBA 3BSSA 5KX5A 1CJTC 1G20E 1TPZA 2HU8A 3QW2A 5JARA 1Z18A 1FYWA 1PZNA 2BYTA 3QLTA 4PLTA 3CNQS 4UHDA 2XBUA 4CF7A 5K0EA 4RA9B 1FDIA 1UOEA 2XUKA 1SG0A 5AK6A 4N3NA 1BMQA 4MWTA 3W90A 2FRXA 1ZGCA 5KWIA 1IOZA 1IBMB 2CB9A 1F3OA 4MIEA 2MSKA 4HN9A 1CJSA 2RH5A 5CGQB 1YJXA 2QQEA 2NADA 3WL8A 3ON5A 2YOHA 4I6GA 2NZVG 3LXMA 4TLMB 2IEBA 1JHMA 3IUNA 5T67A 3DYVA 1ZY2A 3L4EA 4M7RA 1MW8X 3BJIC 3A04A 4I5DA 1QQTA 3THOA 2PN1A 3ZGLA 4DYHA 3V97A 1G8GA 2XF2A 3RS7A 1VIYA 5DOZA 2WT9A 1IHPA 3NHYA 2YMLA 3A6EA 1U9IA 3PRKE 3OO1A 4S0ZA 4K9LA 3CH5A 3GPBA 5CT9A 4FNAA 2RK3A 3I9LA 2XJ9A 1VXRA 3ADOA 1KEZA 3HHPA 4M6WA 1XWFA 4OB7A 2YOFA 4Q7LA 3DDZX 3NIGB 5ALFA 3MC1A 5G0VA 2PXHA 3Q6NA 2IWHA 5ALHA 4MW5A 1L5GB 3TLGB 3V1MA 5TB5A 3AEKB 4NXMB 1V5IA 4IVNA 4TKZA 3EH2A 5CFQA 3GUZA 3WNBA 1AX9A 1T8PA 3MF4A 3USZA 4EPRA 1CUGA 5H4GA 3SVZA 1LS1A 2G5GX 2IA5A 2WNSA 5AHWA 1PYOA 2XCQA 4HBZA 2IU6A 3JATB 4RSRA 1LI7A 1PD0A 2ZWAA 1RPNA 3EQ8A 5K8CA 3HJBA 2X4GA 1SQ6A 4BAZA 4XASA 5CNKA 1NVFA 3SBEA 4QWWA 5SY4A 4JBLA 4YRDA 1R5OA 1GPUA 3IP1A 1ATIA 1E4VA 1Y3HA 2CBGA 2CMFA 2RGAA 2G6TA 2DKOA 1I4TD 5FA8A 1G3IA 2HRZA 4NG5A 4PR0A 3WZMA 3ZG6A 3T3PB 4HTFB 5EGNA 2I22A 1TUBB 2JLCA 1CTQA 1OFVA 3HUDA 3K0KA 1SUCA 3N2KA 3TB4A 2R4TA 2PO7A 2W58A 3TI7A 4LXXA 3I3SR 4UJ3A 4I9GA 2LXNA 5KYYA 3MEQA 1CUZA 2QLMA 1U5BA 3QX9A 5CLIA 2B92A 3U13A 3LSYA 2E0IA 1L5HB 5A3VA 6CHYA 4MWZA 5HILA 3HKDA 4J4HA 3ETJA 3TL3A 2Z8ZA 2WTMA 3HLKA 5ERXA 1YDFA 5UKDA 4IXMA 1QVWA 4Q18A 4J07A 4GQAA 1E1RA 3MTBA 1WW8A 2R62A 3O0TA 4CKZA 4OUKX 1DJPA 1KZ7B 1Q7EA 4GP7A 1F38A 4M0LA 4S1WA 2JNWA 2ETXA 3JZMA 1BU5A 4PAGA 4TSFD 3NYIA 4MVJM 2IPMA 2HJGA 5DFAA 4BZXA 4YPVA 3C3KA 3EAQA 5ECYA 5HNKA 1NFFA 4GD3Q 4WOPA 4ZYWA 4CIWA 1M8GA 3I2KA 3OKFA 3H5TA 3LHKA 2Q5FA 1COZA 1E8NA 1ORWA 2QJTA 1O03A 1VBKA 2ZETA 3LO5A 4FMDF 2Z9BA 2Q5EA 4Y6OA 3UFXB 1UIMA 3VUEA 2ZJ2A 1BIFA 3RVQA 3NJ8A 5I7FA 3PGLA 1DKQA 1RKVA 3OPYB 5PNTA 4DIDA 5KNCA 5J43A 2BI4A 3GDGA 1U7DA 4IY1A 1Z5ZA 3KAQA 5TMBA 3X1JA 5K8TA 1HNWB 2KS6A 4TN5A 3C0KA 3CUSA 4LV5B 4UBJA 2PGLA 4KUHA 3QXJA 4GI7A 1PBNA 2B7CA 4R2WA 2ZSKA 1KPIA 3QG1A 3IQWA 3U3XA 4AWBA 1BCRB 4ZICA 4OSOA 3KOMA 5ICGA 1BEZA 4IZHA 4EUHA 3AVVA 5EHGA 4RDHA 3UAOA 2PZMA 3EFEA 3O8LA 2FVYA 2PNFA 1SULA 5EPEA 3U7RA 2UYOA 1SRQA 3OBBA 2YN2A 1FOEB 2H29A 3IS3A 4KC0A 3COPA 2VUUA 3MWFA 4IDGA 1XRRA 4KQMA 5CFNA 3FNIA 2BISA 1Z4OA 4N7MA 2EQ5A 2ZJOA 2VHTA 4DUZB 5H3LA 3AJEA 2C2YA 4J0JA 4B6JA 4ZOEA 4FFPA 4XTRA 3CN9A 5I8WA 1OYOA 1WPXA 3TLEA 2OK8A 4NV3A 2HU7A 3FM9A 1W581 4TS1A 2YV3A 4OL9A 1HGXA 3SQLA 3QEAZ 1AUXA 3EOAI 3WJ1A 3KOUA 5JATA 5TIIA 2I67A 3EDQA 2Y2VA 3T9EA 2GWHA 3L8HA 1P91A 4BJ5A 2EFJA 1GILA 2PGJA 2NPIA 2C1XA 4GF5A 1KRXA 4A2QA 1ZIDA 2IF2A 2X9GA 1B3RA 4AJEA 5ABPA 5LVAA 4HADA 3EVFA 4MRAA 2O2XA 2GXSA 2H1FA 5IAGA 2RK6A 4IIJA 4DGQA 2V6FA 3MJRA 2ZRMA 5IBQA 1KE1A 3K5WA 3UWOA 3M1IA 4NRDA 3N3AC 2X86A 13PKA 3K16A 4FDVA 1KYIA 1IVSA 1GEGA 2EW8A 4ZOLA 4A36A 3QG5A 2G7ZA 3VKWA 2AJBA 1Q1EA 3N8HA 2PWPA 4A1FA 4A91A 4C6TB 3QVMA 5FOQA 4N0QA 5SZHB 2QAGB 3VYRB 1CRZA 4XKJA 1DKOA 4KAFA 1ZK4A 5L45A 3ZIAD 1UIRA 2ZIXA 4IILA 1N2HA 4WUVA 4F9EA 3E22B 1JDPA 1DINA 2W0MA 5ECGC 5J4LA 4N39A 1RI4A 2PKRA 2DX7A 4P3KA 5HIMA 5B7GA 1F2VA 2QS9A 5TQ0B 2DYKA 1JKJB 2IYLD 3GVHA 3NC4A 1ZDMA 1BD4A 3PFHA 4L8FA 4YWJA 4DA6A 5AW1A 3KQKA 1G42A 1JXMA 3CKYA 4H1HA 2QVLA 5CMLA 1XVIA 1TU4A 4YC7A 1KJIA 4JUAA 3CX6A 3NRJA 1WMDA 2A0YA 4GVXA 1C7QA 3FUWA 3QUTA 3IA7A 1Z2CA 3ZZUA 1HT3A 1ZH6A 1ZMOA 4U2DA 5TARA 2I4NA 2QNRA 3OPNA 2FAXA 2IEDA 3ANXA 1G66A 3C6QA 4ILEA 5D51S 2HHHB 5CYFA 2G5PA 1WULS 1Y1KE 3EB9A 4EL5A 5CFZA 2IGTA 3MYYA 5K51A 3H9BA 2XXBA 2O8DA 4P7JA 2OD2A 1XMPA 1JR2A 1XJ0A 2EQAA 4O2AF 2B4RO 3FWYA 4GLFA 5DI9A 5EZ5A 5TPWB 3RU9A 4AT1A 4C7VA 1OXBB 2JKVA 4I5IA 1VHWA 1RRVA 2I54A 3IDZA 3ZIUA 3AL3A 4N03A 2GJKA 3BCUA 4U3JA 5BW4A 2C7OA 1ZS9A 1ADBA 4XVUA 1GLVA 4O29A 1IZ8A 2AE2A 4Z3KA 3MWJA 1NT4A 1Y4SA 3MVEA 5BMVF 3WNCA 4PZUA 3CB2A 5FDFA 1XNRB 3PVSA 4WFIA 2XT9A 1JSZA 1NLYA 2HRRA 5LD2C 1Z0AA 4MHTA 2YICA 2ATVA 4WKPA 4A2PA 4MDHA 3QY9A 1LJLA 1XL0A 2W43A 4PGHA 4KP7A 2AV6A 3GWGA 1G55A 3LRTA 4QA9A 2E9SA 1W1WA 3A4MA 1EK5A 2R7KA 1G3RA 3UGTA 3NHPA 2R84A 3FPHA 2PX8A 5HGJA 5A6SB 1ZUD1 3U60B 3FBTA 4TXJA 4DEYA 4AL4A 1X7XA 4C4AA 5T6BA 5G02A 1TZ2A 2QMEA 1HKHA 1VHJA 1NUQA 2P2NA 3OZVA 3D8UA 3CRW1 4QBGB 3IEPA 1M2OB 3F6RA 3LUPA 4WJKB 1EWYA 3NWPA 2FZ4A 2R47A 3L4BA 4HN4B 3CWQA 1UDBA 1XJWA 1XKXA 2VPQA 3KUCA 3NNNA 2JI8A 1SKMA 5BVHB 3VSCA 4HO1X 4BBPA 1ST2A 5FCDA 4NXNB 1NLMA 3R3WA 4QM6A 2ODWA 1I13A 4R1OA 5LQNA 1KPHA 5T4HA 2H9AA 3AETB 2XUAA 1XOIA 1JA9A 3PJFA 1OWOA 5I9SA 1PRYA 1J9GA 2P77A 1KEEA 4A82A 1R37A 4ECEA 2ZAMA 5B7QA 1ZL0A 1NVXQ 2QW0X 4HQ0A 1C3LA 4JY7A 1RR6A 3LL4A 2FZGA 4U02A 3S2EA 5FUMA 4P7KA 3F0TA 3QVTA 3SJUA 1RPZA 2HK6A 4B44A 1A2KC 1P1HA 1XZMA 1U28A 1S8AA 1YAHA 2JFHA 4C4OA 1VJTA 4IDEA 4Q19A 4G07A 5CITA 4DA9A 3JQAD 4RIIA 4A0HA 2ID7A 2H1IA 2X8WA 3IQHX 4H1UA 4IEEA 4ZHQF 2JGRA 2VDQB 3R44A 2O5EA 2DLDA 1A96A 1ZJJA 2REXB 5F12A 1E92A 2VBIA 2FR8A 4N6NA 4W9MC 4MWGA 4K88A 3Q15C 1GSOA 4YJFB 2D2XA 5P8WA 2GAJA 1NIJA 3OOHA 4YJ3B 5FUXA 4B48A 4AUMA 3BVPA 4M1MA 5HGXA 1CY6A 4TL6A 2EZTA 3IR7A 5AJYA 5FOVA 2CEAA 4B80A 5BSTA 2ZB7A 5DYYA 3CEHA 4BWFB 2G8NA 4JVSB 1JEJA 3KZOA 4O4JF 2ZAIA 1OFTA 1V3QE 3HCDA 4TV8F 1R6TA 2DUUA 3Q5EA 1Q0QA 3SQDA 4C3ZA 3NMUF 2HF9A 1IOLA 4RQUA 4ES6A 1C81A 2VHCA 2Y9MB 2P4QA 2ZJ1A 1H2AS 4EYKA 1XRPA 3OJXA 5JTTA 3HGMA 3FCSB 3L3BA 4Q7JB 4NV1A 3OBIA 1CZRA 3UB3A 1FDRA 3R20A 1AKMA 1B6RA 1TM7E 2P9TA 4M9CA 1GPYA 4OHMA 4ERXA 4HQLA 2PL3A 3VA7A 1PR6A 3SCZA 4YIHA 1EUQA 2ZWOA 2WTAA 4QULA 2I4OA 4I55B 2A7QA 1Z0FA 5IJWA 4OLAA 3PFWO 4FFWA 1DBVO 4N7RA 4MVJE 1OI7A 5KHOC 5BW6B 2R6CA 4C5BA 3GEEA 4D4IA 2NXEA 1CFJA 1HDRA 4YLEA 1DWPA 2WYIA 2OG2A 3S4YA 4Z1OA 5EZYA 3OX1A 5HJ2A 3T3DA 1PCXA 3WGMA 1UMBB 5FNVA 3L9WA 1F9EA 2N75A 4GMFA 4QBKA 1B8UA 1XX6A 3KQPA 4MW6A 1XCOA 1CZNA 3O3MB 3A58B 4LOIA 4NABA 4F86A 2BGUA 1EP9A 1HLPA 2YVUA 1Z5OA 2I6GA 4L8WB 5JVDA 4ZK6A 1HQDA 5K8LA 2HMTA 2X14A 1DWUA 3EG9A 4O8ZA 2JH9A 5I4BA 3SSNA 2XKBA 1FFSA 3F6BX 4RJLA 1A72A 2JGKA 1OVMA 3FPLA 4UBOA 5AESA 4A6EA 3OOJA 3S8EA 1T10A 1XZKA 1YZHA 1OBHA 2DTDA 3MWGA 4LYEA 1WBDA 4RXMA 2D62A 2D0PB 1A8SA 2YYSA 4FHFA 2Y6UA 2WYHA 2CNWA 4DVGA 1KKMA 4CM8A 2VP2A 3EYAA 4BC1A 2XNCA 2RFLA 1IQRA 1PLKA 1O5TA 5E8RA 4CJXA 3RYCA 1JDSA 4AZSA 1WPQA 2W6ID 2APJA 3H8VA 4ZV7A 1R6DA 1FRFS 3CNNA 3OZDA 3DEFA 4W5WA 1G17A 4BGIA 1Q83A 3GJRA 5HJ5A 2PKYX 3E9DA 3ZX5A 3L0PA 3SK0A 4B8WA 5CB4F 4FS8A 2IU4A 2GBLA 3FSJX 4PAOA 3GA5A 2CUTA 1UJMA 4JROA 1SBNE 2GK3A 2GLXA 4PINA 5JCOA 1O54A 3VDMA 4DJJA 5IC4A 2XZLA 1XJ5A 1UP7A 2J7PA 2PMCA 3TIFA 5KYUB 2C9OA 4PG7A 1Y4UA 3CM0A 2COKA 2H1SA 3UJ7A 1Q16A 5F23A 5TEVA 1M34E 2I2BA 3E4CA 3EXG2 1F2DA 3Q9NA 3BGIA 3D4LA 1I4EB 1RVDA 2GH1A 3MBKA 4HB0A 3RI3A 4UREA 2AUTA 3VC3A 4F97A 1M72A 2BEKA 2QXYA 3QU9A 4D44A 1VRCA 2AR7A 5T7BA 1TF5A 1UT5A 2JFOA 3W2EA 2PO5A 1ZHHA 5FFMA 3TRHA 1CKEA 5JPCA 4P58A 1T34A 5INTA 2P6MA 3P20A 4G0PA 2VQ6A 4YVFA 2CXSA 5YASA 1D2CA 1NW8A 4AJJA 1IUOA 2LKCA 1NN1A 5BUSA 3P9ZA 1GL9B 1LDGA 3C3JA 3CSDA 3I09A 2A5JA 4XLLA 4CGZA 1MO3A 4Q4DA 3C3AA 1E0SA 3EPJA 3IALA 2AZ4A 1R0BA 2GN1A 2GZ1A 2O6LA 1L5ZA 4YP5A 4O4IB 5REQA 3PLAE 3AIKA 3AP2A 5JDCC 3UUFA 4DADA 3DXXA 5HIIA 1XKQA 4X71A 4LF6B 3TXYA 1USIA 2GGSA 1M2HA 3ROTA 5IX8A 2WSBA 5I9IA 4WY5A 3K1ZA 3OIFA 4TT3A 4PGMA 4AY2A 2HIGA 5EWLB 3O8RA 4IHKA 1FMFA 4NJOA 3FRIA 5C4MA 3MWEB 3GJ8A 3P9IA 1X0XA 1YZLA 2DBYA 2LWIA 3AR5A 4C9BA 4FYVA 1VPDA 3Q3IA 4LG1A 3RK0A 1V1JA 1KJ9A 1Y1LA 3B1WA 4WERA 3RYTC 4PCLA 1RAFA 4B4UA 2UU9B 3CBGA 5MHTA 2EJBA 5LMUB 1PGOA 1QYXA 3QQPA 4KODA 4LXQA 3BDAA 1IN7A 4XZ3A 3L7DA 2HGZA 2OCKA 4U2EA 4XWGA 4ARBA 4HB4A 1CCWA 4GMDA 4Y9DA 4Z51A 4LFAB 1XEFA 1D0VA 5K0BA 5JT1A 1W36B 2ZDQA 4QDUA 2J09A 1G3MA 1I6LA 1U6JA 2NV2B 3K4QA 4X20A 3WOVA 1W36D 3BMCA 3G2MA 2HBZA 2C3PA 2C92A 3TXXA 4DNXA 2FW0A 5LQMA 1IWBB 2GZRA 2OKGA 1P1RA 2P40A 5HKOA 2AT1A 2X6TA 4XPIA 4CKCB 1L2TA 1FNDA 3DONA 3LY5A 2HA6A 2W4MA 1T15A 4B3GA 1DUVG 1V41E 2QD5A 3WO0A 1KSHA 1JI0A 1Z7EA 2C5HA 4QQKA 2UUOA 4IZ6A 1N6IA 4LDNA 2VL7A 2FN9A 1KR5A 1XFAA 3DOJA 3HJRA 2QXTA 3ABOB 3MNFA 3AY3A 1PN3A 1WSAA 4IEFB 4PZ0A 4YWHA 1U9IC 2ARKA 4MVWA 1L4BA 2IP4A 3MB8A 4JC4A 3WX0A 4AMGA 5IXSA 3OCYA 1RACA 5AVZA 4YMUA 4HFNA 4GDFA 1XZQA 4WZAE 2EOAA 3BF8A 3L9XA 4EW3A 5BYAA 5ALLA 1W49A 3GHHA 5EMMA 2XHEA 3BTOA 1V9CA 3QPCA 4INPA 4OLHA 4I3FA 3K70C 2BKVA 4YCMA 4GXQA 1KZ9A 3PNOA 5BWCA 3A9CA 4KFCA 1RRKA 1JG6A 1MDBA 2W70A 1RWOA 4EYGA 4R6XA 2GEKA 4Y1RB 4YP9A 2D1TA 1ZBQA 1IPEA 2QTBA 4BGDA 5JD6A 3HYNA 4HZUB 2NSLA 7AT1A 4G0UA 1RKXA 1EM8A 2WIJA 1P4JA 3IUBA 1QLHA 3SPXA 5CYGA 1FVFA 1FYVA 4HH3C 4WNIA 5IZCA 2PR7A 3E0XA 5HUJA 4MIOA 1XLTA 1P7VA 4W5TA 1Y5NA 3MJVA 4O4HB 4MRPA 4LC0A 2X8AA 2O3JA 1YH3A 4ENTA 4F6RA 3N8GA 1VMAA 1DKPA 1J2RA 2IZ0A 2AG0A 3PHLA 5K3FA 3KB6A 4ZT4A 1V5WA 2GD1O 4D8TA 5CX1A 1HDZA 3KJNA 4WNAA 3QLVA 4K9DA 1K8YB 3STTA 3WB1A 4D1YA 3ZVKA 1U2DC 1QRSA 2OE2A 4LJ8A 1T24A 2D13A 5AKIA 1KR2A 1NVWQ 3KR2A 3S2GA 4A6PA 3ZCQA 2QRJA 2EKBA 3CRNA 1RJDA 3H5VA 4REMA 2CMHA 1RBZA 2WD7B 4QYTA 5TJ9A 4CCYA 5B37A 1KQFA 3UMYA 4YJ2B 4AJ1A 3NBXX 1DC8A 1ENZA 2AG8A 1N7HA 3G59A 3WB0A 4G97A 3LT4A 5BSRA 2WA1A 1VG9B 2B1GA 2X1VA 4C0HA 2R7MA 4DLWA 2IU0A 1L4UA 1E32A 4I1OA 1GVHA 4R7GA 1FBNA 1WZCA 1YRAA 4RHTA 4TWZA 1F1JA 1KGDA 2GX6A 3FPBA 4I81A 3NXKA 1UUFA 3I9NA 4EVSA 4C2TA 1RFGE 2QZSA 5EPUA 3AF3A 2XA2A 4DQLA 1M1NB 2HTEA 1EUDB 2BGMA 2PT6A 2X7JA 1LLDA 4S12A 3AUAA 4F4FA 2Q5OA 3NGMA 5C8VA 1US8B 2Z8XA 4Y9UA 1UAGA 2P5YA 4P2GA 4D9FA 2ABWA 2ERYA 4TL9A 1ML3A 5IUNC 4AC9A 1UQUA 5ALYA 4YX9A 4R05A 2UZ1A 2O8BA 1GAQA 5ILGA 1ZR2A 5E2IA 2UYYA 2EATA 3DOUA 4LYYA 4AXXA 3DW1X 3DYBA 2ZKLA 3MD0A 3SU8A 2CNNA 2EZ8A 3ORHA 3QVOA 4RHUA 4BMVA 4N48A 1FTYA 4KUGA 1L4FA 3K1YA 3FAKA 3W3AA 4MPTA 1RKUA 1W88B 1N6OA 2BDTA 5IVPA 4KJZA 2YX1A 2AQIA 2I2XB 1UKZA 2UDPA 3HYTA 4DM3A 3LNCA 2A84A 4BV2A 3VU0A 3A6PC 4LXUA 2G1UA 5A04A 4MJLA 4NHOA 3RH0A 5IYZB 4Z1MD 1AHIA 1EB8A 4OQNA 2O48X 3RJ9A 1U3VA 3ZZTA 3MT0A 1UC8A 3WWEA 1ZC4A 3AF0A 1N34B 3PC8A 4DCMA 4TV9F 3TDKA 1HRDA 1R0SA 2X2FA 3E8SA 3OOYA 3PUHA 3LUCA 4GI2A 3AEUB 3T9FA 4D4GA 4TYQA 2VJPA 1NE2A 1CYEA 1XLVA 5A4JA 1BTOA 3UWSA 1N5MA 1JIJA 2I1WA 3QEKA 3ZD9A 4HR7A 4G67A 3AOEC 4M1WA 3BL6A 4DLVA 4X97A 4HDNA 4U2FA 3FMFA 1RWBA 5DWDA 1YC5A 2DH5A 1SUFA 4BGUA 5LU8A 1JPVA 2IIBA 1JBEA 2OHFA 2YWXA 3SEAA 2B82A 4WXHA 3LECA 3ZHTA 3Q40A 1AUQA 3AU8A 4HX9A 4UKDA 3EVEA 2WF8A 5LBIA 3GLGE 2HDNB 2D0IA 4RKQA 4ZGGA 4CKEA 3QY0A 4KR9A 1L4EA 2HA3A 3PXCX 2K2QB 1DAHA 1WDWB 2X5JO 3JWIA 3Q7RA 4JYPA 4QT4A 3HV0A 1PQUA 1QP4A 1T2EA 4MV5A 2D6FA 4B3JA 3DL7A 3RF6A 4YMSA 4CM9A 1YQQA 2XIQA 1ORTA 3AI2A 3IP7A 5DHTA 1G18A 3PEYA 2GYWA 1VRVA 4PAQA 3WMWA 1MPTA 1VL8A 1Y8CA 3FGZA 1P6UA 3K5PA 3JWJA 5HJEA 1Q7GA 4UVDA 2G6BA 2BDUA 1OLXA 4C1NA 2BC9A 1QWOA 3UWKA 2GD6A 3HBLA 1ZCZA 5KEIA 1Q14A 4J9UE 1HK7A 4JC0A 5IRCD 4G63A 4J3NA 1CDDA 4FQ8A 3GT4A 2F1RA 4W63A 3I9MA 1E2JA 1POWA 1N75A 2RHHA 2X19A 3QIAA 1ULUA 4JMLA 1N7JA 3BJRA 2JB9A 3ME5A 1EJ2A 4MO9A 3K15A 2C59A 1WEKA 2ODBA 2IPLA 3EFBA 4XR4A 1PEAA 3TR6A 3TTYA 5KNLA 4RK0A 1Q84A 1GFSA 3IKJA 1HQCA 3LVFO 4UHJA 5TVGA 5CVDA 4AROA 5KSYA 3F78A 1EA5A 2YJGA 3GFTA 1YL7A 2XLBA 3CUKA 5AI6A 3O8CA 1C2TA 3K71B 4IIDA 1M6HA 2NIPA 2FDXA 2R1ZA 1NHWA 1A0OA 1YOBA 3I5MA 4L15A 2OCPA 1V8FA 1ZN9A 3OCCA 3ZJVA 5HM6A 3IXLA 3JVDA 5HX7A 1M6EX 1PD1A 2TMKA 2JJYA 1U0EA 4UXHA 5ENDA 5F3DA 3GO4A 1E3JA 1T6NA 2QG6A 5DGXA 3RAGA 1NYLA 4FYHA 5JCZA 3SKXA 4URZR 3WE7A 5JH7F 2WMYA 3VYWA 3ZYCA 2YCLA 4JAVC 5JALA 4G1BA 2IU3A 3FCCA 1N1MA 3NVAA 2OCAA 2A3NA 1E1CB 4G5XA 721PA 4CLRB 1Z7YA 3ZHQA 1ECPA 5AXCA 4E1VA 1XROA 3CU5A 1FFBA 2FP3A 2HQSA 2CJWB 3HJGA 4ZVUA 2HMVA 1SQSA 1NULA 2B3DA 2ZBDA 4R6WA 3R6LA 3RJMA 3W9UA 3HYCA 4GVPA 2VDPB 2WJ4A 5DNVA 5EHNA 3KE8A 1EI9A 4NS4A 3SYLA 3Q1LA 1KU6A 3O75A 3C3BA 4ZVVA 3UC5A 2Q1YA 4HYTA 3BMNB 3CN7A 4EENA 6REQB 2QD1A 1HDXA 3O9MA 4YFYA 3E84A 4RTMA 4E1BA 1O2DA 4N3GA 3RC1A 4JIGA 4K6CA 1J24A 4KFUA 3L40A 3WICA 3EGDB 2H2HA 3A2NA 4BUZA 1VGQA 2GAIA 1BDJA 1WL8A 4WLOA 3THXA 3HC7A 3QX8A 3O4GA 4ND7A 3DHVA 2NXWA 5K05A 3X1MA 1U3GA 2OYRA 1F2TB 1UKVY 4YPOA 3TBFA 2PUHA 1J42A 1NXVA 1OMOA 4GSLA 2XADA 4YUAA 4E4YA 1FNBA 2XZOA 2CVHA 2ZJ6A 1SCUB 3I9KA 4WT7A 4I4TA 5E9AA 3WQBA 3W3ZB 1K27A 1SM4A 4ENWA 4L73A 2YW2A 3E9ZA 4C88A 2GPYA 1T36A 1JQEA 3OUUA 5D7BA 4AJ9A 1ESEA 1O9GA 3A05A 2GCNA 2POCA 4O1MA 1HE4A 2I1QA 4MVCA 5BV7A 1HI9A 1P4GA 1MDFA 1GNVA 1T5DX 2DG2A 3HUEA 2AQ8A 4BVJA 2YWJA 1QHSA 3BK2A 1MFPA 1NBAA 3KCQA 4RF3A 3ZD7A 4UHFA 5I7HA 3UOGA 5E6RA 3UGKA 1U28C 1Z12A 3S70A 5B1DA 1FNSA 1IIRA 4C78A 4PC2A 1OYYA 4N1AA 3ZE1B 5H5JA 3WMGA 4ZJUA 1C0EA 2OO5C 4QLBA 1XMQB 2XB2A 1IM2A 2C78A 3O7MA 4LVCA 4MVJA 4BDTA 3UW1A 4L1KA 3R40A 5KINB 3S8MA 1QAMA 1FRQA 4BVHA 3ZK9A 3GLFB 4DR2B 3CBQA 4IIXA 4KJXA 4RWZA 1PUIA 1CUWA 3RASA 2L0XA 2V45A 4AAYA 3NM4A 3EZXA 5DX8A 2EIXA 1TGVA 4FSHA 4BNDB 1XPRA 1UC5B 1PEDA 3HUFA 3LUKA 3GUHA 3M3HA 4A16A 2OHJA 3O2JA 5LR6A 1FX1A 2F48A 5EVCA 3RBXA 2XB8A 1DKLA 5JAMA 5JQGA 4CT4B 3IMFA 2XNDD 3KRTA 2NVWA 4QLAA 4Z6KA 4PIPA 4OXKA 1CD5A 1J90A 1P5HA 3FWHA 4HH1A 4Q4LA 3UJAA 2BSQA 2WKQA 4B6PA 4BIIA 1FUKA 2I9KA 3ONFA 2JGFA 2OFWA 4GQBA 3VR4D 5C7OO 4MEBA 2NZUG 3KEOA 3QX7A 1XWWA 1P5RA 4YXWA 4YDRA 4DILA 4E09A 4YMGA 4BQQA 4XEUA 4FYJA 4RTOA 3F9CA 3ENQA 4UUPA 1Q6YA 1YUNA 5AHXA 4J0HA 4CIXA 3D0OA 5J63A 4U7FA 2FPUA 4HY3A 2QTFA 4TXLA 1XQ6A 2J7KA 3HJCA 3SFTA 3ZWOA 2PQ0A 3BRCA 3KTAA 4HB3A 3DA8A 2FMKA 4WK6A 5DCUA 2Q3CA 3ODGA 4JB2A 4JQCA 4UDOA 4XUEA 1PR0A 5H1YA 4OHVA 3D9QX 4M8KA 5SV2A 3QJ5A 4KPYA 5DI3A 4MUJA 1A7AA 4DV0B 4JT4A 1TVCA 4I1RA 1YVDA 1QJ4A 5ERYA 4RS3A 2PBFA 3BXZA 2XKKA 4UOZA 3R7FA 3DJFA 5EJIA 4Z5XA 4F72A 2ECKA 3CXRA 1SUSA 1U1EA 1E69A 1L5YA 2XSZA 3MPUA 2Q1TA 2Q0HA 2QP4A 4MS4A 2XCLA 4OQ4A 1CNMA 3QPWA 4RK5A 1BS9A 1WNTA 1W0KA 2WUVA 4H1VA 4I14A 1N9GB 4JR1A 2XJ4A 2JFPA 1ZMXA 3JRXA 4ZWNA 3RCBA 4KW7A 4NIMA 1QZXA 3V1KA 2A94A 3L7MA 4Q3EA 1RMYA 4MKIA 3K0FA 2XUGA 2E2WA 4H4EA 1C30B 1YV9A 3P0HA 3PXUA 4G01B 4IINA 2BFAA 1ML4A 2EX4A 2JH3A 4CRWB 1DC3A 3T6KA 1NOKA 3PCRB 5ILQA 4GX1A 2NO4A 3QU4A 2A5DA 2YOGA 4QEDA 1EZZA 2VVTA 2XUHA 1VLMA 1BDBA 5EE9A 4UVIA 3KTOA 2GNAA 3O8NA 1GZVA 2DWQA 2F1IA 2FSSA 3SX4A 4DA0A 3L2OB 2RGYA 3CZ9A 1WV0A 4ISCA 2EFEB 3UNXA 5I6DA 4KQIA 3BSFA 3B5JA 4DV6B 4K9PA 1E3QA 4IVPA 5JCOC 2J85A 2FX2A 1IK4A 2OV8A 4D74A 1KC1A 3CLSC 4FMCF 3UANA 3K8OE 3OZFA 1TT5A 4PQYA 4EATA 2HHJA 1G8JA 5H82A 1DJNA 3CEAA 2I6FA 3T9BA 2NO7A 3OQIA 3UMVA 1H0SA 3CNLA 3EW9A 3ORSA 4QFBA 4V03A 2V9CA 2CCJA 3H0CA 4MUXA 4P80A 1I7NA 4RF2A 3T5MA 3VYUB 4LI0A 1U2SA 4NENB 5JZMA 3CVUA 2O8EB 2DY1A 3PLNA 2ADOA 2H6EA 4M36A 4D0LB 2PV0A 3V8BA 4YRQA 3OEHD 2HCBA 1G6KA 3DMPA 3OY7A 4UDXX 1X8KA 5DHQA 1KTVA 4M22A 1SQFA 3JYPA 5JIBA 1IULA 1NYTA 1Y34E 3FRHA 2PA0A 3VQTA 1FLNA 4A0SA 1ZHOA 3DLBA 2CW5A 5AW9A 4Y2XA 1C3EA 5JYCA 3HB5X 3TD2A 2GOYA 2IRWA 2HLHA 2OV1A 2YJTD 3FZGA 3T5GA 1PL7A 2BLNA 4DA8A 4WLFA 1X7WA 3U4IA 3OECA 3L7IA 2VPTA 3LRPA 3TSCA 5KKNB 2EJUA 2H5LA 1H2EA 3M89A 4PQRA 1KMHB 2EGGA 2X5KO 2YXBA 3B38A 2DFVA 1H05A 3PGMA 3QVGA 3GH1A 2QE6A 3U26A 2R8ZA 2D0DA 4CHTA 3SEZA 3KJQA 4P84A 1XXLA 1OX6A 2ZI3A 1OPXA 3K7EA 521PA 1P61B 4E33A 4DCNA 2RHRA 1NM5A 2H2GA 4QE3A 4QQ8A 1WD5A 3S81A 1W76A 1C7JA 1XAHA 1WY7A 2GZDA 1XMIA 3K0CA 1ODSA 4R9UC 1WXQA 2GPNA 1IJFA 2PGDA 2VT2A 1Y7HA 4RS4A 5FORA 2VDVE 1G8FA 1MG0A 1ZUNA 3A1SA 4MR7A 4O02B 5CUQA 2H52A 5EWJB 3TM5A 2QLLA 1V43A 3GFQA 4YH1A 2VYFA 4UHKA 3I1IA 1HG1A 1VLLA 3CR3C 1PNRA 3S29A 3KQSA 2PKQP 1IHOA 4Y2YA 4DCOA 2CMGA 1U3TA 3ZBPA 5MDHA 1JU3A 1N0WA 1QTNA 3IMCA 1OF1A 2VUTA