1XTUA

Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump) and cytidine 5'-triphosphate (ctp)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Probable uracil phosphoribosyltransferase
total genus 70
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtuA00
2P1ZA 3NAGA 1I13A 1WD5A 2HCRA 4M0KA 1XZ8A 1PZMA 4WMLA 3H83A 1TC1A 3OZFA 3GGJA 1U9YA 1P17A 3HVUA 3ACBA 3N2LA 1D6NA 1FSGA 1J7JA 1P18A 1QK4A 1A96A 3MJDA 4LYYA 4RQAA 1TC2A 1CJBA 2PS1A 1QK5A 5JV5A 4M0UA 2VFAA 2PRYA 1G9TA 1GRVA 1XTVA 2WNSA 3ACDA 3DMPA 1DQNA 1G2PA 5ESWA 1ECFA 2E55A 4LZOA 1ECJA 4RV4A 5E38A 1A95A 4X44A 1GPH1 2H06A 3DEZA 1DKRA 4WN3A 1JLSA 1P19A 1W30A 4RAOA 1Z7GA 1A98A 1ECBA 5BRNA 5JSQA 1BD4A 1DKUA 2JI4A 1XZNA 1VCHA 1YFZA 3DAHA 4RANA 1XTUA 3LPNA 4JLSA 4RABA 1ZN7A 3OZGA 5BQOA 1QCCA 4PFQA 2YZKA 1UFRA 5BSKA 1NONA 3GGCA 2JKZA 1ZN9A 1L1RA 1OPRA 4S2UA 1DQPA 2GEBA 2IGBA 3G6WA 2H08A 3M3HA 4LYGA 4LZAA 1UPFA 4RHUA 4P83A 4QYIA 2AEEA 1O57A 4P81A 1QK3A 1DBRA 1I0LA 3GEPA 4RADA 2PRZA 1ECCA 1G9SA 5K51A 1OREA 4P84A 1BZYA 5KAPA 1I14A 3EFHA 3QW4B 2DY0A 4M0PA 1HGXA 4P82A 4RHYA 5KAMA 2JKYA 1I0IA 1R3UA 4RAQA 4Z1OA 4KN6A 3OHPA 5HKLA 1Y0BA 1STOA 3ACCA 1A97A 2H07A 5HIAA 4TWBA 3O7MA 4RACA 1QB7A 1QCDA 1O5OA 4RQBA 4PAWA 1A4XA 3MBIA 3S5JA 1NULA 5IPFA 4P3KA 5BQPA 4JITA 4QYIB 1VSTA 1BD3A 1L1QA 1A3CA 1UPUA 2JBHA 4ZFNA 5ESXA 1U9ZA 1ZN8A 4RHXA 5IAOA 1OROA 1V9SA 3KB8A 4OHCA 1JLRA 4FYMA 2XBUA 4X45A 1I5EA 4IJQA 1QB8A 4MB6A 1XTTA 4LZNA 1G2QA 1AO0A 1HMPA 1VDMA 1LH0A 2C4KA 2EHJA 4P80A 5EUCA 3LRTA 1P4AA 2FXVA 1IBSA 1ECGA 4F8EA 4QRIA 4P86A 4RHTA 1MZVA
chains in the Genus database with same CATH superfamily
1HDOA 3AR7A 4QXMA 3QLJA 3AF4A 4YECA 1RAHA 1NVGA 4XIJA 1XVAA 3VJMA 5KOJB 3FX2A 4Q05A 3EZXA 4IQ0A 1DIRA 2CYBA 3WKBA 4DA6A 2K7FA 2MOKA 3JXEA 2ESRA 1BXRB 1K4YA 1NBOA 2GYVA 3EMVA 4GBMA 4UCQA 4YV0A 2DZDA 1K6EA 2C9ZA 3EGEA 5K09A 5HOQA 1GRVA 4QKQA 4R2HA 1AV6A 3FSGA 3REQB 3F5FA 2OV6A 4F6RA 5BVGB 2Q41A 5F9MA 3WQSB 1NW9B 2QTMA 3HDGA 3JALB 3KD2A 3ML1A 5T4BA 2WUGA 3TIFA 3GDOA 2IS2A 4FFRA 5I5GA 2ZP1A 4TYPA 5F5NA 3R7FA 3FVTA 4GKVA 2C4NA 1WHSB 4BGUA 3UW3A 2VQ6A 1FSFA 2E5FA 2Y6VA 5EKUA 5FQOA 3S1AA 3UC5A 4YRKA 4YT8A 3M6AA 4OKIA 1LZLA 2NM0A 1NASA 4IG9A 1IHDA 3FMIA 2DU8A 4O6VA 2AF4C 2O2ZA 4G9GA 4P8RA 2ZANA 1LFDB 1PW5A 1SZDA 1TI7A 3QRWA 2PGOA 5K0FA 4L02A 5F9HA 2PD3A 3SC6A 4WGFA 1ONNA 2J3LA 3PDJA 3A1CA 3NVMB 3N8GA 3C48A 1CUEA 1SBTA 4F56A 2CLHB 3FOBA 1NONA 3QV2A 4J6FA 2R86A 3DZIA 4YLYA 2Z2ZA 2JDIA 3HLTA 3EOAI 2EHDA 2HCJB 4LJ8A 1JEJA 3IAHA 4RORA 1MEEA 3TLKA 1W0KD 3M70A 1W59A 4XIYA 3WI7A 4ZCQA 3HJFA 4Q9AA 1DBIA 3R5TA 1T9BA 4LI0A 2I6SA 2B99A 4EBBA 4EPRA 2W2MA 3AONB 3ZDZB 2DOKA 1ZICA 1N2EA 2DPGA 3R6TA 4RD1A 1K7YA 1XALA 2QU7A 5EEHA 4I4TF 2OGZA 4YR9A 2X41A 1QSGA 5I7UA 4KB5A 2HNAA 4NU0A 2XDQB 1EG2A 1GLVA 5JY6A 2Q2NA 4OQPA 5JAPA 3LFHA 4HEA6 5DE3A 1M1YB 2VAVA 1KY4A 2JGIA 3KAQA 4WA7A 1KTVA 1ZNZA 3DE0X 2ZBFA 5LQAA 4DIEA 3X2SA 5A3QA 1WVMA 4OFBA 3LL7A 5COAA 4JC8A 1R18A 1N6OA 4IXMA 1TCAA 4LW8A 4MWSA 4ZOAA 3B51X 1V9LA 1XCPA 1GKUB 4K05A 2JVKA 3W5SA 5JCPA 1T1SA 3ZY3A 1L4GA 4CUJA 2P41A 3CEPB 3HFSA 5CH8A 2C9CA 5CT9A 5D5HA 3UCXA 3KTDA 5EIXA 4NKRA 5DYNA 3ZCTA 4DXHA 3HJBA 2ZJ1A 2GKGA 3LOUA 4W1QA 1R8QA 2WF5A 2G76A 5LD2C 1UMKA 4PC1A 4MITA 4B8WA 2YY6A 1G98A 1C1DB 4I4LA 1J0AA 1MABA 2VBGA 1JA1A 4OHFA 1ZO8A 1Q6ZA 2Z8XA 1SC6A 1ZVJA 4Q3CA 3UGJA 2BR5A 3FPAA 3UG7A 1GFWA 3LQYA 3OUTA 3V4SA 1L8AA 2QVBA 4ZYXA 4I3HA 1XVUA 2O23A 3HJGA 3ICWA 3I6YA 2JI9A 1LSSA 5E4JA 3ANSA 2RHGB 2PUHA 1CETA 2GMWA 4CLHA 2GA8A 3DJYA 3RPEA 4UEWA 3T7JA 4ER7A 2FG7C 1JQBA 1RRFA 3PG5A 3V80A 2ZDGA 2BM8A 1Q1BA 1DOAA 1JHRA 1UOEA 3CN9A 3EVDA 1IXZA 5IMSA 1P2UA 3WKDA 4F4IA 2B25A 1NKVA 2ZTHA 4BFVA 2C31A 4NDAA 3I5UA 1JH9A 2DJ5A 2O0LA 3OJ0A 4ZI7B 3G9ZA 4IDCA 3JAKA 4CNBA 3OBBA 4JI7B 5GVRA 1OLOA 1S3SA 3HK2A 2ZS7A 1C14A 3DFFA 2GM4A 4FYPA 1X7WA 1YJ8A 4DAOA 1D5WA 3FPBA 3I9V6 4MQEB 2E55A 3LL4A 2B3DA 1ZRMA 3QLVA 1U7PA 4LZOA 1AUOA 4C4TA 1VSBA 1VTKA 3IBSA 1PEDA 3LWDA 1NRJB 4RCZA 1V26A 1D04A 5EIEA 5J1TB 4N41A 2C1XA 5K0GA 1DEKA 4WLUA 3WL8A 3OQIB 1E0AA 2WUVA 2VJDA 3D02A 1N1MA 1TJYA 2VUHB 2HADA 3FMGA 1TNDA 2MR6A 1EK2A 2HK7A 3EMBA 4OG2A 1Y1KE 5ALGA 4BZXA 3KQKA 4W9RA 1Y33E 2C1EA 1CIJA 4G5QA 1OLUB 2Z5LA 4PX9A 3UMFA 1W4BA 1J8DA 3C3WA 5EZSA 3OU6A 1KGSA 5CGQB 1GYRA 5HFNA 1R12A 1TZMA 5CRIA 2MINB 4C7KA 5LP6B 3V55A 1YQTA 5IG2A 2WFLA 2XBMA 5J2TA 1X1QA 4G85A 4TS1A 3SYRA 3GGOA 1R0SA 2B4KA 3IOCA 3P94A 1KYQA 3JQ8A 1KR5A 1B42A 2ETVA 2R6DA 3C6ZA 3K0AB 4IUCS 1CUJA 5CLIA 2DPHA 3IEXA 1YRYE 4BNYA 5F1PA 2WWHA 3JATB 4Y6OA 4X97A 1AA6A 1RHUA 4BUZA 3IERA 5KYWB 5H81A 4YRGA 1R37A 2HB6A 3A6FA 5IDQA 4CMJA 1SRQA 3QVXA 2YWDA 4IH1A 5A6SB 4DSZA 1GFIA 1KK3A 1J2TA 3LY9A 2OSVA 1X87A 3I39X 2ZSFA 1G3UA 2Q5OA 1HL7A 3ZCQA 3JYLA 3TQFA 5KAMA 3WRXA 1VGQA 1G3MA 2O3QA 3FDXA 3HCAA 3S6JA 1HDXA 1PYOA 4GF5A 2QYSA 4HDAA 2H1RA 4J3NA 5FTLA 2BH2A 1P1RA 4W5NA 4C4OA 1OC2A 3LF1A 5GMOA 2UUPA 3Q9NA 5HF8A 5HCNA 3A6KA 2XPCA 1PQYA 1FCJA 2QZ4A 1AHNA 3GEDA 1B0PA 2OXEA 4TWBA 5AK5A 1OYWA 3HADA 5PNTA 3WRVA 1DAPA 4X1IB 4NDNE 5LNK1 1UDCA 5ALPA 3Q40A 2QRVB 1AF4A 1ZU4A 3RSHA 2X6TA 2NPIA 5CFLA 2V7QA 3EX7C 5FULA 1BDHA 1A7UA 4C05A 1G8FA 1A3CA 3TQCA 2OO5A 4W7SA 3UXYA 3AM1A 3G02A 5E2BA 1PK8A 3B3JA 1J2RA 3EZFA 1I7LA 3M5WA 4FFWA 2CT8A 2XJ9A 3AESB 1LPNA 3N53A 1MJGM 4BV9A 1AURA 2BEKA 3NHFA 3PYMA 2QD2A 1MXHA 2XUJA 3H9GA 4KAAA 5FEMA 4ZQEA 3UXMA 2XKKA 1G2OA 1X1BA 2Y1FA 1JR3E 1A9PA 1VDMA 1HM5A 2PQMA 3ROZA 3F47A 4XZ3A 5CW1A 2AKAB 2HCFA 4XTCS 3SZUA 1S2GA 4JSRA 4BIIA 2OKCA 3C41J 5DHSA 4C3ZA 1N5DA 2YHIB 3RIMA 1WHTB 2G9RA 3VPBA 3WYFA 1BEUB 1JJVA 1TPYA 2VF2A 3GGJA 3V8PA 4OBWA 4GDMA 2YNMA 2JF0A 1AKYA 3I42A 3AVXA 5B12A 1KE1A 1PO7A 3ST7A 221PA 3KB2A 5A1JA 3TTVA 4IO0A 5JPDA 2B4TO 3CKMA 3RSLA 3S29A 4BEBA 2VFAA 4ENUA 5EZYB 1BC5A 1Q14A 4Q7EA 2XDQA 2WAXA 3SEFA 3GZTB 4Q12A 1MDFA 3VSAA 4KNVA 2YZ2A 3UN1A 3WNVA 5A7HA 4P54A 4CCAA 5L6LB 4FUTA 1P81A 1Q1ZA 4KBFA 4M1OA 5CIQA 4AU1A 5FLXA 1B26A 4F4DA 4FFOA 3RT1A 5GIPE 1VYUA 1A8PA 2JHAA 4FW8A 5P21A 2A5FA 5CBPA 1FMCA 1S9DA 1GG2A 2RAFA 3WB1A 3NHUA 4L2IB 2D54A 1XEFA 2D4HA 3TRKA 3U09A 3K8YA 2Z08A 5E7JA 3U7GA 2BH9A 1KXJA 5CNJA 5A4DA 1PEAA 1ZN9A 4MHSA 1H2HA 3ELDA 3IE1A 5CMLA 1JUDA 3K1AB 4LF4B 4QQ8A 4G0OA 5G41A 4R9UC 2V7BA 1J33A 4V02A 2R84A 1JDSA 1ZOSA 4KIWA 1YDEA 4LE2A 2FXIA 4QYIA 4PZ9A 2HT1A 1M2WA 2IXFA 2CXSA 2QENA 4I5DA 3HZOA 4WD3A 2CHUA 4LXUA 4M76B 3GEPA 3ZNOA 2P4HX 5IT4A 5AOCA 2L17A 1Q3KA 4HJXA 3PICA 2PUAA 1KVQA 1S8FA 2BEUB 2GCIA 4UDYX 4I4CA 2QJTA 1NR1A 3L7MA 3MWDA 2RDMA 3PDCA 1FFXB 1TM7E 2CLOB 1OH5A 5G1PA 1BXGB 4D81A 2QQFA 2BMWA 4W99A 3RAEC 2HU7A 2QRUA 3KP1A 1KI4A 1CUUA 1NTRA 3B78A 3C5VA 4QOJA 1OTXA 4ND5A 1L7QA 2EF1A 3FJ1A 3PGKA 5C9ZA 2YY5A 2DH5A 3ZEIA 1I32A 4YMSA 4C87A 4RK6A 4A36A 3TRIA 2C92A 2HLPA 4FHGA 4FNAA 5IT9A 3S5UA 2Q6LA 3P2YA 4A03A 2I9PA 3TRDA 4M9QA 2OWEA 1EWKA 1OAAA 4PAWA 3BEOA 4BNFA 4EEKA 4AROA 2AMFA 1FPMA 1U4OA 3HUTA 3RUIA 5CB4B 5HYVA 2DKNA 2V98A 3BAZA 2G17A 3DKPA 3QYPA 1ZRSA 4QGAA 4Y6QA 4FNMA 1FUIA 1QIKA 4NFSA 3ETCA 4CTOA 1JLHA 1Z4JA 3IE0A 3X1XA 1ZAKA 3EHEA 3CINA 3NPAA 4UHKA 3ZLUA 1CZKA 2GCGA 3VNUA 2Q9CA 2XH8A 4EO9A 4L76A 3GPLA 2W2XA 2D2VA 3H0KA 2GNOA 5EJ4A 3ZYCA 2R0QC 4R81A 4Q4AB 4L5CA 4Y1GA 4KQ6A 1C1XB 3ZVKA 3N39C 4I9FA 3IEMA 1GNTA 3CEHA 3ETLA 1HYQA 2AN5A 3CSDA 5B3JA 4C7BA 1ND5A 1NV8A 3OF5A 4MPPA 4IDNA 3VOSA 2Z6UA 3EA0A 1GSOA 2QTZA 4HR7A 4ZQGA 5GGXA 1P8JA 2ZULA 4LPSA 3E2PA 5ELXA 2W4MA 4ZAYA 1KQPA 1KK1A 2WHQA 3H1BA 4PSDA 4A8JC 2PZJA 2XXJA 1DQNA 1VE5A 1OLSB 4FHFA 3LUAA 4DBLE 5COQA 2VF5X 1LLCA 2HSJA 5CLHA 4CMIA 4FYWA 4PVCA 1CUBA 2VNJA 4IMJB 1IM5A 1R0KA 3TG8A 1DKRA 1SCQA 1NVTA 4W1SA 1O3YA 3FYDA 4PV7A 1G38A 1G8GA 3VU0A 1OZHA 2RGNC 2Z3WA 5LA6B 4LJAA 2G1UA 4DM4A 3RTAA 3F6CA 3V8NA 4JHLA 1JFFA 3ZIAD 1ZK0A 4LECA 4JLDA 5IH3A 3Q4GA 1N8SA 2RHCA 3O2JA 5CW2A 4X00A 3I2GA 3T15A 1LBQA 2HIGA 3ESXA 2ZAIA 1YIDA 5F7OA 4ENTA 4C3VA 1PG0A 1E1DA 4O0MA 3I58A 4BJ1A 4JFRA 3SP1A 1MEJA 1WLYA 2BIFA 2OCPA 1EFRA 3R4CA 3TXXA 1V6SA 4MB0A 2QOEA 2HJRA 3KUUA 3N5CA 1L5NA 5JC8A 4G4IA 3AETA 3LZCA 4X94A 1JTVA 3NIGB 4PTZA 1D2GA 1JMVA 1MVNA 2PGNA 4OUDA 4URWR 3T9DA 1I1OA 3USCS 3NCTA 4U7TB 3DS8A 1E7SA 3BRWD 1T0PA 2QRJA 1T4BA 2RHDA 5CGZA 5E6RB 5A6SA 1W6RA 3AHFA 3DV9A 5FO0A 2OCYC 1MDBA 1R4NA 2PNFA 2YV2A 3D0OA 5BN4A 1PJ2A 4B1FA 3HJAA 4UTPA 1NF3A 3E9DA 1WOYA 1L5WA 3GVHA 4BVFA 3AUJB 2PKXA 1CEQA 1T36A 2J6HA 2QUHA 1J1ZA 4GPBA 4N7BA 1KJZA 3FOAA 3QNUA 1SUSA 4Z86A 5JR3A 4C07A 1CE8A 1W4RA 3VR6H 4CQMD 5FNVB 4S12A 5M29A 1FFXA 5E6SB 1T15A 1RI1A 4N01A 4AECA 1EDEA 1W2WB 2IP1A 1SOVA 1Y3HA 1OW3B 1F20A 3TLEA 1EK1A 5F2OA 3VUFA 2PAAA 2IHJA 2YQ5A 3DTVA 3I09A 3I23A 4Q9IA 4HT3B 2C2XA 2W6ZA 4HV4A 5GY7A 2EEPA 4UOQA 2YINC 4YAKA 3D81A 3JCZA 3GT0A 3IAAA 1WRBA 1YJQA 1JWAB 2I22A 3VV2A 2D5IA 2EBUA 1USVA 4ZOEA 3MM4A 4NNPA 1HUQA 1WW8A 3A1WA 4OHCA 4O0LA 3T52A 3INGA 4FCVA 1J39A 1IY1A 2GZSA 3PR3A 4ZT5A 3LK7A 5CURA 4H9GA 4MAFA 4WJLA 4V1CB 1WB5A 2VUSA 2WMDA 5LIPA 1ADFA 1YI1A 3IAM1 4Q02A 1GAQA 5J59A 3L8HA 2FQYA 2EJVA 5HF9A 2XE7A 4NBKA 1H6CA 1I13A 3GAZA 2OGWA 3ORSA 3QKSB 1WD5A 1LLDA 2ZRLA 4WFKA 1E62A 1VBFA 3W5AA 3GOQA 1M0TA 2MCFA 1T3TA 1CRZA 1UZLA 3ICOA 1QK4A 3PUKA 4DLAA 1KWKA 3QFHA 1M8GA 2C9DA 4IY1A 4N4AA 2XB4A 3PQFA 4GQAA 5LBIA 4EEZA 2ZIUB 2PUCA 1PL8A 1ZD5A 4G09A 3MD0A 4G36A 4PGGA 2VEOA 1EDZA 4PVDA 1XN4A 4P31A 1SUCA 1U5BB 3AHDA 3FTDA 1EM8B 2LVBA 3E27A 4ARZA 1DHRA 4OQLA 1X86B 1D9ZA 3HR8A 2ZU6A 3L0ZA 3AVPA 2B98A 1HE1C 2Q21A 1WKVA 1T2EA 2BFEB 3QUBA 4HAOA 1CQJA 3OD5A 2BGTA 4MKHA 4BHTA 1RCUA 1B7GO 2XW6A 5FHRA 3C5EA 4NOLA 4YQYA 3F6RA 3UPUA 4A0QA 1UMDB 2W2NA 3M81A 5BO5A 2C7PA 5A0VA 2OWDA 2W5UA 2I1LA 4DWJA 4YACA 3BQ9A 3GY0A 1MG0A 3F7OA 4QNMA 3AB7A 3STTA 1G4AE 1DC6A 3B7WA 1XCMA 2QE7D 5D1NA 2CJXA 5FPTA 4UPVA 2PH3A 3JPWA 1EWYA 3ZK7A 4FGLA 4UM9D 5B3AA 1PS9A 2JI6A 3JS5A 1GDHA 3PEFA 4I6EA 4LOJA 4FJ1A 2BGJA 1DX6A 2YY7A 3OG9A 4YWJA 3W6ZA 4BJ5A 1I6KA 2BZGA 5AHOA 1UZAA 2CB9A 3H6KA 3AFMA 4WNCA 4A0SA 4ZT4A 3V42A 1OWNA 5JXGA 1RZRA 2PGAA 3D2AA 3PQ5A 4KE7A 4KLRA 4UREA 4KSYA 1SB8A 1YR2A 2QZPA 1JEOA 1FS4A 1XKQA 3HCOA 3OZVA 2WF8A 3VI4B 4CMHA 3KYDA 1R6XA 3UHOA 5JCOA 3LXXA 1KC3A 4RHCA 3JQ9C 1T1EA 3SXUA 5B3KA 1JEYA 2YCLA 2WJVA 4TS3A 3B9BA 1KI6B 2HK9A 3NUQA 3WRXC 4L1KA 1SKMA 1FZQA 5TARA 4ZOQI 4ZOBA 3I9OA 1OA1A 4A0GA 1P33A 3ASUA 1LVHA 2AK2A 4UNSA 4V0SA 5D01A 4CKBB 2K2QB 2R68A 4MUAA 4BO7A 2FKAA 2Y1XA 1QHEA 2FW9A 4FW9A 4DZRA 1MB9A 1ORVA 2FYTA 2HL6A 3DBLB 1TIBA 1PGPA 5LMCA 1OR8A 3KR0A 5E7QA 2WLTA 3AXTA 5TC4A 2FP4B 3PNSA 5BUSA 3B8HA 1NW3A 4AYWA 1XQYA 2NUTB 3T3GA 4E1AA 4CM3A 1TVMA 2XUDA 5CLLA 5CDTA 3EZ2A 4MIOA 1YZUA 4JUAA 4BFLA 3I73A 4TZ6A 5ALRA 3KVRA 2R8BA 1DTEA 3L6EA 2ZT7A 1WU8A 1ZR4A 4UBMA 3VTAA 4RDXA 1KFCB 2GCOA 3A04A 4V3BA 5LNK6 2P9HA 3A14A 2EVWX 3D3WA 1OVGA 1E4EB 2UVPA 2IZZA 1H6DA 1U65A 1JFVA 4GR4A 4H3HB 3CG4A 4MWBA 4JUBA 4WN9B 4E08A 3SZLA 4RVNA 1KTIA 1UBSB 3HRKA 2Q2QA 3HJHA 3U7QB 3F7MA 2YBEA 1JB1A 3VPXA 1E5QA 1DG3A 3O3MB 5K0ZA 2O06A 4IKPA 1OBCA 1ELOA 1PFUA 1YT5A 4UTZA 1V71A 3PEEA 3IUBA 2CKDA 3TL6A 4F60A 1PGJA 5LZ4A 1L5KA 4Z4QA 4RKYA 1XTIA 1U11A 3W34A 5TVGA 5IFLA 2R6ZA 3W78A 1NN0A 3CVVA 4CEIB 1ODIA 3AR4A 1P2DA 1XX6A 1S2IA 3LNCA 3L7LA 3K1JA 3SG0A 4ED9A 2IV2X 1BEEA 1RKBA 3EC1A 4YA6A 2JJ1D 3JARA 1K7CA 2P0EA 1GZUA 4L28A 2J6CA 2WJYA 3H3XA 3O4FA 4KLCA 4L8LA 4DJTA 4NXMB 1IVYA 3P8ZA 5F7JA 4CU2A 1AHIA 5BV7A 2JG3A 3N5KA 1TMKA 4BB0A 1Y1LA 1JHOA 1XZKA 1FTGA 3V7UA 4HOYA 4DCSA 1COWD 3Q7EA 3K0SA 4NLLA 5EMNA 2OCGA 1ZZEA 1ZUD1 2FHSA 4ZKEA 1IZYA 4MV7A 1FFEA 3EW7A 2HJHA 3MXTA 3GG9A 3Q0IA 4WESA 3ER6A 1NL3A 2CYCA 4X6YA 3VPGA 1FQOA 1ML4A 2B7CA 2PUJA 2C5GA 3EUEA 3JD1A 3IUMA 5EXEA 5EXXA 4IIJF 1KE2A 2DBVO 3FZNA 3LCVB 4DYHA 2W4QA 2DWOA 2ST1A 4NBTA 3UK0A 1Z39A 2HV8A 4L6CA 1UANA 7MDHA 3K9CA 1XKLA 4IJUA 4WECA 3FJOA 4E5YA 1KC1A 4YPVA 2YWCA 3RBXA 4S2EA 3ASYA 3ENKA 2CVZA 2H5EA 2Z83A 1J5XA 1LF0A 1GARA 1US8A 2GM9A 3OMXA 4RF2A 2AOUB 1FUYB 5FBWB 4P92A 3UJ7A 1SKBA 3IIIA 3U7FB 3TNJA 4ARSA 1XGKA 2E6UX 4MUKA 3AMVA 2FN7A 3DFIA 4QPJC 4B79A 2FAXA 1DC5A 1E8NA 2L19A 1EZ4A 2COUA 5P8WA 3VMMA 1R7RA 2P3SA 5DHPA 3NHMA 3GOHA 1JDPA 1W46A 3EYWA 3RRJA 1X7ZA 4ETNA 5TVKA 1OWOA 3T1TA 4D9MA 1BGXT 1C2YA 1M6NA 3FPSA 2QI9C 3QY9A 2L2QA 3TQIA 2YL2A 2VWQA 1ZXBA 3HCEA 3K4PA 3M4NA 3MVEA 3REGA 5BR8B 3Q2IA 4ZIRB 1R0BA 1X9IA 2G83A 3P4UA 3WDMA 4AJ1A 4BUJA 3FRIA 2EXXA 2D59A 5F33A 1NM5C 4QYWA 1SBHA 5BXQC 4DE5A 1QIJA 3Q7IA 1OXVA 3ND6A 4B2IA 4E32A 2CXNA 2WZQA 3PUIA 5A06A 1ZCBA 4BNDB 5EUMA 3NHRA 5TV2A 5CG2A 2WM9B 3PJDA 2V7WA 2H29A 4HG2A 4BO1A 1DAMA 1U8ZA 3SC2B 1HEUA 4RCVA 4DCPA 3FTNA 3IV7A 1PZXA 1Z18A 2QVYX 4U8HA 3GRKA 3QV1A 2ZKLA 1ITZA 1CUYA 2UYGA 2YIDA 4KVFA 4LYFA 4BFXA 3NTUA 4G56A 5JSKA 1RYEA 3I34X 1Y1PA 3FHLA 4B3SB 1OZFA 1ZL2A 1CJUC 1CF9A 2C4UA 4BE9A 4XD2A 5FOWA 4PN7A 4BRZA 5KYGA 4P86A 4RMIA 1BTOA 1I1QB 4JS0A 3MA0A 4LS3A 3SR3A 3WK9A 1ZD9A 5KU7A 1IULA 2X0RA 3DNFA 3CV3A 3AT1A 2QA5A 3KXPA 3PRYA 3QU7A 1B6RA 3K35A 2PBFA 3ONDA 4IUBS 3QE4A 4IL5A 2A33A 1ADCA 3I4FA 4XJXA 5FV7A 3OLZA 5IYZA 3GLIB 1OILA 3JQ7A 1BYIA 4PLWA 2G80A 2PO7A 2UZAA 5LU8A 3IIJA 4TS4A 1H6BA 1HFEL 3GRAA 4EJSC 2GZMA 2F6RA 3UMRA 4GD3Q 1X2BA 4OOEA 1QMPA 4R2LA 1M3SA 4JYZA 1QGAA 1SG6A 3QBJA 4UNNA 1MNAA 3SXPA 3VPAA 4HH4A 3ZWMA 1U3CA 4BMOB 2ZAMA 4HB3A 4IGFA 1QYWA 1RYMA 4CTKA 3TG2A 1O0SA 4MEJA 4BQIA 4HAYA 4G1MB 1RAFA 2I2FA 4RAOA 3ZJVA 4MAAA 3QUCA 2E3JA 3EC7A 4RKWA 4E14A 1NYTA 3SF0A 1P0CA 4MYHA 1PR1A 3GELA 1RC1A 4OX9Y 4OQXA 1Y37A 2JGAA 5JHHB 2RC5A 4WBNA 4UVDA 4X24A 4RSRA 1W4CA 3CZ4A 5E4YA 1GQYA 3TDKA 3KB6A 4DV0B 3DWFA 3FMFA 2P69A 1UWLA 4DR4B 3CNOA 3HO1A 1AXEA 3GGCA 4CNQA 3THYA 3ZZNA 4XD7D 1DJQA 3TL2A 2H1OA 4S2UA 4AX8A 1QU3A 2JFXA 4EYQA 3LYHA 4XGKA 1UK6A 3GQBA 5LYJB 2WPDD 4P36A 3R41A 1TT5A 4WOPA 3TJMA 3CJRA 1AKMA 4Q03A 3PJRA 3BH6A 3HCRA 4QDZA 3UHJA 1VIMA 1GADO 4FD2A 3GARA 2HQ1A 4W1PA 4E11A 2EDAA 1IN7A 2FSUA 3IODA 4D4KA 4IWYA 5KZMB 4Z5XA 3IP3A 2JCXA 4MW4A 1UBKS 4Z9FA 4AJNA 4R69A 4XASA 4RZQA 3JZAA 4UUNA 1DXOA 1VKRA 4RO0A 4V0RA 3C43A 5C0OE 3EJ6A 1FXUA 5COBA 1FDTA 4OMFG 1ZVKA 4Y2HA 3W5VA 4E7OA 4I1RA 4UTXA 2WSSD 2ARKA 2Q4RA 4PGFA 3GLFE 4QELA 4Z9YA 1V8FA 4PCVA 2VVTA 1SG0A 2DHCA 1YCDA 2WZDA 3LYUA 5BNWA 1EQUA 3OJOA 2YFKA 1XK7A 4FOOA 2Q0QA 4A4DA 3RFVA 2J0EA 2QUZA 5H1YA 1Q7GA 2V5AA 1IJKA 3GR6A 3A36A 1NIJA 1CR4A 1RFGE 4BTVA 3FI9A 1KEPA 1QIMA 2QM7A 2NO9A 3HGQA 5TX7A 3UB2A 5HIAA 2BAGA 3BKXA 3K96A 5JD5A 4WJKB 4DMCA 4JGGA 3I2YX 3PBKA 2IYLD 3RVSA 2VDUE 3ZV7A 2QJOA 4R5MA 4XIIA 5SZKB 3RS7A 3EIOA 1P29A 4U00A 2PBZA 2QIOA 3A4LA 3JYHA 3WBFA 2WFZA 4YWHA 1OGYA 1D03A 2JVJA 3QNMA 4YUZA 2QVGA 2QXUA 4MS4B 1I5EA 5CT4A 2G7MC 3DL0A 2FW8A 1DELA 1JJAA 2A9JA 2AJBA 3C85A 3DFMA 3ITNA 4JASB 4ZOLA 4ZVQA 3CW9A 3OCYA 3VVMA 3PE3A 3RARA 4R2WA 4EYKA 3L84A 2WSIA 4PYRA 4BGVA 2H8KA 4R8MA 4BAUA 2JFQA 2WPNA 4NBRA 1JFSA 2E1RA 3O38A 4JR2A 1DT5A 1Q1QA 1T43A 1UBGA 2PFKA 3OQJA 4GMFA 4OGWA 4CM4A 3SJBA 1NDHA 4AZWA 1A27A 1CRLA 4A0RA 4DPMA 4MWOA 2IUYA 2GN2A 3D5QA 1NSFA 2BI7A 4L4RA 2ZQ5A 1PNVA 3B1FA 4NH4A 5BN4B 2IZ7A 2PU5A 4FS3A 4F4HA 3CW2A 3AVTA 2HMAA 4GSLA 2UYQA 5C8YA 3PXXA 1T0HB 4PINA 5KSZA 4CIAA 1DJMA 2CDBA 2GHQA 3A8TA 3MS7A 3PWZA 5AI9A 1RP7A 3VNAA 4A8HA 5JFOA 5GIOE 1II8A 2OCDA 3ND5A 1G2PA 1DCMA 4W5HA 2VP6A 1E92A 1UC9A 1XRPA 4ZYYA 2GZ1A 1IEXA 2HA2A 2PMBA 3MPOA 4CPDA 4XEHA 5DTJA 1KEWA 3RS9A 3F73A 1YC2A 2I8LA 2HWWA 3HUFA 2X9VA 2BELA 5ALUA 2I6QA 4WH0A 3UAZA 1FMJA 4YT4A 1BS9A 1QDUA 3OTGA 2HDHA 3CR3C 3QFFA 4W9MC 1WZ2A 1WNFA 2WABA 4TPKA 3D8TA 3D3WB 4WDRA 1NOJA 3HKEB 1UFRA 2C7VA 3QVTA 4GW3A 3I64A 1YS9A 3KFVA 4DLUA 4E88A 5HK9A 3DULA 4WKCA 5LCXA 4JI8B 1CE8B 4ZRMA 5KDLA 4L4XA 2XKJE 2NU7B 1X2EA 2I4LA 1MORA 1PEKE 2H2WA 3CLHA 1PLLA 3GMIA 4NYMQ 5DBEX 5G40A 3K8QA 3S27A 3VYSB 1P72A 3GFBA 4QBTA 4CKYA 4FR0A 2ODBA 4G4JA 1F2DA 3T7KA 1Q91A 3WMGA 3GJZA 3HWSA 3MJEA 3PF9A 2J6BA 1QOPB 3ED5A 3VC2A 4I1IA 2QUKA 4DUGA 5IS2A 1TLTA 3EFHA 3D0QA 1DL5A 3QXJA 4V38A 1PFWA 2BSXA 3NX4A 4M9ZA 5FBQB 4CMEA 1AMNA 1SPXA 5TS3A 4DGSA 3HL4A 4AZ3B 1C3EA 1NIPA 4JQYA 4MWDA 3SEAA 1J0EA 1XXHE 3L5OA 3AIIA 3WMEA 3K0FA 4RQTA 1TYZA 4XARA 5F78A 5JZMA 1USIA 3JD0A 5GZ3A 1JU4A 2VLBA 4LTDA 5JNUA 1AQUA 3HY4A 1QANA 2O4UX 5K3DA 1GOTA 5AI0A 4UOEA 1H4VB 2PZLA 4K0KB 1XC7A 3A3YA 3KM0A 3UJHA 3MCUA 4H17A 5C31A 1F5SA 3KPYA 3MIIA 3VKUA 1VMDA 4BBJA 4REQB 2VQDA 2ZLBA 2AE1A 1Y8QA 4NBWA 3LY7A 1AUQA 4N54A 4PZZA 4I1SA 5IF9A 3D3EA 2QSJA 5KJEA 4GP7A 3IAM6 4N47A 4BMSA 2O0JA 3L46A 4N9QA 1XRRA 4AI6A 3ZVNA 2IS1A 3RREA 2R1TA 1N2CB 4EZEA 2R9VA 4NYJR 3S2GA 3HSYA 3ILHA 4FYKA 2VOEA 4GQBA 3C3XA 2ZXUA 2XQJA 4P4UA 5AVRA 3JPYA 2EHJA 1ZSVA 4IS2A 4MVJE 2SECE 2HYDA 3S99A 5C2JB 1K5GA 2VTEA 3V1TC 4FMDB 2PKYX 4NCHA 4DTIA 2FLWA 4UUMA 2IYQA 4TTAA 1MX1A 1UEIA 3QVWA 4DMFA 1NXXA 2ATEA 3M4ZA 4DIDA 4FOLA 1KVRA 3EN0A 3OLWA 3GNQA 3TL3A 1S2NA 4OKSA 2D06A 2Y1LA 2DWQA 2P40A 5BOSB 1ENYA 2OHXA 4Z54A 4WCDA 1SD1A 2ZSEA 4IVNA 4P7BA 1L5HB 1KDPA 3YASA 5BV8A 1LS6A 4ASUD 4F4FA 3SOPA 3QVMA 1TEXA 5ESWA 2O7NA 3PTZA 5EL0A 1K8QA 3EASA 5H82A 5J40A 1YU6A 3D1LA 3UUFA 4B2YA 3DEZA 4R41A 3ADBA 1F8UA 1JLSA 5IC6A 1QZZA 1MB2A 2IOHA 5JUWA 4F7DA 3DL4A 1XA0A 1HH4A 4H7FA 2ZIFA 3H2GA 3NHLA 1C0LA 1WXQA 2FZLA 2AI3A 3MN1A 4NV0A 1ZHFA 4E33A 1YB5A 2A57A 3VR1A 4HO1X 2RD2A 3ZW8A 1R4MA 2P11A 1IYZA 1Y81A 2QLMA 1KAGA 2ZI3A 3TW8A 1Q21A 1MA3A 2O50A 2OBNA 2V74B 3U3ZA 2ADMA 3LUBA 4DADA 1BU5A 2IDJA 1JN0A 2PRIA 2IOYA 1QP4A 3E3LA 2CHFA 2EW2A 3DBRA 3L0IB 4KXVA 4UVIA 3UB4A 5AQ1A 4FEEA 2Q3BA 3GZJA 4DV5B 2NV2B 3L04A 5LXTF 3ZDEA 3JQAD 4FR5A 1KSFX 4BN4A 5FJJA 2BBTA 3MUNA 2GEKA 1VE9A 3HS3A 1K8YB 2BFCB 3FVRA 4D4LA 4HH1A 1APBA 4F1JA 3JQGB 2ZRKA 4JQCA 3WO0A 1KZ7B 4H60A 4J76A 4A27A 5FWXB 2F1OA 3ETNA 1CIVA 2ZJ7A 1E0JA 2BMJA 3Q85A 3JVVA 1NVBA 3UJAA 1FS6A 3JQCA 1KHTA 4GL4A 2P1RA 2JKYA 3TYXA 1CZLA 2L18A 5K8UA 5KNDD 1QVVA 4KN6A 3GJ5A 3O3CA 3O8NA 3Q5GA 3RF7A 3EF0A 4HLQB 3D3JA 1A5BB 2VA8A 1E7QA 5GAJA 4Q7LA 5DZSA 1GD1O 4CQMB 3FCYA 5EZ5A 5KKAA 3DKRA 2YYZA 1GN9A 4GPD1 3HGTA 4E7PA 2E4UA 2WPDA 3IBTA 1EMDA 2OB1A 4LNUB 5G02A 3R5KA 4J0HA 2HBZA 1QWSA 4QQRA 1PV1A 3PHHA 1NAHA 3VO9A 3DE3X 4MUYA 5AVJA 1V6CA 1L7MA 5JMPA 5FWNA 3QVGA 2IYEA 1N5MA 2IX9A 3CC8A 4OK3A 1RT9A 2VUUA 4YP5A 4AKSA 3L8MA 2JLZA 3KQYA 3A58B 2XYVA 4RGVA 3D8SA 1Y5NA 3K6JA 4XM1A 1KBOA 3M2PA 1YA8A 2QRQA 2WWGA 3D59A 4GPTA 3SBOA 3SFZA 4KO3S 4MS3B 3T3DA 5I4IA 3T3OA 3ZV6A 1ZM3A 4B7UA 1QX3A 5AI6A 1NLUA 1ZH8A 2QX7A 3K71B 3WA6A 2CCKA 1RPNA 1L5HA 4IINA 1UC5B 1LLQA 3BZUA 4HAXA 2PT9A 3FOCA 5AM1A 1LLUA 5KX5F 4LKRA 3LC7O 2Z1MA 3D9QX 4CJXA 2QSUA 5AVKA 2Y27A 2P9QA 1RU3A 2CB0A 4IJKA 3TZ6A 3ZD9A 1GDTA 2NSJA 1GPJA 4K6MA 3Q7QA 1L4BA 3MAAC 3UJCA 4ZYLA 1E9FA 3FSEA 1AKUA 3MCWA 1VZ2A 4M99A 3R23A 4Y2RA 1V11B 2MSKA 3MJHA 2FDCA 5B6JA 5FUVA 2X0JA 3E8XA 3OD1A 4KX3A 1V7ZA 1G6OA 2HMSA 2JA1A 3AFNA 2ECPA 1Q0QA 1NATA 3N87A 1Q3TA 3K0AA 1NNSA 5CJ2A 4K86A 5IEBA 3PSAA 4DC1A 4F06A 5F3RA 3T99A 1YL6A 3G2KA 1XMJA 5A3SA 2ZRGA 2GYWA 3B1JA 4J16A 1BROA 4TXLA 5DX1A 4DB4A 3RDPA 2XA1A 3R0XA 3GLGA 3SBDA 2H16A 3EWNA 1X7GA 3EXHC 4KFUA 1W36B 3LGXA 2QX6A 3R44A 4NE9A 4DC0A 4DKJA 4YP1A 4DJDC 4TQ9A 4A8JB 2H7YA 3E84A 3NBXX 1AKVA 4H4CA 1VE7A 2QR2A 1OLUA 3CNQS 5FT9A 1CJMA 4ZCPA 4E22A 5LP1A 1ISIA 2VK2A 1IY2A 3WGQA 2W7TA 4BLSA 3MGCA 2BEJA 5LQNA 3F5DA 2VK1A 5ESRA 4E4TA 5CDGA 3ORHA 1FTNA 2DHRA 2R47A 4B73A 2DTEA 3OZTA 5E4FA 2NO1A 4CM9D 5JD4A 1ZC3A 2IGBA 1FXWF 1KZ9A 1C41A 3ESYA 4WNAB 2HMYB 2WF6A 4RCYA 1K6IA 3E3AA 2VDNB 3LIPA 1E58A 3LHSA 4LPKA 5CNKA 4PIMA 3PI7A 1IQRA 2RK3A 3CW8X 1AHPA 1PX2A 5K2MA 2XNHA 3P97A 2AMLA 1QH1B 2OKGA 2YZMA 4RK1A 2XCLA 3E9YA 1VPWA 4HL6A 4KN8A 3PUJA 1SKUA 4PU0A 3L1KA 2DR0A 3D2LA 3QVOA 1PJ8A 1IY8A 1Z0IA 4YAJA 1JT2A 3IPYA 5ULLA 4X3PA 2COKA 1WB9A 1QZXA 4MYRA 4UJ5A 2C99A 3HXQA 1TTPB 1O94C 2BFNA 4AD8A 4GZ3A 4YVFA 3ZCRA 2JLWA 4B71A 2HF7A 4Q3BA 3O8QA 2VPYA 1Q16A 1SZPA 4IHJA 5JXWA 1J97A 4FJ0A 4M4SA 4BO4A 4JLBA 1HLDA 1AN0A 4KR7A 4IMIB 1TJPB 3M6LA 2EQ5A 2H4XA 3L0BA 1H5QA 4V24A 3QU4A 3K6RA 1ZD4A 1QTNA 2AUTA 4MPRA 4TXJA 1DLIA 3GCXA 1PT6A 1J56A 2INGX 4F2PA 1AN9A 1BJTA 4QYIB 2BTEA 3BF8A 1Z26A 1W19A 2ZSBA 3DV0B 3BD7A 3L6CA 5K05A 1UK7A 4C0LA 2AC7A 3HUUA 3IVAA 1E79A 2WU1A 1P7YA 4ZYUA 1YL5A 2B30A 4QOEA 3V5NA 4EHLA 1K9VF 3TM4A 4FUQA 2LE0A 5B7PA 2FMIA 1LD3A 1G2QA 1I1NA 1UJNA 1AO0A 3QJ5A 1ADJA 3E9EA 1ZY2A 4G6ZA 4RZXA 5IAAA 4CHGA 5KSPA 1DEAA 3MCTA 1MBZA 1YXMA 4DCMA 4HLUC 4OCZA 4URXR 2MIIA 4RVUA 2B8WA 5F51A 1Q0ZA 2JCBA 5GJBA 3H5RA 5U9CA 4YRDA 3FTCA 3WGUA 5F21A 2A9RA 1UJMA 3BULA 4G5GA 5D84A 3PB3A 4H0FA 2HA3A 1YONA 4C01A 2VNKA 3P0JA 4J2OA 4OHPA 5A0FA 2XVZA 1JEEA 4UCXA 2V8OA 4DEYA 2GTPA 4MUNA 4AC9A 4ER5A 4GZ5A 1X80A 4N5HX 3UWKA 4I1UA 4X85A 1JHZA 2ZYWX 1KZ6A 4OJYA 5HJ7A 1E8MA 4M83A 1SGWA 3DEHA 1JAYA 4MV8A 1E1KA 5GP1A 1CKEA 3INRA 3PZBA 3VDXA 4KR2A 4NQRA 4MO9A 3GX1A 5JCJA 3UICA 3IEVA 2X0NA 3C3BA 3KX2A 1N9KA 3IJ5A 3MTAA 3OIVA 5BSEA 1T2CA 3D7RA 2WMNB 4DSOA 3OA2A 3Q7SA 2OHFA 4EKEA 2X4LA 5AUOB 1U81A 3FNRA 1V1RB 4WLVA 4ENQA 3OQBA 4KR0A 1NZFA 1KY3A 3LPAA 2YJGA 3GFRA 5NULA 2BT4A 2I71A 3P52A 4KN9S 2FSPA 5A4AA 4O33A 1K88A 4MRSA 4ENRA 4IIFA 1U28C 3P96A 1BHSA 1G19A 2F3TA 2F3UA 2OHHA 2WA1A 3V1NA 5I9NA 3GBVA 4BXOA 2J0SA 1JIXA 4J7AA 5DI3B 1Y4DE 4C5BA 4XGQA 6AT1A 4NEHB 4V0KA 3IB3A 1WUTA 4IOLA 1G20E 3MTQA 5EG5A 2HD4A 1RIFA 4JUCA 1NG9A 1BKDR 2FEXA 2ZJ2A 3CLVA 3T4XA 3SR4A 2H57A 5K8CA 3WQBA 3ELWA 1NUSA 4EATA 2J67A 3AJAA 4FSHA 5JJLA 4UHFA 4ZOCA 3ZHUA 2CE2X 2CZGA 3R75A 2PX0A 3T9FA 2QZJA 3JYOA 1ECCA 4E3WA 2WJ6A 1YE5A 2RK4A 3UK2A 4KO1S 3ZJYA 3PL1A 1LNQA 4ZA2A 5F5LA 1DIBA 2VF4X 3H11A 4Z4GA 4BGIA 4MGZR 3IS3A 4GPIB 4MYCA 4D2IA 4EVSA 3R77A 1OT5A 2ZB7A 2LKCA 4R8LA 4EMTA 4KTTE 4EW1A 4UUBA 4UTRA 1RWPA 2IX3A 5GM1A 3EEIA 4EK9A 4YPOA 1DKLA 1G8AA 1XMQB 3HP7A 4F1KA 2XHEA 3JZIA 5KSYA 4ZAFA 5IJ9A 1RXVA 5JH7F 1Z88A 2VKQA 4TMYA 2X4GA 3D8HA 3FIJA 3LW8A 2RHBA 2RKBA 5HMMA 2OZVA 1YR1A 3SC2A 1JHVA 2CKMA 3KIPA 2NU7A 2DBZA 4U2FA 1B93A 3LLVA 4IJ6A 3TQSA 1RQ2A 5JW6A 2XUPA 1YQEA 3BMOA 3F98A 4TRMA 5FQNA 4ENWA 1P1HA 5CHEA 3RRFA 4AUNA 3OIUA 3UMSA 4ZOLF 1D2AA 5B7QA 3DW3X 3BERA 5A02A 5DLQC 1IB6A 2JFYA 2X3YA 4V0ME 3LG2A 4PQGA 4B44A 4PCAA 5I7EA 4G1UC 1DTSA 4LF5B 2H1HA 2HO5A 2FXVA 1IUPA 1UZNA 2R65A 3HZZA 4AG5A 4HDCA 5FYQA 5BNIA 2C2BA 3JYPA 1Y5MA 4FSXA 4INZA 5K03A 4N3AA 1NN5A 3UKDA 2V54A 5EJ2A 3H1EA 3RHTA 4HXEB 5FL7A 4XFDA 1GCIA 4AP6A 4NIMA 3HH8A 2DUMA 3LC0A 4PBRA 2ORWA 5HRCA 2FSIA 1ZOIA 2QTFA 2ZBPA 3PF8A 3LECA 1ZA1A 4QEDA 5CCXA 1H93A 1DKPA 1NXWA 1P5HA 3N8IA 2ZE6A 4HQ6A 5AKKA 4YXWA 3C6QA 3ABRB 4E15A 4LNAA 2BMEA 2ZVQX 1HE4A 3FB4A 1MO2A 3HGMA 3ZGNA 3OF3A 2NZWA 3CURA 4KQ9A 2GD6A 1RZ3A 1OWPA 4KYIB 1XEWX 4RIHA 5H3LA 2DR2A 4EBFA 1JEDA 3RIGA 1ZH2A 1GG9A 2A67A 4XQ9A 5U4XA 3U1BA 4BNTA 3I30X 1V7QA 3OE1A 1VLVA 3TXAA 1IEVA 2F9FA 3ZI0A 3KKZA 3OC6A 4TTIA 3C1UA 3MSCA 2IBSA 3QEMB 3PUXA 3R0QA 5GOTA 1R9JA 5FRDA 1V39A 4DMHA 1VBKA 4M36A 1M76A 1TADA 3VJRA 3TDNA 3JZFA 3L4EA 1ML3A 4GYJA 4OB7A 4LDJA 4O2BB 5J5CA 3QW2A 2FZWA 1L4UA 1ZWLA 2XT9A 4URUR 1DUVG 2BKUA 3SZ3A 3W1WA 1Z33A 4KO4S 3HL0A 1E3DA 2G0TA 1PWEA 2GT1A 4OLJA 2W70A 4DLTA 4B6SA 2P79A 5A1TA 5FTKA 4BEVA 1FTQA 3OP4A 3KL2A 5DASA 3MTGA 4JJIA 4LX8A 4RH0A 3JWEA 1C5KA 1QVWA 3RANA 1N6NA 2W8BB 2YBDA 2A3NA 5CTAA 2IOFK 2ZJ6A 4P81A 3ET4A 5LQCA 4C30A 3CBGA 3ZI7A 1XMOB 3FLEA 3U39A 3K1ZA 2V1UA 3F6EX 3IHTA 4K0RA 4GI7A 4G67A 3T5MA 5KMGB 2G77B 4V3CA 3K09A 4MTLA 2FCRA 1YB1A 2WP0A 4PLHA 2VQEB 3VPFA 3IUEA 5CVUA 4J0GA 4XUGB 1KGDA 4QG7A 1M0EA 5FO1A 5BYBA 3DE6X 2QJFA 3T4UA 2EERA 3VR3A 1X70A 2FW0A 1RHKA 2HO4A 2M98A 2WD7A 5ALOA 2CV0A 5IULC 1CP2A 1QGED 5AW1A 1Y0BA 1FYFA 1GKIA 3H9JA 4I46A 3AF6A 3OPYB 1KETA 1O89A 1EHYA 1NVEA 5I9BA 3W05A 5BN5A 2VUTA 5KNDA 1RWMA 5KPDA 1UZUA 1VJRA 1WP4A 1XAJA 3KXKA 5ALTA 4LJKA 4KLAA 4MARA 4BFCA 1YVRA 1SG9A 2PUTA 2NYUA 1TRKA 3LPDA 4BBPA 1D5CA 3VO2A 3ONFA 4K1XA 4OEHA 1VE1A 3F9CA 5LYJA 4JUDX 3LO8A 4J0QA 1CR0A 1VJTA 2NZVG 3HVHA 2FR8A 1L2TA 1TTQB 4FYMA 4YRTA 3OJFA 3J7TA 1BMQA 2IWHA 4E6EA 4DLNA 4YP7A 2NAFA 5FAXA 1S3GA 5M7EA 1TB4A 4US2R 3KKOA 1G5IA 2WD9A 3QPWA 3GDGA 1GR0A 1VLJA 2HXGA 1X0XA 4MROA 2CDRA 2G72A 4HWTA 4WY8A 4AJJA 3LRTA 5H68A 1P4AA 4QDUA 5JJ5A 4QBIA 2ZJOA 3WLNA 1I94B 1JAZA 2O5EA 2QYOA 4NJMB 3JRXA 4NMXB 3NUZA 4RF5A 1NV9A 4DCNA 4YT2A 2BR3A 3SJUA 3UAXA 3DONA 5DBHX 4FYXA 1T8YA 3K3PA 3KV3O 1T5LA 3UVEA 3EGOA 4D4IA 3MS2A 3EFOA 2AC2A 2VXCA 4H15A 5FR2A 1A8IA 2XQGA 2BHLA 3C2QA 5A2QA 3LDAA 4LV8B 4DCTA 2EBFX 2YMMA 4F92B 4KYUA 1IL0A 4BCDA 4P3NA 3U9TA 2PVCA 3KJZA 3SHVA 3ZGVA 2WNSA 3KZXA 4PC3A 1MAAA 1LNZA 2LKDA 2GPJA 3VSDA 5BN1A 1KI8A 4O4IB 1JEQA 1Q7TA 4GWLA 4XQEA 1JFLA 1AG9A 3BFPA 2C4HA 2YQ4A 4DL9A 5IHXA 1QO0D 1P9RA 1RNLA 1YDMA 2V0CA 1Y63A 2W6ID 5K3SA 1ZQ1A 1DKUA 2QRPA 5IM5A 1RAIA 5JRZA 5K7SA 2WT4A 2WVJA 3MWYW 3Q9SA 1CPYA 3NHSA 2C3UA 2O3RA 3QXCA 4M6WA 3U7IA 2FR8C 1C7IA 1G6Q1 1IQPA 5K1ZA 2QTVB 1KBQA 2V5UA 4ZARA 1CB7A 2BGRA 2F1HA 2NTJA 5DNDA 5C3MA 1XD9A 2TSYB 3IQFA 1DAHA 3ANLA 3W2HA 1KO8A 2A5JA 1T3ZA 3HYRA 2WAAA 4EW2A 4DCJA 4BO3A 3ZNPA 2LIVA 3WAKA 4JXXA 3B7PA 1ULUA 2FI1A 4P7JA 2R66A 1PN3A 1UDRA 3AUFA 3R3VA 1W5AA 3ADOA 3AILA 3RLIA 1AKNA 1HE3A 3AG5A 3O8OB 3JV7A 1Q0SA 1A50B 1KI6A 3QJYA 4QUKA 1UT5A 1JEQB 3WLIA 3RJ9A 1S2DA 1U9IA 2Q5CA 2QLBA 3SXUB 3TE6A 1JEYB 4YBZA 5FTNA 4N5MA 5JMWA 3M6FA 4MCAA 2O8CB 3IILA 2IODA 3D43A 1XUOA 2WHXA 1PJLA 4PFKA 5HUHA 2Z3ZA 4EG6A 2UUBB 2JL1A 1LDNA 2DHEA 2WD7B 3IP5A 13PKA 1FSSA 2CFCA 3E5MA 1IOZA 1VP9A 2A7QA 3QI7A 4FNGA 4TQUS 4KE9A 4UOZA 4D8VA 4BLTA 1SK8A 1MO4A 2XWSA 2MJLA 4XAQA 1GU7A 2QL5A 3E5RA 1F2UB 1ICEA 1FFCA 2AOUA 4LDNA 5CBKA 3VU3A 1DWOA 1OXBB 4O2AA 4RZHA 4YK7A 3S81A 1QB7A 2VHJA 1PGQA 3P9YA 1AA9A 2AL7A 5L3QA 4HGQA 5AVQA 3KEMA 2FRVA 3ER8A 4OLAA 3IOBA 3QYJA 5I7HA 2XR1A 4LRUA 3GN1A 4TQAA 3ZXYA 3AIKA 4GRAA 1R2QA 2PXAA 3ND9A 1XZLA 2DCUA 3SM3A 4EX6A 4HPJB 1CQJB 2I78A 3W6UA 1C7ZA 5THXA 2WK1A 1CY4A 1KY5A 2VHCA 1YKFA 3I2KA 3IHWA 4FEGA 1SVOA 1ZS9A 3KE8A 4ME6A 2J31A 1MB3A 4TYQA 1J8QA 3K9WA 4PTYA 2MSEB 1RJWA 4AN0A 4PSUA 1ZITA 1WIWA 1EP9A 1TD9A 3NONA 1UXHA 1NJGA 1XD2A 1HI9A 2RI1A 1N2JA 3U60B 1I5RA 5GONF 4KQMA 3RO7A 1U2DC 4AW9A 2QP4A 1VCNA 4L16A 4LYYA 4Y6GB 4EPVA 3QU5A 3N8KA 4L0DA 5JQGB 1NE7A 1T4DA 2XB6A 1T0BA 1S2LA 3HDQA 1OB5A 5I7FA 3JQAB 5JYBA 5JSHA 1BE6A 4OUDB 2Q8PA 2VHQA 3QX7A 4FCWA 4FLEA 4IVQA 2V7XA 4ARUA 4D5EA 1P45A 3IJRA 4TSFA 1RLIA 1TMYA 3KQQA 4X90A 1H3EA 2M9MA 1TZJA 3OY7A 4HRXA 2QZ9A 4HWPA 5CX4A 3RUHA 1IOVA 3AL2A 4DV1B 2HF9A 3O1HB 3SDBA 1B23P 3TRFA 1XTSA 4H7DA 3K9NA 1JIJA 3MERA 3OPQA 3UWDA 4JB0A 4FONA 4NWIA 3RG8A 4O8ZA 2R6R1 3CBQA 2UYYA 1ISGA 5JI2E 4RVGA 5EJ5A 2P2CA 4WK4B 3A1VA 5FOQA 2RCYA 3UV3A 3VZRA 4NS4A 4ZV7A 4LE0A 1KJNA 2ZJZA 3HMKA 3T4EA 2H08A 5L3SA 1FX1A 2ZREA 4U7DA 2IZOA 4M1SA 2Q4EA 2IL1A 2ZTLA 1HNXB 1M1NA 4D6PA 2TRSB 3WZ2A 4BYGA 1T36B 1W4LA 3O92A 4PX3A 5K0EA 4M3NA 3GDWA 3IKLA 2GN8A 1IJBA 2XBLA 2IIVA 4FBMA 1F8XA 2IVZA 2R7LA 2NYAA 2V7UA 1R4NB 3DT9A 3N0XA 2ZUUA 4NU5A 4S0ZA 3GD7A 3BSWA 1M8JA 3K05A 1P2GA 3WGVA 4Q47A 5B37A 2R25B 4L0CA 1E3WB 1NGSA 1JKIA 4HB2A 4F8YA 5BPFA 4G0UA 2CNOA 2V7VA 4K26A 3TLGB 5D5PA 4EG7A 4F4JA 2ZM5A 1R8YA 1GKLA 4AQYB 1M2VB 3CRQA 4YJGA 3ZLJA 3JD2A 1A8UA 4PONA 1QYIA 3WKCA 1XEAA 4EI8A 1AZSC 3IV9A 3BJEA 2CUKA 1N3LA 3SPXA 1WLSA 3BZWA 1EZ1A 3WWOA 3IFSA 4KQKA 2DPYA 5DNWA 1ZH0A 4PO8A 2FZ4A 1RKXA 3BPSA 4NYMR 5K20A 4FGJA 4L5AA 4CLOA 2G7ZA 5EXTA 1MENA 4HBZA 3WGYA 3LDHA 4FTWA 3KQUA 3MRVA 2ILVA 4HI0E 3HU1A 4XVCA 3AF2A 2ZETA 3KSZO 4XA8A 5LA6A 1TIKA 4YUYA 3BK1A 1ETHA 2XB8A 3HA2A 3KZNA 4ND8B 2GCNA 5E7MA 4G2NA 1WB4A 2HCBA 2W2TA 4Y9SA 3ZIDA 1C1HA 3U6KA 3A2LA 2EW8A 3VPCA 4CE6A 1ABEA 3R9XA 1EEXB 1LNSA 2FSFA 4G8BA 3ICVA 3A7EA 1NDUA 1E9VA 4Q4JA 1A7JA 2X1LA 2CE7A 4LZJA 4ZQFA 4Y9UA 1EFRD 3O2NA 5F73A 3RCBA 2WW8A 4U63A 4OATA 4AMYA 3AR6A 1V1RA 2HDOA 4IGAA 1T24A 1XA4A 4MJXA 1D4ZA 1GPWB 3NNDA 3O8BA 5IEJA 4G5OA 5IVPA 2WVHA 2DM6A 5LOVA 1Z17A 1KEKA 1QCYA 3IQIX 1R9MA 5TR9A 4LWPA 1V7PC 5CR9A 2WJHA 3W6OA 4ZXPA 3QMMA 4RQAA 3I12A 5IJWA 1U0EA 2OBFA 2SBTA 4JCOA 2OXIA 3RHSA 2G4CA 2G8LA 4A6DA 1E9EA 4UNRA 4I5EA 3MWGA 1KVTA 1WWKA 1YU9A 3OQ6A 4JBWA 5CDFE 1PLJA 1ATIA 1UDBA 1KBZA 3M34A 3STWA 5IF3A 1HYBA 1QM5A 2P2ZA 1I51A 4EO4A 1K8RA 1ZHHA 4IX9A 1Y3CE 5CNIA 4F91B 1W1WA 2PZGA 3IQEA 3DBRB 2QQGA 4B32A 3DAPA 3RSCA 3C8HA 1JMYA 3QVGB 3IT3A 1ZJJA 4JOSA 3LPLA 3DLIA 1TCBA 3Q9LA 3SC3A 1J09A 2O05A 2QMUA 4RANA 1M6HA 5BQFA 3C5WP 2XYQA 4C4XA 4CYMA 4G4GA 3VYWA 5CBPB 2EKDA 4TKVA 1F3LA 2GK7A 2NO5A 3BXPA 3A3OA 5IC5A 4PYQA 5JAIA 1UDXA 1UBTS 2GILA 2CL6X 1W47A 3PYXA 4GGPA 1T29A 2C8LA 3H8WA 1YC5A 1QX4A 4MV4A 5KBYA 1X15A 3C98A 4V0NA 4XE5A 2XCUA 3AI1A 1QQ5A 3LRXA 2ECKA 2N75A 2FZKA 3AHGA 3NHKA 4XSVA 3D7LA 1S1CA 4KVZA 3D6AA 4QX6A 4DLYA 4H27A 2AA3A 5C37A 2ON6A 3G1TA 3TVYA 1UOOA 5JDCA 4EELA 2QBYB 4NULA 3RJZA 4I4TA 2FSGA 1JQJC 2H63A 3NRBA 4TWIA 5MFPA 4E2WA 2TMDA 3LF2A 5EJIA 3W8NA 4C04A 1P8AA 2WVGA 4JBGA 3RUDA 4OSPA 1T6XA 2QPTA 3PP8A 4RHYA 3RKRA 4BQQA 4INPA 1WZIA 1S7CA 4QJ4A 1B3RA 1E3LA 2G06A 1ABBA 2NVUA 2YN0A 5JVDA 2VSQA 4DDHA 1Y3DE 1RKVA 4QNNA 3OE4A 4M86A 3ZGYA 1SIUA 4MO2A 4IMRA 4LRYA 3W2IA 2J9XB 3IGFA 1GNRA 3KQNA 4XWAA 4ND8A 2MMCA 1J21A 4F2DA 1AV7A 2XVXA 1DQRA 2VRWA 5FF9A 5C5CA 5TLSA 4HGOA 2IH4A 3H2IA 4TV9F 3HXPA 1X7XA 1TU3A 2C2MA 5C35A 2YV3A 4BX0A 1ZCAA 2PZ8A 3ONWA 4G0ZA 2ISSD 4EGJA 2A7XA 4RH3A 3TI7A 2BDEA 4CLOB 2VJBA 4AM8A 4F5WA 1IEWA 3E3NA 4QEZA 3WL4A 2J9GA 3Q41A 3S7ZA 4D7AA 3FPHA 1VG9B 4FYIA 3IAUA 3MILA 1KEVA 1ZMRA 5G0SA 2GAOA 4MKZA 3G5UA 4YAEA 4PTLA 1UPAA 1OD6A 1FYXA 2WEKA 3FJYA 1C4OA 5LQJA 2O2GA 2IEYA 3RV3A 3W77A 3UAVA 3KJNA 4EKNB 1FLDA 2PRSA 4ITRC 4IIDA 2B78A 3A28A 4XYMA 1JR4A 1TO1E 2KBEA 5BUQA 1A2BA 3BB1A 2BP7B 4J0FA 5F77A 3SQMA 3O8QB 1N0VC 1Z0JA 4IHJB 3RVBA 3PD0A 3VKGA 2HV9A 4A6XA 3IQDB 3G0BA 3M4YA 4REMA 3MPUA 5K0NA 4HDNA 2JFGA 2FWMX 4RTOA 3H1TA 3B5IA 2O8BB 2VWHA 3DZFA 1IE3A 4AZ0B 2F59A 3KKEA 1WKCA 1QZUA 5H9VA 4A2PA 3WIEA 4R1UA 4N5NA 5DCUA 3DUWA 4BRUA 3KLNA 3D8UA 2YC4C 1FSPA 5C46F 1Z2EA 4NOKA 3JQ8B 1A72A 4GP9A 2PLFA 2JS7A 2TMYA 4KAJA 3IR6A 2HGSA 3AY6A 4X91A 4X54A 1FFDA 1E5TA 2R60A 3U7RA 3RUFA 1Q1NA 1LB1B 3K7EA 4R05A 2J3KA 5KI6A 4J29A 4PIVA 2QSYA 3GBPA 4J7UA 2FPPA 4M7RA 4CR6A 1JZSA 4CMKA 4IGIA 4QL3A 5AM2A 5AJZA 1ZI9A 3PT9A 2AOWA 2I65A 4O8CA 1DAFA 2I6XA 3EWSA 4MX8A 4OJMX 1I10A 4RK5A 5AVUA 3TF5A 2Q3MA 4UDXX 3BIJA 1QHHB 2I0FA 2RHWA 5KVSA 4QYSA 1DEHA 2RHRA 2H4FA 2ZUDA 3FNFA 4YN3A 3OCWA 1LBTA 3LT5A 4PCLA 4ZP1A 3PFHA 4EHAA 4WBNF 3E7FA 1GZ6A 2NXWA 1BMFD 2VCHA 2X6QA 1KDZA 3GAFA 4P3YA 5FTJA 3O6VA 1WJGA 4MVJM 2GJ4A 3F6BX 1IRIA 3NZEA 4HUTA 1I2ZA 2ZWPA 3QXGA 2O07A 4QPDA 4RMHA 4WFJA 3W8RA 3CH5A 2OD9A 5JC1A 1H42A 1E1YA 3OCVA 3PYLA 4NOJA 3SSOA 2V96A 2BDTA 1FE8A 2P9GA 3LCRA 4IVPA 5CPFA 4RA6A 1OH7A 1OAOC 4MRMA 2VDPB 5DIFA 1AGRA 3M5PA 5M3BA 2XB2A 4PHCA 2X5KO 1EAYA 3UCFA 2AT1A 3H7AA 5DXJA 3F74A 3PKZA 2GPSA 4IXDA 4YQZA 3B3QA 2ZRIA 5EKDA 4YP6A 5G1OA 5FFMA 2ONJA 4AJIA 1M1NB 4RNDB 3WYNA 4GECA 1X9HA 4HB0A 1N3BA 4COOA 2XMBA 5L3SB 4DQVA 1FQWA 4D9IA 1OI4A 2JNWA 2NQTA 4OKNA 1SVLA 2Y3IA 3RUEA 2BGWA 4BY9E 1BHQ1 2R48A 3JQGA 4UEKA 5DWDA 1ZGZA 3BD9A 4LQDA 2YWRA 2C59A 2QVLA 3KU1A 4MR8B 4WDQA 3ZE9A 3V3KA 1Z5WA 4DWOA 4MEAA 5LP6A 2FG5A 4CZ2A 4ZCTA 1PDVA 2ACVA 2PH7A 3EVTA 3LQFA 4B3DA 4ZYZA 1AKRA 2GLUA 3OZEA 4LXYA 2IE8A 4AO7A 1WKBA 5HF5A 3RTBA 2G6TA 3ZK8A 2OZLB 1XB2A 2GBCA 2A92A 4OXYA 3L6DA 4WOCA 4L85A 3B9QA 3E22B 1NLFA 3OFKA 3N76A 4D3YA 4ZVPA 4HVCA 1OB2A 3MMSA 2VJYA 1DRWA 1XMSA 1KQGA 1MC4A 1PFKA 3NH9A 4F2WA 2G0NA 2OAP1 1E20A 5BYKA 1E2BA 2ZBDA 1C9YA 1V5IA 4G24A 4KV9A 1U7TA 4B9EA 4FYVA 4IFEA 1NLZA 5AVWA 1MC5A 3GCDA 4Y1FA 4BFZA 2X2EA 3HZRA 3R2JA 1RI2A 5F64A 3L7BA 4BATA 5TMDA 1H1TA 3ZJ4A 5BSRA 4BLUA 5IHPA 2DFDA 2OORC 4YJKA 4G4SP 2NG1A 2GETA 2H6EA 2LCFA 2O8NA 3G17A 3SF8A 4I55F 4LOAA 3A6DA 3RT7A 4YCCA 1GTMA 2D5CA 1RRVA 3ILXA 2E1PA 2I4OA 3DUFB 1NR7A 1OIWA 2WYUA 3DDWA 4FDTA 4JVNA 4Z9XA 4EYEA 1Y42X 5NLLA 3I53A 4B80A 4E03A 5C4IA 1BS2A 3DMYA 4HPWA 4ETWA 1BN6A 3RTEA 3SSNA 3C8UA 3A9CA 3T0GA 3KHTA 4DC9A 5E2AA 5JI3E 4ON9A 4XGNA 1CXZA 4IDGA 4H18A 1YR7A 2JK0A 3HXTA 1CW2B 3HB5X 3IBCA 3L6BA 4LSZA 4RD6A 3ORQA 3EVGA 3GGPA 5DT9A 1QHIA 5DEOA 1QGOA 1XNHA 2G9UA 3PIRA 4R40A 2M6KA 4AL4A 4IIJA 1EBUA 5AFSA 5ARBA 2XMDA 3AOGA 1Z6QA 3DMDA 1YS1X 2ZW9A 4GLFA 3WLTA 5F7ZA 4RZIA 1H65A 1I4DD 1RQGA 4G0YA 1A04A 4XVHA 1UBCA 1SXJA 4U6SA 2PVPA 1VMIA 2ECFA 3CLKA 4XPIB 1HDZA 5U4QA 4DR3B 4TYWA 1ST3A 1ZEJA 2C4WA 3ODPA 3JW8A 2G07A 2B1IA 3AJ8A 2O2YA 3U49A 1O9GA 4BMXA 5J4LA 1IG0A 3FPEA 3ICPA 3UK6A 2N1MA 3Q12A 3GC6A 3REQA 4DCGA 1M2HA 4A2CA 5DHAA 1K06A 2CXHA 4JI1B 4PYJA 3QKWA 3QOFA 4GLJA 1EIWA 4C6TB 5F5XA 4KQXA 1W5TA 5HKOA 2QE6A 2VL7A 3KRTA 3KT6A 2Y93A 4B3JA 4QM6A 1Y48E 3FWPA 1TKRA 2ZSAA 1IZ9A 1VB3A 2NTNA 1DO0A 5IT5A 2C97A 4BMPB 5BUCA 6NULA 1I0IA 2RONA 1FVOA 1XEWY 3CF0A 4J1NA 4NCNA 4E70A 5K3OA 1ZI6A 3DDNA 3EODA 4P3XA 1XLTA 1E3WA 4FMCF 1O95A 2YUTA 4RS3A 4WKBA 4F72A 2X86A 3TMYA 4WZAB 1XNQB 3PJGA 2IYNA 4ZPXA 2J7KA 5CXXA 1N2GA 1VXOA 2ZUSA 3FWHA 3IMKA 1E5VA 4MV3A 4OFXA 5GPBA 3T9BA 1CDOA 5K5EA 3MJCA 4M87A 3ZU2A 4L5IA 4IGKA 4E5SA 5J2UB 2QAIA 2WTNA 1Q77A 2HU8A 5IK2A 5KOYA 1IK6A 4XTRA 1GQ2A 3HPRA 3K9LA 1UJ2A 2P3LA 3GV0A 1RWBA 3N6RA 1GUBA 2SCUA 3F8TA 3NCHA 2GLTA 1DZIA 3OPXA 1QONA 1S02A 3MT8A 3S2EA 4TLEA 3I4CA 2HMUA 3D8RA 5J4KA 2AN3A 2RIPA 3CB2A 2H3HA 1T2NA 1J22A 3M1LA 2E5LB 3N0RA 3H2SA 1NX6A 1SY7A 5DULA 4JKOA 3SHOA 1L7EA 4D3DA 4F3KA 2O59A 3DCIA 4ZV4A 1ZW1A 1H0KA 1C7EA 3CU5A 3FNHA 2QRLA 2Q3HA 4K9RA 5A4FS 2XA9A 4UQOA 2GBLA 1NJFA 1L4MA 3W9BA 4HDMB 2GM5A 4CTJA 5UKDA 5EUQB 3H9QA 3PPXA 2FDRA 1NE2A 1U2GA 3UGKA 3NMUF 3MMPA 1YRAA 1OX5A 2H4WA 4W8OA 5ADUS 2W2KB 2JEOA 1P3DA 1GZSA 4B46A 1OZ0A 1MJHA 3BC1A 1LCIA 1W0JD 4S24A 1H2ZA 2XUFA 3L7KA 2E85A 2H18A 3ROGA 3DSRA 4ER3A 3SVLA 2TYSB 2OQIA 1HPLA 4ZVLA 2Q6VA 1CUHA 1DEOA 2WG2A 3AZQA 4WZBA 5J58A 4YY3B 3R6LA 3TFWA 3MMNA 1PVDA 1Z0UA 5FPYA 3SIXA 3CPHA 5MHTA 2PV7A 2GHTA 4L8GA 1OI7A 3ES9A 4WV3A 2H1CA 1H9AA 1VA5A 2PWBA 4RM3A 2VH2A 4IIYA 1HFJA 4AY3A 2MSWA 4BFSA 5LN1A 4TL7A 4KPUB 1DX9A 3O4JA 1Z5GA 4ZALA 3HBJA 4ZQBA 4EY8A 1LVUA 3A2MA 4OJTA 5BNFA 1KY2A 4X7RA 4B75A 4NCBA 1KMNA 4FINA 1IJFA 1IVNA 2DKFA 2WSLA 4PPYA 4B33A 2RB4A 5DLYA 4QQKA 3RYCB 3FLBA 1WXXA 4DDWA 1T9CA 4HZUA 4KJXA 3F4LA 1Z56C 3E8SA 4R1QA 3NWEA 3FNIA 3OPYA 1SXPA 4QULA 3DH0A 4RW0A 4NMMA 2NPOA 3IC5A 3L9WA 4MKXA 5EIOA 3NTXA 1SUEA 3KQTA 2QMYA 1QORA 4FCTA 4HNUA 1CQXA 3HR7A 3MAGA 1NQ5A 2A59A 2NT4A 4IXNA 1FU7A 1HOXA 3C1AA 2JLRA 3V4VB 3U4QB 2ZJ8A 3DDOA 2XHZA 3NHPA 2BGGA 1Z29A 3L1HA 1SVIA 3JQEA 4IDHA 4DHWA 2JFHA 4JJZA 3WDLA 4O2AB 4YIKA 4KFTA 4ZT3A 1G9SA 1SNYA 2Z5VA 3KKQA 3NIBA 5DNYB 4AS2A 4P84A 2C3PA 1UADA 1C9MA 3LQQA 3H6HA 4XLLA 5A5DA 2BZ0A 3EIQA 2PMCA 3DMGA 2XUHA 4K9SA 3I0NA 3LPMA 4TS9A 2OBBA 1EFUA 4K9OA 2HKIA 2DH6A 3O95A 2YJ5A 1Z8HA 4AKIA 2OHIA 1BG6A 1YGPA 3FG9A 3EISA 1KOLA 2YMLA 4RH1A 2Z9DA 1MT3A 2BEWB 4US1R 2Z5GA 1F17A 1WSDA 1Z0SA 4JSYA 1ZCJA 1BRTA 2Y67A 3R7SA 1YB7A 5D1HA 1DQSA 4X61A 1B2RA 3JRNA 3AKZA 1R10A 5LMNB 4TTRA 1NN3A 2WIBA 4OY3A 1ZJ5A 1P61B 4S1PA 5KS2A 1V35A 4Y7CA 1YZVA 3DBHB 1T6BY 5HP4A 2C7QA 3LYAA 4H3SA 1CIPA 2JFUA 4OBBA 5AQEA 5L4SA 3U44B 1C3OA 5LA6F 3P9IA 4HMQA 3ROXA 5JS2A 3TMKA 1HNWB 5CK5A 3OO1A 5EIFA 3JARB 5HIMA 2HPVA 3FPGA 5AICA 3WNCA 4XJSA 3IT1A 4TM7A 4TLMB 3K1TA 1N6KA 1ZD1A 5CD9A 1AS2A 5CDSA 1EE9A 1M2FA 4D25A 1IM8A 1U2ZA 4LZNA 1ZXXA 1UKBA 3VSBA 1E2HA 1FRZA 5GOZA 4AIIA 1MJFA 5GADl 4HB4A 4BNGA 2YXBA 1QS0A 1WNTA 1UMCB 4Q7KA 1AUVA 1CS0A 4Q4HB 4KBGA 1EG7A 1E8DA 1KOJA 2F1KA 4HP8A 1O03A 4R1SA 1F1JA 4ZRDA 4WEQA 2C9YA 4BO0A 3OFSA 4UMEA 4BQEA 4EI7A 1FJGB 1W2GA 1PR4A 3M4XA 4Y2YA 3QEBZ 2BWJA 4MI9A 2Y71A 2DUUA 2PPLA 1M74A 2FV8A 1IB0A 3IB6A 3Q1KA 5JV5A 1Z68A 2GN0A 4YALA 1ZH6A 1G9TA 3T1NA 4M0LA 2FE4A 3W5JA 2VSNA 4ALKA 4WVFA 2ZT5A 2VP2A 4QTTB 4IR7A 1G16A 2YIVX 2ZSIA 4R1PA 5EE3A 2C2YA 1AK9A 2YWEA 1IHXA 3EFOB 1BX1A 1S2OA 2V8BA 2GRJA 2EJWA 2R5WA 2GCOB 2WYOA 5HE8A 1YO6A 3ZR4B 3ZHSA 4DV6B 2GTIA 2FOIA 4KMMA 4E12A 1JDBB 5HILA 3H3JA 4X64B 4ARBA 4Z49A 3EIEA 4MRPA 5JSQA 4YRQA 3PHJA 3BE4A 1QLJA 2YWJA 4DFDA 3ZQ4A 2JIOA 4S1TA 2WI8A 3L7OA 3TD6A 3RRYA 4DBZA 3F97A 4TMFA 1N33B 3VR4D 3U7JA 4FFDA 2F55A 2ECQA 5B4TA 1T9GR 2B1RA 1EWTA 2OFOA 1B8PA 2ACKA 2C5EA 2QVZX 3BD6A 3GAMA 3HKBB 1KK0A 3GNTA 3I2JA 1UKVY 3Q6IA 4GEKA 2AUMA 4M49A 3RQSA 3T3HA 4ZK2A 3EJWA 5H5JA 2FX5A 1D3AA 1NA5A 4M6WB 4CW7A 1GLGA 2RGBA 1N0UA 5BN3A 4Y0NA 4B0OA 3CH4B 3DGEC 1E59A 2LBPA 4LZAA 2GAFA 1EXNA 2ZJYA 3RVKA 1CUZA 1LTHR 2VQSA 3EXIA 4NS1A 4OQFA 5DK6A 4BLWA 3EGVA 2ZB4A 3SM9A 3GN2A 5LQKA 5AJYA 4DUGD 1S89A 2PWPA 4HSEA 2ZAOA 4D41A 1YK1A 3EIFA 4XKJA 1DIOB 4AF8A 4HFMA 2CLDX 2Z6QA 3EK2A 2PGIA 3AG6A 3CSSA 4RULA 1H9CA 3IBFA 1H2XA 2OQ2A 4XFKA 3BRCA 3LJKA 4FE4A 3GYBA 4M0PA 3L18A 4ZYTA 1LDMA 3ETHA 1I80A 3ENWA 3FCAA 4LCJA 5B1DA 2DXIA 1Z28A 1BDBA 1GPKA 4QGBA 3I5AA 3KDAA 5AW4A 3MTDA 2AOXA 4JI4B 2PX5A 5A5VA 2JBAB 4CG0A 1M10A 4PPNA 3EARA 4AP5A 1QQTA 4FJ2A 3ZDFA 4MVJI 4BWFB 1CY7A 3H05A 4TL8A 5MN4A 1KP2A 1BKSB 3O7MA 3KD3A 2HX1A 3HJCA 3RR2A 3DLHA 1E6EA 3VR2D 3IEKA 3TWOA 1QYDA 3NWPA 4HD8A 1F3OA 1LUAA 4OHMA 2WU0A 1W52X 4IAOA 2EC5A 2D6FA 3IPXA 2FQXA 2JJMA 3P2KA 4QAQA 1C9KA 1NI4B 3F1KA 4PWZA 1UFQA 4L8YA 4MW5A 4OLBA 2A35A 1TU0A 1V5FA 1VMAA 3AK4A 1QOQB 3C5CA 5JD3A 1CYEA 4NCIA 1PZFA 2BEVB 5JBIA 3QPCA 3B1ZA 3RGGA 2ZUVA 2ODNA 1JXQA 1YZHA 4QSMA 1GGMA 2P9FA 4D6YA 3C3JA 1EM8A 3PC4A 3DBHA 3VC7A 1SBNE 2W2VA 4H1WA 4JVOA 1M34E 3LUPA 3QOYA 3LUKA 2A58A 4JI3B 1EVEA 3HPQA 3TRJA 1RCTE 4GOJA 3SY8A 2WSYB 3ZWWA 2G5GX 2PH5A 1IIBA 4FWIB 4HEJA 4KLNA 3EMDA 4H6XA 4AAYA 1F0KA 6Q21A 3DYVA 1E5DA 1MW9X 2WG0A 2B1GA 3L02A 1M2KA 2I1QA 1TC2A 4KC0A 1DDGA 1ULAA 5G3ZA 4C0BA 1DAEA 5DGCA 4W5WA 5EE5B 1FDOA 1L7XA 3KEFA 1YKGA 1UK9A 2D4AA 3KZOA 3DQQA 4O3FA 3PC6A 4C43A 1F14A 4FS8A 3VR6D 2PL9A 4RV4A 1UJ6A 1W76A 1KDVA 2PHZA 1OGJA 2POCA 3FMOB 1SK9A 3FVQA 3H18A 1MX9A 4DLZA 3L7YA 1KYZA 3PQ6A 4P5EA 5F1KA 4DQXA 1GG5A 3S8YA 3UK7A 1PWXA 2XNKA 2ZYSA 1ULZA 3OX2A 3DT6A 4W8GA 4AICA 4D0LB 5JBQA 3OCJA 2KI5A 3HVKA 1AZWA 1GUAA 3UOGA 1N7IA 3GD5A 4OMDA 3B2QA 1XQVA 1I9GA 4N5DA 5F4BA 3FR8A 3QXSA 3RU7A 2FETA 5FBVB 2GPAA 3RAJA 3FOZA 4HCJA 1DAOA 7YASA 3O31A 1RLUA 2YWXA 4KO2S 3AVOA 5KVVA 1I8TA 2GBGA 2VTBA 2YJZA 4CM1A 1RBMA 1PJRA 2XDAA 5C5IA 1JFTA 1TM2A 2X9NA 1H4SA 1U2TA 2XRFA 2XRYA 3N9IA 3SQNA 1IWBB 1D1TA 4C88A 1ICIA 3K2IA 1E2DA 2FP3A 2SCUB 2ZVDA 2GBIA 1ACMA 5DYGA 1O57A 1P80A 2OCAA 3DVQX 1FLAA 5LB2A 3BX1A 2HXSA 2PO5A 5BSTA 3IDSA 4TTSA 2ASEA 2B8TA 1NW4A 3GH1A 4DEVA 5KCZA 1NQVA 1QC5B 5E3JA 5DCYA 1JLLA 3CKLA 3CNEA 1N32B 1EWRA 2FMKA 4FMBB 1PDOA 1TCCA 3OEYA 2DLCX 5A7GA 3QUAA 2H5LA 2R3SA 1WD7A 4HN2A 5JAQA 1UC8A 1Y8CA 5FJIA 1DC7A 5JCOC 4M1TA 3MELA 4JZKA 4QU9A 2C57A 2HPHA 1EWVA 2W2QA 2C61A 2KJQA 1Y82A 1MEOA 3FYUA 4KKVA 2YYAA 5KYKA 5AM0A 3V2IA 1W36D 3CRW1 1C4KA 3F3KA 1EVZA 2XNDA 1TTTA 1JI0A 1M6WA 4AJ4A 1GRQA 1W93A 5K3CA 4E07A 2ODPA 2IELA 1YZYA 3PZRA 1C29B 2JFPA 4KK4A 2FZVA 1USKA 3N59A 2O48X 3D1VA 2GARA 2O3UA 3SVTA 5AUQA 3OEHD 3DEFA 1B1AA 3AP2A 1QV6A 4QUIA 5TDHA 4CV1A 3UJNA 1THMA 1BXZA 1DTWA 5DP2A 4ZGBA 2NVWA 2OK8A 5KTOA 3X1JA 2PUEA 2EFHB 5K99A 4UU0A 3KQHA 2Q3LA 3L8FA 1FVFA 1ZBDA 1Z06A 2BKVA 3MG9A 1REQA 4QFMA 4WLEA 4BWVA 4CV0A 4MVWA 4ZC8A 1NPYA 2FPWA 4JVSB 1A77A 5ITVA 2ZUCA 2YWFA 3AFHA 5AKZA 7GPBA 1I7SB 1JE1A 3ZS9A 1PGNA 1A69A 4M37A 3AHCA 5FOTA 3BKWA 3O5AA 5FWXA 4RV5A 2HFKA 1CZNA 1SHKA 4P4NA 3RVLA 4EUNA 4F96A 1Q0PA 4AJHA 3ECSA 4QNRA 1VKZA 2Y1WA 3PC7A 4B4WA 1YVUA 4AY5A 4CF3A 5JOQA 3LUGA 1TM1E 3PGMA 4OXNA 3W5UA 4LF7B 4MA0A 3NIDB 3LV8A 3EAQA 2HPZA 3GK3A 1KH2A 4LJLA 5T57A 1PE0A 3OLXA 2QU8A 3KYDB 4YRPA 5DNAA 5AW3A 3HUDA 4HZIA 5HCUA 2RGWA 2WTMA 5EJ7A 2XMCA 4BX8A 2BBOA 3ZDCA 2HHJA 3ABZA 4F5YA 1UM8A 5HIKA 2WYIA 2XZOA 3T12A 2IGTA 2WNIA 1QE3A 4K6CA 4IIHA 2IU4A 5TQ0B 2EX4A 3LCUA 5A03A 3IRUA 2QD3A 5T7BA 3U56A 1JKXA 2NXEA 1V8DA 5CT6A 1EX9A 3AGPA 1JILA 3RWMB 4E51A 3DC2A 2XXAA 1RBZA 4ZVOA 4HTAA 1AB6A 3NTLA 3T5PA 3EZ6A 5F23A 3RABA 1R74A 1XCGB 1OC4A 4RGQA 1AX9A 5JWOA 3EPKA 3OPMA 3GBSA 2I1WA 3Q98A 2DFLA 5SZIA 2NVUB 4C2UA 1NY5A 4NARA 2OZLA 1K0FA 4UZSA 4W9NA 5AIAA 5AW8A 5ADHA 3BT7A 4G8CA 1W88B 2IKSA 1ESDA 3P2JA 4S04A 1XZQA 2ZATA 5C8VA 4TYMA 3ISTA 2P62A 4RFSA 4H59A 5DSTA 2WJ4A 3FBTA 2JH3A 1NXOA 3AUTA 1MUUA 2FSVA 2P6OA 3VNRA 3UMGA 4EOGA 4I4TB 4Y98A 4YR7A 3UFXB 3CVOA 5AJTA 1C8KA 4GWKA 3MHTA 5LQDA 1WXEA 3K0CC 2F8LA 1OXUA 3I1JA 4YDHB 4AWBA 1R15A 3P2MA 3ZQ6A 5BMOA 4JD5A 5ALJA 2FX3A 5JADA 3H4TA 3C3KA 2EKBA 2DB3A 3LP5A 1ZC4A 5TEWA 3Q0TA 5B7NA 3QKSA 3SLGA 1KAQA 2PSDA 3B1KA 3L41A 1ESZA 4X93A 5AO9A 1BCSA 4X7PA 3S7TA 5JCJD 5TMPA 1EVKA 3DZKA 2XXAB 1F9AA 1BVRA 5FI5A 4QLOA 2O3JA 4A26A 4C3OB 2VJKA 4YCMA 2O6HA 2PYZA 3TH5A 1J1UA 2HWYA 4A6EA 2OV1A 1A8HA 1QJ4A 4K28A 4YLGA 4L50A 5IWAB 2GWRA 2R6GA 2B5OA 3SN6A 3GUHA 1U02A 3E22A 3M5CA 4I66A 1U7WA 1CG6A 3M3PA 4D43A 2D7JA 5CHYA 5CT5A 2HLNA 4UFNA 3I62A 1RVV1 3FYSA 3I05A 3NDPA 4QHTA 4N8EA 4KXMA 3PE6A 1D2CA 5EJMA 3WP0A 2BZ1A