1XTVA

Sulfolobus solfataricus uracil phosphoribosyltransferase with uridine 5'-monophosphate (ump) bound to half of the subunits
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable uracil phosphoribosyltransferase
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtvA00
1XZNA 1DBRA 3DAHA 4LZNA 1W30A 4OHCA 3OZGA 3QW4B 2AEEA 4P80A 4RHUA 4P83A 1DKUA 2EHJA 4LYGA 2JI4A 3GGJA 5IPFA 1VCHA 1A97A 1CJBA 3GGCA 4PFQA 2PRYA 2VFAA 4S2UA 1O5OA 1TC2A 4Z1OA 1NULA 1A98A 4ZFNA 2C4KA 2E55A 4M0UA 1QK4A 1ECBA 1Y0BA 1Z7GA 1UPUA 5BRNA 5BQPA 1VSTA 5JSQA 3OZFA 4PAWA 1U9ZA 1JLRA 1XZ8A 1GPH1 2HCRA 3M3HA 4X45A 1UPFA 1A4XA 1HGXA 4P81A 1D6NA 4QRIA 4WN3A 5JV5A 4MB6A 4QYIA 1QCCA 2H08A 5EUCA 3S5JA 1XTTA 4RAOA 5KAMA 4JLSA 3ACCA 1G9TA 4RADA 5ESWA 5HIAA 4P86A 1YFZA 1IBSA 3NAGA 1MZVA 1O57A 1OREA 1DQNA 1P18A 3HVUA 3LRTA 4RQAA 1ECGA 3ACBA 3H83A 4RV4A 5HKLA 1TC1A 5ESXA 5BQOA 3DMPA 5KAPA 1L1RA 1DKRA 2DY0A 3OHPA 1I0IA 4IJQA 1NONA 2XBUA 3DEZA 1P4AA 1I5EA 3KB8A 4JITA 4RHYA 3LPNA 1I13A 1V9SA 2GEBA 1I0LA 4P84A 2YZKA 3N2LA 5E38A 2PS1A 1P17A 1DQPA 1ECJA 1XTVA 1G2QA 1GRVA 1U9YA 1ZN8A 4TWBA 1P19A 4LZAA 4LZOA 1ZN9A 1QK3A 5IAOA 4RHTA 4F8EA 1A96A 2IGBA 4KN6A 2PRZA 1QB7A 1UFRA 4FYMA 4RACA 1VDMA 1A95A 1BZYA 1A3CA 1R3UA 2FXVA 3G6WA 4M0KA 2H06A 1I14A 1XTUA 3MBIA 1BD4A 2H07A 1LH0A 1PZMA 2WNSA 3MJDA 3O7MA 4RQBA 1QCDA 3GEPA 1AO0A 5BSKA 1BD3A 4RANA 1QK5A 1OPRA 1OROA 4WMLA 1ZN7A 1WD5A 4LYYA 4X44A 4P3KA 5K51A 1ECCA 4QYIB 4RABA 1L1QA 1ECFA 1JLSA 4M0PA 4RHXA 1J7JA 4RAQA 4P82A 1FSGA 1G9SA 2P1ZA 1STOA 1HMPA 3ACDA 1G2PA 2JKZA 2JKYA 1QB8A 3EFHA 2JBHA
chains in the Genus database with same CATH superfamily
2Q49A 3W5SA 4DRZA 3GZNA 4EG0A 1E9EA 1P6XA 3G2PA 2EW8A 1RWNA 3HGQA 5LZ8A 2H16A 4WT7A 2R1TA 1R15A 3D3EA 2YVAA 4L3OA 3RBVA 3ZWKA 4BNLA 2A78A 3C24A 5EJIA 5BWMA 1C0EA 3T4UA 4R71A 1UAAA 2J0EA 3GMTA 3LFTA 4RQTA 5HFAA 1XJCA 3VV3A 4PFKA 1ONNA 3H6HA 3RIYA 2ZYHA 2ZB4A 4IH4A 2E82A 3E8SA 3A04A 5EYPB 1JPJA 1KYXA 1QK4A 3GYBA 1KZGB 4EJMA 1Q3KA 2MSWA 1UP4A 2JFZA 5BRNA 2V6MA 3C43A 4DLRA 2IU6A 2JH3A 2P3QA 3IO3A 3JASB 1Q0HA 5BR7A 4CDRA 2G0TA 1IB6A 4Q3BA 3KQMA 1I10A 2NUTB 1VG8A 3ER6A 4GLLA 4HJRA 2HWYA 2IEGA 2R7KA 2OCYC 1YRYE 3AIKA 5D6OA 1C81A 3MGBA 3VR1A 1P61B 2BTOA 2UUBB 1MABA 4ND3A 3AZPA 5JTTA 3UMYA 4RAOA 5B1IA 1WUIS 4F04A 4YP1A 2QR2A 3HU5A 5UKDA 2C98A 3RRNA 2PXXA 1VE7A 4PRLA 2CNLA 3DXFA 3C8HA 1MX9A 2ZAMA 3HJNA 1DKQA 2PGLA 1E5QA 2R00A 2NSLA 4U7HA 2FDRA 1ZM9A 3OJEA 3EGEA 1AKWA 4RD0A 5LU8A 1FFWA 4HAYA 3H05A 4Q1BA 3ROZA 2O0LA 3KHUA 4R2JA 1HDZA 3N3BC 3O93A 4R8MA 5F23A 1CNFA 3F8SA 2BFOA 2FK8A 1R9MA 1N0VC 2C7GA 2J33A 2W48A 2PLFA 4FHDA 4EFMA 3SHTA 3AY7A 5LQUA 4RMIA 1Q14A 4RTSA 2GAFA 3L4KA 3DE1X 4ND7A 4Q1AA 2NLOA 1SC3A 1MB2A 1ZK4A 5J5AA 1XIVA 2OLKA 4ZT5A 4CDMA 4OU4A 5DNEA 2HI0A 4F8YA 1CNEA 2F48A 4FS8A 2ZWMA 4XPZA 4JLJA 5AHKA 4CTJA 4Y6PA 3BH6A 3D4LA 3BTUA 3I1IA 3IMCA 4QDZA 2FZKA 2YWDA 4OO3A 1TKBA 3LPCA 5LOVF 3DOOA 4C06A 2O50A 5IAOA 4E5VA 2FKAA 2FFRA 4RH1A 1VKRA 1N7HA 3KKKA 4I55B 3GLKA 3G7SA 4MVJF 3AO0B 3HKCA 5F51A 1XFAA 5IJZA 4KXXA 1CUVA 3R5XA 5EMJA 1A8SA 5HKKD 3ZJUA 4MPTA 1L5ZA 1NQWA 5PNTA 1BGVA 2ENUA 4GF5A 3UHFA 4YUWA 4ZYLA 2QV7A 5MN6A 1CZLA 4IXDA 1HDRA 2J4DA 4YRDA 5H16A 4CCYB 1JHOA 2HB6A 4W7IA 3AZOA 2Q1YA 3KKOA 4MLDA 2AWNA 3VNQA 3LBIA 3QV2A 3NC4A 4JBGA 3ZGOA 3A9UA 2VDRB 3LD9A 3QUSA 5HCIA 4H6PA 4BMCA 5HQTA 1T5TA 2NW6A 4DB2A 3O21A 3L46A 3KE8A 2BFBB 5A4IS 4JJ8A 4OXKA 1GRQA 1JWAB 2VK4A 4HFMA 4URYR 1XDWA 2AN9A 4WCFA 4WZAE 4AKGA 3CH7A 4U0KA 4RIIA 1HRKA 3GJ6A 4P7KA 2F43A 4OHRA 1WCV1 3WP1B 4KZKA 3IPCA 3O83A 4YROA 4UOZA 2P67A 1BN7A 1PW7A 3PQ5A 2I2FA 2QSYA 5LA6B 5LQAA 3PR3A 4KNVA 2OA0A 2IU3A 4K7JA 2H7VA 3O2NA 4H35A 3ZDAA 4AY4A 4RKWA 1UMBB 3DV0B 4LWPA 1RRGA 1W30A 2JL1A 2V4UA 3IAM6 4OA5A 4X1OA 5EKSA 4QOEA 4WNIA 2VWGA 5U9CA 1Y1KE 3IR6A 3GLFE 4FEEA 2AJCA 1DKUA 2P2NA 1SC9A 5IG2A 1MZPA 1P1JA 2WAOA 4G8JA 1EXMA 2A92A 1GQQA 3IELA 2LXNA 4NQRA 3E7DA 3FD8A 4UPVA 3D4IA 4WCVA 4IKPA 1MO4A 5G4KA 1L5KA 1N9ZA 1RE0A 1E60A 3D0KA 1T8TA 3EZYA 4FNMA 2FCRA 1QRUA 1HE8B 2AJLI 3HMKA 2FUG6 5HILA 2PA3A 3L7CA 3JD1A 1E9BA 3SOZA 4FGKA 4X84A 3ZZNA 3IX7A 2Z8XA 3DYBA 1LFDB 1SIOA 1KOLA 3R9KA 1NXWA 1IZ0A 1LK5A 3U2QA 4F92B 5BOVA 2Q99A 2V1UA 5E0KB 3O92A 1UPXA 1QVZA 4B5KA 1XEWY 1MORA 3MMZA 1K4KA 2I3GA 2IOHA 2OGSA 1OFTA 2WWXA 2XB8A 4CR6A 4E2XA 5KPJA 4Q02A 5C9ZA 1KHHA 3P96A 2IEZA 1YQDA 4LA4A 5TNXA 4PSVA 1XCGB 5AM1A 3VZCA 4WH0A 3RO7A 4HEHA 3WB9A 2O8FB 1N8SA 1ABEA 2JPDA 4MCIA 4UPDA 2GVZC 5IJ9A 2JIDA 1OT5A 4M49A 4RC9A 1WUJS 4NYMQ 5LP6F 2WVJA 3L6EA 4ZHSA 3BWMA 4RE6A 1BKDR 2E0IA 3UJ7A 1AQYA 4YRPA 1AKQA 5BUSA 1ECGA 2X1VA 3MFQA 5FTMA 1DXYA 2F1OA 4DE5A 3WL7A 1IVSA 4J0KA 3A0RB 3EPPA 3O8QB 2BGTA 2WJVA 1R6DA 3PA8A 1GNTA 3G49A 1R4NA 3IJRA 4UM8B 5F7XA 3KZ1E 1C0IA 4Y6RA 1VIVA 3TQFA 3TEFA 5E4JA 4DCNA 2I3DA 4XSGA 4JI8B 1I1OA 1CQIB 1OWNA 3R0VA 1X8LA 1L3CA 1JVSA 1NQTA 2ZVQX 4A0FA 1OFUA 4YMSA 1FUYB 2YINC 2CFRA 1P7PA 3VHRA 2XCOA 4LUCA 4PPGA 3DMTA 3V3KA 5KTRA 2X5JO 4XVRA 2OCPA 3X2FA 3BH7A 2HK6A 4IJUA 5AKHA 2XD4A 4Y67A 1QIFA 5HGXA 1VP9A 1W4CA 2JFWA 1DQYA 1VLHA 2PD4A 4JJ6A 4KACA 3H9EO 2QL7A 4WRRA 3H65A 3FDJA 3SMQA 1SG9A 5EKXA 4AXXA 1Y1SA 1V1MA 1Z8FA 13PKA 4KB5A 1CUGA 1JX6A 1ZHFA 4FEAA 3NUGA 3EIWA 3Q85A 1HEUA 5C4GB 4JI5B 4DRYA 3O91A 3UTDA 2JI6A 4A8HA 2ZIVB 1SCIA 2PZFA 5JCJD 5DM4A 3IFSA 4XB6B 1EBFA 2W43A 4L8LA 1N6PA 3USES 4RYDA 3FMOB 5D3KA 3T9FA 3UAVA 2OXRA 5CX1A 3DNFA 5DWDA 1XLVA 4GGMX 5LUAA 1JQJC 1I24A 3B1XA 2A9OA 4XEUA 3U3RA 3ONWA 4RGVA 2I2CA 1JE1A 2AQ8A 1LSUA 1MF7A 2O0HA 4BV2A 5ER9A 3K6SA 4PPQA 1YS6A 1RXSA 2WC1A 4QATA 3HWSA 1MIOB 2V5UA 1C9JA 1INLA 3DD5A 2NACA 2QOEA 2W0SA 1LDMA 1TTTA 1MV5A 3ENKA 1U7OA 1NUHA 3WLTA 1IN1A 1GVNB 3AUFA 3L0BA 3GQBA 3K72B 2J3MA 3LWBA 4CF5A 4DTCA 3BCUA 1MO2A 3Q8WA 4TKZA 4NZZA 4XOUA 4F6RA 3CEAA 1E7QA 4FX2A 4C9BA 5HCNA 2VXOA 2HSZA 4GEGA 3IOCA 2GZ2A 3TBFA 4H7JA 4XYGA 3AF6A 5TJ9A 1FJGB 3OZBA 4YTEA 1NFQA 4DV0B 5BVGB 3DB1A 2HJ9A 4C0XA 2ZYWX 5FI0B 1M6VB 1E2FA 1NBHA 2VSQA 1E5VA 1N5JA 4FZ3A 5C81A 4WL0A 1PR2A 4K28A 4G9BA 3MRTA 1T8WA 3QH4A 1HPLA 3F96A 4JYZA 2GBIA 4FBGA 4E1BA 2R48A 1EG2A 5C52B 1CJTC 1CS4C 2X9GA 4Q1FA 5FQOA 4N03A 3VXKA 4LJ6A 1Y4DE 3T5AA 1VKJA 2XGGA 2PCJA 3GVPA 1ZGCA 3VUFA 2JBWA 2HM7A 2QW1A 1ZQ9A 3DL7A 5A5GA 1VCNA 4URZR 3FWHA 2OCDA 2Q3LA 2QVZX 2P4QA 2ZIUB 3PJDA 4RH0A 5EVCA 3EVEA 4KQIA 3UB2A 3HDVA 4TYNA 1TDJA 3FYHA 1GV0A 3A6LA 4B2IA 3LF1A 4KFSA 1R1DA 1SOMA 1M6EX 1LW6E 1XRLA 1VE9A 1VLJA 2VPIA 3DM9B 1QU3A 2C4NA 1JG3A 1QANA 1XWFA 2XNHA 1AC5A 1OTYA 1BW9A 2IU0A 5DBOA 5JPCA 1B73A 4QXOA 1F7VA 2HA3A 2J3IA 2J8ZA 2ZEJA 5AK5A 2X7JA 3KEMA 2PXAA 4JVOA 1YDWA 4Q37A 1JEEA 4CG0A 1E7WA 4JLDA 3KPUA 1UPAA 4QXPA 4DQ0A 1U1FA 4J1TC 3IMEA 4P3NA 2JJ8A 4YIKA 1LI4A 3FCEA 4I6GA 3ZD9A 2VJOA 4BFZA 4J0CA 3G1TA 3FPEA 3WIOA 2P2ZA 3CUSA 1H6BA 2YV3A 3J7AC 4JSTA 1SOWA 5K3EA 4CQMD 2BHLA 3FYTA 4K9KA 4OQYA 2R0QC 3MD0A 2Q5QA 3HDHA 4URFA 3W06A 1ENOA 3C3YA 3EB9A 4RDHA 1PZNA 5FI3A 2VK8A 3K0CA 3DVSX 3JYLA 1JR3A 4DMLA 2B36A 2G72A 3PDWA 3V4VB 1D7AA 3IBCA 4A73A 1OU4A 1PEYA 3JVEA 4AJEA 2WT9A 1TCAA 5A4KA 4JMPA 3EZ7A 3C1AA 1WMSA 4B83A 1FSSA 1O2DA 1LH0A 3V8VA 5KKCA 4QFDA 1FNSA 1F9AA 1P7CA 3G0CA 3Q5EA 4GBJA 2FJUA 2XW6A 4H7HA 3OZRA 5EWJA 4FB5A 4F2PA 2IP1A 3LCUA 1W0JA 3NM4A 4X24A 2FWJA 3AR5A 3I2YX 5KJCA 2JGEA 4RTQA 10MHA 4WV3A 1V2HE 3L1HA 3QXCA 3ZQ4A 5AESA 5BVHA 2QVCA 2DXIA 1F3LA 1LNZA 2MR5A 1GZ5A 1BHQ1 1V41E 1C3JA 3ZC3A 1L7NA 1VC2A 3H5IA 1Y3IA 1YL7A 3AKYA 4P3XA 4UBIA 5K01A 1PNRA 4LEIA 3T7CA 5HWSA 3TVDA 5DSTA 4NL4H 2BYTA 2NZUG 4KMRA 1Z7BA 3VNAA 3I5YA 1P73A 3QBJA 4P5DA 4CF6A 1TD1A 3CC8A 5K0SA 1UP7A 4LJ9A 3BB4A 3CF2A 4A8TA 2JHFA 1I5RA 1YFKA 2TMKA 3RHTA 3RFUA 5B12A 2WTBA 1DBQA 3HYNA 4DUGA 4ALKA 4GKBA 5BW4A 2UXCB 1BA2A 1XRRA 3R5FA 1GUAA 2C5BA 1BU8A 1IY8A 3EQ9A 3H9BA 1RWVA 4FXOA 4KBYA 4U02A 4C04A 3GWGA 4LPSA 3MCWA 3WAKA 1IBCA 3CF4A 3RQIA 5MFPA 1CR1A 4IM7A 1KZ6A 1X9IA 3C3CA 1O5OA 3CN7A 1CETA 1KQOA 4B5LA 5TE9A 1PSDA 4JBLA 2NZ2A 2R6DA 3UYKA 4RZQA 1MXHA 2H7XA 4DRXB 4R1NA 1G55A 5BR8B 3BK1A 3TW8B 2NTJA 3LUDA 2RKWA 4EX7A 2QT1A 2VA8A 4ZZ0A 2D00A 1E2GA 1L5YA 1NBOA 1K66A 2YCLA 1URPA 1C50A 1PI3A 2HDHA 3OPXA 1RDFA 2V54A 1UBLS 2WWGA 3SZMA 1JIUA 4QELA 3ICCA 4RGYA 3WLSA 1ZJWA 2QM7A 2JFQA 3ZOZA 5A3RA 3JQBA 2VF7A 1VSUA 2V6IA 3D8TA 1DJMA 5E7MA 4FK8A 1JN0A 1SU8A 1JFFB 2Y9MB 3AEKB 3HKEA 4HJXA 5IDYA 1RJGA 3L9XA 3HXLA 3G8YA 4L73A 3OPYI 3OIVA 4N0QA 4Z8YA 1ABBA 4NATA 4CIAA 3QVGB 4K1LA 4YRZA 1AZTA 1U80A 4R9VA 4KPEC 4FE7A 4ZI7B 1HWYA 1I7NA 3H19A 3OOWA 3UHOA 3UVEA 3W04A 4LQ4A 2RB4A 4IVQA 4MR9A 4A5SA 5IX8A 1GCUA 4YDHB 3I6YA 4IUYA 4DMRA 2FHSA 3EWAA 4G2NA 3RG8A 4ENSA 1M6YA 1G8FA 4MKIA 2HN9A 5KNDH 5AJHA 1JNXX 3HP4A 1G7TA 5K0NA 2C8JA 1KGSA 3G82C 4LNHA 1IY0A 5CT4A 2JNWA 1GT6A 4YASA 4AZ0B 2WKWA 4MUIA 3IODA 3WHLA 3UJPA 1XLWA 2FOIA 3QZUA 2YN2A 1T5OA 3VU8A 3WK8A 1AMNA 1TCBA 1GUYA 2IXDA 2IUFA 1Z8HA 2P2YA 1THGA 2VT7A 3HR7A 3I83A 4MRPA 4NJEA 1AMOA 4FYHA 4U7DA 2FXVA 5FOWA 1W52X 2D3WA 5D01A 5E8JA 3T5GA 1V5WA 4C4AA 3D5QA 1EGVB 2X4LA 1BOFA 3FXAA 2H07A 4Q4LA 4B32A 3I37X 1NJGA 2B2NA 3IBFA 4GKAA 3DAGA 4CEIA 5KYWA 3SNKA 3T5BA 3QVLA 1NVMB 2Y1KA 4M53A 2BBTA 1R0BA 3JZAA 4J29A 1IE3A 1CDZA 1P9LA 1AIPA 1F8UA 2ZOSA 4GXNA 1ZJ5A 4L0CA 3KOOA 5I7EA 1EVLA 4JN6B 2XUKA 4RK1A 3MQ4A 3MSXA 3I04M 4A8JB 1M5TA 2WHEA 4YAJA 2G8LA 1S96A 1VLLA 3U16A 1P0MA 5TS2A 3IAAA 5JDIA 2I4OA 4P7JA 2C2WA 1K6JA 1PV1A 1CUFA 1QO0D 2RK3A 2X1HA 2AE1A 1DEXA 2YY6A 5DGCA 4MO2A 4MRMA 2YRXA 1EIWA 1BMQA 1LDNA 3GJSA 3RSFA 4L2IA 4REQB 3TQRA 1RHRA 5I8PA 2CV0A 3SQOA 1M0WA 2RGAA 2FPOA 1N1DA 2YVKA 1QUFA 1PLJA 1PG5A 5EZYF 4EO9A 1FMJA 3NUQA 5IN5A 2O7RA 1GZ4A 4XA8A 4R9RA 4GICA 4TVKA 1V3QE 3TB6A 2D5AA 5I9LA 1Y8ZA 5A0TA 1RFLA 4EVRA 1FFDA 3OTGA 3WTBA 4YJHA 3G9ZA 3DEIA 3JS5A 4KSCA 4N6GA 4L08A 5P8WA 2AK3A 4CLHA 1UF9A 2B21A 2OORC 2ZJ8A 5KTKA 3EBLA 3IR7A 4IIVA 1QIGA 5JOQA 1FMLA 3TTTA 4KK3A 4JLAA 1QV6A 2JHGA 4NENB 5DM1A 5EWMA 2M32A 1BJTA 5JADA 4OQ4A 4W9RA 2JIRA 4GZMA 1Z88A 2ZSEA 3WKAA 4AO7A 5D2CA 5CEEA 3BOSA 5H9WA 1POXA 3C6YA 2I22A 2TMGA 5JATA 2WM9B 2HPVA 4K2AA 1XD2B 3ZCTA 3PITA 3PUHA 3I73A 3EMVA 4HNRA 2AI2A 4QQRA 3RNLA 1QDLB 1TAUA 4MVWA 1C1YA 3WO1A 5IDQA 2FPWA 3S2FA 5LMZA 3DFIA 1O0BA 2E4YA 4HNHA 2PKQP 3HKDB 5CB4A 2GK6A 4F11A 5JD6A 1JQLB 4MNTA 5EMKA 4BZQA 3I3SR 1I51A 4JLWA 1C4KA 3IEMA 3LWDA 3S70A 1U02A 4EHNA 3WISA 2YN4A 5JT1A 5L51A 3NALA 4R01A 1CUHA 1JHDA 4FGJA 4M46A 1BO6A 4L8VA 1PF7E 1FF9A 1PK8A 2CJPA 3KDPA 4AJ4A 2DH5A 2B4YA 1Z0IA 2VWQA 2C3PA 3ELUA 1A5AB 4L95C 4BASA 2TECE 5K05A 4QQNA 2V0GA 2O2ZA 2ZLBA 2FK7A 3GFTA 1OTHA 1I6WA 3T12A 4BO2A 2E7ZA 3DHWC 1P0QA 3F7OA 3ZD7A 1H2BA 2X1MA 1UDRA 1FLDA 1IRIA 4RMGA 4BBZA 1K5DA 2O2CA 3JCZA 1G6Q1 4B2YA 4RKYA 1XQVA 3RAJA 1T26A 5DCUA 2FMFA 1FPMA 1HFJA 1AHIA 1CYDA 2CK3D 1TQDA 2PFSA 1Z0AA 2Q28A 2CCJA 3MTBA 4OBXA 5HRUA 3ZQUA 2RC5A 4XQ9A 4ZA2A 2QJRA 2D0DA 2AG0A 3BJIC 3FBWA 1OZHA 2IHVA 2HWWA 5A0FA 5JQWA 4CTOA 3FGNA 3ZU5A 4B4OA 5B1DA 1X87A 3N70A 3RTDA 1Q74A 1TA4A 2PGDA 2XTMA 4QEZA 1R10A 2EQAA 2ZI7A 1GZ6A 2H06A 4NZYA 4H1UA 1RZRD 3P45A 4D81A 2C82A 3SSMA 3WG9A 1UJBA 4DV4B 3TLGA 4K86A 3L4BC 3OT1A 4H7IA 4LOHA 2CD9A 3B9BA 4YCSA 4O4IA 5FT9A 3PNVA 5IAKA 1YC2A 4EMTA 3H04A 1I7SB 1G4HA 3UJCA 2F59A 1VIYA 5FPPA 2G77B 4GOXA 4DCSA 1R9GA 4KXNA 4IV5A 2HT6A 2YL2A 1FYDA 4L0QA 4YCNA 3EPHA 3FR8A 3CIFA 1T9GS 3AEZA 4OK3A 1QHEA 1KI4A 3ASUA 4RAQA 4EY5A 3HI4A 3LGAA 3VJRA 2EDAA 2BE9A 3R3VA 4JV5B 2QL6A 4UBKA 3V3TA 1RYFA 2PX0A 1IQRA 2NSDA 3SF8A 1X7GA 1GFZA 1JHMA 4ES6A 2XDQA 2ABWA 3FUUA 3A4TA 3K9FC 4JCCA 3DAHA 3EWIA 5B7GA 2GCOB 2WHXA 1BHJA 4Q4HA 1BMDA 4FNGA 4WFKA 1WSDA 4PGHA 3K30A 1GKUB 3AI3A 3DOJA 4Q1DA 5CXUA 2H17A 2GKSA 1VPLA 1S9DA 2K2QB 3ENWA 4H0FA 4LYFA 3BMOA 5JW6A 1SVKA 3EY9A 4KE6A 3HR4A 4M9ZA 1JHUA 4NE9A 1PUXA 3TKLA 2H0AA 1WO8A 1TRHA 3F5SA 4ND6A 1HE1C 5EXSA 3V1UA 1SA0A 5LBTA 2Y1WA 1VHTA 1IWPB 4K1XA 1A9RA 4Z8XA 4DXAA 4QUDA 5FFFA 5AUOB 2H4ZA 3KEOA 4G6ZA 5HUQA 1GG8A 4YCDA 4UTRA 1WVGA 2H59A 1TQ8A 3I58A 2NPOA 3E58A 1V48A 2I34A 2EZTA 4HD8A 1X1QA 1BVUA 1GLGA 1H3NA 3OEHA 4FPXA 5DGXA 5KTMA 2W90A 3UGJA 3LY8A 4PANA 1WPXA 3BN3A 1II8B 1KDOA 1EDOA 2DECA 2Y8EA 4X8HA 5FL7D 3KQNA 2HU2A 3C6MA 1QHNA 1XTTA 1T9KA 1YAHA 4Y1GA 1D9ZA 5KOJB 3G2NA 1Q6ZA 1BCRB 1QTRA 2VP9A 4RJJA 5EQJB 1O3YA 1P33A 5C34B 3CRRA 3T9BA 5M34A 1CR6A 2GASA 1P4JA 5L53A 1Z74A 5IMBA 4AJ9A 5KWJA 4Z53A 3HUTA 5CA0A 3I1FA 4ZYWA 3BIWA 3IAS6 2WEKA 2EOAA 2EAUA 3Q6MA 4UCXA 4IGKA 1Z0JA 3ZBQA 3B8HA 4CIWA 4HB0A 3N2KB 3G9TA 4WFIA 1KSJA 5AW1A 2VNSA 2EVWX 3MK31 3D1JA 3WZLA 2D7DA 3RF6A 1AJEA 1RADA 2ZIEA 1QHGA 5JS6A 2WRZA 1AKUA 5CBPB 2JAOA 4ETNA 5FV7A 2O1WA 1WZ2A 4DHEA 5BWCA 4MPDA 3NU1A 5AVXA 4KKXB 4KWCA 4AWXA 2OV1A 2YY5A 3AX6A 3BMNA 3OCZA 5JDCA 2DBVO 5AW3A 4NS4A 2QK4A 4ZWNA 1PW5A 3QE4A 3PJRA 1YL5A 1M34A 4JXJA 4S1WA 4ZT4A 3KOXA 1OV4A 2JCBA 1TF7A 1GQSA 2ZQ5A 1RD4A 4KWTA 4MW1A 1NAIA 3ZHVA 1KZ9A 4HX5A 3P0IA 4G85A 4DR4B 4AICA 5EZQA 3AHJA 3CR3C 3JYHA 3VKUA 1TCUA 2V58A 3KYCB 4AW9A 1MA0A 1Y6FA 1BWRA 1DTSA 3U4GA 3OFKA 5ADUS 4MUMA 1MX5A 2CL0X 4XYBA 5F21A 3JATA 2X58A 1EWYA 5H81A 3NFYA 3W1WA 3ZWVA 3Q11A 3JWJA 5DVZA 1N9KA 1G9XA 2X8LA 4PIVA 3CE6A 2WJWA 3SHQA 3KAPA 1MKYA 4PIMA 4M4SA 5LP6C 3CXUA 3D9QX 1GSHA 3LECA 4M60A 5FBZA 2X42A 4N40A 4TV9F 3U39A 1DHRA 4MUAA 4R41A 5I4KA 2C2MA 3UATA 3FNRA 3PLRA 3S2GA 1PFVA 2QE7A 3DW1X 3FWKA 3UWDA 4QULA 4GWLA 1RT9A 3QXGA 1PGJA 2DG2A 3BFPA 1XZNA 3DTVB 4FOOA 5FLYA 4C7OA 3IUPA 1T3HA 3L7IA 3W6ZA 2WLTA 3CSSA 2G63A 1JKMA 1L7VC 4YP0A 2YOHA 4N0PA 2NZYA 2ECKA 4XQCA 1UOQA 2EARA 4J16C 1NYTA 3OQJA 3CB2A 2ZRIA 1VLMA 1ISGA 2BKAA 3MGCA 5I7AA 1VE6A 2I76A 2XIQA 4E08A 2WWYA 1QLHA 3PKZA 4MHSA 1HYHA 2QXYA 3Q12A 2HIMA 4OHMA 1VBNA 3FROA 5E6RA 1XTPA 2J5BA 5LKAA 2XQVA 3OIYA 3FFTA 4FZVA 2EYUA 3FZYA 1W5AA 3BIOA 4X54A 5I3CA 5KQRA 1YZ3A 4IGEA 2XTJA 4O25A 1DAOA 1OR8A 1QR2A 1FS5A 1XK7A 2RKBA 2CEKA 4IF6A 4JUDX 3W0LB 4LOIA 3AK4A 3OESA 4EQ6B 5A9SB 2JVKA 1BA3A 1BKYA 1X7XA 2WYVA 2XUZA 4WVFA 1U0SY 4PCAA 2OFFA 4BNYA 4Z9XA 1FQWA 1N8NA 4LE2A 5D3ZA 3D1LA 5FBWB 4EYOA 2ZCUA 3SAJA 4FIDA 4CQLB 3VZBA 2NG1A 4XH9B 3D54D 3RJZA 8GPBA 2WJ3A 3ANMA 2KBEA 1RNLA 3E0QA 2XWJI 2A0FA 1NLFA 2BKUA 4RVDA 4Y6SA 1J1UA 1H3FA 1Q92A 3RTBA 1IHYA 1W1IA 3TBKA 3LYAA 3M70A 3B7WA 1DBPA 3M6WA 3IA7A 2BRUC 3N2IA 4JT4A 1NOIA 3NBZC 2OSBA 4R7TA 5FUMA 3KQOA 3OP1A 3FLAA 3LRTA 5TEWA 2FZGA 2D06A 1OUMA 7REQA 4D02A 2DHQA 3FM9A 5BY2A 3P4UA 1JG1A 2FOXA 4RVOA 4BIMA 3OX4A 1F4PA 1SXJA 3BERA 2OENG 2OHXA 3HU1A 3PFHA 4GD3Q 3MHTA 1ZK0A 2QGZA 2MHCA 3ENZA 3VPGA 4E33A 5GAJA 2R47A 3FZNA 4FTWA 4GVPA 1J90A 1LBHA 2H2GA 2IY8A 2RHGB 4O29A 3G8DA 5ARDA 2UVDA 4B4VA 3L0ZA 4B1FA 1GILA 4GPBA 2ZTMA 4ZEXA 3IKVA 5KWSA 2HV8A 1U8ZA 4WA8A 4B6OA 4CTMA 5HKKA 3C85A 1WL8A 3AUYA 2N46A 3RSQA 2PT9A 1K27A 3EDYA 2VDWA 3ND5A 1G3IA 3L40A 1C1HA 2I7XA 2OSVA 1PS9A 1S8OA 2E1RA 2V55B 3JYOA 2QLFA 3TKAA 3QX8A 5IH3A 4BMVA 3PI7A 4CIVA 2R751 2YNMD 5TQ2B 5LVAA 3AL2A 2WFZA 1QOQB 3UM9A 1ETUA 1PL8A 1MIHA 3R77A 3SZRA 3T1YB 5NLLA 1YC5A 4WJZA 4ZDIA 4IL5A 5AKZA 1BTOA 3U3MA 2C00A 4EQZA 1OC4A 4I8IA 2GNOA 4EPYA 1T1IA 4ZHQB 2BFWA 2JLXA 4ABTA 1E20A 1UT8A 2ZSDA 3THOA 2DMRA 3OQBA 5B3JC 2AFIB 2JAQA 5LIPA 4U0JA 2VJDA 4CNQA 1V11B 3RSZA 3KJNA 4DTIA 1AKNA 2OHIA 3TSOA 1EZ4A 2Z3WA 2PZJA 3GNSA 2QD5A 3OE4A 4EDFA 5JJCA 2FUNB 4DA4A 3BKXA 3GT3A 3UGQA 1GSAA 4B40A 5BN3B 1UKZA 4NXNB 1R0YA 2G5TA 4MROA 1DRWA 2RAVA 4MS3B 4OUDA 3H1BA 3LKBA 1DX4A 1V9CA 3PKIA 4X00A 4C6RA 2VDOB 2ZP1A 1P8AA 4G0MA 2HA4A 2ZJFA 3OJFA 1K6EA 2XXAA 3E9MA 2WB2A 4CU2A 1ST3A 5TPZD 4ENRA 2QMOA 4G0WA 1WXGA 4QLBA 2ZE7A 2VR1A 2XTZA 1ZJJA 4ITRC 4UD6A 4A82A 3G2JA 5PGMA 2ONCA 1UBJS 2HMUA 4YRBA 3JU3A 4G86A 1TUGA 3GAZA 1KEUA 4I50A 4PS1A 4S3MA 3ZX5A 2DFLA 1O96A 3LF2A 2BEWB 4U7FA 5A4FS 1RKUA 2FPPA 3ZHQA 2Q1SA 4JL6A 3K09A 4UNRA 3WZMA 4JENA 4AX4A 4QUBA 4CKWB 1KSHA 1LKZA 1Y3AA 3C3PA 3PGJA 4GZLA 5M3BA 3WGOA 2ES4A 5JCZA 4GP7A 3M4XA 3AESA 3D8NA 5AICA 2JD0A 3PE6A 1GPH1 2YIVX 3DS8A 3F4LA 3CR7A 1FUIA 3WWDA 3TN7A 3AB7A 4KCGA 4D8WA 2GN6A 1SZJG 3WP0A 2V97A 4KE8A 1O5TA 1SHKA 5AUNB 4JEMA 2QXUA 1XVAA 3M2PA 3IV7A 2OCKA 1HZZA 3F3SA 1ZU4A 3L05A 1NR7A 4Q1VA 2ZSAA 1N7IA 3FOCA 1R4AA 5FOTA 1U3GA 4HAXA 3H2KA 3TEMA 1B0ZA 2ZSKA 4U6SA 4R2LA 1M2GA 3V55A 4B33A 2NVWA 1E3DA 2E6UX 4PLGA 5B3AA 1LQ2A 4QPZA 4EUSA 1BWSA 3U3KA 2NYAA 3CO5A 5JYEA 2XGSA 1L3BA 1Q20A 1JSXA 3EVFA 1GPAA 3UWKA 2GEBA 4Y2XA 1PR0A 2H8KA 2ID7A 4LHVA 3RFXA 1MRSA 2H1FA 2C9OA 5EYPA 2V45A 4O2BA 3UG7A 1D1SA 2HZBA 3FRIA 1NIJA 2HY7A 1UIMA 1ADFA 2C7VA 2Q9UA 3AUAA 2PGJA 3NOXA 3TZBA 5K2MA 3EFBA 2AXQA 3IHTA 3KOZA 1UJ2A 5INTA 2NIPA 1YCGA 1WIWA 4ZAXA 2PFKA 4I4TF 2NUTA 1KY3A 4W8HA 3WMFA 4D74A 1MC1A 1VLZA 4D45A 3OLYA 4OSEA 2G07A 4W5WA 3W5UA 4D8YA 1FS4A 3PEFA 2PMEA 2J0SA 1FSFA 5DZSA 1X7HA 4XDHA 4Z0HO 3K9BA 3Q7TA 4BNTA 2QRHA 1V7QA 1RE1A 3JWIA 1D6JA 4C4PA 2B4RO 1EJ0A 1HNNA 4ZKEA 1E8NA 3C14C 2YWXA 4XWTA 1XTQA 5CLLA 2NX2A 3AG6A 5JMPA 1SKMA 4QHYA 5AKXA 5ALMA 4EMSA 2Y2VA 3GH3A 3GRRA 3N5CA 2FFQA 4QGGA 3VO8A 2Y66A 4HGPA 4C6HA 3TTVA 3GZTB 3QI7A 1JLSA 4J0HA 4DDUA 3ETDA 3VH3A 1RC8A 3OJXA 2FPIB 2NAFA 2EIHA 3RFCA 3TXAA 4M9XA 1L7AA 2CNBA 1UQTA 1BQ4A 4GSYA 3S55A 3U7RA 4KSBA 3W34A 2OTCA 2FMKA 1N25A 1PZXA 3VGJA 2XCUA 1C2TA 2ODAA 2ZTSA 3H42B 1XQWA 2DHDA 1BQ3A 1W76A 5AW6A 2JARA 2IWRA 2VDKB 2PVSA 1ML4A 2VHCA 1FBNA 4FFSA 4AP6A 2D4AA 1KY5A 1XTIA 2NV0A 1V0JA 3LUCA 4FEGA 2ANCA 4I55A 2VTKA 4X90A 5HZKA 2ZKLA 1MJGA 5H5JA 2J1LA 2D1FA 1XPRA 3CRQA 3QVTA 4NE2A 4H08A 3UB4A 3UBMA 1X19A 2Z09A 1Q0UA 4HNGA 1ZONA 2F9FA 1W6RA 4ZOAA 2BMFA 2G40A 3PR2B 2WSBA 2JH8A 3OD1A 4MI1A 2FPGB 4DQUA 5KCZA 6CHYA 2DPYA 4UAUA 2ID8A 4TV9B 2GN4A 3TR6A 3VSDA 1DEAA 1H5QA 4MS4A 4DVGA 2QMUA 1DBIA 1HDYA 1HEYA 3CJRA 1A7JA 4OFXA 1SB8A 2HCRA 3I4FA 2RGGA 3A2KA 3EA0A 1O9GA 3TIIA 1OC2A 3CV3A 3QF4B 2Y4OA 2H29A 3D7LA 2XMDA 3G2IA 1OBVA 4LBWA 4RZSA 3SNHA 1LBQA 2C29D 2R1VB 2GEVA 4N6NA 1SU4A 4CR7A 1WD7A 4TKVB 3AHHA 4GPZA 1OVMA 2DOKA 2X2FA 4TRRA 1U0BB 2IXEA 4B2LA 4F3NA 1N2ZA 1YFZA 5IJXA 3R1IA 3E3OA 3U6BA 4NBTA 5LA6A 4IRXA 4ME6A 2MYUA 4AJHA 1WMEA 4IR7A 2XTNA 1CRWG 3D0OA 1KO1A 1RZUA 1Z0KA 3DV0A 4FQ7A 3WLFA 9MHTA 4YAUA 2H5LA 3ADBA 4A8PA 1TPYA 3P0HA 5K3FA 2X0JA 1NMZA 4Q3DA 3DOHA 1Y8RB 2Y99A 4CQMA 2AK2A 2PGIA 1RWXA 3JQPA 5E9JA 3V4SA 1CULC 1O1YA 4ZYUA 2EC5A 3E1GA 4KO2S 2F8TA 2CMGA 2ADOA 3AETA 4U2DA 1SOAA 3P0RA 4XM0A 4MRRA 3UT6A 3EXEA 2HQSA 2BM0A 2HQBA 3SE0A 2XYVA 1G66A 2JFNA 2PX2A 3CX6A 4ZVKA 5BYJA 4FNAA 3WIVA 2W2QA 1RRCA 4WX2B 4Y0VA 2TMDA 5EFOA 5MFZA 1Z7EA 2F3PA 4R0NA 4RS3A 1AUVA 4CL2A 1HNZB 3PUVA 2A9PA 2ZT6A 2JG3A 4M88A 2JAXA 3STVA 4JX8A 2XNCA 5CPBA 3AVXA 1RYHA 3SEQA 1L4NA 2V03A 2YR0A 1YR9A 2AOWA 1JLKA 4IX9A 2JA2A 2Y77A 4JYCA 4P53A 1TUEA 1JKXA 4UFOA 2XUFA 4WXRA 5CMLA 3T95A 2O8FA 1X70A 2LCIA 5I51A 4X6YA 4BB0A 1FW8A 2P4EA 4BDTA 1NDUA 1R4MB 2CVPA 3ME5A 4C0QC 3GJTA 4AP5A 2DHCA 2W83A 1RWQA 2ZBEA 2VP0A 2V7XA 2DULA 4QYIB 4HRAA 2M6SA 4I5FA 4KO3S 2NPIA 3AUKA 1UXKA 1S2NA 3PXBA 1HUQA 4P36A 2Q29A 4X63A 1N78A 4J0IA 1UMCB 5CLIA 5TR9A 2O1SA 3TLEA 4NV3A 3O4HA 2JASA 3F6RA 2CJYA 3L3BA 1E92A 4ESHA 5KQGA 4LFAB 1KJZA 5IWAB 1QRTA 2OBBA 1R8SA 1SQ0A 4UUBA 4PW0A 4Q9IA 2C7PA 3VSEA 1UOOA 3SHVA 1IDOA 1Z2NX 4KGDA 3SS7X 2CLFB 1PTJC 1LDBA 4YJKA 1G18A 4XPIB 5IJ0B 2B99A 2I7DA 2FF5A 1EQUA 2GGSA 2VYCA 3KB1A 1W1WA 3NCHA 4Q3OA 1KQFA 4R9UC 1L4BA 3EZ2A 4Z9BA 2JI4A 3BUSA 1W0KA 3VYTB 2WZQA 3W3AD 3EVBA 4MIEA 3RW9A 1RWKA 2QP3A 1AY0A 3BTSA 2QQGA 4G1UC 4JASB 3TYXA 4E7PA 4IGAA 2WSYB 1Z0DA 1E3JA 1L7QA 3F97A 2QX6A 3JALB 3T41A 5JNWA 2F1JA 2ORED 2TYSB 3DT8A 4Z0PA 1MUUA 3EEYA 2I7CA 3HJHA 1L5VA 3F2VA 3I2FA 5SV2A 1Q1AA 4YUXA 2IOQA 3RC2A 4DW8A 3WS7A 2QLBA 3NKFA 1KAHA 3ND6A 1SPXA 4ZTZB 3ABQB 1UDAA 1PWHA 4BFLA 2PUBA 1SXHA 3H8VA 1D6NA 3EHEA 2R2GA 4EO4A 2PJDA 3GUHA 5AM4A 4XTRA 3GR6A 1EZZA 3MJCA 2YIMA 4HDMB 2GM4A 1L6IA 5HMLA 3FOWA 3DXXA 4FGUA 4QUIA 4RFVA 4K9OA 4OGFA 2XSZD 2RI1A 3NYIA 2ZR8A 4DHWA 2EU8A 4QXMA 4E5YA 5C18A 4BNMA 5DULA 4KR2A 1PZGA 4BQQA 3KVOA 4DYHA 2ZW9A 2CLSA 1SULA 1MIOA 1Q1EA 2PSJA 3L82B 2EKDA 3U9SA 1LBSA 3IDAA 2GLXA 3LQFA 2W9XA 1HYQA 3LK6A 1R27A 3GCXA 4JJKA 4ZOLA 1JL3A 4NBNA 1QC5B 4DZTA 1CEYA 1KYTA 5DLPA 2IYZA 4BJ3A 1LWOA 1GKKA 1JJBA 2YASA 3WRWA 3HGMA 5JSZB 3L7JA 2ISCA 3V5NA 1CC1S 3A3PA 4ZT3A 2ECPA 3NORA 4DOMA 4WKBA 3Q9LA 3G13A 4CG1A 5BVGA 3UOAB 5KOIA 1M6VA 2ZRPA 2YWRA 1YR6A 3K7EA 1QE0A 3BEDA 3WDSA 3I2KA 1E63A 2Z2XA 4HWOA 5JAOA 2B20A 2FW0A 2P9HA 1IC6A 1PVDA 3NDPA 4IQ8A 2RGEA 2XQJA 4WACA 3A2MA 1GYRA 3VHXB 3ZTTA 4AJLA 3TVTA 3OTIA 2WJGA 4P38A 4F2DA 3G8CA 1RYDA 3ZV3A 2YWJA 2PU5A 3KOWA 4XLTA 3AONB 1OLOA 3CYFA 2IF0A 3CNOA 4X41A 4YJ2A 2C57A 1Z28A 1JALA 4L75A 2EBFX 4LJSA 1RXEA 4O2LA 5REQB 1WXXA 4R2IA 1KRWA 1R5JA 3OY2A 2OK8A 1E4OA 4CYMA 1J5EB 1IUNA 1N6KA 1A27A 3DB2A 2K6GA 4WNAB 2I9KA 1L4LA 1SKAA 2P2GA 3IDFA 3ZLUA 1WA5A 3MT7A 5B6IA 1OXXK 4M9SA 1V71A 3TRDA 1N3IA 1OH6A 1OI4A 5JMOA 3NVMB 4BUCA 4DBLE 4QECA 4C43A 2C83A 1K06A 3IKJA 1DRKA 1EFDN 1C3EA 5HPYB 3PTAA 1G2PA 2IBTA 3MIZA 1XN4A 4LXUA 1Y5RA 5JSKA 5TIIA 3UMVA 1YJAA 2X2EA 5LCXA 4PYOA 3M49A 3AFNA 3W3AH 2WHPB 4NAUA 2DFTA 3C8ZA 1LQUA 2G9VA 3OT4A 4IJVA 5G40A 5KTSA 1VMKA 4YJ3A 4E4RA 3QMVA 3G2KA 4MPRA 3ESRA 1SZDA 3M4ZA 2QYTA 1IK4A 1LVUA 2R8XA 3LQ4A 3SZ3A 1JDSA 3K8OE 5G1OA 1TEHA 3NG1A 3GFOA 2EJBA 3MWKA 2ACVA 3V7UA 1LDGA 4EI8A 4NS1A 1F14A 4PZDA 2V4ZA 5DT9A 3MQFA 3NOOA 3FHCB 3CLUD 2GPNA 1CDOA 2VPXA 1V1RB 4X92A 4ZFNA 1H0SA 2ZG6A 3SBXA 3U0BA 3BZBA 4LJAA 1K9VF 1RFGE 3IERA 2Z04A 3OF5A 3RIXA 2R8YA 1FOEB 2WKQA 1KZHA 2AYXA 2QX7A 3CRNA 2LNDA 4YALA 5K09A 1H2ZA 2DTDA 1ZGGA 4B8ZA 1X7WB 5GV7A 4LV5B 4N82A 4K26A 4OQPA 1PR9A 1H5UA 3JQFA 4K3UA 3KLOA 1LC0A 2C96A 2F64A 4IDQA 3W2FA 3WGNA 1QM5A 2MCFA 2ZRJA 3FKJA 2QTHA 2C4MA 2ZYIA 3QVVA 3HU2A 5KUTA 3CVYA 1BHSA 3N58A 5K8IA 3MB8A 3B3JA 3O74A 4R8RA 2RAPA 3DE2X 2VJQA 4RCVA 4C0WA 4YYZA 1UM9A 3KR9A 3LZCA 1X86B 4GVXA 2PEYA 1JH8A 3RS5A 2QZ4A 1XTKA 4QYMA 5D1NA 3R5SA 3O3CA 1VBKA 2AGVA 4TS1A 1QPZA 3SLGA 4EYKA 2HRCA 2GJAA 5JRZA 4JYMA 2UU9B 2E5WA 2P41A 5J3JA 4IDBA 2GTPA 3NNNA 4XFKA 3KD3A 3MJEA 1WZEA 3D6NB 3P1JA 7YASA 1XRSB 3VZRA 4G41A 1RM0A 4IJQA 4UMEA 3TDKA 2CC2A 1IN7A 3JQ9C 4EHAA 1ZUNB 2EP8A 4V0SA 1Z6QA 3F7MA 3Q87B 2NP7A 5JRDS 1JTVA 4RLHA 2G25A 4RCYA 5FOUA 1P17A 1OFIA 2VCYA 1A9ZA 3V8PA 4DRXA 1SBTA 2A5FA 1E4EB 1PQPA 3H2GA 3KNZA 4YMHA 2I54A 5JFOA 3PP8A 4UQLA 1GQYA 5IZCA 1M34E 2BGMA 3IA2A 2VCHA 3ZXIA 3SU8A 4B3CA 3RHFA 3FX2A 4FQ8A 5JNRA 5L3SB 2JVJA 1FXSA 3L4EA 5LYYA 4TL6A 4K6HA 4BU0A 2QE6A 2B0CA 3OQHA 2K2WA 3RRFA 3HVHA 4XR9A 2ZUEA 4U2GA 3VKVA 3ZE6A 4D4MA 1U94A 5TV2A 3TW0A 2A6PA 2OWEA 5CM8B 2REQA 4DG5A 3H5LA 3IEVA 4LDJA 2ETVA 3C1TA 3FYUB 1DX9A 3ZZTA 4KR3A 4Q66C 4KSYA 1FLNA 3FNQA 2GXAA 1CIVA 4DJEC 3WIUA 4Q47A 3AEKA 5I9IA 1JFFA 2XECA 3JZFA 1ZY2A 1K5HA 4HVCA 4N12A 3SX4A 1C7QA 1YR8A 1LVGA 1YZQA 4G1MB 3VZSA 3PA6A 2RGNC 3AM4A 2ODTX 1KSFX 2RJ3A 3BPSA 4HADA 4ARZA 4ZI7A 1PFWA 4DNFA 4YP5A 2GFHA 1C9KA 1JZSA 3BDIA 4J3NA 4QDOA 3UFXA 4ZDKA 1DIHA 5JBQA 3IXMA 2DPLA 1OXVA 3ZJYA 1LPSA 1NWHA 2B4TO 3QBTA 1Y80A 3ZXYA 4DLPA 1GEEA 1D2GA 5A1JA 4LJ5A 1I3NA 3CIOA 2JFOA 4IH9A 4LY3A 3BXEA 3W2TA 1DUVG 1UL1X 4V03A 3WMGA 1KVRA 4ALNA 1R37A 5F9FA 1GPLA 4INZA 4W7SA 5M2QA 1PFGA 3GYGA 4M3NA 1GZHB 2ZRGA 3VPBA 3DAFA 3ECSA 5JPIA 2VZ8A 5LMCA 2A57A 3AKCA 1EI9A 1EUZA 1JEQA 1DZIA 2DWUA 4ZYYA 3CZMA 4BO1A 1UKAA 2ZBVA 2ZZKA 4WDRA 4GPEA 3MTEA 4YY3B 4LF7B 3O94A 3TSAA 3G85A 1VQ1A 3THRA 4I99A 2VXCA 3RBAA 2A84A 2ZXEA 2GK4A 4LGMA 2UVPA 3B7GA 3TZHA 3HNOA 1OLSB 3TPZA 2RHLA 1U9ZA 2QAGC 2R25B 2WAAA 1RTTA 4AYWA 2NMVA 2XITA 3S8MA 1CJVC 1FL9A 3ADOA 3ZJTA 3P7MA 3FYSA 1AB5A 1Q77A 2WSSA 4LXTA 2Q3BA 4BNUA 1JZTA 1RWPA 1XP5A 2KHZA 2OO7A 2X5OA 5EUCA 4A8JA 1CPYA 4W5QA 3TZKA 3T9DA 4J1QA 1J25A 3OMXA 2XWBF 2BF7A 4NU0A 3ZVNA 4KRXA 3EN0A 5G0UA 3NHRA 1UBOS 3R7LA 1SGWA 4GMDA 2QBYB 4YRLA 4D6YA 3RAPR 3SQDA 2UUAB 1DV1A 1TJ3A 5G0VA 1U98A 1QO9A 3L07A 4ZICA 1K8RA 1IHUA 2PY6A 2OEPA 2Q8PA 3D6AA 1G20B 4EBFA 4RE5A 5E6UB 2Y71A 1UDBA 4OHUA 3F1KA 3PQEA 5H4HA 1CUYA 2C2ZA 3RUCA 1NQOA 5ECGC 2QVGA 3S8EA 4BMPB 2ZUTA 2W98A 5BSFA 1BG6A 1F6DA 3OTQA 4IV8A 4NENA 4HQOA 4HYEA 2YJ5A 1CYEA 1P1HA 1GV1A 4UXJA 1AA6A 2EHDA 1FFBA 2VT3A 4X6LA 4HFNA 4BCCA 2P9JA 2NO6A 1KERA 4LQDA 4V39A 1K6XA 4B3SB 1DARA 4CM5A 4QOIA 3ILYA 3LAWA 3RT1A 4DZRA 1KH2A 1XZIA 1R3UA 2OK7A 3HKDA 3EZ6A 2GZHA 2Y27A 4LOKA 1GA6A 4KIWA 2YXLA 4S2EA 3IC5A 3KHSA 1UJ4A 4DA9A 1Q3TA 2W2KA 2DT5A 3BJEA 3QA3E 3ZJVA 4PQGA 1OB5A 2E4UA 4QARA 2BJHA 3PXCX 2Q7DA 3K0SA 3PQCA 4XDZA 1FU4A 3ET5A 1L5HB 3AILA 4OV6B 3M1AA 5ARCA 4CIYA 2AIRA 2X40A 5IC6A 1EJ2A 1B2LA 3E4DA 5AHXA 4M9UA 3CEPB 5FIUA 2J3KA 2NPFA 1IUPA 1GNSA 1KK1A 5AVJA 4KIFA 3UC5A 1EX9A 4B35A 4DIBA 2II6A 4RJKA 1EHCA 1CUJA 3PF9A 4L02A 1ABFA 5H8WA 1Y5IA 1STOA 1W88B 5ALLA 4C14A 4CXMA 4HH0A 1W6UA 1IY1A 1ZNYA 5LLTA 4J4HA 4TV8B 4OK5A 4Z86A 1EX7A 1K75A 3C3AA 3OZGA 4GOJA 5A7FA 1Z63A 4AJNA 4M6WB 3D3WB 4EA9A 5HR5A 2JLUA 3M9XA 4ZANA 2HREA 5JJIA 4HGRA 1A9QA 3GXBA 2IUYA 1KJJA 1SVUA 2JFPA 2HLDD 3FDXA 4GEKA 4MWEA 3QPUA 5E1BA 4C5AA 4F4JA 2QJWA 4FM9A 2ZYSA 2E5FA 3CNNA 3GY0A 1RPJA 3OU6A 3RUDA 3DO6A 4FI3F 3L8CA 4KQFA 1MFPA 1NNLA 5TC4A 2PSEA 1RLOA 1PAUA 4IS3A 3TM5A 2C59A 2LKDA 4C6TB 3F9RA 1SBYA 4BFSA 4BYGA 1NIPA 3BQNB 2ZBPA 2IITA 2ODWA 4MZDA 4P4GA 5E4TA 3SJUA 4TWJA 3QPAA 1Z7WA 1U2DA 1J09A 3UK0A 5KHAA 2I2DA 3ROGA 2JFVA 1A8IA 5F9HA 1LPNA 1XO1A 3CURA 3ZVLA 3NCTA 2BL4A 1NATA 2R79A 2Z2IA 3KQSA 5KTNA 2YXDA 4OQNA 3MJHA 4IIJF 2WNHA 4I1IA 4IXNA 3S3TA 4GMKA 5CP8A 4OSPA 5AI0A 4X62B 5KSWB 4OOEA 3GJXC 1U1GA 3LRXA 4PIPA 4HZUB 1KQ3A 4DZZA 5A7GA 5KHLB 4F5EA 2AOVA 4X71A 4GSLA 3EE6A 3HJBA 4IMJB 4YCAA 2UAGA 1CU1A 1JDBB 1TKAA 3WGMA 4EIWA 2J6HA 5JCOC 2QM0A 2PL3A 4K9PA 4XCVA 5AI4A 4YK7A 3WV4A 3NIDB 4KVZA 3S0JA 4CODB 1EM8B 3TECE 1QG6A 4UW9A 3HHEA 3ISVA 4KMSA 4AZ3A 5U1PA 4G0XA 3ZZ0A 1B43A 3E0XA 5DK6A 3M9LA 4DWJA 5KWVA 2X5NA 5H3CA 4AF8A 2G9QA 3MJFA 3NTOA 5SZIA 1DAFA 2VUTA 4JYBA 3CZ4A 3VR6D 4B3DA 4ETIA 1AD2A 3E1KA 4ZRDA 2FUG1 5E4YA 3O1LA 1KAGA 1P19A 3RC1A 1KU6A 3N2EA 1CIJA 2ZDHA 2JLVA 3RVJA 5CLQA 4AYTA 1M1UA 3QVJA 3B1ZA 3Q98A 2QVLA 1FU7A 4H7DA 3PC8A 2CXHA 3KFLA 1WHSA 3HEBA 4UTVA 4Q9NA 3RIHA 3AHDA 6ADHA 1A71A 2RDMA 1I4EB 1Y9AA 2FSSA 1SD2A 1NSTA 3QYJA 3GPDG 2TS1A 2YQ5A 1LS1A 1WMDA 3OOEA 2AX3A 2QJFA 3OA2A 5KOJA 4HAZA 4PLTA 3UAOA 1OI7A 2XNKA 1MMFB 1ZH8A 1Z73A 1J0XO 1E1RD 1J8MF 4EA7A 8OHMA 1E3WA 1U81A 1RI3A 2QRVB 3ZWQA 4WXEA 1XPOA 5KOYA 1US8B 2LDXA 1RXYA 1KYZA 2VHTA 5GTDA 3CT6A 1QHHB 3N2KA 1JHXA 3SKYA 3RRJA 5HQ3B 5TPZA 5FH9A 1FSGA 4MMYB 2Q27A 4BPRA 1L8AA 4P3OA 1U9IA 1P1BA 4HPWA 2JIQA 3FKQA 1IZ7A 3GT7A 3MGGA 4I9NA 4R69A 2YXEA 5CBPA 2GKOA 3NJ8A 5IHXA 1KYQA 3BGVA 3BK2A 1NUSA 1V16A 2ERCA 3BWCA 3GVHA 3O03A 4PQEA 2B4KA 2POCA 5CCDA 5TVGA 2PGNA 2ZSUA 1SVNA 4NPAA 4OY3A 4EENA 1DAMA 1JQEA 1FVHA 1L0BA 2PMWB 1ZKMA 1R0WA 2NSHA 2PKCA 2H18A 5I47A 4NH4A 1GCGA 1OFHA 4E1VA 5DYTA 3ZZUA 3IHLA 4PLVA 1I32A 1G5PA 3EYAA 2IXTA 3WYFA 1M2WA 3O0TA 4FQ5A 1K86A 1KAEA 2QVBA 2ZYUX 3VBCA 1PJTA 1P74A 3BEOA 1P4GA 1GKYA 2KE5A 1E94E 2Q7XA 1LQTA 1G8GA 1KXJA 1HBJA 1VYTA 2BC9A 2NO0A 2YZ7A 3K9NA 4FFBB 1IMJA 1KK2A 3KYCA 4NY1A 1X8JA 2AZMA 2DFPA 2P8JA 4OJQA 3GARA 4TYWA 1S2DA 1T1RA 3KALA 4XOIA 1XMJA 2ZQYA 4GMFA 2ZTUA 4LDNA 3OQPA 3KE9A 2HMYB 3EH2A 3I6BA 1F2VA 5BNZA 2RGYA 3K1TA 4HX2A 4ISCA 2W6QA 4Y7CA 4XUCA 4NONA 3V1YA 1KVQA 1R74A 5K2OA 2DERA 3P71T 3H11B 3HBLA 4LZWA 3FSEA 2VT2A 2PD3A 1NTOA 2YC4C 3MOSA 1L7BA 1O77A 2IDZA 1DE0A 1EYZA 3F73A 1QG2A 1PT6A 1O9HA 3QEKA 3IMGA 1BC5A 2JJ2D 3ORSA 3QE3A 1UBUS 1UC4B 3PUYA 4JC8A 4AMYA 5HUHA 2UXBB 3FPCA 1AUPA 1F5NA 1SMKA 2E89A 3ED1A 3DTVA 3TI7A 1XXHB 2C0CA 2OLJA 1B3BA 4TS3A 4ND5A 2JLBA 5DWQA 3PGVA 4UTZA 2I3ZA 3AKEA 4AY5A 3L04A 1M0TA 4HFJA 3AI1A 2JGDA 5K0FA 4KODA 3I01A 1GDDA 2R5NA 5AWFC 1UKBA 2ZJBA 4WLVA 1NQ5A 4FIZA 1C7ZA 1L7MA 1A9PA 1I1QB 4JP5A 2GPTA 1PLKA 2DRIA 4IIGA 3AZQA 4XLZA 4HHEA 4E5SA 4V2IA 4KBFA 4O1IA 3RPEA 3RSHA 3SJAA 3FB1A 3F8WA 3T1QA 1P0FA 3RARA 2I6TA 4L4UA 3UGTA 1UEIA 5JFTA 3GJ7A 3ZY6A 3JYPA 4EQ6A 5A9SA 4KNWA 4L4RA 3TK1A 1EFLA 1Y8CA 2GJKA 4WFQA 3W3ZB 3AF3A 4IJMA 5A05A 4DMHA 2LKCA 4HN9A 5EHZA 2OWDA 4MA4A 1A69A 2W22A 2VZEA 4JI1B 3NTUA 3W7BA 1UJ5A 5FEUA 3D5EA 2B78A 1YCDA 1CDDA 1DMRA 1I14A 3KBOA 3LDHA 3N05A 4TUYF 1J9GA 1FTQA 2Z6UA 1Z36A 3ANYB 4PO9A 2E21A 2IVFA 4JJZA 4GP9A 4RJ2A 2XX3A 4B79A 1BS9A 2Q5CA 1J8DA 3OQ1A 3SJZA 2FEXA 2JHPA 2QTAA 3HP7A 4RFLA 4WKGA 1ZDMA 4YI5A 1RACA 1T91A 2G80A 3CUTA 1BMFA 1CUXA 1E59A 2E4VA 1G6OA 4JOQA 5FA6A 1TM7E 4DM3A 4EB3A 5I7SA 2VTBA 4AULA 3MT0A 3KU4A 4F2WA 1CX9B 4AQYB 4IDHA 1LRKA 2OCXA 4R0MA 3UUGA 5K8VA 3TIVA 3OUZA 3SEAA 2XKBA 4CKEB 4DCPA 4NBUA 5JI2E 4URUR 3PDHA 2WMOB 2G09A 1QXSA 1L5LA 4P6VF 5BSVA 4L1KA 3R2JA 3CCCA 5DB4A 5B36A 5L7WA 5BV1A 5FUQA 3SYLA 5DP2A 5A03A 1BOOA 4CUZA 1THZA 1YUNA 2Z4TA 1JPNA 2CLDX 3UMMA 2AG5A 2HA7A 1QOZA 2VT6A 4YDQA 4MAMA 3G5LA 1LNQA 2MSDB 3GCWA 1JW9B 4TMKA 3DMNA 1EM6A 4P4TA 1VA5A 4ZJYA 3VC2A 3U3DA 3OX3A 4DIFA 3KEGA 3H16A 2KWIA 3ABRB 1XMSA 3E70C 4CM8B 1EVYA 4L15A 2FU5C 3HZRA 3THWB 4FWTA 1PDWA 1Z6PA 3LWZA 1ECBA 5LZ5A 3M0EA 2F55A 5TGZA 3ZEAA 2NU9A 1Z8NA 3AIOA 2BTQA 4OBEA 1JAYA 1Q17A 2J0UA 4KG7A 4ZHQA 2I62A 3UV3A 4QUJA 4JGGA 3OH8A 2ZRHA 1C9NA 5C8VA 2AFIA 3DZ8A 5KTYA 1TEXA 2LRHA 1QE5A 3A7EA 3JWGA 4G97A 2WIGA 4RSMA 4X6UA 4DNPA 2FLKA 1ZXLA 4HP8A 3EDOA 3O95A 4QTYA 4YRAA 3M33A 4I8DA 5KYUB 4D2IA 2D1TA 2MR6A 4B84A 4ZI3A 2Z6QA 4JB2A 1Q0SA 3K0HA 1B76A 4LSGA 5T67A 3O4RA 4MS3A 4H1WA 1J2JA 2ZIAA 4IHJF 5JYBA 2V5AA 1QH1B 2OQVA 4FJ0A 1Y98A 2X41A 4AWAA 3JX9A 3KUXA 7MHTA 5EXEA 1JECA 1V3UA 2G82A 4DSOA 2C8LA 2WYOA 1FFSA 3OFJA 4P0QB 3BTOA 2OV3A 5M29A 5IDWA 3FOEC 5TF0A 3A6EA 1U1IA 4ZVTA 3VMMA 1OLXB 5L7TA 3ADDA 1EB8A 1XZQA 3L1KA 3LX4A 5I9SA 3INGA 5FOVA 1ZH6A 2CCGA 4YUAA 2FDXA 2P40A 2QW0X 4DUYB 3PB3A 2I6XA 3EXG2 2RHBA 3DZFA 3JTMA 3U4MA 3OIWA 1JQBA 2D5LA 5EZSA 1RP7A 4M7OA 4TL9A 1KEWA 4V24A 5E1DA 4L8YA 3PSHA 3E6AA 1CK4A 2FX2A 2IYPA 3IPLA 4J03A 4MJ3A 1WUYA 3B6JA 3T1VA 4AC9A 3SR4A 5HKAA 1S2GA 1NW3A 1AV7A 2PMBA 1DEOA 2DCUA 4HMOA 3UXMA 3QELB 4XVUA 1N5KA 3KCQA 2BI8A 3RIMA 4UTPA 3VR4A 4NCBA 1Z4LA 2VNAA 5DM70 1YVDA 3NVDA 4YCLA 2WG2A 4FKZA 1PKEA 4BLVA 1JDBC 1H8HD 2NT4A 4LHYA 3UB3A 4L4YA 3OPMA 3ZVMA 4UCWA 2OG1A 3ORFA 3COSA 4MK4A 1GQRA 3AVVA 3LPDA 2VZ9A 4JP3A 3FMFA 4S24A 1HFWA 5F5NA 3NIBA 3FI0A 2OD7A 1NBEA 2Q6IA 2DR2A 2HEGA 4KAAA 1TJ5A 3ZWBA 2GESA 4W5OA 1K92A 2IT1A 1P44A 3AVOA 1KPHA 4MIYA 1DKMA 2QB5A 3OHSX 3PUJA 4KOEC 4NC9A 1EJ6A 1GKIA 3KELA 5AK6A 1KC3A 2XRYA 3LGSA 2Z9BA 3N0WA 3GGSA 4UEJA 2WFMA 1GOTA 5JAQA 4C2AA 1B8NA 3AYXB 3DLAA 3LHFA 1LF0A 2YC2C 3P20A 3TB4A 1NN5A 3DOIA 3F6YA 4RESA 3EMDA 2ZIGA 2YHUA 3FAZA 5KDOA 1FJXA 4BEBA 2BHTA 3CEJA 1WEHA 4IDEA 1KBZA 1V7CA 2ZPTX 3FJOA 3DOFA 5B37A 3GGGA 1LNSA 3DE6X 3H2ZA 1ZISA 3NZEA 4LRYA 3PQ6A 4D99A 2H2WA 9LDTA 3LXMA 1P3Y1 1NVVR 3KWMA 1WV0A 3LE8A 4M8SA 3GMIA 4NIMA 3GNLA 1KFCB 3MUNA 2VUIB 2BM8A 1PG0A 4QXRA 4AS2A 2JI8A 4KREA 3DHEA 3RB8A 3GD7A 2FZCA 1MDBA 3R7WB 3NRJA 1YZNA 2QLJA 3AUXA 4B34A 1NULA 1ZU5A 3DG9A 1PR1A 4XVQA 4EUEA 4YPVA 5D51S 4UAGA 2I6FA 4RW0A 4WZAB 4Y2VA 3F78A 3QYFA 4FT2A 2WUVA 2CXUA 4TL8A 3TNJA 4OLFA 2H1OA 3ZCPA 1QH9A 3SK0A 2G4VA 2ASEA 1JILA 5FUYA 4S05A 3MA0A 1EA5A 5CIQA 4RK5A 1KMCA 1YE5A 3MJTA 3EAFA 3QU5A 3RT9A 1H93A 2GJ9A 4K6FA 1CT9A 3H0KA 3PNYA 4RM2A 2WU0A 4NVRA 1EWQA 1E2PA 2PM8A 3AXSA 4O1HA 2IZ7A 2FPIA 2VDUE 1SUBA 4TSRA 3INYA 4JJ4A 2FZVA 2NZJA 4JQOA 4MVJE 4U2FA 4AZWA 2DKFA 1RXIA 3HV0A 3K20A 2QT0A 5FB3A 1V4VA 2GFIA 3GP5A 3HYRA 1Y9ZA 1V4NA 2IZOA 4Q9JA 3UMSA 3GEEA 4W4TA 2GPBA 1KI9A 2ZE5A 1H2AS 3OE7A 4HDAA 5A7HA 4IUBS 3HYSA 1XA0A 3BXZA 5LYJF 3AVQA 2GETA 1W34A 4V0KA 2XDWA 5P21A 5AOAA 1ZD2P 3K2EA 1A4RA 1JB1A 4FBLA 1IUOA 1BH6A 4JITA 1QHFA 4R2MA 1S2LA 1M7HA 1APBA 1F8GA 3DC7A 5CYGA 4JFRA 4TN5A 3V2UA 2VQDA 1U28C 3QVKA 4K8OA 2XVYA 2YYAA 1E7YA 4FONA 2FPGA 5C46F 5IEBA 1U7ZA 2Q4DA 2FB9A 2G8NA 1N5DA 3TLBA 5DBIA 4DPKA 1WDTA 3CZQA 4D0RA 1K8YB 3FDZB 3L7KA 4UBJA 3RQSA 4EJSB 1UZLA 2XXBA 4QDJA 4B81A 4LTNA 2RAFA 2A1IA 3QF4A 4XIJA 2ZDGA 1Y1QA 4LK2A 5IYZA 2PL5A 3L79A 4BU1A 3ZCUA 4ZI5A 1RC1A 2QR5A 3GJ8A 4EG3A 2GBLA 3QU9A 4I9UA 5CW1A 1J2YA 5J43A 2GM3A 3HEMA 4DV3B 3CW2A 3DD1A 4W5TA 3OQMA 2V7VA 1L1EA 2EZUA 4BJ1A 1D3AA 4D8VA 2B8EA 3LBNA 4LHEA 1RWWA 2AB0A 3HH8A 3JAKB 3GN1A 4J3JA 2A4KA 3Q9SA 4YUVA 4CE6A 1BCSA 5FA5A 2CDNA 2W6ID 1CRPA 4G0YA 4IFEA 3DBLA 1U8TA 3RT7A 3UN1A 4JJGA 3TZ6A 4KL8S 2NV6A 3NTXA 4QTZA 2OHHA 2VSYA 4R81A 3OI7A 2CXOA 2OGZA 2R4QA 4MLPA 5K0TA 5K6TA 3P52A 4RKEA 3G2OA 2I67A 3VPHA 1TAHA 4GO1A 4G5OA 1FB5A 4TUYB 3S29A 4H3SA 2CL5A 2P9YA 4C21A 4OH1A 4NBVA 3Q0TA 1V5GA 4MQEB 3LP6A 1EAMA 2HAEA 3ZQ6A 2HBQA 4KQGA 1DTWB 2H1RA 2QLTA 2J9FB 3D6MA 3PEWA 1NP7A 3ILSA 1S6YA 2IIPA 3K4HA 4HWPA 5J2UA 2GZAA 3G5TA 1PD0A 3P2IA 4C7XA 3BCSA 1VHQA 3B9QA 4Q3EA 2JCGA 3JARA 2TMYA 5DN9A 1SVWA 3RS2A 2RSLA 1M66A 4WKCA 4J76A 4ZD6A 1F6WA 3I34X 3SHFA 4EPTA 4LRTB 4G8CA 3IH5A 3RANA 221PA 3LPMA 1G7CA 1GL3A 3CUKA 4IOJA 1VDZA 4EG5A 1R16A 1X74A 3PK0A 4QVKA 1G5TA 1HKUA 2CW5A 3UJ9A 3HCRA 1TYEB 3VC7A 1SU6A 5HDQA 3TQSA 4BZPA 1R4MA 4HH3C 3RS3A 3AEXA 3DZHA 4MW9A 4CWAA 4XX1A 5IT5A 5HBRA 4R8VA 2B3TA 3K73O 4QYIA 5TX7A 4AJ2A 3BJMA 4DV2B 4B4KA 4FLMA 1NPYA 3OMWA 1DAGA 1E18A 2W2LA 1JLHA 3A1TA 2UYQA 2FX5A 3B1KA 3L06A 4CV2A 4FKMA 1E3MA 1HFEL 4K2HA 3M6FA 1W4LA 4EG7A 3NAMA 4W6QA 2C2XA 3FOFC 3CJTA 5KU7A 5JSHA 2P6NA 3D43A 4H59A 4CMIB 4R2XA 3RS0A 3IQXA 3SQMA 5KSYA 3AUJB 3CVVA 3WGIA 3M5PA 2YHSA 5FPHA 4GYWA 2XB2A 1QLJA 2Q5IA 3VO2A 3HV2A 4XPIA 3W6NA 4WBNB 5IJ0A 3M2TA 5JWRA 1RAEA 1RAFA 5EHXA 1ORVA 5ABPA 5I4BA 3LC1O 2PUCA 2O7VA 1B6GA 1YBMA 2VYVA 1E79A 1GLNA 5EP3A 2E4AA 4ONEA 4PXYA 1J1ZA 5CVEA 4N0MA 1R8QA 3O8NA 3WB1A 1OYWA 2XUHA 2RIPA 5CB8A 2IGTA 1X1BA 2CVHA 2ZRMA 1U0JA 1GIAA 2QYHA 1EZ1A 1QDEA 4KXLA 2IEDA 4BAUA 5IT0A 3ZQKA 3CVJA 4B6QA 4ZKDA 1QIJA 3OKFA 1BGXT 4ZOQI 2GYVA 5JSUA 3DP7A 1C3OB 3GNTA 4FI3C 3IQIX 1YZKA 5GM2A 3AEQB 3N28A 4GMHA 4L0DA 1M8KA 1MGPA 1RAGA 1ZD9A 4MGZR 4OK6A 5ELLA 2IDMA 4OXNA 1ONBA 1PFUA 1DT5A 4M0KA 2JRLA 3ZPXA 5IVHA 1RKXA 2PQMA 4DREA 4HDMA 4BTVA 3U4QB 2YXPX 3ENNA 1LW7A 2B1JA 4HRYA 2JVIA 3A4IA 2Q9AA 2QG4A 3TFQA 3UV7A 3ZHYA 1YNOA 3PD0A 1P2DA 2CLEB 2J4CA 4R3WA 4A0HA 2UZ4A 4Q3NA 2QSZA 5C0OE 2CFCA 2Q4EA 3OCCA 4RPIA 4R4JA 3ZYCA 2NU7B 3NLLA 1W48A 2HX1A 2JFUA 5ALDA 4DIDA 2BFFA 1G60A 3IAS1 3N0RA 2GLTA 4IIEA 1XQ6A 4IGIA 4DLUA 4ASUA 5K7SA 1PGOA 2CDAA 2JLQA 2W11A 1QC5A 3QI2A 4LHWA 3LKZA 2HCTA 1GGJA 3U4DA 3KYIB 2WTXA 4ZIRB 3A9TA 3L49A 1C3LA 1FXWA 4FW8A 1DELA 1SURA 2EV9A 2JBHA 4TTVA 4BMDA 3WLJA 4B75A 1RM3A 4LY6A 1IXRC 3IMKA 1F0PA 1G291 3WE7A 1E1YA 1JP7A 1WZIA 3DLTA 1ZGZA 3GF4A 4TVBA 3IJEB 1XJWA 3M5DA 4YXWA 3ZS8A 3N0XA 1F6BA 2FTKE 4W82A 5DXAA 3E5HA 5U4QA 5ERYA 1QQAA 4GKKB 1BYIA 1HTWA 2Y1DA 1F2DA 4PICA 1BN6A 3EBOA 3UHPA 4YWHA 4S2UA 4KE7A 1N3LA 1TC2A 2HCFA 4WY5A 5CT8A 3H4IA 3VHXA 1FYXA 1AK9A 2QTGA 3KZVA 2YJZA 2ZBRA 2A33A 4E15A 4M7PA 3KPVA 5EKUA 1E2JA 2F8MA 9GPBA 4PO3X 4RVNA 4MGHA 4ZAVA 5C8YA 1W5FA 2EKZA 2OFPA 2R44A 4YJGB 2BEJA 3C3XA 3VJKA 2W2OA 2Q07A 3VR5H 1A72A 1U3CA 2RHHA 5REQA 3C4QA 1L5MA 5TSDA 1HF3A 3STYA 4O8CA 3WMRA 1V8OA 3GCZA 5HMMA 3LHIA 1W94A 4PLWA 5A4AA 1RZVA 2R11A 4WNAA 2H2AA 2Q3HA 5GJWC 3ER9A 4H4EA 4N7JA 3GFSA 3SYTA 2WWIA 2LGJA 2YHIB 3OLCX 3AM5A 4NMMA 4WBSA 1DIOB 1T2DA 1VPEA 4BLQA 2BP7A 3WHKA 3LVRE 3RU9A 3EC1A 4UEOA 2YXBA 3HCWA 4N0EA 4GLJA 5D8DA 5I9NA 3B9RA 3SYMA 1F7UA 4L50A 2UVQA 3P4YA 1II9A 1IN5A 3KB2A 4ZAYA 3QVWA 2P2DA 5CTJA 1Q7CA 2PQ6A 2WHPA 4Q15A 3DGFC 3JPYA 4ZOBA 3T52A 4CM6A 4DCUA 4RX1A 4Y2UA 2C78A 3F3KA 3KJQA 1L1RA 4XE5A 1JLMA 4JA0A 3BMCB 4HNAB 2NYUA 4IICA 5DMXA 5CA1B 2RGCA 3DAPA 5IM4A 4KX3A 5I48A 3WRYC 3DE5X 3EFEA 4ZVUA 2DJ5A 4OGWA 3RK0A 3DL0A 2FP4B 2W6NA 3EGIA 4K88A 2YZKA 3W5DA 3L0OA 4EKYA 3RUPA 5HNKA 1I8TA 3OQ6A 3ZUGA 1P72A 1A8UA 4P7FA 4XGRA 3BD7A 3KLMX 3NHYA 4G84A 3ROQA 1UH5A 5IXYA 3R7SA 3KQHA 2BMWA 2IH5A 2O8BB 4IY1A 5KNCD 1JJFA 4LXIA 4RH3A 5IUKC 4EHLA 4ZJZA 2X9QA 1X7WA 4OXRA 4QT0A 4AJIA 2BSQA 1TYAE 4C7VA 3PPVA 3CZRA 2QHXA 3CPHA 2IHKA 4PS0A 3JQCA 2X9LA 3R3WA 3ZIAD 3QLUA 5L6LB 2WMDA 3TRFA 4EGSA 1X3LA 1CQZA 1BD4A 1M83A 2D5BA 2WLSA 9LDBA 1E2NA 3TQTA 2NZWA 4QGSA 3AV0B 3FY4A 2WPNA 2INGX 4ND8B 1JA0A 4LI0A 4OQFA 3T7IA 1CFJA 2B5VA 2IZ1A 3A1CA 2CBGA 4G0OA 1MH9A 4IINA 2N47A 1BXRB 3M5CA 5G1NA 1DJQA 3DFKA 3NC1C 2QEQA 5ENDA 1XTJA 2G36A 1G98A 2CMHA 2QZSA 5AW8A 1IXKA 2YNMC 3NM5A 4K6OA 2D59A 1KHTA 3MWFA 3Q3HA 3FMGA 1E9FA 3M6IA 5EE0A 1UODA 3S2ZA 1G1MA 3WYEA 3KG2A 3GUUA 4N39A 2GYWA 1EK5A 1RC0A 5FD8A 4RPHA 3FVRA 4H31A 3AL3A 1JG6A 5CNMA 2NTEA 4I66A 5FNVF 3P0FA 4ZT2A 1LLDA 1Z5UA 4IG4A 5BMVF 2G5CA 3WGKA 1E4EA 3M4NA 1T9DA 2CXRA 1Z7YA 4UNPA 3R3HA 5EIHA 3CGGA 3ZY2A 3ZX4A 3ZCQA 4RHFA 6PFKA 4ZO9A 1ULSA 3MF4A 4ZCQA 2PD6A 5L3SA 2V7BA 3G6KA 4IP0A 1FJ2A 2QN2A 1NW9B 1XAHA 4IIYA 4KQ2A 2HUNA 3F9CA 3IKTA 3O8OA 1NBAA 4MDYA 4G2TA 4G8BA 2B35A 2ISQA 1KFEB 3PHGA 5I45A 1H66A 1W0CA 3FYUA 3VTKA 5JISA 2IRWA 4HGQA 2C7OA 1OWPA 1FDSA 2RH4A 1U6JA 2BE7A 3ZV5A 4DLSA 4WFJA 3CG4A 3T7TA 5BT9A 4AY6A 2GBPA 2PMKA 3N7UA 4N47A 1D2CA 2OHGA 3BS4A 3LOPA 1PHRA 4GOMD 1A9SA 3SZGA 1W581 1EDBA 4ND1A 4TLCA 2OV8A 2VAXA 3T94A 3GRCA 4LVCA 5H9VA 3BL8A 5F52A 5HE8A 1H6DA 3HYTA 4RUKA 5HK8A 2PBFA 5FTLA 4H4DA 2ZULA 5IKOA 4PZPA 4P86A 2GN8A 4EBBA 2GCEA 5EEGA 1G41A 2JFYA 4FYIA 3CKMA 3MEQA 4KR7A 2F1RA 3OEEA 4GWKA 2YUTA 2ZB8A 1DJLA 1ORDA 1O6GA 2ZKIA 1U2QA 4Q39A 5BUQA 3OD5A 3EGXA 4LSWA 2OCLA 4FZRA 1YXMA 1MRZA 3NDIA 1LZKA 1L3IA 2J3LA 1QZZA 2E87A 3GFBA 3KYDB 1I5EA 4DABA 3MLBA 1IL0A 3DWFA 5DNYB 2OCGA 1OHHD 1L4KA 5CJPA 2PR2A 1S89A 2R2AA 3TTSA 2DPMA 2OFOA 4I5DA 1K68A 3GVIA 2WSMA 4M1OA 4RELA 3TINA 3T3HA 1FY2A 1OX4B 1CFZA 1PJAA 3PCXA 4DF3A 5FADA 2GRAA 4QYWA 2EW1A 3OO0A 5CGQB 3SDBA 1WP9A 2BHNA 1U3VA 2QL9A 3C3WA 5J1TB 4CFZA 2WPDD 2O7QA 2IUTA 1OLSA 3I04A 1IZ8A 1QB7A 4TT3D 4HTAA 2PZLA 1VPDA 4RKRA 4KR0A 2OBXA 1MFZA 3VJLA 3UJHA 1U9JA 4MH0R 5KBYA 4XCQA 2FWMX 5WRFA 3IQFA 4O8ZA 1SWWA 5F64A 1SU7A 3R4VA 1XCBA 4X1YA 1DJOA 3WGJA 4H1HA 2QPTA 4UXIA 1Z6ZA 3EISA 2V8OA 3QBVA 5JD3A 1XGKA 4AF6A 2B61A 1SIWA 3OZDA 1X39A 3IV6A 2ZRAA 3JQDA 1C4XA 5EHQA 3OAAD 2QBYA 5C80A 1P2UA 2CLKB 4ZVQA 4WMLA 4H7FA 3B6EA 1R0CA 2CXPA 2VBFA 1N5RA 4Y6LA 3WKCA 1ST2A 1KNQA 4M0PA 4CETA 4RTOA 2A0YA 2B83A 2MDTA 2NNWB 2ORWA 5JCPA 2J41A 5E6UA 2V7TA 1Z35A 3LT1A 3Q40A 5DO9A 5CAEB 5MHTA 1JDTA 4EYQA 3L8EA 3WLMA 4Q9KA 2Z1DA 4GI7A 3X1MA 4AKTA 1CDEA 2ZWAA 4UUPA 3B1FA 3UW1A 1MW9X 3C6KA 3BFXA 1KJIA 4IILA 5J4LA 4FS3A 3S81A 4KXQA 1DC5A 3ESCA 3N39C 5DDIP 5KNDA 1GR0A 2OR3A 2PQ2A 3W9UA 4EPWA 2DP4E 4ZZIA 2CXNA 2VOEA 4WXYB 3N8DA 3WLPA 2PRKA 3FNFA 2HU5A 3RC8A 3QSGA 4IDGA 1NQAO 4GX1A 3L84A 1L4EA 2WG1A 4BY9E 3GUVA 3U7HB 2PRIA 1U2RA 4FT4A 3MW8A 3N76A 3ORYA 3C8DA 3OJCA 1Z47A 1L5HA 3ELWA 3U0VA 4YMVA 5FWYA 3RKRA 5BT8A 4I9HA 3HWRA 3T61A 1WABA 4P81A 3WHIA 1Z4MA 1LTHR 4MAFA 1L7EA 4WN3A 5F1YA 2AMLA 3I8OA 4E2YA 1KEKA 3VU0A 3DEJA 2NUBA 4R2KA 5GVRA 4JYPA 4R2WA 2OZEA 2DSTA 2E6KA 2HRDA 2ZANA 2Y0BA 4I4IA 2CN1A 5D1HA 1IEQA 2PH3A 5CUQA 3SC2B 4FJ2A 1VJTA 4F86A 1NJ1A 2IY7A 3EF0A 4PFJA 4G56A 2GARA 1A1SA 3HBJA 4TV8A 2CE7A 3CKLA 5AIAA 2HSEA 3ZD8A 3HI6A 1K2WA 3BXFA 1YZHA 4LSZA 4TQUS 5AW4A 4N8EA 5FLEX 3RUHA 2FGJA 4AKSA 3TG8A 3K9HA 3WL4A 4HVTA 4M6WA 1GUBA 1KI6A 4JUAA 2LIVA 1CY2A 1I0IA 3O1IC 2XNSA 3BXOA 4CR8A 2XBUA 3KQKA 1YIDA 4B3MB 3LZDA 1FDUA 3D7MA 5G2OA 4LISA 3CLRD 4UCFA 5B55A 1EINA 1PWXA 1JIIA 1SCQA 2D1RA 4MWTA 5AJXA 3E7PA 5EQTA 5SICE 4B31A 4QDXA 1CJUC 1XMXA 1RIFA 3O26A 2VP4A 5DE3A 5AJUA 3UJ6A 1BEZA 1XDBA 3HCCA 3OM9A 5DTQA 3MBKA 2V6GA 4C6TA 4D5GA 1JWBB 5I9TA 3LT5A 4G37A 1A9TA 2QU8A 3EQZA 4L5BA 4YUYA 4LWOA 3VKWA 1MG5A 3IUSA 4L22A 2V3WA 3KFXA 5E4FA 5KYGA 4D3SA 2W8BB 1KPIA 2FPRA 3BRWD 3HFRA 1E8DA 4IHKA 3RS4A 3V7WA 2ZJ4A 1R6UA 3WFJA 1Q0ZA 1R6XA 2QMZA 2F17A 5CK4A 1U1DA 2REXB 5EWLB 5GIOE 4IH1A 2IS4A 4DXHA 3JWEA 1DDIA 3BFKA 2UUPA 1JBKA 4RTJA 2PWPA 3L6BA 3ONFA 3GEPA 4U6QA 5AVOA 2Z6AA 3UA4A 1N2CA 2ORVA 1LU9A 3C6XA 2OXIA 2PNJA 3U60B 1M74A 4COOA 3EPKA 3A6PC 1ORTA 1HORA 4X7RA 2ZYVX 5ITSA 3ZJ5A 1L9KA 1LX6A 3K2QA 2VUUA 2Z4RA 4Q6WA 1PT9A 3G0OA 4ZCIA 5ALOA 4BLRA 2GO1A 1JMVA 2HO4A 4GQIA 3L1UA 1L1FA 4O2AF 5HJEA 5ALJA 4PN7A 4YT8A 2PUJA 3SLKA 4N4AA 1KF0A 1EM8A 4YCBA 3SJCA 5B7NA 4HNQA 3EFHA 4GOKA 3UMGA 3ZWXA 3RYCB 1CE8A 1QQ7A 5JVDB 4RV9A 5EMMA 1CJCA 2YHAA 1QAMA 3BHMA 3U3JA 1ICIA 4ACAA 4HPJB 4EY3A 1G5HA 4QHTA 3R0IA 1QG0A 3PZBA 5FFNA 1DCTA 3LC7O 1ZSVA 3ZDBA 2JCXA 1FVFA 4LF8B 3PEVA 1TUBB 2JK1A 3GGJA 4M1ZA 1T2AA 4DC1A 1F48A 3EVTA 5FOSA 3AUUA 2L82A 1FX1A 4ZCLA 3W2IA 4Q4JB 1K9SA 1H2FA 2EZ9A 5LJLA 4AXBA 1I7DA 2GN2A 3LT2A 4GNKA 2W42A 3T3OA 4G5YA 5FYDA 4M37A 3N5KA 4MPPA 5J47A 3DYIA 1A2OA 3LVQE 2ZJ6A 1M73E 1U04A 3QENA 2AFRA 4BQRA 4OQDA 4WEOA 5DGTA 4A26A 4ZI2A 4D9IA 3QFSA 2AEFA 2Y0EA 5IZ4A 4HQ6A 4FB4A 4QXAA 5JZSA 1PS8A 3WBFA 5BMVB 3C1UA 3HG7A 2HIAA 2DY1A 2YMLA 3IB6A 3NQ41 3WBJA 1QHHA 4F2HA 1LB1B 3DTNA 3QX3A 1YK1A 1COWD 2HF9A 3IUNA 3QW2A 1ISJA 2PH5A 4HUQA 2P79A 4W9NA 4YX9A 4PY2A 2COUA 4ZVPA