1XTVA

Sulfolobus solfataricus uracil phosphoribosyltransferase with uridine 5'-monophosphate (ump) bound to half of the subunits
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Probable uracil phosphoribosyltransferase
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtvA00
3OZFA 1A98A 1VDMA 1UFRA 2P1ZA 2YZKA 4P81A 1NULA 1G9TA 1VSTA 1U9YA 1OROA 5JSQA 2PRYA 1Z7GA 4MB6A 1D6NA 1DKRA 3GGJA 4LYGA 1I5EA 3ACCA 3MJDA 4LZNA 4M0KA 4RQBA 4WMLA 1STOA 1Y0BA 4KN6A 3NAGA 1JLSA 4IJQA 1QK4A 1L1RA 4QYIB 1I14A 5E38A 1AO0A 1I13A 3KB8A 5ESXA 4M0UA 4P83A 4RANA 4QRIA 1P18A 3MBIA 4LYYA 4RHXA 4RHUA 1VCHA 4S2UA 5HKLA 1MZVA 5KAMA 4F8EA 3M3HA 2EHJA 4TWBA 1YFZA 1ZN9A 3N2LA 3DEZA 4RACA 2JKYA 2DY0A 1A3CA 2PS1A 4JITA 4RAOA 2AEEA 3G6WA 4Z1OA 3O7MA 1TC2A 1G2PA 1ECJA 1QB8A 2C4KA 1LH0A 1R3UA 1QK3A 3HVUA 1V9SA 5EUCA 4P3KA 5IAOA 1XTTA 1ECCA 1QCDA 4JLSA 1DKUA 3GGCA 4RADA 1XZ8A 3OHPA 2PRZA 2H07A 3OZGA 5K51A 2GEBA 1ECFA 4OHCA 4P82A 4LZOA 1WD5A 1OPRA 5BRNA 4P86A 1W30A 4RHTA 1CJBA 4RQAA 1QK5A 4X44A 2HCRA 1UPUA 1P4AA 4RABA 2E55A 5IPFA 1I0LA 1U9ZA 2H06A 2JI4A 2IGBA 2JBHA 3LPNA 1J7JA 1A95A 1JLRA 5BSKA 1DQPA 2XBUA 1G2QA 3ACDA 1XTVA 3EFHA 1OREA 1FSGA 4RV4A 5KAPA 4ZFNA 1ECGA 3DAHA 1BZYA 1QCCA 1L1QA 2JKZA 4RAQA 5JV5A 3S5JA 1PZMA 1O5OA 4PFQA 1QB7A 3LRTA 1GRVA 1BD4A 4M0PA 4WN3A 5ESWA 2H08A 1HGXA 4P84A 1DBRA 1A4XA 1TC1A 1XZNA 3QW4B 1XTUA 1ECBA 1ZN7A 5HIAA 4PAWA 5BQPA 3GEPA 1I0IA 1G9SA 1HMPA 2WNSA 1A97A 4X45A 1O57A 1P19A 1DQNA 4LZAA 1NONA 1UPFA 3H83A 2FXVA 4RHYA 4QYIA 3ACBA 1IBSA 4P80A 1P17A 4FYMA 2VFAA 5BQOA 1A96A 1GPH1 1BD3A 3DMPA 1ZN8A
chains in the Genus database with same CATH superfamily
2O0JA 5BURA 3IDOA 3R3UA 1L7XA 4LISA 5FPYA 3SEQA 3FOEC 1S2DA 4MUGA 5K8CA 3PHHA 4DB4A 2NADA 1GAEO 4QDXA 5K0TA 5KI6A 4O33A 1Z35A 2P40A 1C4WA 3IQIX 4KTTE 2JARA 2NXWA 4ND2A 3TOCA 1NBEA 4CNBA 2P65A 1KK1A 3E70C 4G0PA 4DV2B 2JLZA 2ZRNA 1JFFA 1EFPA 4FP9A 3FCEA 3JVIA 3RT9A 1XPRA 4IFEA 3RUDA 2FFAA 1IQ0A 2ZSUA 1DMRA 4GRAA 5G3YA 4D3FA 3GZNA 1LDYA 3FYTA 4OK6A 3QMMA 4HS4A 5GAJA 1NIPA 3O91A 3DO5A 4N4AA 2HBRA 4YPFA 5AVWA 4DMUB 5D7BA 5EAIA 3KOYA 2OKGA 2R8RA 1ZBDA 1M73E 1R6AA 1O03A 1ZUNA 4NICA 1KYZA 5GOTA 4F92B 1LDNA 1CQJB 1AT1A 3MJEA 2NUTA 1ADCA 3EZ2A 5TGZA 3U7EB 3JD0A 3AFHA 4BFYA 3B7GA 5JNRA 5DPMA 4LRSB 2AI3A 4MQEB 2PAAA 3P97A 4HDKA 4HZUB 4TKLA 4LJ7A 1K7XB 2HRCA 2PZMA 1JYEA 2X58A 4HLUC 1N7HA 4XM0A 1YQUA 4TQAA 5CCDA 4BTLA 4F60A 3CUTA 1CVIA 1NATA 5KX5F 4DMGA 1BS9A 1KMNA 1C0PA 1UZNA 1YS6A 3K0EA 3PUVA 4KQKA 3ZHYA 1XVTA 1G38A 1V8ZA 1YMQA 2F2TA 2G8NA 3KKQA 4L8FA 4OXRA 4ARCA 3G0IA 3GLHA 3HBJA 4DGQA 3KSBC 3K7EA 3HXPA 4P4NA 4Y1FA 4BU0A 2B3DA 2L82A 3AI1A 3QOXA 1WX1A 2FSIA 3EVBA 1XZIA 4AX8A 1RWQA 4DDWA 4A0FA 4DTCA 3QE0A 3LT0A 2WD7B 2B83A 4WY8A 2ZBDA 4C01A 1SURA 2TMYA 5JAZA 3B38A 1FRNA 3DOJA 3K1TA 1K66A 3OJ0A 1DQZA 2ZQZA 3CHYA 3F3YA 4NKRA 2A0KA 4J07A 3VR0A 3WJ2A 5A6SB 4FSHA 5KWIA 4FQ8A 5DISB 3ZDDA 2W7TA 2EU8A 3FPEA 3UO8B 2IUEA 3KZXA 2YXPX 1BC5A 1QMGA 3DWFA 3KR1A 4YQYA 4CTMA 2HQRA 2YQZA 4IYJA 1NFQA 3H1PA 5FLKA 3QKSA 1ZN7A 2CMGA 2OSVA 5IH7A 1ZHFA 3GMTA 5CEJA 1DV1A 4YP5A 4DLZA 5CEFA 5JFOA 2NNLD 3AERB 2WHEA 3BC1A 3H4MA 1EK6A 1UJ2A 4LZAA 1ENZA 4UHHA 1BW9A 2XRYA 4ZAGA 4F21A 1E9CA 5A4FS 1MJFA 3HBFA 3HVIA 1SVKA 1T0UA 1YB6A 2PHZA 3NT5A 4GMKA 2OHHA 4MUFA 3RJTA 3TK1A 4QQNA 1GZSA 3E35A 3OO1A 2IOHA 3TUIC 3FCOA 2O8NA 1AKQA 2ODNA 5KBYA 2IXDA 3GT3A 4LYHA 2O8DB 4GPEA 3IHTA 5E8RA 2R8XA 5DHPA 1TO6A 3BM5A 5FR1A 1TD9A 2H1SA 3FHJA 4XLTA 4LNAA 2J3MA 1V11A 2I2FA 4CQLB 2WT8A 5C8VA 2Y77A 2V6JA 2B78A 2G7ZA 4X84A 2A92A 3IMFA 5CGQB 2AZMA 3PDUA 5GINE 3OUZA 4M1WA 3SK0A 4UD2A 5BUZA 3SQNA 1H6CA 1YK0A 3D3KA 3D7RA 3U62A 2PQ0A 1GUFA 2Q6TA 2BW0A 3A2MA 3E48A 4LI3X 1TK2A 1W73A 1YCDA 2PX4A 4AZVA 1RC8A 1KQ3A 1TKRA 3K6JA 3PJRA 5JWRA 5CAEB 4M0UA 3RRBA 4I4NA 3MGAA 2CT8A 1II8A 1EFRA 1KMCA 2PBRA 4CMKA 5KAMA 2IEBA 2PSDA 4TMKA 3X1WA 1IZ0A 4NXMB 4Z54A 1L7VC 1EGQA 1ODIA 2P9EA 1Y5NA 3HUDA 3ZH9B 1GTZA 1W36C 1PDVA 3WWOA 1JSLA 2C92A 3MJ4A 1P0FA 4FN4A 3R7WA 4BKRA 4EMTA 2C4KA 2MCFA 4C30A 2EKBA 4Y7CA 2QNBA 3HVUA 1PKEA 2J6BA 2CNOA 2WTMA 1QRDA 3SOZA 2COUA 4XD7A 4NIMA 4D1YA 1XDDA 2BSXA 3OX4A 4L5YA 1D2CA 3IXQA 1QYRA 5LBIA 3WNZA 3ZWPA 1WWKA 1JHUA 3ZU6A 1JUDA 4WRRA 5MGBA 3LF1A 3L8GA 4V0OA 2Q3DA 2H8GA 2AL7A 1V41E 4C0AC 3GMIA 2ZWIA 2BUCA 3WMWA 3OTOB 1XMPA 5KYWB 5I7HA 1AY0A 2GDZA 4OMDA 2V7QD 1Y4AE 4P3PA 2DHCA 2VHWA 3KZCA 3S1AA 2ODQA 4UNQA 4FOOA 2ZRBA 4JR1A 1Q2XA 1X1SA 3SCZA 2J3QA 1LCIA 4MZXA 2O4UX 2OGZA 2HA7A 3FHOA 4WXEA 1IM2A 1GCOA 2QUHA 3TIFA 1P77A 2GRAA 1WB9A 2DJ5A 3L6RA 2C4WA 4WZBA 3D3EA 4NBTA 4LXHA 4P4LA 2G83A 4JEMA 1DGQA 4A26A 3OLQA 4LJ5A 1D04A 3JARB 1XTIA 1QPZA 4XZ3A 5DHFA 4I36A 3F90A 5E2IA 2VPTA 1Y6FA 4ECAA 2LCIA 4OREX 1J9EA 4TSFD 1JNXX 3BWDD 4DDUA 3E58A 3PXGA 3TE7A 4FDLA 2BDUA 4BMCA 4A6DA 3DEJA 4H6PA 5BOSB 2DHEA 5ALYA 5I9LA 3N53A 5TJHA 2E6KA 3SQDA 4CKCB 3BTSA 3NTVA 1C8KA 3R7WB 1PJ4A 1EYZA 4WZBE 3GFOA 5KYVA 4RXTA 4MIEA 3C8UA 4QYXA 4BCDA 3BSSA 1LB1B 4JYPA 4KI0A 4N0MA 3CEMA 3C87A 5EWJB 3HU3A 4II3A 4Z7OB 3DO8A 2NO0A 4QE3A 4OQQA 1DMSA 1CB7A 5FWYB 2D5BA 2IIPA 3W7VA 1F8FA 1BKYA 1E1LA 1KXZA 1EG7A 3KOZA 3QRWA 1VKOA 2GBLC 3JQFC 1J97A 5CA1A 3UWKA 1E6EA 5ALIA 2W22A 2A0YA 1RYBA 4BNHA 1LSSA 4F72A 5EIEA 3GNQA 2YY5A 3CKKA 2JFHA 1R10A 4EX7A 5BNTA 3TUZC 1XU9A 2KBFA 4HLCA 3FE2A 4C6TB 4BFSA 1EX6A 3I61A 3PGMA 3LL7A 2N42A 2CNLA 4ZVOA 5MN4A 3BK7A 4IIYA 1K3UB 3IBFA 2GNOA 3KXDA 3IP3A 1IG0A 1KEWA 1G9TA 1E3QA 1P0MA 3CE6A 3RWBA 3TTVA 3ZNNA 2BI8A 4AJEA 3OP4A 1TO2E 1JI3A 1VZ3A 1ZXXA 3WL7A 3EFOA 1FFXB 1KL7A 1WF3A 5IKEA 3VYWA 5DYGA 3B78A 4AURA 4RF5A 5FYQA 2JLBA 1WZIA 1EFLA 2GD1O 1X0VA 2FP4A 3B85A 3DD5A 4QYIB 3K5HA 3FZNA 1AO3A 5B3KA 5LMCA 2RG7A 3CT4A 3VYSB 4NXNB 4YJ2B 1SXJE 4DUYB 5KJFA 2EP5A 1QH9A 1P18A 2RHDA 5C32A 1I3CA 1IEQA 3I8SA 3ZHZA 2WKWA 1HMYA 3PQ3A 3KBOA 3EIEA 5H3HA 1XTKA 2BCEA 5B6JA 2FW7A 4DLPA 2ADOA 4H7PA 1MMFB 2IELA 4INAA 3B1XA 4ZQHA 1JU3A 1UC8A 3A3OA 2KPOA 2HHAA 5EQDA 1HTTA 1WVGA 1VRWA 1AKEA 2FQYA 2HV9A 2M98A 4FHEA 3ZNPA 4DPLA 5ITVA 1NVBA 1ZD5A 3BHNA 1MD9A 3DEIA 1G0OA 3GBVA 4OGWA 4XI9A 4ND8B 3HXTA 5CG2A 3ANTA 5I6DA 4E22A 2WD7A 4I1YA 3UT5B 2ECKA 3OHPA 1W4CA 2QD1A 1FZTA 3I37X 4BKOA 3L7KA 1B4DA 2Q5FA 4INOA 3DMTA 4TUYF 3RU7A 4HXFB 2FR8C 1ADBA 2FZGA 3KB2A 4Q39A 3E84A 5DM1A 2NUPA 1CYDA 2A8YA 1I2ZA 1K5DA 3EWNA 2IV2X 2PUDA 1GQ2A 3UUFA 4ZJPA 4IHJB 3SC4A 4E5SA 5EIOA 1ND5A 4PN7A 2GESA 2ECQA 1LZKA 4CDMA 2H85A 5A04A 4Z3OA 5HGJA 1EPUA 2FNAA 2WSIA 3WGVA 4E2ZA 2BMEA 4G0VA 5EGSA 1NM5C 2A9QA 4N3NA 5HZHA 1L4YA 1FDIA 2HH9A 2Z1DA 3DEHA 1SBHA 4YROA 4MQBA 3FDJA 1MRZA 2X2EA 4BJHB 2ZIWB 5D3MA 5E3JA 1WPQA 1GHTA 1L7MA 2WM8A 1JPNA 4JJKA 4BO1A 4DM7A 4RFLA 3ZHOA 1FSGA 3L8DA 2HLPA 4NWIA 5G40A 4DLNA 4URXR 2JGFA 1QOQB 4HAZA 4DV6B 4C78A 4N9QA 1I6KA 1QGDA 1XK7A 2XDYA 3BE6A 4HWPA 5IVPA 2ZSIA 2CCKA 3JQEA 1NJSA 4MULA 5B1EA 4LVCA 3DBOB 2JC3A 2FZKA 3HV0A 3IDZA 4IFTA 5JWOA 5KQLA 2ERXA 3ZCQA 5FFFA 1JSCA 1A2KC 4MPTA 3T06B 3UB3A 3PUHA 2ZRGA 5DN6A 3BD7A 4GKVA 2W48A 4YAJA 1SKYB 3AIIA 2IC5A 4PYMA 1QUFA 1L5MA 3K2QA 4B4VA 3DNPA 3E22B 2HYIC 3KTFA 1E9FA 3KKOA 4UDNA 5A7HA 3BS4A 3WNDA 1EFPB 1GPKA 2YZ7A 1HEUA 2ZR7A 3MUNA 4P6VF 4Q4CA 4B9AA 5KYKA 4IG4A 5H9WA 1C7FA 2Y4OA 4D8XA 1PW5A 5JRJA 2HMSA 1XD2B 2BGJA 4N5NA 4FW9A 5BMVB 4LN1A 1G8GA 2WIGA 4TVSA 1M7BA 4DLVA 3JQQA 1T8TA 1BYUA 1ZMRA 2JKVA 4OJYA 3WDKA 1CDOA 1GT91 1OXBB 1QR2A 3W79A 4CG1A 5JJCA 2Y1XA 3H19A 1Z7EA 1KPHA 3AHJA 4ID9A 1BE8A 4G4GA 4RZUA 2CV2A 2QRPA 1ZD4A 2GPWA 5DTJA 3NMUF 3HNRA 2IYQA 4I9HA 2N75A 3UK2A 4ZI7A 2PGJA 2VJBA 3D2BA 2YQ4A 2B36A 3ZDEA 3IVAA 2HSDA 5H9VA 1E5XA 3CEAA 1M7GA 1VMDA 2Q4RA 1KI1A 5K0FA 1N2GA 1CF4A 1LNQA 1EHIA 2PH3A 3UW1A 2QUJA 3G1TA 2DFDA 3MEQA 1H22A 4GR9A 2W6IA 2NN3C 2R85A 2BGUA 4OFBA 5ECDA 4TSFA 4EJ0A 4RBNA 1TM4E 4I6EA 1HDZA 1OGIA 3JTMA 2XNCA 1CUEA 1NDUA 1EE9A 3TRDA 2VJAA 1C1YA 1UZUA 1BDJA 2E4WA 1ECJA 3UBMA 1GTSA 2TMGA 4ZEXA 3QTLA 3RW9A 1ZK1A 2QXYA 2UZIR 3KB1A 3L8CA 3PGJA 2IHBA 3NRBA 4Q3AA 4WAUA 4ENUA 3DMTC 3NVKI 1KP9A 2DFPA 5TJ9A 5C8YB 3AIMA 3J7AC 5KPJA 3SF0A 1M1YE 4HSEA 1NRXA 1M2EA 2DLDA 1T1RA 4NP6A 2E7ZA 1MJNA 5TARA 2EZ9A 3C1OA 4MH0R 3TW8A 1H6AA 1M1XB 2IUYA 4TSKA 4N3AA 3WMEA 1JZQA 1YB4A 3GGDA 4XB6B 5FA5A 1NMXA 3HU1A 3HTXA 3ESQA 1MX5A 3OPMA 3P0JA 1CBUA 1A9XB 2NACA 1FF9A 5I9NA 2VQEB 1K4MA 6ABPA 3GFPA 3EPLA 3T41A 4OX9Y 1UBMS 3VPBA 4UPEA 5HIJA 4HNSA 4RGYA 1SQ6A 3EOBI 4OHWA 2H4JA 1TUBA 3WHPA 3DZBA 1C0LA 5EVJA 3BAFA 4XGKA 2W70A 3B3AA 2ZSHA 4EPVA 1N32B 4UVGA 4Y8VA 2QM3A 1B42A 3WFZA 2QAIA 3ORQA 1T5IA 2B2CA 2C5EA 2D1FA 3DPSA 3PP8A 3C98A 3CKLA 3FNGA 3QFTA 4OKSA 4N48A 5DLQC 3QWHA 1O5OA 3LSTA 1Y8CA 2A5FA 5D01A 1NVTA 2P6UA 3FOCA 3FOBA 4URVR 1J49A 4BNIA 2BMAA 2OC4A 2QD5A 3T5BA 3PC3A 1F2TB 3PQ5A 3UFXB 1UAYA 2GJ8A 3UJNA 1V5FA 1CY2A 1BOOA 3P94A 2VDVE 4ZARA 3TRHA 1VPTA 3U48A 1XFAA 3B20A 3FF4A 3O84A 4EJSC 2FSSA 3GZ4A 3GEPA 4HQ6A 1ZIYA 2DSTA 3OQBA 2FPGB 1KY5A 1WV0A 2XQIA 5CURA 3SJZA 1O57A 4DMMA 5ALFA 3ASUA 4PG8A 1UFVA 4IG9A 4D8TA 4F04A 3THWA 1A27A 1I3NA 1W0CA 3QX9A 4JLMA 5T57A 3TTTA 1Q3TA 5BQ5A 5IUJC 5CPBA 2E5LB 3K6RA 5D3KA 1HT1E 1VLMA 4XWOA 1ODFA 2CD9A 4K46A 2J08A 3O92A 1S2LA 4QU0A 4NVRA 3DVAB 3KR0A 3AL3A 1XKTA 1J6UA 1HTWA 3C6BA 2ETXA 4OMUA 2HYDA 4H1WA 3E7DA 1YZGA 3L1HA 4DANA 3X43A 4F84A 1BSVA 1JKIA 3DJYA 4PVDA 1QIKA 4R2LA 4QJ3A 3NTRA 4YA6A 1SXGA 2E4AA 3EASA 1VYHA 3UK1A 4XH9B 5ES4B 2VH2A 1ISJA 2AXPA 2HMAA 3O1JC 3ODGA 1FFEA 4LYJA 3NBQA 4BQPA 3SM9A 1D03A 6LDHA 1STOA 4KQ6A 3T7RA 2QT9A 1BQ3A 2HX1A 2OXEA 1DEOA 2G07A 3ZKWA 1FJXA 1RXVA 3JVDA 3BCUA 3PT5A 4EIWA 4GXRA 5EKXA 4HX2A 3M1IA 1NHGA 1CR4A 2NTYC 4S1TA 4LYEA 3WIEA 3WL6A 1IHYA 4XYMA 1Q22A 3GVCA 4P36A 1E1QA 4AG6A 1HR0B 2JLVA 3KD3A 2ZK7A 4LWZA 4L9SA 1XA3A 4NFSA 1PJ2A 3KSMA 4QUIA 5IC4A 1OC2A 3PQDA 2BGLA 4C5AA 4NG4A 2QSJA 3KL4A 1ZCFA 1QTNA 4I4LA 2V96A 1FYVA 4QWMA 2Q0HA 5FBZA 1XVUA 3V2HA 2QTCA 1USGA 4U0KA 2NYVA 2LR0A 4E4RA 2E49A 3VKGA 5AMXA 4BEBA 3NHUA 5LIRA 1KEPA 1P8JA 2EL7A 5LA6B 4EPYA 3KDSE 5JG7A 4D7AA 4EJMA 2JK1A 4P2BA 3WXBA 1YKFA 2PMWB 4F38A 3COJA 5AW0A 2WAOA 3K5WA 2KMLA 4G09A 1OIXA 4ZVPA 3AR6A 4JUCA 4TVBA 2PUJA 1I10A 1KZGB 1I3MA 1I9GA 1XV5A 2J0VA 4MRPA 4QUKA 4KI7A 2PGNA 2WC1A 1JIVA 1QWSA 3NBXX 3LT2A 3UJ7A 3FYSA 1XXHE 3OCUA 4EITA 5IPFA 5A0TA 2H57A 2JJ2A 2MWMA 3DMDA 4TRNA 4DUPA 4EYEA 2WAAA 2PMFA 2PZJA 3AETA 1IXSB 2QP9X 4XQCA 4TQGA 1RRKA 3DEAA 1IDOA 4TKZA 3AMVA 3OLWA 4BPRA 2BBOA 3MWDA 2UUCB 1M72A 3DUFB 4EHFA 1MENA 3RHFA 4U5QA 1CJUC 3ESBA 4DBZA 1RHUA 3L8EA 5JV5A 2JAWA 4L28A 4M1SA 1U7XA 4RKYA 2XB6A 2B69A 5FADA 4CMGA 2ZIFA 1K3FA 4MHTA 4GSLA 4N82A 1OU0A 3LQQA 4OHXA 2D13A 1BN7A 2ORVA 3DFIA 1JIJA 3W5UA 3DAYA 3NJ8A 2BPOA 1T2UA 1KJWA 2PL1A 3ILVA 1BHJA 3QU5A 5B55A 3CO5A 3MQ2A 2IFTA 1L7AA 2KHZA 2P77A 1NFFA 1L7DA 3IUYA 4L6IA 1NXSA 1HURA 3RGGA 3SIWA 3OICA 1OYWA 4F46A 5K3EA 1ZJ5A 5G2OA 1DO2A 4XJXA 3FPGA 3SQXA 3DFZA 1XCOA 3P19A 2CZGA 4ZU6X 4UW9A 1M9NA 2E37A 1JR3D 3EPPA 3VPDA 4FBMA 1WU8A 4E88A 3QY0A 2VP5A 3DE7X 4D9IA 1SVLA 1NN3A 4PBRA 2O0MA 1YB2A 1EP2B 4LAFA 2GAAA 4UMEA 4JJ6A 5BNWA 2QPTA 2ZIVB 2ZTVA 4MDEA 2OXFA 3ORSA 1KERA 2CHVA 4LOLA 5H80A 2YVAA 3SS9X 3CG4A 2QLMA 1NULA 3RS4A 5B4TA 3PIRA 3CVUA 2X2OA 4IIJB 3SIPA 4DV1B 4MR8A 3OTHA 1HWYA 1Y34E 1RMQA 4X8LA 1KH3A 2IYSA 1Q84A 4LYFA 2JJ8A 1VCMA 1MAVA 2FR1A 3OX3A 3PLNA 4PFKA 2O05A 1RHRA 2DAPA 2NXJA 4DHEA 3WMGA 2PZLA 4NCKA 1YL6A 3G0OA 4CCYA 1Z8HA 3GCGA 3AU9A 3R3ZA 3EDCA 1M2FA 2WWWA 3FKSA 3MJVA 4GHWA 3WMFA 2GXSA 2X1HA 2VJPA 1IC6A 2XDQA 3BJMA 3FGZA 3NO4A 3EG9A 2RG1A 2ZYWX 3I6YA 4GO1A 1XELA 5JAUA 1E18A 3A9RA 4MW6A 2VNAA 1DXOA 3CB4A 3D0OA 2IOFK 1G20A 5K0BA 3TR5A 2AW5A 1D1SA 1HYGA 1WUKS 3DE2X 3PIIA 3CY6A 2SBTA 2YYSA 3A2NA 5L40A 2WTAA 3FUUA 2YXLA 3IHWA 4RZXA 5I3ZA 2BGRA 4XVUA 3UFBA 3V7WA 3JAMA 1OASA 4NDNE 4MVJM 2F9MA 5KINB 2FX3A 4QZVA 1GGHA 3OP1A 2ONCA 4PQFA 3BEOA 2XGMA 5EJAA 3HKCB 1PUXA 3DDHA 3DH0A 4RLHA 1NQ5A 1JG3A 2JLXA 3RG2A 3KYCA 1XFDA 4YV1A 1PTJC 3NIFB 3HI4A 3JQDA 1XRRA 1F9EA 2QL9A 3EEBA 3Q40A 2C5SA 4CLDA 1TK3A 1GNQA 1SVUA 1V45E 3GDHA 1DFHA 2DG2A 1IUKA 1QV7A 3H6KA 4Q1FA 1A5ZA 2AR0A 2HBZA 4ZI2A 3KNZA 4MA0A 3AVWA 1OF1A 2WF9A 1S8FA 3V2UA 2COEA 2JHGA 2OORA 2ZT5A 3S4YA 1C0KA 2Q6KA 3H13A 4ZAXA 3BHJA 3M6IA 3GLFE 4LDNA 4MKHA 3PNPA 3TSZA 2R68A 4IIUA 2BFCA 2YHIB 4K6HA 3UC5A 5JMWA 3DOEA 4UNSA 4XYLA 3K6SA 1JQJC 2NTVA 3DZFA 1ST3A 2XUZA 2WU3A 2YMQA 3ETEA 3K96A 3F9CA 1VE5A 4JOCA 2FPRA 2FRVA 1HKHA 1YR3A 2J31A 2NZJA 2R5NA 3CTPA 2Y93A 3WOHA 1X13A 4OQ4A 3MK31 1TJPB 2WYOA 2BTQB 5AI9A 1UBOS 2ZJYA 3I9V1 1I4EB 4QUAA 4EEZA 1QJCA 1V8DA 1VLVA 2FSFA 3GO4A 3O4IA 1FP4A 4HS9A 5TQ2A 3ZNQA 1PV1A 3WK5A 1NNEA 1MEJA 1AXEA 1LQ2A 3BIXA 5SYNA 5J5AA 2EF1A 1SB9A 4V2IA 4D9FA 5DTIA 4HT3B 4JBIA 2WPDD 4KLAA 5FOVA 3T9EA 4A0QA 3U7GA 3AVUA 4UJ5A 3ZHQA 4C7OA 1KA9H 3NOQA 2G17A 4G1MB 4QQFA 5CB0A 3QEAZ 4BLTA 1TF5A 1B8NA 2D8MA 1DOAA 1RAFA 2J4CA 3IR7A 4CN8A 4AQYB 3HK2A 4P0TA 1QGOA 1XO1A 2VHUA 1N1MA 4G8JA 5ALUA 2N9UA 2H3HA 1SUFA 3GT7A 4HGYA 5DT9A 3PEWA 2I9KA 2FMHA 1MQ8B 3FUCA 1W75A 2VJDA 3GHHA 4ZICA 1J1UA 2QQFA 3C8DA 3U4GA 3RKUA 1T36A 4JUBA 3GP8A 4Q7QA 3IKTA 3SQMA 3I5UA 1A77A 4LBZA 1DAGA 3I0MA 3KZKA 4G2TA 4IDNA 2YXEA 4MQFB 4YLEA 1P2FA 2HA2A 4Q24A 4RKWA 4TMVA 3I30X 1SXJB 1N92A 5HG0A 5B3LA 5ITZA 3NAGA 1TZCA 4HP8A 3W9UA 3NOOA 4OI2A 2VHQA 3U0BA 1ZOSA 4BOYA 4UNRA 4P7KA 4DCNA 3KYJB 1QNLA 5JARA 1SMKA 1MQAA 4KQEA 3MBIA 4PZYA 1KMIY 1VFPA 2AF4C 4RMIA 5F33A 3OOJA 4PVCA 1J5EB 3LH5A 1MO3A 2FEKA 1GL6A 1CRQA 3VOTA 4BLPA 2ZUSA 3KFVA 2MHCA 4CMBA 3CA8A 4GXNA 4Q9DA 5JATA 4OXQA 4PHCA 4ATNA 1BHSA 2D1YA 5AKLA 1QBGA 3H4VA 4Y2JA 4U7FA 3H5TA 3NQ41 2NSDA 3ELYA 4N39A 1UKZA 2HQBA 1SELA 2K4MA 1WBBA 1HF3A 4LE0A 4D8VA 3GFQA 5E7QA 1N2XA 1JAHA 4V1CA 3RU9A 3BA6A 2PLFA 3VDRA 1DKUA 1P0CA 2J48A 4QDKA 4TS3A 4UM5A 1WD7A 1P5JA 2X0JA 1XIVA 2IIVA 1CUCA 2OCAA 3HLKA 2A0XA 2GK6A 3RBZA 2PXCA 2GN0A 3M6XA 3IT0A 2EJTA 4N5LA 5K51A 3CN7A 3UK6A 5AVVA 5LP6A 4JX9A 3E1GA 3LZ6A 3VFDA 4JMPA 1KO5A 1KIMA 1YR9A 3IKLA 4RHFA 3RC7A 3VTFA 1IN8A 2AFIB 4R6XA 4V0RA 4RQAA 1UR5A 3COWA 3D81A 3SMQA 1E3SA 3CR3C 1HZZA 1PWEA 4GSKA 5EXEA 2AJ8A 4X93A 1CUGA 3BWVA 5IDYA 2ZTLA 4WESB 2ZWMA 2W5UA 3HVHA 3K0AB 4MUXA 1G17A 3HJHA 5EE9A 4GOKA 4PW0A 3DA8A 3QVGB 5LA6A 3T4PA 1JXAA 4O6VA 5JSYA 1LBSA 5AM0A 2GN4A 1JLLA 4KPUA 3WLOA 1QPBA 3KOMA 4L07A 1K27A 4NBWA 3HYSA 1DCMA 1SCKA 5ALGA 4QFMA 2B1IA 4CZ2A 1SD5A 4CVNA 5JWHA 3TLAA 1CUIA 4CIVA 3D7SA 3BXFA 1YULA 1N5RA 4F97A 5AVXA 4KO2S 3G2HA 1B26A 3UHAA 2P3SA 4IXTA 3AEUB 4F9GA 3BQMB 4EB6A 3AR9A 3IE2A 3NHSA 4AY5A 2SCUB 4LOIA 5T8KC 3S28A 1KZ4A 1XDZA 2P91A 2QQEA 2ZW9A 1TUEA 4B2IA 1NXVA 1AK9A 1GQRA 3F6CA 1R6XA 4BX2A 4RPGA 3GUYA 4O5OA 3T9CA 2X0NA 3HEAA 4BP8A 1UBSB 3NXKA 1C8LA 3BYZA 1JFRA 1M8JA 2WFLA 5C8YA 4BUCA 2XXBA 2VHZA 3N59A 1KJ9A 1ZISA 1KI4A 2AOWA 1ZOPA 2UV8A 3P8ZA 5DP2A 4JOSA 3CURA 4Y1GA 2YWEA 2H8KA 2CCGA 1X1QA 4GMHA 4HAUA 1XZAA 4B82A 3ANXA 2K6GA 4LGCA 3RGWS 4HTFB 1Z2NX 3R75A 4HEHA 1JR6A 5IF9A 1PFVA 1XF9A 1IOVA 3P71T 5F3RA 1TCUA 1Y8ZA 6AT1A 1GILA 3QXXA 1E3EA 1NM5A 4CETA 2FVYA 4Q4JB 3T1YB 1E3LA 4GDFA 1KK0A 4O0MA 4PAOA 1SWVA 1SQ5A 4Y2YA 1NXXA 2AUMA 4NECA 2GBLA 3R20A 4FFNA 2R00C 3COSA 3EIFA 4BB0A 2FPIA 3D0RA 1JEJA 2I2BA 3DB2A 1PJQA 4PZ9A 3QMVA 1X7XA 5IXSA 4CLRA 2YRXA 3CZ4A 1I5RA 4BNDA 5BXYA 2Z8ZA 1G5IA 1Z38A 3SNKA 2VZLA 1VCIA 3EZGA 3OKAA 1VOTA 3MMPA 4E2YA 1LLDA 5C5CA 4LY0A 3EW9A 3AUYA 4JITA 4WW0A 5AHRA 3CLKA 3G6WA 3OLVA 3VYRB 1G8PA 2B94A 3X44A 5DN6D 2AKEA 1OVMA 2GZDA 2VJKA 2XECA 1FP7A 4XIIA 3RSCA 5I7SA 5DWVA 1GAQA 2WMNB 1NU8A 3GCWA 3TD2A 4ARIA 4NJEA 4WA7A 5LP6C 1JDBB 1XTTA 4V03A 4BB5A 3ZWBA 3PCRB 4JASB 4LHXA 5C80A 4LSWA 1DKPA 1RZVA 1IOZA 1CX9B 4CPDA 1MB9A 2OBYA 3SBXA 5LZ7A 1ZMOA 2Z1NA 3AB7A 2FG6C 5DFAA 1ZU5A 3RC9A 2OC9A 1RCFA 3NUQA 3VSEA 2CDRA 1JDVA 3Q7IA 2VBIA 3TDMA 1YBVA 2NO6A 3K8ZA 1D6MA 3GAMA 2VT2A 1Y89A 2HF9A 2JGNA 1N57A 1QGZA 4OU4A 3JXEA 1ISSA 3VVCA 4JJIA 1JAYA 2QZZA 4MYHA 2NIPA 2VHCA 4X20A 1VPEA 3H2YA 1ZX1A 4J43A 1CG6A 2DBRA 5ALJA 5DSTA 5FPQA 1IYZA 5LQMA 3NHZA 1L5NA 2VUSA 1YQTA 4P98A 4AB1A 3ROZA 5ILOA 1AH2A 3G8DA 4N8DA 3AUAA 1HA3A 4W5OA 2C61A 4QLOA 3UANA 4Y2VA 1P6UA 4RVFA 4EY8A 5HW0A 2HPVA 4OL9A 5EIFA 4BC1A 5FJIA 1PCXA 1YZ3A 3WBKA 1Z0ZA 3ZHTA 2OZLB 1HQYE 1Z5PA 2ZBRA 3IAS6 3I4CA 4JJFA 1H42A 3WV4A 3L41A 1GYRA 1UWCA 1L4LA 1W5BA 1ZEJA 2OMEA 3E61A 3FNFA 3GMDA 3H1TA 4UZEA 4AJ4A 5DM60 5HUQA 1SXQA 4LC9A 2XMPA 1PJSA 3DFUA 4ESVA 3T5PA 2X14A 1QQ6A 1NXOA 2X7HA 2W2PA 3W8EA 1U4NA 5K3DA 4NAUA 1U02A 2AHOA 2QRUA 3NONA 1I7NA 1V3TA 3C97A 2FPPA 2IY7A 5CX4A 3WICA 3RYHB 2XTZA 1TJ5A 2RE8A 1DFGA 1RE1A 1TIKA 5NULA 3K9LA 4B1FA 4LEIA 2ZJFA 4Q9KA 4ZYXA 2D0DA 2HKIA 4B3TB 1SOVA 4WDRA 2RFLA 1XZJA 1J9ZA 3L7MA 1AZLA 2P9JA 4GWGA 1OD6A 3EBLA 3O3CA 1YNOA 3W5HA 4EHDA 5JXWA 4YMVA 3L8ZA 3ZIDA 4A23A 5IKPA 3FFWA 3A4IA 1A96A 1P8AA 2G88A 3B3JA 3PI7A 4ZI7B 4FWTA 3BMOA 1ECLA 1E59A 1BD3A 3AF5A 1Z3IX 3IQGX 3VPXA 3EZNA 4AMZA 3OOSA 4JYBA 4BLQA 4MW2A 3L1VA 1GTJ1 1Y7TA 2VPPA 1F7UA 5HJ7A 4UTXA 2XODA 5ERGB 3E9CA 5AW4A 2XVXA 1TEZA 1T9ZA 3IPRA 3MJDA 4WKOA 2GI4A 1ORIA 1JHXA 3ME5A 1I7SB 3KWJA 1ZW6A 4Y1RA 4A8TA 4LF6B 1U6IA 1YE3A 5FUBA 3RO7A 3R74A 3GFFA 4LGMA 2B99A 1FFCA 1DEKA 1KJIA 4PU0A 4DJAA 3AM1A 3EIXA 4G84A 1F1JA 5EP2A 2D0OB 2WMOB 5IZCC 1Z28A 1N5JA 3FPCA 2L18A 1XB2A 3IV9A 4B3JA 4XSVA 4C7XA 2G0NA 1MZVA 4PRYA 1X8KA 4TTSA 4RULA 1N33B 2R6R1 1CY1A 2VPXA 4FZRA 1BWRA 3HHPA 4ZDWA 1SGWA 1LLUA 2J0UB 3INYA 3PC8C 16PKA 3H2HA 4MMXB 3JS5A 2AZTA 4W6ZA 2ONZA 1QLJA 3R9KA 4KQJA 1CY7A 2ZE5A 3GUCA 3H9EO 4RLSA 3S2UA 2DQYA 2ZREA 4D9MA 2YN0A 5DNYB 3AKCA 3ABQB 3DDOA 2WIAA 5COAA 1SB8A 3T3MB 2GPBA 3LPAA 4BHTA 5JZSA 5IDWA 3IL2A 1ZJJA 1A4UA 1VB3A 2HBQA 1A72A 5FTKA 4LV5B 4NV1A 2R6JA 2HB6A 3WL3A 4MGZR 2EZ4A 5I5GA 2YY7A 3C85A 3DZKA 3OIWA 1K1EA 3OM1A 2PS3A 1J00A 1QWOA 2FEPA 2H07A 2FDXA 3JQGA 4RE5A 3OCZA 1IY8A 4HDOB 1OT5A 4C0XA 1Z6YA 3F67A 2RGGA 4JP3A 1NR5A 4IV8A 2P90A 3E3LA 3F7NA 1P5FA 3KOUA 1L4BA 1DRKA 3LAWA 4XX0A 3W2GA 4QLAA 3GPBA 5JAQA 4JU9A 1BEEA 4RZHA 3ST7A 4RK0A 2HJGA 1RXCA 2QM0A 3I72A 3TAHA 2BL4A 1Q95A 3G0DA 3E8MA 1UC5B 2XT0A 4FYPA 3OFJA 4JGGA 3A1FA 4TLAA 3BN3A 1WKCA 3ZV7A 2CNNA 1H66A 2JFWA 3NHYA 1NBME 1UFKA 1UINA 4LJRA 1ZI9A 2IP4A 2IOQA 4FHFA 5EE0A 2PWBA 4OEHA 4US2R 4AJJA 1PBTA 1J25A 4JXKA 4TSRA 1ODTC 3KPVA 3CWCA 2V7UA 4FE4A 2I7DA 3T5DA 4D0LB 3RYCB 2EBFX 4CIBA 2G09A 1R64A 4HWKA 4JBLA 5FJJA 4P4GA 5A5GA 4DABA 3VOSA 4D4IA 4IIDA 1T24A 5B53A 4BX0A 2AC7A 2RHBA 1M6VA 1PS8A 2VDPB 3E3MA 3LC2O 2YVUA 3QSGA 5G4KA 3RCBA 2D2FA 3WGHA 5KDOA 3V4RA 4H7HA 1THMA 1H6BA 1YDFA 1RACA 1M34B 2WPDA 3WTCA 1CXZA 4JYCA 5K45A 4XGIA 2YIDA 3A36A 2HD4A 4DG9A 3AGPA 2UU9B 1X9GA 1BDHA 2ZPTX 2CWDA 3H83A 4TXNA 4UASA 5BN3B 3COYA 4DB2A 3EFBA 2G9NA 1GYPA 3B6KA 3A58B 4P80A 3DLPX 4HATA 1C2TA 3LL4A 1B73A 3TH5A 1PD1A 1N25A 2PZGA 1FFXA 1JALA 2C4UA 1V7QA 1XTSA 4M38A 2GZRA 4YRTA 2FUNB 3CH7A 3I1YA 4EEKA 1J09A 1IU9A 2AXNA 1QOPB 3LXMA 3M1AA 3VAAA 1LBEA 5EXPA 2NSJA 2EFYA 3JCZA 2FFHA 4C0BA 4ACAA 1W34A 3IDSA 1N9KA 4JT9A 1BFUA 2Q4DA 3F1KA 4AUMA 2I91A 1A8IA 2IS1A 4F12A 2X5JO 3FDXA 4HY3A 2IY9A 3ACCA 3T1VA 2P6NA 5ARDA 4G4JA 4X62B 3ZXUB 1YBMA 4RSGA 5LZ5A 4PLGA 4WA8A 4KUGA 2CMKA 4IRUB 3ISVA 4F2PA 1SXHA 5HF6A 1M1UA 1SPBS 1TYDE 2BDTA 2OD9A 2PTGA 3I9NA 5CDTA 5HQ3A 3FTFA 1WXWA 2GA9A 1JEQB 2H1OA 4Z53A 1EJ0A 1ZAKA 3OIFA 4YS6A 4CF7A 4RUKA 3WK8A 1ZD1A 3VC1A 1WW2A 4RACA 1AK1A 3EDRA 4NHEA 4NZYA 1L8OA 1YR6A 3SZMA 2BAGA 2HMYB 3GX1A 3JAKB 1MX1A 4M8NE 1KI3A 3C1UA 2QX7A 4BIMA 3QKRA 3VR5D 4E94A 2YFQA 3L05A 4R6WA 5T7BA 1UDRA 1YOBA 1T91A 1N0WA 2EGHA 4R9VA 3I2YX 4UUMA 4FQ7A 3QPCA 4LX0A 4WZZA 4ZVLA 4M99A 2X0EA 1Q6ZA 3W1VA 1SIWA 5FEMA 4PS1A 3REFA 4DQKA 1YOVA 3F47A 5EJ8A 3DMRA 3FLBA 5EMMA 1U2RA 2H11A 4FOTA 1XDWA 2MSCB 3FMPB 3FSJX 1KZHA 5EEHA 3RTEA 4EGAA 1TGVA 2AC4A 2D1TA 2P79A 2V74B 2NNWB 1V96A 3KJNA 2FG5A 2Q7OE 4BNTA 3UXYA 3HC7A 3UAVA 1PO7A 1TJNA 2VUHB 2WUGA 2ZKIA 3LU1A 1ONSA 1R4NA 2NSLA 2ODEA 2Z2ZA 4R1PA 4Q18A 4CLOA 1CR0A 1RPZA 1THGA 2ZRJA 2HHHB 2P4HX 4MV4A 3ETHA 3PNSA 3MXTA 4BECA 3CF0A 4LZPA 1V5EA 2C94A 1X7ZB 2B1RA 3PA6A 1F0YA 5HVNA 3OIUA 3KFXA 4S3MA 3J81A 2H2IA 4WZ6A 3D6FA 3O4HA 4OLFA 3L1KA 3JV7A 3P2EA 4LMPA 4N3BA 2XBUA 4RWEA 4BBJA 2C2HA 1KO8A 4M83A 5FHRA 1Q7BA 5EOVA 1DX6A 5F5LA 1YBAA 4JR2A 3HCRA 4LZWA 3NHKA 2J8ZA 4PCLA 1E64A 3AFMA 3SR0A 1WBJB 2DWOA 2GPAA 3E82A 3JQ9A 4RIHA 4HNVA 1QFXA 4CEIB 1C81A 1OCEA 4WK2B 2VWHA 4AWBA 2HQOA 3AHIA 3ESZA 3NWOA 4J2OA 4CL2A 1T2DA 1TFRA 2DPHA 2ZSDA 4GL4A 4IHJF 2FMFA 4KJXA 4OF4A 5DB4A 3S8MA 1ENPA 1YB7A 2P7HA 3N5KA 3L2OB 4KOEC 1H23A 3FFTA 3UG7A 4V3BA 3GLGA 1GT6A 4K0RA 1FTNA 4KXWA 4MWTA 1XTZA 2Q9UA 4YQZA 5KKCA 1V9LA 2QTBA 5J1SB 1J20A 1FFBA 3OT5A 1CRPA 3O9ZA 5EERA 1Z5ZA 3B70A 3VPHA 4EY5A 2X0DA 1A97A 1U8XX 5B1HA 2DUUA 3MIIA 4BQIA 3AESA 3IQZA 3OPYB 2FXVA 2W8BB 4QEZA 2Q7DA 4ZYLA 3RSLA 3RU2A 3ETNA 3O6VA 1DEAA 1Y8RB 4K9KA 4JLWA 2YYAA 4XIGS 3KVRA 3C6XA 3S2EA 2CFRA 3N76A 2ZUVA 3DLIA 3KYDB 3HJBA 5AI0A 1CK4A 3VR2D 4C4RA 5CPFA 2MOKA 2V9CA 1EFHA 3V7UA 2C03A 3GBPA 1VJDA 3U4IA 2O3SA 3GH1A 3MCAA 4MW5A 3I53A 5AOBA 3NG1A 2WG1A 3QENA 5DV9A 5KOJA 5BO5A 4ZMSA 1E2LA 1G4HA 5BN1A 3F6YA 2FWIA 2QQGA 3F9IA 3MM4A 3PNMA 3Q2IA 1F9AA 4CEIA 1HFJA 4BEVA 4YRCA 4BS9A 4KSCA 5JS7A 1ES9A 5JW6A 1UQRA 4LKOA 4MP6A 4UAUA 5FPTA 3PI6A 5A05A 5ALTA 4BVEA 2QYOA 1C1DA 2WI8A 5J2TF 2PNJA 2CL6X 3E5NA 3I73A 2QQ5A 4HPWA 4N1AA 5FO0A 2F3SA 2PIDA 5JSZA 5CCBA 4MYRA 1EDDA 2HWKA 1FMFA 2GRJA 3QE9Y 1XPJA 5H59A 2AQKA 1TW2A 2VDRB 4ZXFA 3JATB 3SM3A 4M1EA 3PPIA 1UBRS 2RGDA 4KN9S 5LNK6 1ULAA 1Z2OX 5GGYA 3OFVA 2HSEA 4IDEA 4BE4A 1KI6A 2ES4A 3OX2A 3RIGA 5DIZA 3UF0A 1AQUA 1PSWA 2CZCA 4DR2B 2MR5A 1JJBA 1XUOA 2AWOA 4C7MA 4ISCA 1SG9A 4OAQA 5T6MA 1EQUA 4CMHA 4E51A 3IXLA 3DDNA 1YUNA 2F1IA 1CQWA 1WQ3A 1C29B 3CF6R 5CYPA 3TI9A 3TSWA 5JASA 3F2IA 2DPXA 2PRZA 3AQ4A 1CNEA 3ETLA 1DTWB 1L8XA 2JH9A 2AFIE 3A05A 2H51A 1SQSA 3D4OA 1E1NA 2ZJOA 1P2GA 2W6JD 2Q3HA 1PR9A 1QGAA 2CHFA 4ETIA 1OTXA 2ZYRA 4N5IX 3EBPA 3NWEA 5CXUA 5AJZA 5L4SA 3MINB 2UZ4A 4MI3A 1XVVA 4MLCA 1Z4KA 1FDTA 7ADHA 5EJ9A 2LP4Y 2O2EA 5TR9A 1SUBA 3E27A 3OQJA 4I9NA 1MG5A 1HLPA 2O07A 5JMPA 4C0JA 4HKTA 4B7ZA 4LF5B 2AWNA 1MOPA 2VAWA 1PLJA 1UBNA 2NVUA 1JLRA 3FW1A 1HE1C 2WPNA 2WFLB 3EARA 2X9NA 4O4HA 5IYZB 3VR4D 3QX3A 1E4VA 3LP8A 1ONNA 3UPUA 1UCFA 2HJRA 3VOAA 1WZEA 2NUTB 4HUJA 5AVOA 1Q0LA 2ZSBA 2B3TA 3JQRA 4OXXA 1JRLA 5BSTA 5HOQA 5LMUB 3TCXB 3AF2A 5HZKA 4OHOA 3IAS1 3LX4A 5AM4A 5AI8A 3NIDB 1BD4A 2NO9A 3K92A 1NRWA 4D6YA 4MQMA 2H1WA 1EVKA 3Q72A 4WK0B 2FMXA 1QHIA 2BM1A 1L9KA 1PLLA 1DDIA 3GN1A 4MUEA 4R84A 2XB2A 4JT2A 3DB1A 1K7FB 1SCDA 5CA0F 4RZ3A 3D2AA 2XNHA 4WT7A 5K6TA 1YJXA 3CF4G 2PX6A 1MHPA 2Q3EA 2NQTA 2PKYX 2BF4A 3LDUA 2CEKA 2I6FA 4JU8A 4WLEA 5CH5A 1VBKA 3OHMA 2BGGA 3EW7A 3BFXA 4IDGA 2ID9A 3L7BA 5BW8A 4Z1MD 2OO5A 1AA9A 3M1LA 2HMUA 5IJ9B 1UPCA 3BXEA 3CNBA 3GH3A 1EA5A 3V8PA 3P20A 2XAAA 4RNDB 4Z49A 1QZZA 1U81A 4A6PA 1N5KA 4HQ0A 1KKMA 1LV8A 1NUQA 4DR4B 2V9PA 1A04A 4RMHA 4XIJA 2JVKA 2OWDA 3PNYA 5IAEA 2VPQA 1T3SA 2VH5R 1ZCJA 3TLEA 4M36A 5CXXA 2V3CC 1FJHA 4UAJA 4NEQA 2E21A 4FX2A 2KI5A 1SBIA 2OUIA 1QP8A 2OZVA 4HWOA 2LW7A 1K97A 1Z12A 2EQAA 3NHBA 1OX4A 4G8BA 4TTQA 4ECEA 4BVFA 5BR7A 2Q49A 1ZM7A 1K68A 4TS9A 3K53A 1BMDA 3OJWA 3AJRA 3HEBA 1NJ8A 2PVPA 2FSPA 2Z2IA 3OJLA 4Q4JA 3FKQA 2V7EA 3N1UA 1NL3A 4R8SA 4YFYA 2DT5A 2BI7A 2JIZD 4F4DA 4UOEA 6PFKA 3WYAA 2AH5A 3FX2A 1LTQA 3O0TA 5BUSA 1E8NA 1QYDA 1A2BA 4R8RA 3GFGA 4KZKA 3S0JA 2CJFA 1FNSA 3H8JA 3UQYS 4EHJA 3BXZA 2CVQA 4B6FA 2Q4BA 3CSSA 3Q10A 3UAWA 3AR7A 1JGTA 3G2KA 2GEKA 1W76A 1NC1A 3TM5A 1SJ9A 2JI8A 3KPWA 1E63A 2H1CA 2NZXA 4G1UC 4RPJA 5K6RA 3O2QB 1DZ3A 1X7DA 3PRHA 3TLBA 5HZMA 1N1DA 2IPNA 3T5GA 4R1MA 1HG0A 2VBFA 1G8AA 1T3LA 2FG7C 5LU8A 1GCIA 1QUEA 1JHDA 3HB9A 4IMRA 3MTBA 5EPUA 5IM5A 3VO1A 2PO5A 4XRRA 4Y2HA 2OAQ1 1M33A 2QA5A 4OCZA 1MABB 2H4YA 2C2YA 3HDYA 5JUWA 4IEFB 5HRUA 3ZDFA 2E55A 1YI8A 4Q1DA 3AW8A 3K31A 3RK4A 1HKUA 1U9IA 4HPJB 1NW3A 1L3CA 4YJKA 3G2QA 4B09A 4X6XA 5J40A 5DMXA 3STTA 2ZT8A 1H2WA 4CRWB 2V03A 3R6WA 1LK5A 2O1EA 5HRCA 3WKBA 1VI5A 3QVGA 2W2LA 1DADA 4KLNA 4F3CA 3L8YA 5GQSA 4DUZB 1MA3A 4XUEA 1H9AA 5JNVA 4HDCA 3LRTA 4WESA 4XCXA 4S1NA 4F3RA 4OSPA 2OUKA 5CU7A 2L17A 2IOFA 1W36D 1NT2A 3MTEA 1V9CA 2ZGVA 3D7KA 3HPRA 4OXIA 5C18A 5K3AA 2FQWA 5MDHA 3KZNA 2EAUA 2A33A 3H42B 3THXA 4XSHA 5HOEA 1AF4A 2B8NA 2ZUCA 3FPHA 5C5EA 4RJJA 1C1XA 3T7SA 3HJCA 5KNCA 3ZWXA 5JCZA 1GAXA 1UMCB 1YHYA 4LWOA 4AAYA 5B5SA 1I4LD 4J7XA 2GXAA 1U99A 2VQ6A 4XJTA 4C1NA 3DVLA 4RCYA 1IY0A 3KKLA 3DONA 1FQKA 2SKDA 4UULA 1JVSA 1GUBA 1OLXB 1KY2A 2Q0SA 2DQSA 1BCSA 1CJCA 3CNEA 3IQWA 3MTGA 4P8RA 1NAHA 1Z6ZA 2JASA 5FL3A 2UZ1B 4D3YA 1ZPDA 3GA5A 4OH7A 3HVJA 1GPH1 3RT1A 2IKSA 3OKPA 2OV1A 3DKPA 1CDZA 3O47A 3RKRA 2GTIA 1AMNA 3SICE 2IT1A 2C5BA 2WB4A 3NIGB 2C7QA 2EHDA 4L0DA 4UAVA 1WV1A 4MWBA 1FYXA 1Z07A 2X4LA 3JSXA 2JEZA 3RF7A 4AF6A 2CYCA 3B82A 3L18A 1Q11A 2UZ3A 4BXOB 2FKAA 1SEVA 1VCOA 1TA9A 4EG5A 1MNQA 1W85A 3HLTA 3HZHA 3ZGNA 4D9NA 3P32A 1BO6A 3P9PA 4LBYA 5J4VA 1M2NA 1Y0BA 2EW2A 3R5TA 4L3OA 3H3JA 1NT4A 5AHKA 3TJMA 2ZE6A 2HA6A 1IZZA 4HBGA 2NTNA 4YECA 2AUNA 4BX3A 3HDVA 1M1YA 2N3ZA 3DTTA 4QBIA 2QRKA 3LMKA 2VLIA 5JXGA 5LA6F 3CYFA 3EVNA 5HK9A 1GUYA 1T2FA 3SHTA 4GP6A 2WJIA 3ND8A 2FOLA 2IYAA 4DJFC 3CO0S 1E79D 2VBCA 3DKIA 4GVPA 4OMCA 4CF3A 2I9PA 4Z1OA 3UIEA 4TKUA 5L7TA 3AF1A 4KWCA 1RW4A 1YZVA 1KZ9A 1V1MA 3MWJA 4JJEA 3QP9A 3BTVA 4YMHA 1ECCA 4OL0A 4GX2A 1XEWX 3R8FA 1N2HA 3WAKA 1H1LB 1MOZA 1ZI6A 1QG4A 1ZSNA 2VC2B 2WNIA 1G63A 3ELDA 3ND6A 1TQHA 3EXG2 4L0MA 4RELA 3UATA 4E15A 5KCMA 2XW6A 2OV6A 3I9LA 2QPOA 2JIBA 5JFTA 5L45A 4QUDA 1JFTA 1O5IA 1JS1X 2BP7A 3N05A 2CMFA 3PUJA 4MJ3A 1UOEA 3AIOA 4KG7A 4YTEA 2PM8A 3NHJA 1L8QA 5AW2A 4PV7A 5IXJA 2O48X 2RBKA 3MTAA 3DTNA 5P21A 3WQQA 5KU7A 1CYEA 2FEAA 5EJ5A 3D0QA 1ZL2A 1NTOA 3BRQA 1Y1RA 3TLYA 2FZLA 1LXCA 1G6KA 3GCZA 5MFPA 3EGVA 4FCWA 2EX1A 5DSXA 1G5FA 2B1GA 3DFMA 1WUJS 4UNIA 3EC2A 3UQZA 4KVAA 3GJTA 4FNAA 4LE1A 1JKFA 1I4WA 2XCIA 3VDQA 1JVNA 3X3HA 5CA1F 2X41A 1XJCA 2FLVA 5DULA 5TEVA 3QE2A 1X19A 1G64A 3LDHA 4I5GA 3BL5A 3B2NA 1R1DA 4JKYA 4TWAA 3BXXA 1IY9A 5E0KB 4F5EA 1JEYB 1BROA 1ILEA 1JYSA 2D5IA 2Q27A 4RNCA 1R6UA 2WSBA 2YNMC 3MWGA 3U3OA 3FHTA 1A69A 4OUDA 4BB9A 1KMHB 4WZAE 3CVXA 3LGAA 4DLTA 1O4VA 3COPA 3MCWA 3KVYA 3G82C 5ENZA 3JTEA 2VO1A 1E8MA 2POCA 3SD7A 2ENUA 2H1RA 4DXHA 2QRHA 2GD0A 1H9CA 2CNWA 3AB3A 3PFCA 5TEWA 1ADFA 4EYKA 4XPIA 2OQVA 2C04A 1EFVB 1XKQA 3DVQX 4GX0A 2PJRA 2R7NA 1VIYA 4YIKA 5EHQA 3IKMB 3L0BA 2DMRA 2AX3A 1JBKA 2IXGA 4YT4A 3LPDA 2R84A 4D3XA 2YOFA 3K4QA 1UXIA 3U3KA 4ZEVA 1SOWA 1PNQA 3D6MA 3GOQA 1WUIS 2AQIA 5ITZB 4TMZA 3OZRA 3UGTA 1T5LA 1E6CA 1Z5NA 4UHEA 1CE8A 1GNRA 3SAJA 1NOJA 4D4JA 1V48A 3AETB 4NU5A 3WLNA 1Z5VA 5DCWA 3VHXB 4F5YA 2C5AA 5B4UA 3L0CA 1FPMA 4EB6B 1Y8QA 2QZPA 4G23A 4QG7A 4Q9IA 3VH3A 4ZMRA 3TRKA 3C15C 1U9YA 2F90A 4Q1EA 2QTHA 3L92A 4ZOCA 3WO1A 2W00A 1ACJA 4B3BA 1ORHA 2IYYA 3NVDA 1WW3A 4HMQA 2JD0A 3IEVA 1JLLB 2XZTA 3DE1X 3I52A 2A1UA 4KPUB 4P5DA 4II2A 4EBFA 2UXCB 5ESXA 3CS3A 4PPGA 3AW9A 3GVIA 1IDN1 1P7CA 3GT0A 1JHQA 1OI4A 3K09C 3JRXA 4NATA 3L9XA 2BCJQ 4HGPA 5ALWA 3TD9A 3HFGA 1RQPA 2GD2A 5ALPA 4PO8A 4BATA 4DCTA 3M9WA 2C7VA 1RHQA 3HR8A 4HTAA 3EF1A 4GOXA 5DHRA 1HT2E 1A1SA 1DC5A 2EBUA 1R27A 1QQ7A 2G8LA 4D3DA 3OBBA 1HDOA 4BQRA 5KPDA 3MTDA 4HLDA 4TWZA 4D26A 1YQDA 1PUIA 2EYQA 1V9SA 1Z33A 3R1IA 5B3JC 3PL5A 3JQAB 2I78A 2A7QA 2W2TA 1CE8B 3MAJA 3QVJA 4GLBA 4CEHB 3LWZA 5LP6B 1YT5A 1ZVVA 3I42A 1FQOA 3L6DA 5TSDA 3NR2A 1P1KA 3T4EA 1E96A 3DL0A 5E4TA 1KO4A 2C7GA 4YGYA 1M1NA 1O5TA 4GG1A 5K5EA 4XFDA 3I0ZA 2BCGY 4IUCS 1NBHA 2VS1A 3LX8A 3N6XA 2ODTX 3DV0A 4O2BB 7REQB 4DZRA 1E98A 2DWUA 3MJFA 4OQXA 4Z8XA 4G01B 1EFRD 1NLZA 1M10A 2J7PA 1Z6TA 5DF1A 1CDDA 3L8MA 5HTKA 4D9HA 5CDFE 3PCTA 1AU9A 3DT9A 3FBGA 3JVEA 3O5AA 2QMUA 4ITVA 4EQ6B 5ICMA 5K0ZA 3KQUA 1UEIA 3FRIA 4RVSA 3HCWA 4FI3F 1QDEA 4NI5A 4R3NA 4HPXB 1RYFA 4H16A 2W9XA 2IPMA 2I6XA 3UJ8A 4DIUA 4IZ6A 1OLXA 4BLOA 1J2YA 1D09A 3WBFA 1RLTA 4WOPA 3TTUA 4I4TA 2V7TA 2C20A 1VKRA 4DKXA 4GD3Q 1OV4A 4ID3A 2GPJA 1EUCB 4R1TA 3GLIB 3TLXA 1I4OA 4KYIB 4HI0E 5KVVA 2XCSB 2YZGA 3C4QA 2HNBA 2JJYA 4LI0A 1PTKA 1KAOA 1VIAA 3SVLA 3KVNA 4YUVA 1Q16A 2GYWA 4MW4A 5EPEA 3WB2A 3TPCA 4AZWA 3BMQB 1XEXA 1W4BA 3OZCA 4HWRA 4TZ6A 5ELLA 1D4FA 5E1BA 4AT1A 2EIHA 4FFVA 1VE9A 5FPPA 5TS2A 4YLYA 2O5RA 3AO0B 4OOEA 3OEYA 3S2SA 3M7IA 1FA9A 1UAGA 3DGFC 3Q12A 4KPEC 5D5HA 4J49A 4B74A 3M4NA 1G6HA 4UM9D 2H48A 1L4GA 3D8TA 2BLLA 3GVHA 3IPAA 3TMAA 1K8XB 1XA0A 1YA4A 2OQ2A 3FOWA 1XALA 1GU7A 5I45A 1MB2A 1VZ2A 3UB2A 5J9FA 6ADHA 1COWD 5HR5A 1CTQA 2ZBFA 4TKUB 1LI7A 3KZVA 2IXFA 1FMJA 1XCBA 3HFJA 3RNLA 3HDJA 4NOJA 5LL6P 1E3IA 2EW1A 3FR7A 3DE4X 4HK4A 3QW2A 3R44A 1SZDA 4MV9A 3N8NA 1NI4A 3DS8A 3IX7A 1QX3A 1E2NA 4FGJA 1BHQ1 4LYGA 1E69A 1JV2B 2WF7A 3M5DA 3RTAA 3A11A 4W63A 1BA3A 3Q8WA 1CVLA 3VTAA 4QU8A 4YMTA 5IDXA 4Y0VA 1C7ZA 1E5VA 3WRXA 4ZGBA 3AR5A 1T3GA 4D44A 3MWEB 4S1WA 4DJTA 1QHGA 1M76A 3AEXA 4C2BA 3L0YA 2HF8A 2DUJA 2P3OA 1ODKA 1FNMA 2ZSKA 5LVAA 3N0XA 4KUHA 4AC9A 4H7JA 5MN5A 1N36B 2J6CA 1FFSA 2LKDA 1FLDA 2RONA 2WKPA 3DEZA 3HHEA 4N0QA 4MHOA 1AA6A 4KRXA 2QZ9A 4OHRA 1F0KA 2AFRA 1CIPA 2FI1A 2XKBA 3O2SB 3PYXA 1P9OA 4GKAA 2VPYA 4QDOA 4X6YA 4YMSA 3EGOA 3EG5A 4LMBA 3RU3A 3NGXA 4D2IA 3RYFB 1EZ4A 5CH8A 3GELA 4O2BA 1QK3A 4KH1A 1A7KA 4TXLA 3TIXB 7REQA 1EX9A 1VC2A 3FJOA 2XKJE 1Y5IA 1CS0B 1I32A 2FDRA 3DWIA 1ZUHA 4O2AB 4UTZA 1CEXA 3A9UA 3FCSB 4GGOA 2CWWA 2ET6A 3CRW1 5BN4B 3ZWDA 4IH9A 3K6KA 3DW3X 3D5TA 1NWCA 1M7HA 3EQ2A 3Q7TA 5DEOA 5M2QA 3LA8A 1DAFA 3NJ4A 3SSNA 4IKEA 4DCUA 4OMFG 1OPRA 4RHCA 2OM6A 2P9YA 1AUQA 1W48A 3HKEA 4GFDA 3PXCX 2QRVB 4JGIA 4P2GA 1W30A 4FR5A 4FT2A 4QA9A 3C70A 1TJ3A 2YY6A 1GXSB 3VX4A 2FMTA 1GV0A 2KJQA 1P4AA 2PD4A 3PF9A 4RABA 3TTWA 3ZQ6A 1F2TA 3UFXA 3M2PA 5AOVA 1BH6A 4MO9A 3CW8X 3G85A 3MRXA 4U63A 4B5LA 2QENA 4UCQA 5DO9A 2V7XA 2DBQA 5F9MA 4BAGA 3UV6A 4YI5A 4JI8B 1DQPA 5F3WB 4EW2A 1W581 3P0EA 2WHRA 4G5QA 2ROQA 2UYHA 1W87A 2JEYA 3WC4A 4BMPB 4HH4A 5KTYA 2A9KA 3WXMA 2PXHA 4LNUA 1SHZA 1TQ2A 4PFQA 4JXJA 4A8HA 1OQAA 4YAGA 4DHWA 1GRVA 1KEEA 1UPBA 1ZRNA 3B6IA 2VF8A 3LKDA 4GQBA 4U2EA 3ZK8A 1R50A 2CKMA 3ZW7A 1UK8A 5CVDA 3GFBA 1B0PA 3GEMA 3VBEA 4FFRA 2F59A 4XXHA 2I33A 5C2JB 1IG3A 2FQXA 2F64A 1EK1A 2I54A 1KOGA 4ETMA 5ECWA 1RYEA 4PLHA 2XQFA 5A2QA 4AJOA 1T9KA 1FXSA 4FHCA 4KMOA 1RM0A 4CKWB 3T15A 5ADWA 5ALKA 4I9FA 3HUEA 3W4JA 5IYZA 3AQIA 3AHCA 1JAXA 1E2MA 1KJNA 5FIUA 4EKIA 1N6IA 3M8KA 4WLNA 2OGWA 3CLRD 1EXNA 3MOSA 4B46A 2WR8A 5DGDA 1P5RA 3FSGA 1FW6A 4HNAA 3PL1A 4XPIB 2UUBB 4P32A 4BFTA 5A5EA 5DXJA 4B44A 2F3PA 3E8XA 1V4VA 1E7YA 3FGPA 4EM6A 5IN4A 5REQB 3V9AA 1WA5A 1Z0IA 1UIRA 3S27A 5KC9A 2EKQA 3WBBA 1VBMA 3RS2A 1QRRA 1E66A 4B8WA 3VISA 1HYEA 1C7RA 4QT4A 4MICA 1BGXT 3A1WA 2Q8QA 1TF7A 4O4IB 3WSWA 3PXAA 5E9JA 1QO0D 1WZ2A 2GK7A 2JGEA 2QAGA 2YJ5A 1ZH0A 3BWBA 3BRSA 3H75A 2DPYA 2QJWA 4LZNA 4ZAFA 1VL2A 2D06A 3H5IA 4CMCA 1B8UA 3TKLA 5GMOA 2HRDA 2PA3A 1VPVA 1U2GA 3QIAA 4UUQA 5C3UA 1IMOA 4PY2A 3I6IA 5ED0A 3F4KA 6Q21A 4YCDA 5I3CA 2QMEA 1R12A 4L4SA 2V54A 3NETA 3Q9UA 1YL5A 4KHPB 1Q92A 4GI7A 3RV4A 1G21B 3GJ3A 5KTKA 1HE8B 4F7WA 1OWLA 2F00A 4J0HA 4O29A 2F9LA 1G7SA 1EX1A 2OYRA 1T5HX 4AWAA 1JG4A 4FCCA 1EWTA 1NVFA 4AP5A 4MIYA 4CIDA 3R5HA 1KORA 2L2QA 2ZRCA 3A1VA 4DSTA 4AW9A 4UXIA 5FWDA 1VGVA 1T2EA 2X0FA 1P1HA 5IAOA 5TMPA 5JCJA 2AG8A 1F20A 2O3JA 3PKIA 4FHZA 3U7JA 2HSZA 2YZMA 3SN6A 4OD0A 4ETNA 1QKJA 1BGVA 1I7LA 1J2TA 1SIOA 1U2EA 2HIMA 2X0KA 2XOXA 1AURA 1OGYA 2ZPAA 3LF2A 1JFLA 4I08A 3AY3A 4IQ0A 1AV6A 4ISBA 1KFBB 3AEYA 4P54A 3HCNA 4TLLB 1DARA 4ZO7A 2ZTHA 3TZLA 3A4NA 3OQIB 1SD2A 3W5VA 3PXEA 5JJLA 2FRXA 1K4YA 1M54A 2VRWA 4MW9A 3EXHC 4QNMA 3GCDA 5AT1A 2PKRA 4DNQA 4RK4A 3FMIA 2XIQA 3HSYA 4FXPA 4TKMA 3KU4A 5CMLA 1K6JA 4BO3A 4TLMB 3EODA 2GHIA 5HKAA 1ZITA 4JNCA 2F4VB 5JS6A 1M5TA 5C37A 2XA9A 3GUZA 4YDRA 4MROA 4UDXX 5HX7A 4JXXA 1AZSC 3RFXA 3PUKA 1QVWA 5EQJB 1U8FO 2R6GA 4UBJA 4GT1A 3CPEA 4U2GA 1ATZA 4U6SA 4GF5A 1KHTA 4KKXB 4RW0A 1QFZA 4KITB 3R0XA 2Y1LA 3TXXA 3BKWA 2V55B 2XXJA 4NK5A 4FJ2A 2V8OA 4RAQA 1RWBA 5JDCA 2CXXA 4XOIA 4AQ7A 1UXKA 3IUMA 4GQIA 4HAXA 4JY7A 3T0FA 1H1TA 1UBKS 5ENVA 2XGSA 3BJIC 4LV8B 1R9JA 3AONB 1X7WA 1ZI8A 4BZPA 4PFJA 3R76A 2O50A 2ATCA 3QJYA 4BV2A 3IBCA 2P9BA 3TZEA 2JZCA 2C4HA 2CLCX 4IKOA 1V4BA 4M98A 4X1YA 2AFHE 3PC4A 1XI2A 2EC5A 4UQLA 2P41A 4TMYA 2IH4A 2ZYSA 2OXTA 5MGNA 5TMDA 4LMRA 2C77A 1ZG3A 5IS2A 2X40A 5DNCA 3AIKA 2ENWA 1N9GB 5JY6A 4KNVA 1KU0A 4YPVA 2FPMA 4WQMA 3G2MA 3NWBA 5B57C 1FBTA 1GSIA 4WZBB 4GPIB 4AYTA 2XSZD 1ZNWA 3CEJA 1W19A 3HLYA 3KOWA 3CUEF 3OC0A 2ZM6B 2AN9A 2JLRA 3DVRX 1N2ZA 5DTQA 2OL4A 5CB4B 4H1UA 4M60A 4YJ3A 2P2NA 1RXEA 2CB9A 3LECA 1FRFS 4L1KA 1DG1G 1LRJA 3JD1A 3O8DA 4IR7A 1M6HA 5KQRA 4EELA 3OZAA 3R7NA 4EUSA 4FINA 5CYFA 1NVVQ 5HNKA 3REQA 2LPMA 2XA1A 3T3PB 1ZUD1 3JQ8B 2ZRHA 3LHDA 3ASYA 4EP1A 1ZH4A 1LSOA 3II6X 5FPHA 1WDKA 4LDZA 3VSBA 4DS3A 4IQFA 1ZLYA 4BEJA 2OCIA 2WWTA 3B5JA 3TSYA 4GBED 4W5WA 4B3MB 3IRVA 1EXMA 4EVSA 2O8FA 1AC5A 2NAPA 2QI9C 2A5GA 2YJ3A 3D3WB 3FCCA 3PEEA 4FZJA 4R1UA 4WVFA 2LD4A 3V7FA 4UMVA 3WLAA 5BSHA 1FNNA 3RUFA 5K8VA 3RSQA 5IZ4A 1KVSA 2IX9A 5E6SA 3EHDA 3QWFA 3C3WA 3A3PA 3OE7A 4HSGA 3BH6A 5ICFA 3W2IA 3U09A 4GKJB 3ETJA 5EP4A 3EQ6A 3RVDA 2PJDA 4RDHA 4NYJQ 1P1BA 2KLBA 3HNOA 3EBOA 4M22A 3WLTA 1UMKA 2RH9B 4FC6A 3BL6A 2IZ6A 1FUEA 1BKDR 4OAPA 4WCFC 3VNAA 1V3QE 2FN7A 2FETA 3NCHA 4L73A 1YS2X 3JPYA 1MB0A 1C8VB 1W96A 2PKEA 2PGIA 2FPLA 3CF4A 4K1LA 3AVXA 3G9UA 1XWFA 1Z26A 3SYKA 1O87A 2W42A 1F51E 3ITEA 1DAKA 4NY1A 5CJPA 4EB0A 2LCFA 2QU7A 1N0HA 2ZSEA 2IPOA 4CFZA 2A9OA 3CZ5A 2VTEA 4RE6A 1UPUA 2WOOA 3PDJA 2CFTA 3L7YA 2GEVA 4M88A 4QELA 3SNHA 4FE3A 3VO2A 4JKOA 1YQGA 1ZN2A 1LBIA 5EHIA 4C14A 3EGDB 4W8OA 3AH8A 1P0PA 2H65A 3BZWA 3STHA 4BMSA 2CFIA 3HYRA 3ACDA 3NAQA 1KJZA 3A26A 2AIRA 4YN3A 4Z4IA 1GARA 3THSA 1G7RA 1X39A 2WILA 5KAPA 4DEXA 1YA8A 4ZVRA 3LQ2A 3QU9A 3ZLUA 3GJSA 3HSSA 4P3OA 3ZJ5A 4BU1A 1P1CA 4AG3A 2H2GA 4MRMA 4LC0A 4KV9A 3W5JA 1SXJC 5GGXA 1AG9A 4LQLA 1ZK2A 5LXTB 2X3FA 3T4UA 2FSGA 3O31A 2I4NA 3PYMA 1CEYA 3W8RA 4EG0A 1KNQA 1GL3A 4PZLA 4WNYA 3WHKA 1GPDG 3BDAA 1R8YA 4JC5A 3GRYA 2NU7B 1USIA 5E7MA 2QZJA 5KYYB 3L02A 3KT8A 2AJLI 3NP9A 2GSDA 4RPIA 4WJZA 3ROMA 1ZU4A 4AJKA 3VM6A 3FTEA 2NV0A 5GONF 2UYGA 4UTPA 1H5NA 1IB6A 2FP4B 2Z08A 4QYIA 3WRWA 3FH0A 1EK5A 5JI2E 1I9CA 4E2FA 1WXIA 3FIUA 3OQ6A 3T54A 1XQYA 2WUVA 4YRIA 2ECFA 4PZ0A 2R1VB 3E18A 3SBDA 2IHKA 2NUAA 4LRYA 1PJZA 4FHDA 5EXTA 3QPDA 3Q87B 2OWEA 5ALZA 1Z0JA 4BFWA 4QLBA 3KVVA 1PG2A 3RRXA 3ITKA 3DE3X 4RTRA 1RZ3A 2FKNA 2HRBA 3BZBA 4HFRA 3F3MA 1HORA 3I2JA 5IZCA 3WWCA 2ZUBA 3TWOA 5ULLA 4MJ7A 1ND6A 5FWXA 4W1PA 3U4AA 5KQGA 1JLSA 4AIIA 4MUHA 1V43A 4GLFA 3MCZA 4Z9YA 1CQJA 4GMXA 4D56A 4A0RA 5CIYA 1AGYA 3AKEA 3IV6A 1AS0A 1D0SA 5DGIA 4QXPA 1T2NA 2OPBA 3TVYA 2JLAA 2YNMA 4N65A 4FBLA 3VAZA 4CKXA 4AKTA 1GGFA 1KVRA 1YR7A 5A0FA 1DKLA 1KR5A 1V8PA 3Q3JB 1B3RA 1IHXA 1B2RA 2AZXA 1JAIA 1D2HA 4I5DA 4HQOA 4YCLA 4LWQA 3VGPA 4GZ3A 4HC4A 1MC8A 1WDMA 1QB8A 2O8FB 1IJKA 4KLCA 1VJ5A 2NUPB 1F5SA 3BSFA 3FCUB 4YMLA 2RGXA 3F6SA 4QVGA 3W5IA 1QG2A 1LEHA 2RHGB 2JFPA 4LF8B 4DY4A 3BPSA 2ILTA 2IS6A 4QUJA 3FYDA 1PT7A 1LPOA 1TQ6A 2AJCA 3IXMA 3WWZA 4LE2A 3ZWWA 4TS1A 1QGUB 1WCXA 3H2KA 4GXTA 5BOVA 4YXWA 4GZ6A 2NP7A 2C83A 1WETA 4CTKA 3VUEA 1EVYA 3OU7A 1ULBA 3NBUA 2A5DA 4J0EA 2YBEA 4D98A 1DTEA 3E03A 3SC6A 2R9VA 1FDRA 3T7EA 3PEUA 1TQ8A 2GZ3A 3ZIAD 3I5AA 3WIOA 3SE7A 2VTKA 5FXMA 5HWSA 2JCYA 4CL0A 2PWAA 1E4EB 1UJNA 1JDNA 3QLTA 4N40A 5E95A 2I8LA 3WYDA 2ZBGA 4N6GA 5LXTA 4NARA 1M8GA 3PSAA 3H3XA 2PJUA 1TQDA 4LY9A 4ZHQB 1JPJA 2ZT7A 4INPA 5DGCA 3QF4B 5EE5B 1N2EA 3OJFA 4QOSA 1N9GA 1CV2A 1P3Y1 3UV3A 3L46A 4IOLA 3AY6A 4P08A 5T3YA 2G80A 3VJMA 4UOZA 5JOQA 4UDYX 3FLAA 2QG6A 1V8OA 1NJ5A 3G8YA 3KPUA 4QU5A 1FU8A 3FDIA 1EINA 3OE5A 3OIVA 2A88A 1RAIA 1XQWA 3MBOA 1WXXA 3E5HA 4MV3A 1EP9A 5KSPA 3JQ6A 4IIBA 2JB9A 4Q12A 1CDEA 5IVHA 2PH5A 1GKYA 1PW7A 3OZEA 4MP8A 4EKEA 3HBNA 1C5KA 3H7AA 4ASUA 3QYFA 1VMIA 3ANYB 3UK7A 2J07A 2PPLA 2WKSA 1GR0A 4FU0A 2QYTA 1HL7A 2C5GA 5JROA 1N8TA 5ICEA 1DAEA 2Z4RA 2M1XA 1YFKA 3OUTA 3OZXA 1TYZA 1DKNA 2OG2A 3AV3A 3HVKA 3LC1O 1DLJA 3PLRA 4N3GA 1TMGE 4S2EA 5L7YA 5LWQA 3WIBA 4MIKA 5BT9A 5BPHA 1S6YA 3GLVA 4EYGA 3GJ8A 4J1TA 4RD6A 1TZ2A 2UKDA 4BNVA 2Q3JA 4HRAA 2Q62A 4TX1A 1IPFA 1E5TA 4LDJA 4ZTBA 3EZ7A 3ZEAA 4JJGA 1UT6A 1LZLA 4G1FA 1I3OA 2XCUA 5FBQB 2IHNA 3I0NA 1P2UA 2OG1A 3BD6A 5SY9A 2O7SA 1H0SA 1X1EA 2JIMA 3RSSA 1CQPA 1MV8A 2HHLA 2YWHA 4I3GA 2R8BA 5AK0A 4KXYA 1Y1LA 3HWWA 5IBCA 1RPJA 1RYMA 2XNJA 2G1PA 1CR2A 2FWRA 1W4LA 3BGVA 4G5HA 4F4FA 2WABA 1P1FA 4C0QC 3T38A 3FPBA 4EA8A 2VSXA 1KFJB 1TT5A 2UVPA 3AERA 5IX8A 3C3EA 2IGTA 4L16A 3W6PA 3EXFB 4NJEB 4WNCA 1T4CA 1I7QB 1K8YB 4KMRA 3RE1A 4J7UA 2G04A 3N5CA 1NVAA 3L6UA 5JSUA 5G4KB 2H4ZA 4FUTA 1IONA 2P4EA 4B2YA 9LDTA 4JV5B 2VKTA 3BGOS 3RI3A 1Z39A 3SJ7A 3CLTC 4DLKA 2ZJ5A 2YVLA 4MRMB 4YO7A 3TNJA 4H31A 5EA2A 1ZSYA 2B0CA 4YP0A 2O2JA 4ILKA 3SHQA 5E1MA 2CXNA 5DBEX 1ZD3A 2GUWA 2FEWB 4DJDC 1OXTA 4C05A 2PUGA 4EZIA 5GIPE 3SC3A 3NFRA 3EEFA 3M70A 2JIQA 3R8XA 4RKRA 4BV8A 4BVKA 3ZS8A 4XWGA 4TVKA 1PSZA 3QJ5A 2VQDA 3Q15C 1EFCA 3G7SA 2XKAA 5F51A 1TKAA 2O3UA 4BO5A 5L53A 1XJQA 4HLNA 5AW8A 4W7IA 3C5EA 1M8PA 4DQ0A 1X8XA 5K4HA 1SHJA 2QW1A 4BDSA 3GRKA 3H5RA 4A0GA 3OQVA 1R0CA 2IU4A 1BE0A 4G9GA 2OHFA 4GRIA 3ESYA 5J58A 2CLEB 1NQWA 3NFYA 4ZC1A 2W2KA 2HUPA 4BP3A 4D42A 3PVZA 4D97A 3U4MA 2CUKA 1M0TA 1EH5A 3C6YA 4L22A 5MN6A 3NWPA 5L9AA 5JAIA 5CB6A 4RTNA 1LX6A 3CSUA 3IBSA 4GBMA 4M6WB 3UXMA 1XP8A 3WRYC 4KR3A 5CIQA 2P69A 4R01A 2NPOA 1ABEA 8MHTA 2P2SA 3VSAA 1N2CA 2CVFA 4R2MA 2CXUA 2NUAB 3VOBA 4CUZA 2F48A 3W5SA 3EQ8A 4WXPA 1RI4A 1V71A 3TEJA 2ACEA 1I0IA 2K7ZA 4C4XA 1W5AA 3HFRA 4Q05A 1BH2A 4C7VA 1ZNZA 1TO1E 2VSFA 3P0IA 1AQIA 4HXGA 1UUFA 4FYIA 2XKKA 1XA4A 1EIWA 1F8XA 2JATA 4HF7A 1JJVA 2OV2A 2B30A 4GC9A 4TRJA 1NNSA 2C9BA 4Y1RB 4O08A 1LK0A 1PR3A 1T3HA 1WCWA 2IA5A 3EF0A 1DQYA 5EHNA 4PSKA 2YBDA 2CFOA 3KJHA 4KQ2A 5J63A 3G7NA 2VHJA 4F96A 1AF7A 3NS7A 2DUNA 4JVSB 4DUGA 2WWYA 2FUG1 4Q02A 4JR0A 2XWPA 3GLIE 4CGYA 4IO1A 2J67A 5LYJF 1N77A 3AUTA 3ON5A 4KODA 2HO5A 4MV7A 4MVJD 3R77A 5CLIA 4IIJF 3EULA 2O2SA 3SOPA 1IY1A 1RMYA 3BMOB 4AJ2A 3QOYA 1XF1A 5F1YA 4BRWA 3ZX4A 4QT0A 1GV1A 4KK3A 1P31A 2VI5A 3EVAA 3NJRA 2RKOA 4KMMA 4Z0HO 3ETDA 4LOHA 5J4YA 5CITA 1J1IA 3LBHA 4GM1A 5DRYA 4BNFA 4PZEA 4X65B 5DXFA 4DNOA 4ZV7A 4IDFA 3UXEA 2VUUA 3EGIA 4KGXA 1CKEA 3TFOA 4MRSA 1NY6A 5JYEA 3JRWA 2BBWA 2E4XA 3AXSA 5KX5B 3QEKA 2CLSA 3HADA 3U31A 1R4AA 2J4DA 1O96A 4EHKA 2W90A 1T25A 2WP8J 4HTFA 4HGOA 2MSLA 3S81A 2O20A 5J2UA 2FGKA 5ALHA 4ITRC 1G20E 5AESA 2HLHA 2VK2A 4BVJA 4NK4A 1Z4LA 4HXEB 1QF7A 4LJAA 3G9QA 3TN7A 2XTNA 4M1YA 3FMVA 4HDKB 4NV0A 1SXIA 1U8EA 1DIBA 4V0KA 3WLHA 3WGIA 5DBFA 4PSDA 1KIFA 3ZQJA 1G5PA 4MCHA 4BNNA 4PQGA 3UW3A 3PF8A 3N2EA 3OZSA 4L9RA 4EY4A 4PG4A 4JI4B 4CGZA 1NTRA 2O06A 2UVQA 3LCRA 3LXRA 3TG2A 3LFTA 1Q17A 5JEDA 2IRWA 1WD5A 3KSUA 3M83A 4XAQA 2N47A 5JADA 4Z5XA 2OVFA 1GNTA 2OYCA 4RQUA 5DYYA 2XHEA 4B3SB 2XUDA 3FVVA 4QPDA 2OQIA 4M49A 3C4VA 1DUIA 4P4SB 3GDWA 1I0LA 1N0IA 2PKCA 4UU7A 1C30B 1ZM9A 4PPYA 5K3SA 2BR5A 1LK7A 2OLKA 1KIAA 3FB4A 2R25B 4ZT6A 2IXTA 4WEOA 5T4HA 3RVRA 2ZDQA 3LQKA 3B9RA 4MVJA 1HI9A 5JH7F 3AVQA 1KE2A 2DPMA 4EVRA 3SFVA 3A1EA 3NHPA 4W9RA 4OGFA 5ALEA 1C3JA 2DX7A 2GVZC 4BRSA 1IXYA 1XNQB 4EI8A 3SIXA 4CT5A 4LJ6A 1TYBE 4MVWA 1RU3A 2NGRA 3H97A 1M6WA 4LW8A 5BY2A 4D9CA 1D5WA 2XYHA 1UBFA 3KO8A 3B3QA 3MMSA 1YZHA 3UYLA 5D51S 2ZIEA 2VZ0A 4BPBA 1U7ZA 5FDFA 4CT0A 1T9CA 1IN6A 1EM6A 2BHRA 4DT1B 2XYRA 3H5NA 2AE2A 3GIDA 4EATA 4B75A 2YHIA 4BMZA 3SLKA 4HUQB 1DRVA 1IUNA 1UBGA 4KRGA 1DBQA 1OZAA 3LK7A 3PNBA 4E70A 4C76A 2PS0A 4G26A 2BWJA 4EQZA 3FWHA 2P5SA 4WBNF 2DP4E 2DSNA 1KJ8A 4V1CB 4JI7B 4TLCA 3E4DA 3KQLA 4UU8A 2PYDA 3V5NA 1I36A 3H05A 3MYRA 3J7TA 5EIXA 1MEEA 3OZUA 2G72A 2EEZA 2Y6VA 3PNLA 4YIHA 3E05A 3QX8A 1M0EA 4K6FA 4RTMA 1G21E 4W5NA 2YFYA 4WH0A 5HE8A 2A0UA 4MUYA 3LWBA 1LJLA 2NVBA 2Z5GA 2E82A 1WXEA 2C9YA 1FIUA 1H4VB 5EIAA 3GLFA 3A4LA 3HKCA 3TNFA 2GK4A 2J3EA 1OX5A 2H92A 1PIWA 2HXYA 1NIJA 1RQGA 3OEED 1EM8B 1RAHA 1XNHA 1K7YA 4IJ6A 5AI6A 3DKKA 3N8GA 5ERYA 3WDMA 3U56A 1PL6A 4JB3A 2AGVA 1E2JA 2RHTA 2HRZA 1P5ZB 2IHZA 3IQEA 3K9GA 5IKXA 1C3EA 2I3AA 1T9GS 3M3HA 2EHJA 4ODIA 2RJNA 3HS3A 4HWTA 1HETA 4H3HB 4NQRA 1LVHA 5H3LA 2VWQA 3B9QA 2C8JA 1CUHA 3LYHA 3NYIA 3Q5EA 2XYGA 3ULKA 5LZ8A 3RUAA 2CE7A 3HCEA 3FPLA 3H2ZA 1DELA 1KZ7B 1LH0A 2W2QA 3N2KA 4U8HA 4N5DA 2QN6A 3ZI4A 4IDAA 4HBZA 4EGQA 4PGHA 4ZU3A 1JMKC 2ZBQA 4RWZA 4YFVA 4IHAA 3G2OA 1ZWKA 5B7NA 1Z4JA 1LI5A 1SKBA 2LRHA 2A58A 2YIVX 3E9QA 4BP9A 2R7KA 1KEZA 4GGPA 4DA6A 3WL4A 1US8A 2CL7X 4HDRA 4HJRA 3AVVA 1IJEA 1VA4A 2ICAA 2I71A 4JHLA 4K9LA 1U9IC 3QFHA 4L76A 3SDZA 4IEIA 1W93A 4MR8B 3IDAA 4MMZB 1U3VA 3JD3A 4EF4A 3QPBA 5IJ0B 2GNAA 1YS9A 5F1KA 3KQTA 5FNVA 5J47A 1Y8QB 4PYRA 1RI3A 4RDCA 1PZEA 4MA5A 3ILHA 5JD3A 2DQ4A 4TTJA 2Q5HA 4Y6SA