1XTVA

Sulfolobus solfataricus uracil phosphoribosyltransferase with uridine 5'-monophosphate (ump) bound to half of the subunits
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable uracil phosphoribosyltransferase
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xtvA00
1P4AA 4RAOA 4M0KA 3GGCA 3OZGA 5IAOA 4M0UA 1A97A 1J7JA 1ZN7A 4LZAA 5ESWA 4OHCA 3HVUA 1DQNA 1DKRA 1A95A 4QRIA 5BQPA 1I5EA 2H08A 1D6NA 2FXVA 1TC1A 4X45A 1STOA 1VDMA 1XTUA 3KB8A 1ZN9A 3NAGA 1QCDA 1ECBA 1ECGA 3ACDA 3EFHA 4LZOA 1G9SA 1ECCA 4QYIA 4LZNA 4RHUA 3ACCA 1UPFA 2HCRA 4KN6A 5JV5A 1I0IA 4RACA 1QK3A 4RV4A 1GPH1 1PZMA 4P82A 1A98A 4RQAA 4P3KA 1DBRA 1I0LA 1P17A 3N2LA 4RHXA 1CJBA 1HMPA 1OPRA 4IJQA 2E55A 1BD3A 5EUCA 5BRNA 1G2QA 4RABA 1GRVA 1L1RA 1P18A 1JLRA 4S2UA 3GGJA 1ZN8A 5ESXA 1JLSA 4RHTA 1LH0A 1HGXA 1O5OA 1UFRA 3S5JA 1NULA 4P81A 3OHPA 2JI4A 3LPNA 5HIAA 2PS1A 1IBSA 1W30A 2C4KA 1XZNA 1AO0A 1BD4A 3DEZA 2H06A 5K51A 4PFQA 1OREA 1QB8A 1A96A 1I14A 1ECJA 1QCCA 1R3UA 2AEEA 2DY0A 2JKZA 3MJDA 1QB7A 2XBUA 4JITA 1U9YA 1XTTA 2GEBA 5KAMA 3M3HA 4RHYA 3H83A 1ECFA 4WN3A 5BQOA 4QYIB 1G9TA 1VCHA 2JKYA 3OZFA 4M0PA 4ZFNA 3DAHA 1DQPA 3DMPA 4P83A 1A4XA 2PRYA 1FSGA 2VFAA 4PAWA 1XZ8A 1O57A 2WNSA 4RAQA 3LRTA 1XTVA 4X44A 4FYMA 4WMLA 3GEPA 5JSQA 4RADA 2PRZA 4RQBA 1A3CA 4MB6A 3G6WA 2JBHA 5KAPA 1UPUA 4P84A 4LYGA 1L1QA 1VSTA 5BSKA 2H07A 4JLSA 1NONA 4RANA 3QW4B 1MZVA 2EHJA 1QK5A 4P80A 1V9SA 2IGBA 5E38A 1I13A 1P19A 2P1ZA 4F8EA 5IPFA 5HKLA 3O7MA 1YFZA 4LYYA 1OROA 1Y0BA 1G2PA 3ACBA 2YZKA 4TWBA 1Z7GA 1WD5A 1TC2A 4Z1OA 1QK4A 3MBIA 1DKUA 1U9ZA 1BZYA 4P86A
chains in the Genus database with same CATH superfamily
4YJGB 4YTEA 2XNKA 5BUSA 1CYDA 1NMYA 4IZ6A 1I80A 5DT2A 3IDZA 5JEEA 4RPCA 1NYRA 2PMKA 5BMVF 5B6JA 4YCNA 1NOIA 1JDVA 1W4AA 4EEZA 3ZLUA 1C9YA 4JEUA 2ZRDA 1W8DA 1XIVA 2ZRCA 1IQ0A 3TQHA 4ABYA 1VI2A 2WNHA 4QQNA 4Y2TA 2IEBA 1FRVA 3FNBA 3PHGA 1E63A 4PE5B 1JW9B 3NANA 1Y5LA 2IVFA 2QTHA 1M2VA 3M34A 3HNOA 1TK2A 2R87A 2BFBA 3UA3A 1FW6A 1JHXA 1FFDA 3TLXA 3GLUA 3KYDA 2FEPA 3RVDA 3EY9A 5LP6C 2X2FA 5AICA 1GUDA 1Y7TA 5LBIA 4US1R 4EVQA 3FDZB 3B78A 4KBYA 1QGZA 2P75A 4DDTA 3RG8A 1W4RA 2WLTA 2K6GA 2Q3HA 3IOCA 3LPAA 4RHCA 1SMKA 2WR8A 3IDSA 5I9MA 3WLRA 1QAOA 3DFZA 5DE3A 5NULA 2A3RA 2G06A 3IPCA 2Z9DA 4Y0VA 2WFLB 5KKAA 3ZYZA 3LF1A 1L6RA 4D6PA 1LTHR 2Z6QA 4CN8A 1NW5A 4PIVA 1JYFA 2HBRA 5IDWA 3ZXIA 1K7YA 5TY0A 4AG6A 1PQYA 2R6DA 1XAHA 1KJQA 4MB0A 3THOA 5EIFA 4BNXA 4ESHA 3OOSA 1ISHA 2WILA 1B93A 1XHLA 3SZRA 1H05A 4XASA 2WIAA 5LDDC 3R8XA 1RQGA 3ADPA 4Z0NA 5LQDA 3ISTA 2Z2ZA 4LKRA 5TMDA 4JVLA 1H93A 2PGOA 5I7FA 2IH2A 2JBWA 2QXUA 4BQEA 5HK8A 4L73A 1QZTA 1UWCA 5FEMA 4PAOA 3QE3A 5IHPA 3EMKA 3PFIA 1PWXA 4FFBB 4QUAA 3N5KA 4HYTA 4HEA6 2Y1XA 4V39A 5DISB 1L7NA 3EAGA 4LRWA 2NZVG 2PS3A 3PX3A 3RVRA 3CZMA 3N0TA 4G8CA 4GWGA 3U61B 3RVPA 4RQBA 5GOTA 2EFJA 3G6WA 3PD0A 3TZ6A 5KQLA 3WGYA 1YR8A 1F7VA 2PZJA 3AR4A 3I09A 3KEQA 3TB4A 1M2HA 1GLNA 5JS8A 1W19A 5ARCA 3UW3A 4UHHA 4C05A 1FIUA 4FGJA 4IOKA 5C18A 2ZBEA 4MVYA 3ZBQA 2A5JA 2HF9A 3AI3A 5ALVA 3B85A 1GILA 1PR1A 5F1PA 3GIDA 3A1EA 1YGYA 1ZK0A 3VI3B 3T95A 1XJ0A 3V00A 4B4OA 1CY6A 4NBLA 3SDBA 1II9A 5DNYB 2GZRA 3FOZA 3A6PC 3GLHE 2JI8A 3C3XA 3NC1C 2DWPA 1PJ8A 2GHIA 3LCJA 3QMVA 3QE2A 4RMJA 5FB3A 1X1CA 3PQCA 2I9PA 3BE6A 2GT1A 4PYOA 3QX3A 1SOMA 2CD9A 4ZMRA 1C3VA 5ECGC 4BHTA 3R0JA 2DX7A 1R9JA 1SUFA 4YJ2A 4ZJUA 1KOJA 2NV2B 3LLUA 4DIEA 3HUFA 4XI9A 2YUTA 5GY7A 4ZJYA 4Z54A 1E3SA 1UM9A 4R01A 3TVDA 1Y1KE 3GVXA 4G1CA 4RL6A 5L3SB 3E03A 1MDBA 4QGHA 1DRKA 2WJWA 1DXYA 3TFQA 4DRXA 4MWSA 1IZ9A 5EYPA 2BPOA 1CQJA 3TRDA 3RAGA 1EE2A 3DEKA 1JA1A 4BMDA 2Q7OE 1G6OA 3RQIA 4KQ2A 2J5RA 4L27A 1T5DX 1Q15A 721PA 1QX3A 3FA2A 3LUPA 5H4GA 1UKAA 2ZB3A 1KORA 4YRKA 2IHBA 2QT1A 1G8FA 1W4ZA 4UEKA 2AVNA 1Q0UA 5C8YB 3LXMA 1H6CA 4HBZA 4B3HA 4WCDA 2W22A 2WFMA 4KAXA 1PZMA 1TK3A 1UXIA 1SOVA 1ZH6A 5K09A 1VKOA 1ZOOA 4NABA 4RPLA 2B2XA 2XAUA 3MRSA 1TAGA 3KOYA 4I50B 5FL3A 3RT9A 3EPJA 4OX9B 2BFBB 3SC2A 1XZPA 3E3MA 5DI9A 4ODIA 1WPRA 4Q7LA 1YMVA 2CLLB 4BNDB 4EFMA 2JD1A 2R86A 3P94A 4MDFA 4H35A 2X0DA 2BBWA 4V0NA 2NU7B 5ITWA 2WWXA 2C3PA 4BUJA 2XA1A 2O5CA 4MWBA 4UOQA 3U56A 1R16A 3ZE7A 3BTOA 4F1WA 1OWNA 1FXUA 1COZA 1EDDA 4TKVA 1ETHA 1R12A 1QO0D 4D9IA 2I3ZA 1TM5E 3W6OA 3NCTA 4H7IA 2I7CA 2QF7A 3TK1A 4TXNA 2JKZA 1PDWA 2WSSA 2X4IA 2YYZA 3A1FA 4ZVQA 2O2GA 1WDLA 3WJAA 3P0HA 3HCRA 4FOTA 4IUYA 4N40A 1MEOA 5HX7A 3AEQB 4RZIA 5IJ9A 2R60A 3AOGA 4J6EA 1U3GA 2JEYA 1YQWA 1YR3A 2ZCVA 5FULA 4AN1A 4B6SA 1D04A 2PSEA 3GJZA 3KZXA 4CM3A 1OTYA 3R0IA 5HRCA 1C2TA 3VQTA 3FOWA 5EXTA 1SBNE 2ECFA 4NBVA 3SSOA 4P7BA 2AF4C 4X44A 3TOZA 5L3VA 4KJZA 4WMLA 2FSVC 4BFUA 2JJMA 2JLQA 4ERNA 3Q98A 5CB6A 4K05A 1XA3A 2AFHB 3KLOA 5JXGA 4ABTA 3LPDA 5A2GA 5HKBA 3DOHA 3DEFA 4ZVMA 3KX2A 1Z63A 4PO8A 5TLSA 2QXTA 5DSZA 4L3OA 1EUZA 3HB5X 3U5TA 3BWVA 3KKNA 1AGNA 1S8OA 1Y6JA 2QM3A 2XWJI 4JDUA 5CVJA 3IIEA 3TR6A 4HDAA 1RQXA 2X5OA 1OT5A 3EAQA 5BVGA 3DDOA 1L4GA 4EUNA 1NOKA 4AJPA 1J0XO 4ALIA 3QBTA 1JQAA 4A92A 3RYIB 1GZDA 5AK6A 4J6FA 2PANA 1E79D 1A9SA 4U4AA 3D8HA 3P27A 1SCUB 4RD2A 3GUHA 4KR3A 4C0HA 4DCVA 3BCSA 3BMCB 2JFQA 3GZ4A 3V33A 1FS6A 1R0CA 2CVOA 1FQKA 1KXJA 4AJEA 3ANYB 4Y2YA 3MRXA 3QYPA 4EFDA 4QBTA 3N07A 1SELA 3DT9A 2HCFA 4H1UA 2IUYA 4EA9A 4JP8A 1AQIA 4NI5A 5G53C 4LF5B 4UBOA 4XD7A 5SZJA 1A97A 2HDWA 2HO4A 3QU2A 2CFOA 4R3UC 2JIBA 4OBXA 2NPIA 5FI3A 3DMFA 3VO1A 2KQUA 3BZWA 1WJGA 3GVCA 5DJ5A 1A71A 2XCIA 3TZCA 1ES9A 2G0NA 2FAXA 2R4QA 3D54D 2B0CA 3SBDA 2GNAA 3TF5A 1V47A 4DT1A 2I54A 3IXLA 2NO1A 4KZKA 4DSNA 1PUJA 5F7JA 1GKLA 3ICVA 3CEJA 4Z7OB 1X38A 4OHWA 1W76A 5H83A 4ZREA 4D9NA 9MHTA 1CQJB 1BS1A 1DARA 1H0SA 3R3YA 3ZQKA 3RUCA 2QY6A 1WPGA 2HY7A 4KAAA 2QBYA 2CLSA 3OQPA 5C32A 3NTRA 1K7XB 1NVVR 1QAQA 1CUXA 3C2QA 2DECA 3PQ5A 4B3GA 3K9QO 1GRVA 1L4EA 3BE8A 1X86B 1PCXA 3RDPA 1WSAA 3DZGA 3WC4A 4TL6A 3R3HA 3RKRA 5A5GA 2VJYA 1GCIA 4LRTB 2GBIA 2FP4A 4M8IA 3WMRA 1GCGA 3LL4A 1GL7A 1PJZA 4NENB 3SC2B 2WHQA 3HDHA 4DUGA 5JDCC 3T7IA 4CIAA 4GPIB 4AF6A 4B84A 3EWNA 4QUGA 4ZANA 4MVCA 3TLGA 2PV7A 3CNOA 1JT9A 3WGLA 2O06A 4HB2A 3ZUPA 4CLOB 3GL9A 8LDHA 4LJ9A 2CFTA 2VCHA 1DXHA 3ETEA 3LY8A 1TCVA 2CNWD 1KA9H 2X6QA 3LHDA 1X1EA 3B9PA 5FTWA 2DQ4A 1CF2O 1MABA 1NMZA 2E21A 3MC1A 4F12A 5CDUA 4P83A 2YJ3A 2CL6X 4P5EA 3TZKA 3EGCA 1P29A 2WYUA 3HFRA 1MB3A 2DH5A 1LBSA 2XGMA 3GYGA 5FTNA 5IJAA 3NASA 4OTZA 2Y0BA 4HD8A 4UW9A 3CVVA 3EX7C 5GV8A 3DLIA 1QMGA 4Z7JA 2W8ZA 4MKIA 2OCGA 2VP2A 1J2UA 1TYCA 4MAMA 3G8YA 2ZS9A 3ND5A 4BJ6A 1DHRA 1UBMS 1GGEA 2BP7B 3AY0A 3K73O 4QSMA 2ODTX 5HFJA 1QIIA 2JBHA 5JAMA 1Z68A 3TECE 2EKZA 3FBTA 3KU4A 5KOYA 1PZXA 2EVWX 2W6ID 3I9MA 4PAMA 3U26A 4YRGA 1PWYE 2FPIB 5JFOA 2LKCA 1GSHA 2GEJA 4KPUA 1WP4A 3DOOA 4FT4A 3BOSA 5FBZA 4C6TB 5A5EA 1JMYA 1NXTA 4V0QA 1DJMA 4EZEA 1BOOA 2NTNA 4L4YA 4OA8A 5DCWA 4EZBA 1OX4A 4LDNA 5CGQB 2P8SA 4NU5A 3ZBPA 2Q7DA 2VCYA 5MHTA 3NTUA 2ADOA 2AKEA 4CEJA 4GZ3A 4DEXA 1GTG1 2LDBA 3R20A 5L3QA 1I2ZA 5GJWC 3V2UA 2PRIA 3OFSA 3L8EA 1AE1A 3OE7D 2ATVA 2OBYA 5DK6A 2O6HA 3ZVMA 3ED1A 1P2FA 3AF2A 1U02A 3EA4A 4AM8A 3IMFA 5D5PA 2QNBA 3VZRA 3D6TB 1JBQA 4E3ZA 2UZ1A 3EGOA 3KHSA 4D57A 1AD2A 1EVKA 4PZYA 1HQYE 1RLUA 5ERYA 5J5VA 4ZICA 1RW4A 3S4YA 4PYJA 1EZ4A 2CZGA 1FX0A 2GCPA 3OKPA 4QVGA 3RU2A 5TXGA 4JLVA 2WTBA 5KOJB 2R8ZA 3EG9A 2DYKA 2P4UA 4RKQA 2GZ2A 3NP7A 3CUVA 3G3EA 4EPRA 5MGBA 4B2PA 1FRQA 1A50B 1P3Y1 1OBCA 2PX0A 4MPPA 1NKSA 1NBEA 1B0UA 3TRIA 1BAPA 1STOA 3N2KB 1E6EA 5KCZA 1XI2A 2X5JO 3GELA 1F8YA 4ND5A 3RSHA 5JD5A 1Y3DE 2UXBB 2RGXA 4Q9HA 4R0NA 1FFGA 2BM9A 4WHMA 3SQLA 4RK1A 2NU9B 4LV8B 4UTZA 3FZYA 2JK1A 3EFBA 4IDCA 1BN6A 3A58B 1N6NA 2XUGA 1KHTA 3LX5A 1MPXA 1BD3A 3O93A 1YJCA 2W93A 3PDJA 3PFWO 2B25A 4HBGA 2ZK7A 4AB1A 5HIKA 3CNBA 5JPCA 2MIIA 5GTDA 4M49A 1IN5A 1PG5A 1PN3A 3FR7A 1G1AA 2RHDA 1AIPA 3KYBA 3NJ4A 4G09A 2ZU6A 4M7OA 4S2UA 4IYRA 5DHQA 5FD8A 2SECE 4B2IA 5ISMA 4HN2A 1UEXC 1T0PA 3UENA 4F4IA 2B20A 2PS1A 3STVA 4H4DA 1RAAA 1T0UA 3I2IA 4YJHB 1QPZA 1FRNA 3QFHA 1R3DA 1ESEA 4E31A 1M5RA 4O25A 2HJSA 1NGSA 2JIZA 5K3CA 4UU7A 4DDWA 3CVOA 5IABA 1Y9JA 3LTEA 4HMPA 2NTYC 3LC1O 4GECA 3UY4A 4F5DA 2FP4B 2CMKA 4RF2A 1JKIA 1MOSA 3U7EB 3RRXA 1NLYA 3BERA 2WA2A 3FPFA 2ZUBA 1SQ6A 4LBWA 5IAKA 5JW6A 5FOTA 3GBPA 5IJ0B 3SF8A 2IXDA 4WN9A 2CFRA 4M0PA 2O52A 3WMXA 3B1FA 4WE3A 3ZZNA 4YT4A 3AP2A 1K97A 2FRXA 3DXZA 4C1NA 3L0BA 5BW8A 2JAHA 4FUQA 1P9OA 3BBLA 4DAOA 3JVVA 6Q21A 2O8BB 3HR8A 1H3NA 1YWGO 3IOMA 3HKDA 1D0IA 4H6VA 5EE3A 3EZNA 3V5NA 3W7BA 3A04A 1XAGA 1YL6A 1G98A 2F1KA 3UFXB 3KQKA 2XA9A 5AKKA 4BQOA 4EFKA 2R1ZA 2A9QA 1P1JA 2Q3CA 5JCOC 1XCOA 2O05A 1XMOB 2VSNA 2J3KA 3PQ6A 4UUNA 2HK8A 3QKUA 4UBIA 3VJLA 1VE6A 1EFCA 1YS6A 4NH4A 2IBSA 1L1QA 2GN2A 4QGBA 3GEBA 2ZJ1A 4I66A 2FN3A 1PLKA 2QRKA 1OKKA 2V7XA 1EUYA 1E20A 2VBCA 2ZB2A 4PWZA 2JD2A 3AFGA 3IX7A 2OD7A 3EXEB 4UPDA 2ZAMA 1VQ1A 4F4JA 3A10A 4DC0A 3HSKA 5F2OA 1I4TD 1OLSB 2HJHA 3PYLA 1T9KA 2PX4A 3PB3A 1SFRA 4PCUA 3PFNA 3TTSA 4C5BA 1P19A 1GTMA 2HLDA 3L4EA 4HLUA 3AHDA 5KHAA 2OG2A 2YNMA 1MOQA 3V2HA 3M4JA 4DMRA 4HTFA 5BORA 3D6MA 1H8ED 3HPQA 4YRBA 1VM6A 3BL5A 4KXQA 1CQZA 1QF6A 1IOLA 4QA9A 1RJEA 5BN3B 3H8JA 1NJSA 4AMZA 2Z58A 2I55A 3DDNA 1P4AA 1IOVA 3H17A 2R1TA 4LXXA 2BZ0A 3EBLA 5K0NA 5FQNA 2IKSA 1N1DA 2YJ6A 3K6KA 2AJDA 5JNLA 3O21A 2G83A 2OBMA 1M83A 1NN1A 4LNHA 1SCNE 1M1YA 2PUHA 4BLQA 2BSAA 5LA6F 1B6RA 3A0UA 3KB8A 1A9TA 1YNOA 2A5FA 2AYXA 2XODA 2IW3A 4FKMA 2VYND 5DRYA 5LC1A 5ENDA 3I2HA 4B1FA 5I7HA 3G0IA 5E4FA 3B6JA 2DHEA 2J8ZA 1YIDA 2ATXA 4XUEA 4Q66C 1K5GA 3LLMA 2B34A 3E9QA 2RHRA 3N87A 3U4CA 2NQTA 3C74A 3LFUA 4G6ZA 5FPTA 4RVDA 2IHJA 5IT0A 2A5GA 4N5IX 2EJCA 2P35A 4QUKA 4BO5A 3IAM6 1N8NA 2C3OA 3AI2A 1G5RA 1PP4A 4ZAXA 4A2PA 3WLPA 4ZD6A 3B53X 4R1UA 1SG6A 1T1GA 3IO3A 2CLKB 4NY1A 5A03A 1E2LA 1DX9A 3FNGA 1DO8A 4TLAA 1OYOA 5DM2A 4GHWA 5DYTA 1JE0A 1MEEA 1DC5A 5E6SB 3HJAA 3OPYA 2QRZA 4OYYA 4UFNA 4ZT5A 2IP4A 3PR2B 4FFDA 2SNIE 2AQIA 3KBOA 3N0XA 4PHTA 3AXTA 5AK4A 5DNVA 2O57A 1KZ9A 5GQSA 5BYBA 5KTRA 3RVQA 4R8SA 1L4NA 4MH0R 1UBSB 5AXDA 3KWFA 2BHNA 3ES9A 4FOLA 2G1JA 2QLFA 5HF5A 1QB8A 3BK7A 3MJDA 1H6DA 2HQ1A 1ZZEA 1ECLA 4MNTA 4UD6A 4YJ3F 1MIHA 1C30B 1DI0A 3QWFA 1MVLA 5AVVA 2FSHA 3QPCA 3UGQA 2W6NA 2GBPA 3BXZA 4MYTA 3T12A 3GNTA 3VC1A 3JD2A 5ICCA 1VMDA 1QRDA 1OC4A 3GN1A 5G0SA 3DBHB 4EB3A 3C70A 5IC4A 4A1OA 3WQQA 1RXWA 1XJQA 2VUTA 5EQTA 3QUSA 1RPTA 4JKYA 1AA9A 2N46A 1U9CA 1T3GA 4J1NA 3OZEA 4I46A 3OEED 4JZYA 4MI6A 3S5UA 3ZI0A 1CR0A 4KLNA 3D7LA 1WB4A 5J58A 1XVLA 5DF1A 2QP3A 5CEEA 3CX8A 1Y4ZA 4XYBA 4INOA 2QEQA 2QD4A 5ANRB 3RSLA 3OPXA 2WYHA 2A58A 1VC2A 4G07A 2H1WA 3GWZA 5KAPA 2VWGA 3IQEA 4DFDA 2Y1CA 1UBHS 2FMIA 221PA 3DZHA 3RKUA 2W8BA 4G5FA 5DN9A 1H2XA 4HDOB 1DAPA 1LZLA 1M6NA 4LXIA 4RD3A 4CE6A 4FWTA 1YB6A 3KVVA 5FBKA 3A8TA 1K3FA 4OHBA 1NYTA 2IUSA 4Z0HO 3U3XA 4ZYTA 4Z4GA 3LT2A 4TZ6A 3OZBA 3I0NA 1JPNA 1E2UA 1N9KA 3PA8A 1HO3A 4TV8B 4WVFA 4E4RA 4YRZA 1RRPA 1TI7A 1PS8A 3RC3A 1EG2A 4DNPA 1O9HA 1TZ2A 1W4CA 2VRCD 3KUDA 4UOZA 1U5CA 1HT3A 1UZUA 3GV0A 3OPVA 1XEWX 2ETVA 2P3SA 2Y66A 4IJMA 3OTQA 4JT8A 1X9HA 4CMIA 4D9HA 1YR6A 2PTGA 3FVVA 4HAWA 3V8QA 2D6FA 3GWGA 3KPVA 4PZLA 1IXKA 4LWZA 3U3OA 1OASA 1AUQA 2GEKA 2B8TA 1EM8B 3D7NA 2QMOA 3CCCA 2EKBA 1IY1A 2HIGA 1Y8CA 3GJYA 2VNKA 5JS7A 2ZT6A 2VSYA 4IWYA 4BKRA 1OYVA 2AG6A 5DXFA 2FPKA 2I6SA 5AJUA 2RAFA 4TYQA 1EK1A 3EUWA 3FIUA 1O08A 2AMVA 3HI6A 3N3AC 3IAEA 4JBWA 1QFJA 3MF4A 2CMFA 1CXZA 1KZYC 3GP5A 3NHWA 4H4EA 4K6HA 2WKSA 4LZOA 1KI9A 1O58A 4P0TA 5HA5A 4AIRA 5B7GA 3HADA 1G41A 1M1YB 3IEIA 2X3FA 1OAOC 2SHKA 3M1AA 3NUZA 3EARA 3QVUA 1RS0A 4LOIA 4NFYA 2XITA 4NEQA 5K0CA 1T9BA 2DPLA 3HXLA 5NLLA 4BV9A 1YFKA 3SQMA 2QUIA 1XF1A 3L41A 3QKSA 4L0QA 3JD4A 3WOVA 4D99A 1TJ5A 1JQ5A 4ENSA 4U7DA 3VR2A 3GLGA 2XJ4A 2BHSA 2GPYA 4JMPA 2MSEB 4TYMA 3T1NA 2WD9A 4LYDA 1FRZA 2JEZA 3ONVA 1EVEA 5HIJA 2LRHA 2BFDA 5C51B 1EJ2A 1CE8A 3QI7A 4U9HS 4AJ4A 2PD4A 1EXNA 3CJTA 3D9QX 4KTTE 3BDAA 4KCGA 3QVGB 1IC6A 3EC1A 3FPAA 1YSCA 1PKXA 3NKVA 3VNQA 4TYYA 1KI3A 3DNMA 3MCTA 1BQ4A 3LY5A 3T5MA 2F4NA 4A0SA 3FETA 4YAOA 1CX9B 4WZBE 1XDWA 4YACA 4D9MA 4G67A 1ZK3A 1UKVY 2ZYAA 1QVRA 3FMIA 4RY9A 4YEDA 1XTTA 2B6NA 4E1AA 5EFOA 2VXOA 3NBFA 1XG5A 3ZNOA 1V71A 4NZZA 3JQBC 3F46A 2H0RA 2DWUA 1TQ6A 2WT4A 5CDFA 4BDSA 1QYIA 3HR7A 4UDYX 1HZJA 3KEOA 5DU2A 5HVNA 4H9GA 3R7AA 1JNXX 3M6MD 4ZI2A 1DFHA 1E2MA 1KI2A 1SCQA 1F2TB 1SWVA 2J9GA 4OHYA 3REFA 3BFKA 3JYOA 4Q01A 4ZC8A 1A9XB 3SHFA 1ACLA 4D4GA 1IIBA 4NMHA 4KBFA 1GT6A 1U4SA 3HK2A 2J3QA 2GYUA 1YGPA 3K7EA 3KZCA 3OKAA 1I5RA 1Z33A 3V7UA 1TCBA 3PI7A 4EARA 4YRNA 5IMSA 3RJMA 1JJVA 3JQ8B 1Y4DE 5DIZA 3ENKA 1GPJA 4WCVA 1PZEA 3O3CA 4ZO8A 3WNZA 5IUJC 1KJNA 3CFYA 1D7OA 1T9GS 4D8XA 4ZI7A 2RKOA 1UODA 3SVZA 3GUCA 1T15A 1XJCA 3D3NA 3U3DA 1C41A 1SBZA 4JB2A 4D1YA 4CTOA 1GARA 3L6EA 2AC4A 4NE7A 4HZUA 1PFWA 1E3JA 1E7WA 5AKHA 1KGSA 2DOKA 3OTOB 3GH1A 3N2GB 1IBRA 1Z73A 2VOEA 2MWMA 2WQZA 2ERCA 1RRCA 2XZPA 3TL3A 1O94C 2V98A 2DPYA 3B1VA 2WF9A 1ZKDA 4HAXA 1E3WA 4R8LA 5KZMB 2E85A 1NVKA 2QG6A 4YMTA 3Q12A 1J5PA 2JASA 5K8VA 1BCSB 3E9DA 5K3FB 5HIMA 5GPBA 2D5CA 4R1SA 3V42A 1JKMA 4HXEB 3ZVKA 2DPXA 3FBWA 4IV5A 2R96A 3WKCA 1A2BA 2IEDA 1DDGA 2FLKA 4M1OA 5J23A 2J5XA 1EJ0A 1RLIA 3TJMA 3E9CA 2ADMA 3EZFA 3ZDQA 1HTWA 2VPWA 2ZYTX 2ZP1A 4PRZA 4QJBA 4ZIRA 4LF4B 2UXCB 1HA3A 4IHJF 1PV1A 1N5LA 4GOMD 1RKXA 3M82A 2B5WA 4MR7A 4TWAA 3RIHA 3VPFA 1Y4UA 3NO4A 5CYOA 4QPCA 4WACA 1GFIA 4XWGA 4NJEB 5F33A 1Z75A 2GUWA 3DSRA 1ZN9A 4WXEA 3TUZC 1QCDA 1DC8A 1VB3A 1B8UA 4ND2A 4ETWA 5L4LA 4C4OA 4KMMA 5AFSA 4P4NA 1I3NA 3R3VA 2QRNA 3AOEA 1I24A 1KETA 5AOVA 5ELMA 1KZHA 3KTAA 4R7ZA 5FBHA 2IK8A 5ABPA 2GESA 1LDYA 5AVKA 2ZJAA 1HFJA 2VSQA 1AQUA 3BWDD 3E9ZA 2AMLA 3HUEA 1OH6A 1G2QA 3PC4A 4U3JB 2ZJOA 3PCRB 4RY8A 1OI4A 3WIVA 1E9EA 2HU2A 1RTKA 3EMDA 3F5MA 3Q7EA 2BFEB 4M98A 2JAWA 3WGZA 4EFLA 1EDBA 4AO7A 1AKVA 2RGEA 4I1SA 4P53A 2QSYA 3BFJA 3BXGA 3F4BA 4W6ZA 2FSUA 1A8UA 2JI4A 3VR5A 3DL0A 5LIPA 3U5ZB 4LVNA 3WNBA 1XMXA 3A6LA 4HWSA 3DBLA 4E0BA 4EW1A 1M34B 1M6WA 2JJ2A 1G3IA 1OTXA 4MQBA 4XSVA 5CEJA 3G1WA 1Z6GA 3RTGA 1CE8B 3CINA 3EF1A 4BUZA 4KVFA 4IIYA 1DAHA 4FFOA 4MWZA 3B2QA 2Q6LA 2Y77A 4E21A 3F6RA 3CH4B 3ETDA 5CPFA 4GSYA 4NYJR 3MINA 4AYTA 1VE5A 2ZJBA 2VK2A 2UYCA 4XE5A 5EJAA 5ICSA 3U31A 1HTTA 3MAAC 3ZC3A 3ZKAA 1SPBS 1NJ5A 1RACA 3WBJA 1UMCB 3DBRB 2KLBA 2D13A 3QJ5A 2AF3C 4BFCA 5LLDA 3MJCA 2E4AA 1XCLA 4TXHA 3LUJA 5EWMB 4A36A 4JL8A 1D09A 4UUBA 2ZRBA 3S70A 4UFOA 5LMCA 4JYZA 2QTNA 3C1OA 4D8TA 4G8DA 3FGZA 4TROA 4UTVA 5IKMA 3LRTA 5J5CA 3HKEA 2XQFA 3IP9A 3G2OA 4C0AC 1I94B 4DWWA 1K5PA 4G1MB 3PPXA 3UVEA 1MW9X 1SKQA 2HPZA 1RI3A 1LDMA 2Q0QA 4DB4A 2IYOA 2XNDA 3M6LA 3KSAC 1UMDB 1UBGA 2OCXA 5AT1A 4P3NA 2KYRA 4GH5A 2EAUA 1Q0ZA 1KZGB 1NMEA 3RS2A 4CHGA 1P1FA 2ZE7A 4NFLA 4BAGA 1G20B 1SU4A 4HDCA 4JBXA 4RM3A 5CYGA 1E3EA 3U40A 5T4EA 2W00A 4JOCA 3FAZA 1L5HA 1ZSYA 2FQXA 2H29A 2RH4A 4M0CA 1FMTA 2FR8A 3UC9A 2UVPA 3PF8A 2PVCA 4GZMA 5EEHA 1PJTA 4AIIA 4BNLA 5FPKA 4I4CA 2P1ZA 2VUIB 2DUNA 1QF7A 2YHBA 4MVJG 1RU3A 4N82A 1VKHA 3JY6A 2JCSA 4HRAA 4L9WA 1BNCA 4P3KA 3HXPA 4ER6A 4ER0A 1NJ6A 1VRWA 3G1UA 2IZ1A 3CPJB 1JB9A 4M46A 2REQA 4TLMB 2LKDA 3HDYA 4F2PA 3B1KA 4XDZA 4GI3A 1QONA 2GM4A 2CZQA 2VHXA 3ITNA 4RHEA 4YP0A 4JT9A 4EPWA 3AHFA 1V3UA 3CZAA 3KKEA 1IJBA 3NALA 3G5TA 4RGVA 1EVZA 2FZ4A 2AD5A 2D2EA 3BD9A 3A9UA 3EZ6A 3G88A 3G8DA 3MCZA 4LXGA 5EIBC 4P32A 2I6FA 3F4KA 4J2HA 1ZJYA 1WOMA 2PR2A 4PFSA 3VSAA 5BN5B 1SG9A 2QSUA 5L4SA 4BV2A 3MS7A 3RUAA 4POOA 3ELDA 2FXVA 2ZRPA 4F91B 2CLHB 4PBRA 2OL4A 3WDSA 4EUKA 4JEIA 4D0GA 1DE0A 2WFAA 3SGLA 2VJPA 1XLUA 5REQA 4E32A 1TJ3A 3D2BA 3HUTA 1A8QA 4FZ3A 1VECA 3DHEA 4MR7B 1H4SA 2DERA 2WWWA 1HURA 4OQXA 4Z86A 3TBHA 1GPH1 2O8DA 5ALRA 3NOOA 3E61A 5LZ8A 2RHTA 1I0LA 4UHFA 3I9NA 4GYYA 4UMEA 4FEYA 3JQQA 3VMFA 2YWEA 3N0RA 1I9CA 3BILA 3G79A 4FZVA 3GGJA 3P0EA 1LJ8A 2IJGX 3QLVA 4KRYA 4B44A 3MHTA 2HMUA 4U0KA 4GMKA 3W79A 2B7LA 3CE6A 3MJRA 1H65A 1OI3A 4GDFA 1YXMA 1L7RA 4YJDA 1KU0A 3EDYA 2NO4A 2FSPA 2PX2A 4MLZA 1Z4QA 2RK3A 1JIXA 4NE2A 5KMGB 1ZHHA 4FZJA 1XMVA 2OD9A 4LHWA 4JUBA 3STTA 4EAAA 3QGMA 3K1AB 5HF6A 4YT2A 1BJRE 3PHHA 1ZD4A 1GUFA 4ZKEA 1DAIA 9ATCA 1VXOA 1J7KA 2FWIA 4B6PA 3DXXA 4TV9A 1ZGCA 3SXJA 2A0XA 2CMGA 2QPAA 1YMUA 2C77A 3CZ4A 3T0FA 1PU2A 2QAGC 1NLMA 2TRSB 4RJIA 4HFMA 4RGQA 2GD1O 2ST1A 3LVRE 3TXXA 4BZQA 2JGLA 2XKJE 4IG4A 1RJGA 4NARA 3QA3E 5DM4A 4Z49A 3OFND 1R6UA 3AUKA 2IYTA 3IBCA 3O9VA 3R5HA 4WH0A 1JG6A 1N92A 2ZIFA 4QKQA 4J4TA 4E07A 3F6BX 4J16C 1XRSB 2WEKA 1BDBA 3TLBA 1FMFA 2PXAA 4OHOA 3EXG1 1R9MA 3G7UA 1XZFA 2ESRA 4B3XA 4F5EA 1P2DA 1SXJA 3F9CA 4HGZA 4BLRA 1WETA 1L5SA 4QPPA 5F3DA 1WPQA 4RLQA 1CZLA 4ZHQA 2E6UX 4O29A 4TLBA 3B7GA 1K0UA 2DH6A 2PUAA 5E0KB 4MA5A 3PNBA 1SWWA 2ETXA 3U7FB 3NNNA 3NXSA 3PQDA 5E7IA 2PQMA 5JO9A 4AKGA 3OIDA 5AUPB 3QM1A 4LCEA 3ELBA 1NU6A 3V7WA 3ZY5A 5F98A 1TM1E 4NPHA 4WLFA 3M3PA 4UTXA 1U5AA 2EW8A 2R79A 5DYWA 4AVYA 2VJCA 3PYXA 4ZDIA 2C58A 1Q1EA 3VU0A 2OB2A 3W5IA 1MTOA 2OV8A 3QKRA 4DG5A 1H23A 1JHDA 2YWXA 5A4KA 2H65A 3EVBA 3HI4A 2NG1A 3TB6A 3QFSA 1YJ5A 4Q3EA 1DKUA 3E3LA 2PBRA 2HBZA 5JZOA 2GWHA 1L8AA 4MS3B 4YREA 5CT5A 2VSXA 4HP8A 1QGYA 3E8MA 5KYWB 1V45E 2OILA 3FYSA 3KR2A 4N3AA 4ZGBA 4AULA 5A0VA 1BQEA 1Y4SA 1H0RA 3JQ9C 4LK2A 1F17A 4C0BA 2J3IA 4TRJA 4B7XA 1W0KA 3UN1A 1B6GA 1GM5A 3KWLA 4LRQA 4XR4A 8OHMA 3KVRA 3W3AA 5CK4A 4BFSA 5I6DA 3NAGA 5K45A 4Y2RA 3I8OA 4KC0A 1HQDA 1J4AA 3T5PA 2NXEA 4BCBA 1KEPA 2WKWA 2Z2XA 2JFFA 1SD2A 1C1XB 2CFSA 3A6FA 1T6NA 3G85A 2HWXA 3GARA 3CNQS 3O92A 5M29A 1BXRB 1Z07A 4ZEOA 4RZ3A 4PC7A 2BUAA 2R6R1 4ZCIA 2V65A 1KK1A 4CU2A 1NXSA 2WMOB 1H2AS 1J90A 1VYTA 2BEWA 2PXXA 2X0NA 1JZTA 2CUTA 1WXHA 4RU1A 5T4BA 4NU8X 3NT2A 4CFYA 2YHSA 4MVJP 1RQ2A 4NCNA 2O8DB 3K15A 1ZUWA 3QSGA 1FU4A 2HRQA 1KBOA 2PH5A 3NNSA 2QJFA 4K9KA 4BEVA 1KK0A 4A0FA 2D00A 5EHQA 2ENUA 4PS1A 1W52X 4XSGA 3RVKA 3C14C 3ZTWA 5EJ9A 3SZLA 5JHGB 1UKCA 3IO5A 1DO2A 4Q12A 3UJ3X 3WLMA 2Z8YM 4YRAA 2HLPA 1T9AA 2IEGA 3QLUA 3HBMA 2ZTSA 4LMPA 4ZDJA 2H4ZA 2HPVA 4M7RA 3R3UA 1E1YA 1YVUA 3FNEA 3GR6A 1YB2A 3VHXB 2ZE8A 3JATB 5JPDA 3RFVA 2W2KA 5BSHA 5AO9A 3G2IA 4PZCA 3OPNA 1NT4A 1AUPA 1TLTA 4PLPA 2R4UA 4S1PA 4KREA 4AKIA 3FZQA 1P1CA 1SHJA 1RWMA 2C9OA 2QUBA 3COSA 3I05A 4AZVA 5F4ZA 4OMFG 3DHVA 2RDMA 3RUDA 5EXDA 2CK3D 3OT1A 1ODCA 3UCFA 4M1YA 3ZWDA 1PVVA 4YCBA 1FB5A 1LNQA 5T67A 2PIDA 3ZCRA 4NIMA 3OQIB 1E0SA 1MX1A 1OHHD 1PHPA 2EKQA 1HE1C 2QTCA 3H2SA 1P4JA 4KN8A 5EMLA 1CRZA 3NHLA 2GZSA 3FX2A 4MB6A 1CNFA 3GUVA 1EU1A 3L43A 5A6SB 3H5LA 1F0YA 2O5RA 1C80A 1DC4A 2PMBA 4UNNA 1I1OA 4R2XA 1Y1QA 1CZOA 1ADBA 1BE6A 1JU3A 3MQ2A 4KO8A 2WIDA 4LYFA 1RYYA 1Z62A 1ARZA 4MMZB 4N5LA 3HM9A 2RHJA 1T2UA 3QNUA 2WY2D 4FB4A 3KQWA 5IULC 2CBXA 1CZKA 4GR5A 2BFCB 3GLIA 2JLVA 3CSUA 2V03A 2ZRJA 2CCKA 3P0FA 5BW4A 2Z95A 1WBBA 1OXSC 4PYRA 4FYVA 1RI1A 4E5SA 2EIHA 1E4EB 2E4UA 4NMWA 1FP7A 1YJXA 5KVVA 4A15A 1KAEA 3CLUD 3V2IA 3WRXA 3VC7A 2YVQA 1F20A 5K7SA 1SR8A 1Z2OX 1WLYA 2HU5A 3GI1A 4V1CB 4GNRA 4KV7A 1MNAA 4FYPA 1EMDA 2XB4A 2YWRA 1HETA 1C4XA 4FFWA 4QAJA 1XPRA 2IYPA 3AHJA 3A2KA 1WUTA 3GA5A 1KYZA 3ROPA 4MRVA 4F1KA 4QM7A 3NWJA 2CWDA 1VLJA 2A2ZA 1IL0A 1L7OA 3CQ9A 1BE8A 3AR6A 1J39A 1UXGA 3S2YA 2NADA 3I9V1 4YRDA 4CQLB 1O0BA 1RKVA 5EJ2A 1CERA 1G0OA 3CGGA 4ERXA 5KQMA 3HP1A 2VHUA 4D44A 1RWNA 2ZJ8A 3IC5A 4HYYA 1D6MA 3RUEA 3SEAA 4D96A 5C0OE 5I4KA 1ZN2A 4HS9A 4WIAA 4ALJA 5M7EA 1JG3A 2W2LA 3WLJA 5C52B 1HQKA 3FZNA 4B4WA 4MZXA 1Q0RA 5IVDA 4KE7A 3VR6A 2WPDD 1E3IA 3L77A 1DBSA 2TMGA 3EPKA 3Q2OA 10MHA 3WKDA 1V16B 1KFJB 1E7MA 4KGXA 3VAAA 3OLVA 3ZLTA 1KP3A 3EXFB 3EG5A 4X7BA 3PXBA 4J03A 4R9SA 1SK9A 5C80A 1G7RA 5HS4A 3QXGA 4DCPA 5IG2A 2JIPA 2ZBDA 3GAAA 4PZDA 5JJ5A 2PUCA 1ZJZA 3LV8A 4JB0A 3EWSA 1A7KA 4TL8A 1GGNA 1M2GA 1NUSA 2R11A 4TN1A 4REQA 1NURA 5BWNA 3DS8A 3LUDA 3NM5A 4JJ8A 3R7SA 5HIAA 4F46A 4W9NC 2NZJA 1W30A 2WKQA 2ZWIA 1TOAA 1KVTA 4HCJA 3TAHA 1IVSA 1TZBA 2HBQA 3FCSB 5FYQA 3ANNA 2H06A 2EFCB 3FWPA 4B40A 4H1WA 1I10A 1UWLA 4KP7A 1R8SA 3RTDA 4W5RA 1OAKA 1RYHA 2QUZA 1YZKA 4EEXA 5CW1A 2YASA 5JSUA 1GHTA 4LJ5A 1NUHA 5EOVA 1LPPA 3AF4A 4C6RA 2PU5A 4R1OA 3C3MA 2V1XA 1T0IA 3BJEA 2OTCA 2QX7A 3IOEA 3VHRA 3PPYA 2FW8A 4UHCA 3KKZA 4YCDA 5H68A 2O2EA 2YN4A 5A4DA 3WFJA 4EW6A 2WTMA 1V3VA 3SNHA 1IMOA 1F48A 5BO5A 2GCIA 3RUIA 3G9UA 1Z3CA 3UT6A 1C8KA 2W2KB 3QOWA 2IUTA 2J07A 4NYMQ 4C0WA 3C39A 1HSOA 3ULKA 3QA9A 5EXEA 3HUDA 3OWOA 3TS1A 4KSYA 4CDRA 4B33A 2C4VA 3JQAA 3FY4A 1ZESA 4TKUB 5A3VA 1DUIA 1PEKE 4YBZA 3OM0A 5A0FA 4IJVA 1N2CA 4TT3D 5AYVA 3WZ2A 4DLBA 5EP1A 5K0FA 2CNNA 3DW1X 4O4IA 4LWOA 3BCUA 1QE3A 4QJ5A 2RBGA 3ZKWB 5FP0A 2AI1A 3WMFA 2YC4C 2WQ6A 1AH2A 2JGRA 5C8YF 1RXIA 4KXNA 4NCHA 5COAA 3T38A 2DWOA 1U3DA 1ZD1A 5L51A 1L4MA 2UV8A 2J4FA 2QLBA 4COOA 3FUUA 5JH7B 1PT5A 1MQ8B 2H5JA 3JRNA 1URPA 2D1TA 1GUAA 4GQBA 2IDJA 2WM9B 3QWIA 1J70A 4LRSB 3L8GA 4PPGA 3A6JA 1ZXLA 1KAOA 2X1VA 1DCKA 2YDXA 3NHFA 2P2ZA 2H7XA 4JFRA 2R48A 4RD4A 4DQKA 3HXMA 2DXIA 421PA 1XU9A 1O6BA 4EG3A 1AGXA 4N0EA 1L7EA 3L93A 3Q9LA 3FNHA 4P08A 2BTOA 4PLYA 5HMLA 1M6VA 3B6MA 3AIIA 2FGJA 1QC5A 3PRYA 5TVGA 3MRTA 1UT6A 4DS3A 5JYCA 2QW0X 3ZD6A 4NBTA 4WBSA 3HVUA 5FNVB 1H42A 2EZTA 5GJBA 2PZFA 1JR3A 1QZZA 1SEPA 2JHAA 3HB1A 3X1MA 4DV4B 3ZCQA 2PT5A 2QYTA 4ZYWA 4REOA 4ME6A 5DMXA 3DVAA 2RHGB 1GPNA 3EEQA 2XYRA 5CX4A 3HVKA 2YV4A 1GFZA 3GDFA 3RUHA 3U19A 3OZXA 4G0OA 3TR5A 4NDNE 1WMEA 1LDEA 3TMYA 1S2LA 3QU5A 3Q72A 3JQEA 1E4YA 2J33A 3OHMA 4M8NE 3BT7A 3SBOA 1GDDA 4U2CA 1N0WA 3D7KA 3MMXA 3SX4A 1PQPA 5EXSA 4DZZA 4RGYA 2FEMA 2XUHA 3FXAA 3GCXA 4P7KA 4F3TA 4O4HA 4QDUA 1E1QD 5FH9A 1N7GA 1RHKA 2JFYA 3RTBA 4CKEA 3Q9NA 1T5IA 1QVVA 5BV7A 2FETA 2WJVA 2VHYA 3EXG2 4QL3A 2R0QC 4BGVA 1DEAA 3KPJA 3EQ6A 4A8PA 3LOUA 5FA8A 3D4NA 4AY4A 1KC3A 3DUWA 4UKDA 2WW8A 2HIAA 3EBPA 3L6BA 3VR3A 3VA7A 1XLTA 4LYAA 3ZLJA 3OF3A 3WMGA 3PRHA 2XADA 3CVYA 1MB9A 3UGTA 4M7PA 4WCFC 1N9GB 1XU7A 2C9ZA 3TXYA 4BVKA 2BKEA 3IQZA 2Y8EA 3DXYA 4MIEA 4BFLA 3FKSA 3V3TA 3MT0A 5JMOA 1QIFA 1ZM7A 3IULA 3CF2A 5B1HA 4Z4CA 2N9UA 3GHHA 5AI6A 2WHXA 1IM8A 2PLNA 3NIWA 1P0QA 2P2NA 3IHLA 3NYIA 4E3WA 4OK3A 5KC9A 5EKXA 4EG0A 4I4NA 4INPA 4DR3B 1QS0B 3FGOA 3TNYA 1LK5A 1Z5VA 1LPBB 1JDBB 5AKLA 4Q4HA 3IUQA 3WK5A 1OVGA 4JVSB 1XP5A 2AKAB 3ILSA 1W4LA 4ZVVA 1EZ1A 4UNSA 5T8KC 2XKKA 1OV4A 1JQJC 1GGVA 1W93A 2ZTUA 1NIJA 1WCYA 5J40A 3WL3A 5BV2P 3UKOA 3TTUA 4EGSA 5BP7A 1PGQA 3M5DA 2XCUA 5E1DA 521PA 1DIGA 4HQRA 1M6HA 2JFNA 3NWEA 5EL0A 3JAKA 3PJEA 4ZCMA 2PWYA 3JZMA 4E2XA 1ADYA 4D2IA 2HA7A 4BC0A 2GVZC 4ISBA 3RS4A 1C8BA 1E5TA 1DAOA 4OJKA 4K6MA 5HZMA 1E6WA 1WKCA 3BH0A 2J46A 2DRIA 5JUWA 1Z5PA 3A27A 5B30A 3BWXA 2J0UB 4DV3B 3DVLA 4WKPA 1Y1PA 1S1CA 1KYYA 1TT5A 3TUIC 4GQIA 5P8WA 5GWXA 1KVQA 2Q4EA 3A28A 3DHNA 4IV8A 2CHFA 3T7DA 4UAUA 3PJGA 5JXJA 1G5FA 5I47A 4G0XA 2WAAA 3H42B 4EGCB 2VYVD 3R7BA 4Y1RA 4JCCA 2HAEA 1O96A 5FLEX 2X77A 1JP7A 4I4TB 4E09A 1BMFD 1CRQA 3H1FA 4LWPA 5IJWA 4OQQA 2FP3A 4PG4A 4E5DA 5IP5A 5BV0A 1EUCB 1N3LA 3GFSA 4EQ6A 2FRVA 3NKLA 5B53A 2GBLA 2E0IA 2OYCA 4CMKA 2EFDB 3LIIA 2RBEA 5ED4A 3K05A 1K3TA 4CEIB 1YULA 1N7JA 1OMOA 2JLUA 2YOGA 2FCAA 3LXXA 5K6AA 3SZGA 3E3AA 5CEFA 1UC8A 4DSZA 3L82B 1YE8A 3A4VA 3M4ZA 2HD4A 5ITZB 5DHFA 4PW0A 3V1UA 2VLIA 1CW2B 1W59A 4KAFA 3S8YA 1IUPA 4Q7JB 1D8AA 1WA5A 4X6LA 3SG0A 1E1RA 3PUZA 4PHFA 2OG1A 1TTHA 2ZYWX 3A36A 3AHGA 3FF4A 1P1RA 4I5EA 4R0VA 2EX1A 1RJDA 2XJ9A 4TMTA 1AC5A 4YJKA 1MLDA 2VRBA 4LHXA 2VEDA 1X7ZA 3MCWA 4EA6A 1HWYA 2GCOA 3ANXA 2Z3ZA 3HHEA 2AN4A 4EQZA 4QYTA 1G5IA 4UEWA 3BJZA 3AF5A 5JD6A 2BF7A 1PZFA 1XT6A 4L5CA 5DDIP 2B5VA 3QZUA 1JECA 3GCDA 2Z2YA 4S04A 3BXPA 3H5TA 4YMGA 3B9RA 3ZHYA 2DEUA 2CVQA 3P2EA 1HPLA 4TRMA 4B6FA 1KFBB 3F7OA 1MHPA 4QWWA 3OX3A 4KFSA 1P91A 2C1ZA 5K0LA 3WGUA 1HDXA 1WMFA 3BB3A 3EISA 2WJ6A 1BU5A 5IT5A 2PQ0A 4I8IA 2XBLA 1PX0A 4JYPA 2V6MA 5FA6A 1BVUA 3OG9A 5E2IA 2VZ0A 4EY4A 5FI1B 1NI5A 3AB8A 3BGSA 2OY0A 1HRKA 3IQWA 3SYMA 3W2TA 2GYVA 2YZ2A 1YRWA 1QG2A 4X54A 5LQCA 1TYZA 1JQDA 1KO8A 4D6XA 1F2DA 2WU3A 1A4XA 4LQDA 2QZPA 3L02A 3SSMA 1O77A 4QOGA 5AJVB 3TTTA 2KMLA 2B1RA 5DH9A 2DVMA 1E9AA 2V74B 3H2BA 3PX2A 3QYFA 3MWDB 1UMKA 3H6KA 1W87A 3L7MA 2DLCX 4IQ8A 3OKCA 3HZZA 3PBKA 2GZ1A 4PLGA 1VFNA 4JROA 4X91A 3G5LA 3TRHA 3QE9Y 1KI7A 1QQ6A 1O95C 1M7BA 1SVSA 1ZM3A 1FBNA 1SUBA 1WD7A 2DKOA 2QLLA 3LXUX 3OMLA 3R77A 4V3BA 4RIIA 5ES3A 4DREA 1T0JB 4F2WA 4R05A 2XB9A 4DBLC 4GBJA 2ZSKA 1UT8A 2OKCA 3A6EA 5CNMA 3VKFA 2YMPA 1E9BA 4HNAA 3PHJA 4A0RA 1FTQA 2C8VA 5FOQA 2QLTA 2KW5A 3MMSA 1BMDA 3CRNA 4P7FA 4MJ3A 2R97A 4L6AA 4LJ7A 3AUTA 3ESXA 1SY7A 3ZVRA 1M2JA 4DCMA 5MF6A 1O54A 1PYOA 1QYDA 3TNJA 5H59A 1J9GA 1P5FA 3KKQA 4HB0A 1ESDA 2DBZA 3AUXA 4TL9A 5AK0A 3UOAB 2KI5A 4KRGA 2HMTA 4MI9A 4CMGA 3DV0B 1P9RA 2VKQA 1TZMA 3IFSA 4N1AA 2HCBA 4J2OA 5CAEB 3PEUA 1PJ3A 4BNJA 5KS2A 2A94A 1ST3A 4OH7A 4GGPA 1W88B 3SJCA 2C88A 3DEAA 2H4WA 4TTIA 4EM6A 3L1KA 5CXQA 2B8WA 4CF7A 2AUMA 2HF8A 2VPQA 3NM4A 3FSGD 1C3OB 2M1ZA 3BICA 5DULA 4CDNA 3F1LA 1Z2AA 4RPJA 1UP7A 4IGKA 3S2UA 7GPBA 4ZHSA 4JHLA 3U0BA 1CF9A 2B8EA 3KLNA 4KXXA 4V2IA 1XTUA 4XKJA 4Y1RB 4WRRA 3QE4A 5TSDA 3TI9A 1HXHA 4M0FA 3PDWA 3QKTA 3DLCA 4UNIA 1BDJA 1W0CA 5LQMA 1R8QA 4HTAA 4CKBA 2J5QA 1GGMA 1SO8A 2V5VA 4RPHA 1FA9A 2FDRA 5ER9A 1IJKA 5TMEA 4YX9A 2GEUA 5E3HA 5FWNA 1KH3A 3MMNA 5CTJA 2IIQA 1ZCFA 2JIQA 4RHXA 1B6TA 1L4UA 1C7JA 4W5HA 3ZEIA 2GBFA 2IC5A 4MUXA 1ICEA 2D1FA 2BFAA 4I5GA 1RWVA 4OHUA 3TE7A 1E2FA 1F0KA 2ON6A 1LFDB 4O4LB 4P4UA 4RENA 4D8YA 2HW8A 3F3MA 1JUDA 4R3WA 4X20B 5EERA 2IZ6A 2FX2A 2ZSBA 1GRNA 1L4YA 2CB0A 2HRBA 3IT1A 4F6RB 1XXHA 1O8CA 2OC9A 5H1YA 3V9AA 1YS7A 2RGNC 2WUWE 1MOPA 3BWYA 5IMBA 3S1LA 1V4NA 4U6SA 3WQBA 4D9JA 3WLAA 1EDZA 2Q6IA 3MJ4A 4V0LA 3CMMA 3HU3A 3LVBA 1T4MA 3QV2A 1H4QA 5LBUA 3W78A 2BRUA 1YVDA 2XXBA 1SHKA 3CF6R 3JQFA 4CQMB 2YZNA 4FEGA 1PUXA 1AOXA 2F17A 2GCOB 3PUIA 1UEJA 1XEXA 4D81A 3I6IA 2G1PA 2P78A 3QELA 4UM5A 3SJ7A 3U4GA 4X97A 1V26A 1JSXA 2YYYA 3P9CA 5B1IA 4YUVA 4JA0A 3L7YA 1RCTE 2UUAB 3N7TA 3D1LA 2IIBA 4PCAA 2XRFA 3W4KA 2C5BA 2F48A 2OC4A 3I1IA 4MRMB 3C3DA 3WGQA 3PNVA 4FHCA 1X7HA 3M6AA 4L7VA 1BG6A 2P8JA 4ZAWA 1FP6A 5JH7F 2XDQB 3BWMA 1RJFA 3OETA 1K6EA 2CL5A 4GXQA 3PUHA 3K1ZA 3TZBA 1KDTA 4JDPA 2ZUTA 3CEMA 3R0ZA 2FFHA 2GTIA 3CPEA 1QYWA 5EJ7A 3AERB 1XZDA 4L5IA 1O97D 3BL8A 4WNAA 3ZE1B 3GFBA 2F8SA 1V41E 1YI0A 3T3MB 2NZ8A 1ISRA 2XUOA 3LGSA 1XD8A 1U2SA 1FTYA 2J85A 4HGOA 4MV8A 2GLUA 4MINA 1QTIA 2J6HA 4OHVA 4BLUA 4DMMA 4F9TA 1AN9A 3C3BA 3BG5A 3JYLA 4BXOB 1I5OA 5BWMA 1U7DA 4J90A 3I45A 3PDIA 5FNVF 1PJLA 1SKBA 4BX2A 4XIYA 1K6IA 4ZVOA 2WAOA 2AX4A 1TNDA 4RETA 4GD3Q 4B9AA 3DTNA 3LQQA 2H9YA 2IVZA 3IESA 3I1YA 1U7UA 4PEVA 4IVRA 3RK1A 3FCUB 4BLWA 4F8JA 1NQ5A 5A9SB 2L2QA 1BXKA 4ESOA 1YQDA 4PBTA 2X9NA 1ULZA 1WOYA 2E82A 3MFQA 4PTLA 4G4IA 2D0DA 4HEQA 1MR3F 2DHCA 5TEWA 3ZK7A 2AFIB 4K9RA 2VTKA 4II2A 4Y1EA 3EVZA 4MTLA 4DLZA 1HLPA 4E5VA 4CM9D 2GXSA 1DCMA 4EPTA 3ZH2A 1OILA 2QXYA 3PFGA 1NP3A 1TGYA 2ORED 1DL5A 1X80B 2MYNA 5FBQB 2NZUG 3SIPA 5K05A 3FYTA 3M6FA 3O73A 5ER6A 1WXXA 5AP9A 3H9UA 3V7NA 1A4RA 1E2NA 3LU1A 4M9UA 4MQ4A 4WLNA 3TO5A 3THWB 2O14A 2VNHA 3ZXUB 1GRRA 3R3WA 2IYLD 4RVHA 3VDXA 4TTAA 4AX4A 3OCYA 2XWSA 1U5BB 1NVMB 2F3SA 3P9IA 4I36A 3VPXA 1X1QA 2R8XA 5CFNA 3I62A 1RYZA 4BMYA 4UHEA 3ZNPA 1UOEA 3TQTA 4DLKA 2E7ZA 3DAYA 4JNKA 2P3OA 2G7ZA 4R2KA 4WJLA 4MPJA 2XCLA 3GAZA 3LXRA 2BMEA 3VTKA 1GQSA 3H65A 5LQUA 2XDAA 3HP4A 3WNVA 4BLPA 4AP5A 1YB4A 3WLHA 1ZOIA 4I6GA 3AJ8A 2HFJA 1UFQA 3QF4B 4CFZA 2AOUB 4CLHA 1U8UA 4DMCA 4UE2A 1ZM2A 1JFTA 4Z5XA 4DCTA 3NVKI 2HHAA 3I92A 3HGMA 1RP1A 2ZTHA 3IVMA 2BF4A 2H4FA 5BVHB 3RU3A 5EMKA 4W1PA 4MQMA 4QASA 3OQVA 1F2UA 2AGVA 3PVCA 3ZWOA 1GPKA 4AWAA 2AOTA 4E2FA 2NU6A 4AAYA 3P71T 2PA0A 2BIFA 3FYUA 3SAJA 1N0VC 4B85A 4YXWD 3HCFA 5KTOA 1O7JA 2YXBA 1M7HA 2VI5A 3CV3A 4A82A 4BNYA 2D62A 2Q29A 3USCS 1KJ9A 2WP0A 4H7HA 2YR0A 2VTBB 2O8CA 3JQ7B 4NYIQ 2NWQA 2X2OA 3O8NA 4NLLA 2AN9A 2BMVA 2QL6A 4R8MA 4WNCA 4YP1A 5KREA 3QVXA 3QELB 3ZN2A 4QECA 1YQUA 2GBGA 2P9GA 2R8BA 2ZE6A 3LCVB 2XRZA 3FCCA 1CU1A 4WKGA 3VH4A 4D5GA 2BN4A 4L16A 4XIGS 1K6MA 1V8OA 4LF6B 1UANA 3NCHA 2CXHA 5KDLA 2PUJA 3V1KA 2EQ5A 2HU8A 3NBMA 5KCMA 1FYXA 2RHMA 3H5RA 1JXMA 3PU6A 1L1FA 4J9VA 3GMDA 3TD2A 4CL8A 3AIOA 4HPXB 1NW7A 2Y71A 1A8SA 1KMHB 4CN9A 5HR5A 1D4FA 1P74A 2CF5A 2H3HA 2XTAA 3DYBA 3BK2A 4PNPA 2VRNA 3D8SA 3FFWA 5IKPA 4Q4AA 3TPZA 3KWJA 4E33A 5CCXA 1IG0A 1ZOLA 3DOJA 3MMPA 5JZVA 1PNRA 4Q9KA 1CY0A 5BYJA 1CLUA 1ODLA 2FK8A 3D0KA 3FG9A 3Q2KA 3RQSA 3FCYA 4I4TF 4IGFA 2DJ5A 2QE6A 3PDUA 4LZWA 1RI2A 1T9DA 1FMJA 1GUBA 2BJHA 3HR4A 3HY6A 4E08A 3TFOA 5BN4B 4CIYA 4ZZ0A 3O74A 1RPJA 3GRPA 5EUQB 4EJFA 1XZMA 1B74A 1VPTA 4DJJA 1HORA 1BN7A 1T2VA 4KIUA 4QBIA 4AJ1A 4QXMA 3W4JA 4GYWA 2GD2A 4TWZA 4Y9RA 2VPPA 2W2OA 2BTQB 2AB0A 3TLKA 2HJ9A 1TLFA 2HIHA 4LVUA 1V8PA 2BLLA 1JEJA 1M9NA 3DOFA 2BCEA 4GGMX 4MKXA 4XQ0A 3SZOA 2G4CA 3Q5GA 4EJSB 1N7HA 3LWZA 4AMGA 4OLFA 1BQ3A 1OFTA 1X1DA 3WJ1A 5DOZA 3IP1A 1R4ZA 3DF9A 3ZH9B 2VAPA 3BJIC 4UZSA 2GWRA 5BSVA 4GP7A 3I01A 1JG1A 1HI9A 2I65A 2COKA 1Q11A 1RM0A 1JAIA 3DMHA 4RIFA 1SBIA 4KH1A 3EFHA 3AHHA 1S5PA 4G25A 3S7ZA 3TAXA 2CEAA 1XL0A 1EFAA 2CE7A 2FZKA 4Q19A 4CM8A 2OENG 1JB1A 1EIZA 3IBTA 2PUDA 4N8SA 4A6EA 1QRUA 4AZ0B 4ZTZB 2X3YA 2IXFA 1CHDA 1EK0A 1F12A 1ZK2A 2P62A 3IV6A 3LO5A 4JUCA 1GPLA 1RAEA 1RYNA 2B1IA 2PRSA 3OCJA 2ZR7A 2P9HA 3HJRA 2M9MA 4YPFA 1K8XB 3PNKA 1SC3A 5EZYB 1M7GA 2VF7A 4HATA 2EQAA 2XD4A 2WJAA 1E5DA 3ORQA 4WASA 5DCYA 5HMMA 3I9LA 4IRMA 4OVKA 4IIBA 3EY4A 3RRMA 2PE5A 3SQDA 4JK3A 2OBFA 3MCVA 3N86A 3L1VA 3VR4A 3NJ8A 4BNNA 4W9MC 2W90A 1ID8A 5IBCA 4MV4A 2OCIA 1IBSA 3QPDA 3DWEX 2AV6A 1XOIA 5DV9A 5IW8A 5FLKA 4JLJA 5CB4B 2X6RA 4HUJA 3TE6A 4TGLA 4JSRA 1EUDA 3COJA 3FKQA 3CJQA 1CUFA 3LYHA 5CT8A 4R2JA 3K3PA 4FB5A 3RG2A 3KUKA 2A6PA 1G6KA 4I5FA 3R74A 5JT1A 2IIVA 4H7KA 2P9ZA 2ZJ0A 5CM9C 1JE1A 3MTIA 2QRJA 2FPXA 5EINA 2X0KA 4MVJI 3GJ0A 4E88A 4C7XA 4PG6A 1IXZA 5GONB 2A14A 4AY6A 4L22A 1AKWA 1GGHA 4ZT7A 1PJCA 2DBVO 3DAPA 4EI7A 1E2QA 1R88A 5FTJA 5KYVA 5KSWB 1X1AA 5JY1A 1NMQA 2XMPA 4Z0PA 4ACAA 2V4ZA 1DFGA 2ZSAA 2IYZA 1VIYA 2ZQ5A 4WD3A 3AWDA 3F5QA 4D0NA 1QIEA 2OZLA 3FOCA 1PGPA 3HDGA 1PLJA 3K9HA 1QCYA 3GNSA 2AJ8A 4H77A 3ZD9A 1PWEA 4RCVA 4AMVA 1T25A 1EX7A 2JF0A 2XXAA 2GCNA 3MEQA 4R81A 2DAPA 4UXIA 3AI1A 5IK2D 2RIRA 5EVCA 1CY8A 1TL7C 3CR7A 2QZ9A 4E1BA 2PXHA 3P9KA 4FJ2A 2ZE5A 3JTMA 4F4CA 4D6YA 4PX2A 1X77A 1Y37A 1Z83A 1X94A 3M4YA 5D1HA 5JVDB 4C14A 4KLZA 3LJKA 3KT8A 3W8FA 3C7AA 1DTWA 4E5UA 3WK6A 4PZ9A 1YKGA 2CDBA 5TDHA 4D97A 4JA2A 4CUZA 2ZJFA 1BC5A 3WYEA 3THXA 4DC1A 4OMUA 1P62B 1U04A 5ESRA 1U3VA 1YBAA 1I1NA 4RTQA 1WUHS 2OCDA 1NPTO 4KH0A 3TRJA 4DWJA 1IZ8A 4PV7A 3QMPA 1DZ3A 2JIMA 2VT6A 3M81A 4BJHB 3PUYA 4HGYA 1CJUC 1G64A 1G1MA 1H1TA 4U7PB 5LZ2A 1N33B 5CM2Z 2H4XA 4KSBA 1Z7WA 5K0BA 1KL7A 2GSWA 4ZVLA 4BVHA 1FFXA 2JJ8A 3DDUA 1II0A 1D5WA 3GRKA 3K09A 3M7IA 1PGOA 3DFIA 3K6SA 4HNGA 4O4LF 5BRJA 4YRLA 2NUAA 3KDSE 1XWIA 5FO0A 2I3AA 4H7PA 2IHUA 4UEJA 1YBMA 1H0HA 2HPHA 5G4KA 4B17A 3SXPA 5TARA 4IEIA 4QOIA 4QXOA 1SRQA 5DTQA 4UMVA 1ZMOA 3AFNA 1QG0A 4RA9B 1GG2A 2C04A 3K0HA 4F5YA 2WTEA 1CUYA 1OA0A 1XA4A 1U0SY 3ZCPA 4J94A 1DOHA 4AZ3B 3P0JA 1I1HA 3RIXA 4EATA 5CG2A 1X92A 4D56A 4AROA 2E55A 1PQUA 3HKCA 2PLWA 1PNQA 1S8FA 3W2IA 3G1TA 3MQFA 4OXNA 1DKLA 4P9NA 1W49A 3N6XA 4AJJA 4BE9A 2REXB 4CG0A 2YX1A 4KSCA 2FWNA 4XSHA 3FB4A 1RMTA 4JI4B 2WZQA 3N7AA 1H2HA 1G21E 1BO6A 4MK4A 4KQ1A 1D9ZA 4BQIA 4YJ2F 4DY4A 2R84A 3OJCA 3KC2A 4R6WA 3A4LA 1EP1B 4YC7A 4M53A 4I1PA 2FF5A 3KM0A 4UHBA 3HCOA 3MIZA 1FU7A 4QEDA 1XTKA 3K9BA 4RWEA 5DNEA 5KJ6A 5KNDH 4NOKA 4XYMA 1RXUA 5ALUA 1ZXBA 2I2BA 1R8YA 3ECSA 3M5CA 2GCEA 1DT3A 2WZDA 1UPBA 5GZ1A 2WTXA 4ZT4A 3I32A 1S2GA 5H7XA 1C1YA 5BQOA 3DG9A 3D4PA 5KNDD 3PJRA 2ZSHA 3ET4A 3W1VA 2O1XA 3GDHA 3I2GA 5DN6A 3LSTA 1NBMD 3SR0A 3AUSA 3H0KA 2AX3A 1FVFA 1MXFA 5FYDA 1HDCA 1G8YA 1MC5A 4YUWA 3UMYA 1IBLB 3VU1A 1J09A 1VIDA 4PAWA 4AN4A 5L40A 3ITEA 4L1KA 4PQYA 4ZXFA 2OYSA 4QOHA 2O7NA 3OZDA 4YUXA 1M0EA 4JI3B 4LXHA 1SVOA 3I9OA 2PX8A 4RADA 1NRXA 2OHHA 4BO8A 1BA3A 4DUPA 1CC1S 3AJ9A 5GINE 3UUFA 2NQ8A 2NUTA 5C1DA 3ZQ4A 4KO2S 3GLFE 1JDUA 5IU6A 4EMBA 3IBGA 4U1RA 2Y1WA 5PNTA 1TO6A 5C5DA 4HL6A 1QH1B 2PZAA 3HCAA 4IZOA 5BSEA 2H2GA 5AESA 2R7NA 1BCRA 4WA7A 4N5HX 3MT9A 4HXFB 1R6AA 2ZB7A 1RQPA 3ABOB 3IJRA 4QPNA 4DF3A 1OXUA 4MPRA 4F06A 1GFWA 2C5GA 3NHZA 5IARA 4I14A 3T7JA 3X44A 2W2QA 1G16A 1SJ9A 4MGYR 4CFSA 3BJRA 4DIOA 1G2PA 3N28A 5DGTA 5FL7A 3KVOA 4L9RA 2XUJA 3ORRA 1NNI1 5IN4A 2QN8A 2ROQA 4Y7CA 2R5FA 4ZQGA 1LX6A 2E4XA 2AE1A 1I6MA 4B7UA 4JXZA 2P3QA 4I9HA 1PWZA 4Q4LA 2EZ9A 1E1NA 1G5TA 2QP9X 3RSFA 1B8NA 1QKKA 4O2BB 3EE6A 3TN7A 1RQ7A 5C1BA 4OHCA 1DELA 1SA0A 4LDZA 5E9QA 4UASA 1NNEA 5AW2A 3B70A 3H1AA 3W05A 4FE7A 3WA7A 2ZWMA 2GD6A 5CHEA 3V8MA 5JNTA 3KXDA 5JSKA 5JATA 1M0WA 3WXMA 2RGRA 2AD1A 5CLJA 2OB1A 3DNFA 3ESBA 1JHUA 4RMHA 4IJWA 3ZHTA 1PRYA 3EIHA 2JLZA 4LNUA 3K6SB 3HKBA 2A5LA 1TQ4A 2FMHA 4UM8B 2B36A 1H2ZA 4JN6B 5B3LA 1NRIA 5H0IA 2LZ0A 4MKZA 5JNUA 2X22A 3UWSA 3GLTA 4ZTUB 1CS0A 5BN1A 2WHYA 4LQCA 4RABA 4O59O 3C6KA 1PIWA 3TOCA 2YRWA 1NVTA 3C1TA 1CWUA 1T8YA 4M0DA 1XDBA 3O47A 3QPBA 4QTZA 2BE7A 1M2OB 2Q9CA 3OPYI 3AP1A 1JQ3A 3ZWWA 1A7JA 1Q95A 3NTOA 4KK4A 4Q3BA 1DKMA 3HKCB 2BMJA 1R4NB 3EEOA 3SJUA 2H52A 1M1NA 3BFPA 3CLRC 4S1OA 3RFFA 2PD3A 2PKQP 3FWZA 3GLRA 3DTVA 3EGXA 1O0SA 1Z7YA 3OOYA 4PRLA 3MA0A 4CT5A 2Q4OA 4KPEC 1NXWA 1VBMA 2UAGA 4JNCA 2C5HA 2YW9A 4I9NA 4JI1B 2AEEA 5AQ1A 2B4YA 4NMXB 4TT8A 3FWKA 3K96A 5IAGA 4NDAA 5ALGA 1VE3A 2G80A 1F2VA 4CI0B 1SOUA 2PAFA 5B5SA 5JCOA 5I9IA 1W2GA 4PSDA 3KJNA 2W42A 1ISFA 1ITZA 3PL1A 4BL5A 2HQBA 1RZ3A 1DAEA 2CWWA 3MJSA 3FOBA 2G17A 3TINA 4BX9A 1SCDA 4BO1A 3SEFA 1NV8A 3K16A 1N57A 2FUG6 1ZVVA 2PYZA 2FE4A 4YLGA 3ZR4B 3ROTA 2BD0A 4MYSA 2RAPA 3H05A 4PPNA 4XZ3A 4Z51A 1MB4A 4HDNB 4P35A 2C8JA 3NBAA 2DFNA 4PIPA 1YQXA 4FQ5A 4CMBA 5JJKA 2QTGA 1ZP6A 2HO5A 1IK6A 1TQDA 4IILA 4KWIA 5FTKA 1CJVC 1CUUA 2FWAA 5BSKA 5FWYA 1Z5ZA 5E2AA 3CNLA 1HLDA 3HN2A 3L5KA 3OC0A 4AYWA 2ILTA 1XTPA 4D4HA 1RE0A 4TSFA 1E9FA 3P52A 4HLQB 2EP7A 2ZIAA 3SMQA 3KDPA 2Z2KA 4LE2A 1CIPA 3TFWA 3TBFA 4EG8A 1PWHA 3MRVA 3E1GA 4P92A 1DX6A 4X24A 5BXYA 1JYEA 5LNK6 3OJOA 4AO8A 4UARA 4OIMA 3FLBA 2D5AA 3HBFA 2MTBA 1Y6FA 5K6TA 2BUBA 4GF5A 3NTXA 1NUTA 4XPIA 2IU0A 2GA8A 2GHTA 5AVOA 1JG2A 2EIXA 2X14A 4LRYA 9ABPA 3WR5A 4RIEA 3VNRA 1JEEA 1XZHA 1VOTA 4FS8A 3H9CA 5A2QA 2AOWA 2ACWA 3GZNA 4PHCA 4FLFA 2GEVA 3U39A 1P2TA 621PA 4MVJF 4Z2YA 2W7TA 3DULA 3M9WA 2J41A 3WLSA 4F3NA 4MPTA 3GPLA 3FR8A 3GLHA 4OPMA 1YR1A 4GIBA 3S6JA 1VFPA 3AX6A 2A7XA 3R7FA 1A0OA 4QO7A 4CWAA 5JXIA 2H00A 4NEHB 3RIMA 1U0LA 4W1RA 1ND6A 4JGBA 4IDHA 4LRUA 1IXSB 3IVXA 5CIQA 2ZBGA 5EP2A 1CP2A 3JW8A 3KR1A 4COKA 2B69A 1LLDA 1GIAA 5J59A 2XD9A 2XTMA 3LK6A 2VJQA 3RLIA 4DIBA 5J2TB 2GSDA 2VVTA 2J7PA 2P6MA 3O9MA 5LQNA 1ONPA 5LB2A 3U2QA 1BDHA 1GTSA 2ASEA 1X74A 3EEYA 4CQMD 1FLVA 2G07A 3QNMA 1EJBA 1P18A 1FYFA 4RS3A 2FYTA 4BJ5A 5KEIA 3BB1A 1EA5A 4I5DA 1E3LA 1QBGA 1DJQA 1RD4A 2BR3A 3RUPA 5K6RA 5CDTA 1JDSA 4G0WA 1QH8A 4DXDA 3UBMA 2PKRA 1S2MA 1WEKA 1G8HA 4WK6A 3IUMA 4HN4B 4MV1A 4R69A 3FE2A 4BQNA 5GONF 1V5WA 2FVYA 2ZSUA 3WP0A 1FLDA 1BDIA 5KYUA 1C4OA 1L8OA 1T6YA 3H2KA 4DBZA 3SYTA 3VC3A 4OP1A 4BNVA 2PRJA 2K87A 4B82A 2JGJA 5BPFA 3O4IA 3HU1A 3M3DA 3TOSA 3QVJA 4NBRA 3SS7X 1TUGA 2L0XA 4OGGA 4E70A 2D4AA 2EKPA 2PDAA 3IPXA 1Y5IA 5JZSA 5B58T 2OK7A 4FILA 4EENA 2VP5A 4BFXA 5HJ7A 1C3XA 2ZJ5A 4YDHB 2OSVA 1MQAA 4Z9BA 4U2BA 4BNGA 1Y6ZA 4YP7A 1K7CA 3P20A 4IXTA 4DWOA 2C83A 3AUFA 4MRPA 3TSAA 1AQJA 4Q7KA 3ZE2B 4OI0A 3ID6C 3O8OA 3FHOA 3HJTA 2GF2A 3Q6MA 3H4TA 1BH2A 4K03A 5A4JA 4GOLD 3S2GA 3WFZA 5JVDF 2VLBA 4Q3OA 1GN9A 3NUQA 4IBOA 4DB2A 5JCXA 4ZEWA 4DR7B 3CO0S 4YUZA 1DQSA 4DILA 3RVMA 2GA9A 2HI0A 1H9AA 4OQDA 3EIQA 4QJ4A 2W37A 4AKSA 3KETA 1UC4B 4Q1FA 5FWXB 3DMDA 3JARB 2G4LA 1TKBA 3CUTA 4OFZA 5F77A 1C0IA 1KJIA 4EG5A 1SQ0A 2FWPA 2FUCA 4OQFA 3ONNA 4PFJA 4AJOA 4WNYA 3BZUA 1J24A 4OKIA 4HLUC 3DZKA 4FC7A 2YNMC 1L5QA 1VL8A 4H3KB 5BSUA 4LQLA 4AXXA 3T3EA 1KH1A 5CJPA 4QOJA 2ZRAA 5I4IA 3OBBA 4NULA 4CCYA 3DMRA 4W8OA 3MS4A 2W6MA 2WK1A 4AUKA 3T1TA 1R2QA 2OZVA 4MAFA 4H4CA 4QIHA 1YZQA 5GGYA 5H5JA 3T61A 4YHHB 4KR9A 4AICA 1EFTA 5DYGA 1KMNA 3CZCA 4RSHA 5A4MS 4TWIA 3ROGA 3ZJ5A 3H9EO 4MMYB 1YH3A 2AUNA 4IL5A 1QV7A 1ESZA 2EJBA 1FRFS 1WD5A 3IDOA 1BVHA 1M8GA 5CMLA 4I99A 2QLNA 4D02A 4JOQA 5L7TA 2FEXA 3SM3A 3UB3A 5IAOA 3ESZA 3S99A 3S1AA 4IPTA 3AM3A 3K5HA 1KOFA 1O6ZA 3ESYA 1X1TA 1PR5A 1VGRA 3IURA 4YMWA 1MT0A 2VP0A 4E5NA 5IF3A 1A95A 2DE0X 1TADA 4FI3C 3O84A 4MR9B 4HDRA 1TVKB 4WFIA 2XCRB 5H3LA 3AY7A 1THZA 2Z4SA 3KD2A 1N1EA 3UMSA 4WLUA 1QGDA 1J49A 3L7DA 1LBTA 4TN5A 1FMCA 3NDPA 5MFPA 5BSRA 1I0IA 2CLEB 2BR5A 3RASA 4CEHA 1A98A 2EEZA 1QP8A 2QR3A 2V9PA 1J25A 2WLSA 1YBFA 3O4VA 4P98A 4G4GA 1LFAA 3PJDA 3FZGA 4RJ2A 3T0GA 2VRWA 5CA0B 4X63A 1Z9BA 3L8ZA 3BSSA 3S8EA 2JJ1D 1QUFA 5JSZA 2FPMA 3H0EA 2ODQA 4AY3A 1CY1A 1PNTA 1HDYA 1Z8NA 4EAQA 2XVMA 1I3KA 3ZW7A 3H9JA 3IQHX 2NU8A 1GZ7A 4XX0A 1U3CA 1FLAA 5T41A 5CFQA 3KSDO 2AFRA 2QNIA 4KLCA 5TJ9A 5AVTA 4L5JA 3FSEA 5EWJA 5FV7A 1H22A 2QVXX 3EVAA 3TWOA 3M6UA 4ZYUA 5BWLA 5J2UA 3Q3JB 1NBHA 1EP2B 3UBTA 2LIPA 5KWSA 1KRWA 1J97A 1SQSA 1TKCA 2WBLC 1U1CA 4F96A 2A0WA 1QTNA 2HA4A 4OMCA 5KOHA 3IL2A 2CJFA 1J0EA 1KHHA 2IHVA 3R5KA 4HNQA 5KPDA 3W7VA 4MQ5A 4DJDC 3Q1LA 1ZUNB 4GEKA 1Z15A 1XDZA 3PENA 1PS0A 3QVKA 3TW8A 4EY5A 1KYWA 3WNCA 4G0VA 4GMFA 1GXSA 3F7NA 4ITVA 4BO9A 4BKQA 1ATZA 2JCYA 1JU4A 5L3ZA 1XNGA 4XOUA 1I1QB 4LJYA 1IZ0A 4HG2A 3TI7A 1W581 3J80A 2G72A 5EA2A 1NVVQ 2GX6A 4HT3B 1JG4A 2IX9A 2HSZA 2RGDA 2NNWB 2Q6OA 3CRMA 1QLWA 2O50A 2UUOA 4Q1DA 4S2EA 1ULSA 1V9CA 4WFKA 5AD1A 2HSWA 5KHLB 2WDZA 3ZOZA 2C2MA 4UUPA 1O94A 4C87A 3MXTA 5DLYA 2ECOA 2AZ4A 1W85B 2JFVA 1CUCA 2AOXA 3L0CA 4RMIA 3RAFC 5EWLA 2P2GA 1KDZA 3HS3A 1MXHA 3ZWBA 2BDUA 5GMOA 3AIKA 4FVTA 1NATA 2A5DA 3CLSD 3WY9A 4JI2B 1MZVA 2XDYA 1TKRA 3KOWA 1ZD3A 3PXEA 4YLEA 3UW1A 4RIGA 2ZTLA 1Z4JA 3N76A 1ZMBA 4O2BF 3O7WA 4NRDA 1ZA1A 2UZ3A 3C4QA 1S8NA 4QFDA 5JSHA 1CVLA 1JHVA 1I32A 1PHRA 2J09A 3SIRA 3ZU5A 4L6CA 4F8EA 4TYWA 4EBBA 1T2CA 5EIOA 1V25A 5EXXA 2QD3A 3DWIA 1TAUA 4IJUA 4DBLE 3K70C 2AXPA 3ZXXA 1Y6GA 2R00A 3MYYA 2MSCB 2YMMA 3NIBA 2QRVB 3F6EX 1XMQB 4FOPA 4MVJH 1D4OA 3C6YA 4JBIA 3U3KA 2EFHB 3HBNA 3RJ9A 1Y3AA 1B0AA 4RFVA 1WTAA 3VMMA 3CE9A 2Q21A 2XUAA 4QG7A 4J29A 2I5PO 3UUEA 1MF7A 1OXKB 2XOKD 3L84A 4MHOA 4GS5A 1FSZA 5PGMA 4MVJD 4QRIA 1P7ZA 2ZIZA 2HWYA 1ZIYA 3GG9A 5CA1B 4OQ4A 5F12A 2HJRA 4JCOA 3R0XA 1WUYA 3H84A 3LUHA 2X9LA 4CIVA 2H92A 3IA7A 1HEYA 3AXSA 3NH9A 2UVQA 3QJYA 3H11A 4HWRA 4YCJA 3UA4A 4R16A 4X66B 4FU0A 4N3NA 5HF9A 5T64A 3DEYX 5KPJA 4HDRB 4W4TA 3ZJUA 5AKJA 4DTCA 5HKAA 1ZBQA 3UICA 1FSFA 5CLQA 1P1KA 4ZCRA 1SU7A 4URVR 1ND5A 1WMSA 4I9UA 9LDTA 3DQZA 4N7MA 5DHSA 3G5UA 2I8LA 3QYJA 4AUMA 2SCUB 4JC8A 4Q7EA 3PEVA 3VH3A 5EJ8A 1V11B 4DKXA 2FZVA 2Q3DA 5DTEA 4ZCLA 5JSZB 3QVOA 2JFZA 4CM7A 2DC1A 2JAPA 3D3WA 3PVSA 4JSTA 1NKVA 2PGLA 2I34A 2FUNB 1LBEA 5LPNA 1Z0DA 3GNQA 4LFAB 3WJ2A 1UPTA 1OJ7A 1HL3A 2V0GA 1S7GA 4FJ1A 3WGIA 3PV0A 1PX2A 2QVBA 4Q3LA 3T8YA 3TUJC 3U44A 1OH7A 2AXEA 3ZCTA 1G9TA 2XZDA 1I7SB 4X6YA 1X6VA 2XE4A 3VDMA 4ZFNA 1E5LA 1YE5A 2VNIA 3BHMA 2A8YA 3IP5A 2CLFB 3F6CA 2AG1A 1Y5NA 4M1MA 5ULLA 4P54A 3BXFA 5KYYB 3TL6A 4D80A 1ADCA 2GXQA 3MWLA 2FR1A 1AKUA 4R2LA 4ZQIA 1N5RA 4GW3A 5LOVB 3JTEA 3TW8B 1I8TA 4Q21A 1XTVA 4L08A 3S2SA 3R9XB 1ODSA 4MIYA 2R7LA 2ENWA 2A9OA 3FCOA 1GR1A 1SNYA 3R3SA 1SC9A 2PS0A 2NZWA 4PF1A 1Z2DA 1J9ZA 2J9FB 2QRHA 2EG5A 2Z4TA 4I08A 3C87A 1WBDA 1G7CA 3KS9A 3T7TA 5IJZA 2APJA 4GL4A 3EEFA 1MT3A 5IX8A 2FMTA 2DB3A 3WX0A 1ZVMA 5E6RA 3NYRA 1ZRMA 5DTRA 4KMOA 5K3OA 4NBWA 4KPGA 4OIFA 3KQOA 1JEYA 3G6KA 2N3ZA 2WFZA 1RZRD 1VJ0A 1QHFA 2PZMA 5DLQC 4PQRA 2PZEA 1GPMA 1R8XA 2V7PA 4KUGA 5ECYA 1YS4A 2M1XA 2X8BA 4OA5A 3UMRA 1OXTA 1GGKA 2IYRA 2D54A 4X3OA 4YN3A 4WESB 1H1LA 1R15A 4XIIA 4KVGA 1TM2A 3U3MA 1Z8FA 3LTNC 1TK9A 1C8LA 3QUQA 4KE8A 4CM5A 3PX7A 4C7OA 2B83A 5IFLA 2R25B 3A1NA 3AONB 2V7VA 3C16C 5J2TF 3RAEC 1Y7HA 3ZJYA 2F4VB 2Y6UA 4UVIA 5K4HA 3E8SA 2GO1A 5K3AA 3RFTA 5J47A 3GXOA 2A86A 2R6CA 4B83A 3AOEC 5F7XA 4YMVA 3AHEA 1QHHA 1VHQA 5G0VA 1KQNA 1V4BA 4WXMA 2XCTB 1ORRA 1KR2A 1QYXA 3GGSA 3REQA 1NBME 1SKAA 3D4BA 1LF0A 4L78A 1QGUB 2MT9A 4UHKA 1I4LD 3ZD7A 1YJQA 2C96A 4PLCA 2GRJA 4MS4A 3JASA 2YW2A 1MJHA 2J0SA 2XRYA 3BS4A 2RONA 2A1TS 1K08A 3PSHA 1VZ2A 3B8EA 1XTZA 2GJ9A 1DQZA 1QIDA 4PLZA 3IAS6 1X8KA 4C5AA 1HEUA 1P77A 3QU9A 4G5OA 3AVTA 4J0HA 4WX2B 4EJ6A 2HGZA 4DANA 1I2BA 3GT4A 3WNQA 4V24A 2WRZA 1J06A 1VCOA 2WOOA 4LYJA 3IT3A 1EINA 1P7YA 4LISA 3GDWA 1NLUA 3NBYC 5EEGA 2WAXA 4E2WA 3AMVA 3LHSA 3BXOA 3Q87B 4BNZA 2OLEA 4CKXA 1P6XA 2EHDA 4TLEA 3PG5A 1N5MA 3G5AA 3N0VA 1U1FA 2ZROA 3GYBA 1U8FO 1VSBA 1CUWA 4F3KA 1GO2A 5L53A 3IR5A 1GG5A 3OZTA 1Z6YA 4OGWA 4W5TA 3B1ZA 1RLJA 2YINC 2V7WA 4FKZA 4PZ0A 3KOZA 3B3AA 4KQIA 3T3NA 1LNZA 3BA6A 4AJIA 2Y1LA 5C9ZA 4GSKA 3FD8A 4I9FA 5JY6A 4R6XA 2ZRFA 4IO1A 4IJ6A 2BYTA 1UMBB 2OV6A 4OQYA 3LFTA 4KQXA 4L85A 1YS9A 2HNBA 4RCZA 2WG1A