1XU9A

Crystal structure of the interface closed conformation of 11b-hydroxysteroid dehydrogenase isozyme 1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
b'QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Conformational Flexibility in Crystal Structures of Human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
pubmed doi rcsb
total genus 100
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xu9A00
4ND4A 1X14A 2ZTMA 4CLRB 4F6LA 4PVCA 1DC3A 1YBMA 1HRDA 4CMHA 3BHJA 1XYGA 2X0RA 5JW6A 1ZMOA 1PS9A 2O2YA 4WCFC 5FWNA 3ICPA 3CTMA 1Z74A 2WSBA 2O2SA 1UZLA 1LSJA 2GLXA 2Q1WA 1HT0A 2W2KA 2YJZA 3CUKA 3PQDA 3KYCA 4DBZA 4S1VA 2Q2VA 4YJDA 4D7AA 5EL0A 3BYZA 2EGHA 2HK8A 4WNCA 3V1UA 1GCUA 1MC4A 1OC4A 3HB5X 1I3KA 2XAAA 1Y8QA 3WYCA 4LGVA 1T2AA 2ZYGA 1NQ5A 3GVCA 1E7QA 3BIOA 4PFJA 3A06A 2R00C 3E9QA 1OZAA 4U5QA 1OFGA 2GYYA 5TC4A 4MINA 2B5VA 1J6UA 3FN4A 4XD2A 2IXAA 3DZKA 1ZUD1 1JVBA 5FYDA 5IZCC 3W4JA 3F47A 4J4TA 5BSHA 1XU9A 4YJFA 4JXKA 4CUKA 2E49A 1LDMA 5IG2A 2RIRA 1WP4A 3F5SA 4W7HA 3KO8A 1PL6A 4OMUA 3Q3CA 4AJNA 5IDXA 3PJFA 1M66A 3WDSA 3HNPA 4ZU3A 1YWGO 5A04A 1J49A 1PZFA 1S7CA 5KOIA 3DFZA 4CM5A 4GL4A 1BW9A 1MLDA 3JD4A 3FCOA 4GVLA 4L4RA 3VKUA 3EK2A 4CV2A 4QO7A 5AXCA 4I08A 2EGGA 3B1FA 2Q2QA 2PH5A 4D46A 4XEHA 3KRTA 3PRJA 4UVDA 1PWXA 1H2BA 3ZWYA 4EEZA 4ALLA 2QG4A 3QQPA 4PLGA 2PZMA 5DOVA 2B35A 3INRA 1ADFA 1BDMA 2H63A 5ICMA 4D0SA 1TEHA 4PLWA 4IGEA 5KIAA 4QQRA 2ZYDA 1Z7BA 2Q45A 3K73O 1RKXA 3RWBA 3JCZA 4IINA 4RPJA 2RHRA 1ZVMA 4WLOA 1V0JA 2A92A 4OXYA 1EK6A 1BGVA 3L9XA 3LZ6A 3VPHA 3WICA 4E30A 1WMBA 1LUAA 1LDEA 4KUGA 4F3YA 3CZRA 4FFOA 1KYQA 1LRJA 1VM6A 1BXKA 2FSSA 4W7IA 3WBBA 4GSKA 2P68A 1YL6A 5I7FA 4MKRA 2WEKA 2AXQA 2Y05A 3D3WB 4B79A 3Q9NA 2HJSA 1ZEJA 3SX2A 1MXHA 3H65A 2UYYA 3TL3A 3DL2A 1OC2A 3PLNA 4GX5A 2UUPA 1NQTA 3L4BC 1K6JA 3WGGA 2V6BA 3LK7A 3QJ5A 3UOGA 4CR6A 4FGSA 1NHGA 3ZHBA 3GEMA 3JQAD 4MO2A 1TT5B 3IKTA 4IJWA 5ILOA 4RVHA 1LA2A 1P1JA 3E03A 4UULA 3I5MA 4FFPA 4YPOA 2NWQA 5G0WA 3RD5A 1R4MB 4NMHA 5C7OO 4BO1A 4BO2A 2AHRA 5GMOA 4DQVA 1ULSA 4NK5A 3VPFA 3D3WA 1H93A 4FC6A 3C85A 1F17A 4GX1A 3VTZA 4JROA 1P44A 3GVPA 5F1OA 3LF1A 5TLSA 3QY9A 1XU7A 4CMIB 2ZATA 4PLVA 4BNNA 2DPGA 3DBLA 7ADHA 3ZV5A 3KV3O 2JD1A 1PQPA 1CWUA 5JC8A 5A5FA 4XRRA 2NVBA 1ZZEA 4J0EA 5ER6A 3TF5A 3EVTA 3AU9A 5JSFA 5F3RA 4F46A 1RYDA 3U4DA 2CVQA 4TSKA 5DBFA 2D4AA 2VT3A 3PHHA 4LRTB 4CV0A 3QVXA 1KC1A 3D7LA 4LISA 5JPIA 3E5MA 3JQ8A 4CM9A 4DC0A 4OAQA 3L07A 4B7UA 1GTMA 1JVSA 2WYUA 3ZWBA 4ID9A 3GHYA 4BNKA 2B83A 4AJJA 4AJ2A 4PLTA 4GGOA 4U0JA 1O94A 4R1TA 5L7YA 2X22A 5THKA 1AXGA 4BO0A 4BMSA 3DHNA 2GN8A 4R16A 2PA3A 2ZKLA 2C07A 4E5PA 2VRBA 3DC2A 1A4UA 1ENOA 4PG6A 4BO6A 1UXIA 1X7HA 3A28A 1GV1A 3OH8A 1YVEI 1Q7GA 3PGJA 4NG5A 2FR1A 2NV6A 4QUKA 4CMCA 1V3VA 3CMCO 2IYPA 2ZB8A 3CINA 5EJ2A 3U9LA 4IBOA 4XYMA 3SEFA 5A05A 2EWMA 2Y1EA 2JHFA 1GL3A 4J1SA 4RPLA 1WLYA 2R6JA 3AK4A 1EUCA 1YB4A 1YONA 2B4RO 3MJVA 3NV9A 5IJZA 5BNTA 4GSLA 4R1UA 2VOJA 1EBFA 1NNUA 3GA0A 2PNFA 1Z75A 3AOEC 1UAGA 3OEYA 2RCYA 1P1HA 2EHDA 2I3GA 3LC7O 4CMEC 4OHUA 4IIUA 4QSMA 3BAZA 4ITUA 3HDQA 4BGEA 2UAGA 4BNUA 3AI3A 2VOEA 3V1YA 5A9SA 3U49A 3QVTA 1LDYA 3WGYA 3G1UA 4ZVVA 5B12A 1HYEA 4QO8A 3JQ7B 1H6BA 1QLHA 1D8AA 4NZ9A 4LCJA 1A9YA 3ZU3A 2A4KA 3LT2A 4LVUA 4BNHA 5IZ4A 1UZMA 3F5QA 4H15A 2X5KO 1QYXA 4A10A 1HF3A 3KZVA 1DHRA 2O3UA 3LC2O 4OOEA 3DZHA 3JD3A 5F5NA 3MJEA 1DB3A 1PS0A 4J16A 4EDFA 1WNTA 4CMAA 2C2XA 2X86A 5TGDA 5TS3A 3JQ9A 4TVOA 1Q0LA 3E6AA 2ZJ0A 4WGGA 5JE8A 3MJSA 3GN1A 3JQDA 3I23A 2PGJA 1CDOA 1MA0A 3O26A 4J1TA 1AHIA 3TZ6A 2GN4A 3JQGB 1G0NA 1NR1A 1R15A 2IZ0A 3I9LA 1U3TA 4LMRA 4Y6RA 4A2CA 3AM4A 1R0LA 1IL0A 5JO9A 4DC1A 2NU9A 1A7AA 4UVGA 2JL1A 3FHLA 3RBZA 1D1SA 1H6AA 5J23A 4YT8A 3OMLA 5F5LA 4O1MA 3RFVA 4FQ8A 2OO5A 4RDHA 2CY0A 3V5NA 3TWOA 4R5HA 3IJRA 4Q9NA 1RPNA 3K9QO 4FSHA 2HDHA 1ID1A 3B6ZA 4EJ6A 5CG1A 1DIBA 2XXJA 3HN7A 1JN0A 2HCTA 1M76A 3ON5A 1PGOA 1WWKA 2YV3A 5CEJA 3PI7A 3CZMA 1FDTA 3H9EO 2VZ0A 4GKBA 1NPTO 1EBUA 3QVSA 3ULKA 5I8ZA 3VC7A 1ZEMA 3GUCA 2GSDA 3L6EA 4E5YA 4CUJA 3PDJA 3H9QA 3PQEA 1GDHA 4PLYA 2NSDA 3LVFO 4MKXA 1IHYA 4DQXA 3E48A 5AXAA 3HZZA 3GUYA 1E3EA 4NFSA 1HDXA 4IM7A 1C0LA 2P5UA 2E37A 2W2KB 3ZWPA 1I0ZA 2VT2A 3WSVA 4Q3NA 4AJEA 4KOAA 2EW8A 3F4BA 4TRRA 1PZEA 1AHHA 2VYVD 1EZ4A 5I9LA 1W4ZA 2RAFA 4HBGA 3DQPA 4IY1A 1LJ8A 1T24A 1TVEA 1VJTA 3C7AA 3VZPA 1DO8A 3GAFA 4HKTA 5L7WA 5HWSA 3DMYA 2OUIA 2C7VA 3K92A 3OQBA 5DDIP 1P1RA 4K26A 3JTMA 1U1IA 2J5QA 4K28A 3DOOA 1E3LA 4BNWA 4RLSA 1AE1A 1O9BA 3C1OA 3ZNPA 1LSSA 8LDHA 3GG9A 3RAJA 4OXKA 4WLVA 3UCEA 2NU7A 1LSUA 2UDPA 4GQAA 4GX0A 4BNJA 2VWGA 3ROKA 3WNQA 4E3ZA 4EYEA 3SLGA 2CF5A 3PWSA 2YDXA 3WWZA 5GZ1A 3QWIA 3RQSA 2QRLA 2UVDA 4DUPA 2Q50A 2AE1A 3SVTA 1L7EA 2DUUA 3S2EA 3JQGA 3W4KA 7MDHA 2HK7A 1W73A 3ZWNA 3NDRA 3S55A 4UVIA 1GD1O 3BMNB 4B3IA 3GVIA 3OECA 3FI9A 1EUDA 3I4FA 3FNGA 2PR2A 4JBIA 4UUOA 4XIJA 4IUYA 2JKVA 3D64A 4RZIA 3RC9A 3BTSA 3QW2A 4E5KA 4YB8A 1T2CA 1JA9A 4FIZA 4PLPA 1PGJA 4E5MA 5HRUA 4I9NA 1ENZA 4U6QA 1YS4A 1HYHA 4LRSB 4ZRMA 4BL5A 4D3DA 1H6DA 5MGBA 4IPTA 1ZK0A 4ZGWA 1YQXA 3RU9A 1NPYA 5T57A 1UXGA 2J8ZA 4RVSA 2GERA 1CIVA 2NTVA 1HLDA 5EPOA 3T4XA 5B4VA 5TNXA 2NTNA 5DF1A 3WWYA 3ADOA 3O8QA 4YWJA 4CLHA 5C3MA 1IE3A 2Y0CA 3WLFA 1ADBA 5L9AA 2FR8A 2QIOA 3WXBA 2DFDA 1A71A 4MVJG 4WEQA 2IODA 3FTNA 3WGZA 4EEXA 4MKZA 1FDWA 4Q3BA 3VH1A 1HYGA 5G4KB 5JDCC 5KNLA 2VRCA 4J7CA 4Z9FA 3LU1A 4ZD6A 1JAYA 1YOVB 3STHA 3L4BA 3K30A 3COSA 5DCUA 4J3FA 3OA0A 4DRYA 4F6CA 3EY4A 1E6EA 3ITKA 3AUUA 1RM3A 2SCUA 4CM9D 3U09A 1EDOA 4IJKA 4XJTA 3V2UA 4DLBA 1W0CA 4ZICA 1ZK1A 2UUOA 3G0OA 1NFQA 1TT5A 4NJMA 3PIIA 4HX5A 1EQUA 1CERA 4BO3A 2PKQO 2ZYAA 1O95A 4HP8A 4D0RA 4Y9DA 1ZBQA 5L40A 3WFIA 1PTJA 4I5GA 2P9GA 2XXBA 4YACA 1N7HA 3DTTA 5FEUA 4O59O 3NT5A 1PJ4A 2FN7A 4PZDA 1O6ZA 3DZIA 4Z0HO 1ZSNA 3I6IA 4XQ9A 5TJ9A 4BNZA 2HU2A 5CDGA 1SBYA 3G1TA 1P1IA 4W6ZA 2IXBA 4I5FA 5CDSA 4MJLA 5JYEA 5L51A 5THQA 1BHSA 1ISMA 3EYWA 4LCEA 1V8BA 4J7UA 1BWSA 3AJRA 1EEHA 3BMNA 4BUCA 1H9AA 4GH5A 3H4VA 2QQ5A 2VYND 2VNSA 4UVHA 3PJDA 4DGSA 3F1LA 1UR5A 4XIYA 3D0OA 3RUAA 5JFOA 4WLEA 4O63O 2GR9A 2E6UX 3TPCA 4BNGA 3K31A 3UCXA 4J90A 4WPGA 3BXXA 3H2ZA 5KCZA 3VDQA 1K6IA 5H82A 4Q3EA 3G79A 1BXZA 3DWFA 4HFNA 5A3VA 3UW3A 4E0BA 3UGKA 5F1PA 1QRRA 5AVOA 4WE3A 3RCBA 3TN7A 2FSVA 4QEDA 1UXKA 3HG7A 4FJ0A 1UXJA 4GX2A 4FD3A 2OL4A 1WDMA 1ZKMA 2PD3A 3E1KA 1ENYA 3PP8A 4KDEA 4XQGA 1YKFA 1QYCA 1BW9B 4AVYA 4Q3DA 3B1KA 4CMBA 2PZLA 5HBRA 4IZIA 4J9VA 2YHIA 3G17A 4TRJA 3W8DA 2EP7A 2B5WA 1PL8A 4IDAA 2AEJA 3ASUA 3HN2A 2BI7A 2YQ4A 4U0KA 2AE2A 3L0DA 5BNFA 1QXSA 2D0IA 2C54A 1GU7A 3HDJA 3KSDO 3EGOA 4KMSA 3VVCA 3ZV6A 1P1KA 1QV7A 4E2ZA 4ALKA 2O3SA 2V6GA 3QVWA 4IQGA 5T8KA 3IDSA 5K6AC 1I10A 2QW8A 5CDYA 2CFCA 2OFPA 1V3UA 2H9IA 3DAFA 3P19A 4RLHA 2X58A 3ZWMA 1FXSA 5L53A 3S1LA 1QYWA 1E3JA 1BVUA 3O38A 2ZB4A 4DQUA 1M6WA 3FR8A 3AW9A 2JAPA 1B8PA 1DC6A 2VYVA 4DL9A 5TIIA 4YT5A 4J9UE 4IQ0A 3WX0A 4TRMA 3OF2A 4ALNA 4KP7A 4KUEA 1DJNA 1PJQA 4URFA 4EUEA 1DLJA 3RROA 3GNTA 4U6SA 2DBQA 3ZDFA 4CMJA 2OORA 1V3TA 4BNVA 3NYWA 3OIDA 3UCFA 3IP1A 3CH6A 4J1NA 4BO7A 2NU8A 1DHTA 3FNFA 2Q1TA 1A9ZA 5JDIC 1JW9B 4MVJI 2D5CA 3L4SO 4YT2A 2JAHA 2VHVA 3ANNA 3M1AA 1I30A 1YL5A 4CLRA 1VC2A 1U4SA 3JSAA 3JQFA 3ZU2A 2LDXA 5U9CA 1Y81A 2C59A 2O4UX 3VOSA 2PLAA 3WFJA 4PZEA 2OGUA 3VPXA 1FDUA 1A27A 1E6WA 3B1JA 5JAZA 3TZHA 5BSFA 3C1TA 3GFGA 2VZ9A 8ADHA 2O48X 1YQDA 2BELA 2G5CA 4M86A 4LSMA 3BZUA 2C29D 4B7CA 1ADCA 1I3NA 4J2HA 3AY6A 3O03A 4K6FA 1XQ6A 3BMOB 5A9TA 3VH2A 3W8EA 1KBZA 1P0CA 2EP5A 1C0PA 4IDFA 3SJUA 1JKFA 1U3WA 4CLDA 4E6PA 3EZYA 2VUUA 3CMMA 5GZ6A 2TMDA 3AM5A 1E5LA 1SO8A 3OICA 1E1NA 1YXMA 3VDRA 4BMVA 4P22A 5COQA 4IDDA 4FFLA 4NBVA 2D59A 2X0NA 3BA1A 2FZEA 4MVJA 4DIOA 5JCJA 1B3BA 3JYNA 1E0DA 4PCVA 1E1LA 1LLCA 3VZQA 4BNTA 1WDKA 1MG5A 4LVCA 3OIFA 2DUWA 4RO0A 3GMSA 3ST7A 3KETA 3OM9A 3UN1A 2HUNA 2JJYA 3H7AA 4UUMA 3GGPA 3S2GA 4AJHA 2IZ1A 1YQGA 3HHPA 3GQVA 5HS4A 2RH8A 1UP7A 5A5EA 1DC5A 2BGMA 4BO8A 3KVOA 1E7MA 3HJAA 4A5OA 4XZ3A 1PQUA 3S8MA 4PRLA 4TVBA 1EFKA 4DPLA 2CNBA 3DZJA 4L0QA 3HSKA 4NU5A 4CODB 5JO0A 1XKQA 3IUPA 3IJPA 2J5RA 4FOOA 1NVGA 3OJ0A 4J4BA 1X7DA 2GPTA 3FRJA 1ISHA 2DC1A 3KB6A 4KWIA 1F12A 1H0KA 3ZNQA 1QYVA 4FOSA 4JQCA 3OQ1A 3AM3A 5CPBA 3GEGA 4GBJA 1BXGB 1YH3A 2FZWA 2J3HA 3RU7A 1ORRA 5BSEA 2DM6A 4IQ8A 2HMVA 5IZCA 5K0ZA 2Y99A 2ILTA 1BDBA 3WGHA 4LK3A 5EMHA 5AQ1A 5A03A 2FR0A 1QLJA 1L1FA 2NNLD 3I4CA 2OP1A 5C37A 1JKJA 1QORA 4QXMA 3TFQA 4Z3DA 3DOCA 1MG0A 1NASA 3GPIA 4RV9A 1OMOA 2PKRA 5TF4A 2ZTVA 1A7KA 1ZO8A 1V6AA 4XGIA 3NJ4A 1DFHA 5A9SB 3WGQA 3IUSA 5FFFA 1VJ0A 2EJWA 5ICSA 3ZHXA 5L4NA 1SPXA 1HKUA 1U7TA 4N18A 1LC0A 4HFMA 4NU6A 5L3ZA 4A26A 2Z1MA 3I83A 4JP3A 3INGA 4Q39A 5LC1A 3GC6A 5CHEA 1X1TA 2ZQYA 4NHEA 5JCJD 3OHSX 1F0YA 3JYQA 2VHZA 3GDGA 1O89A 4U7WA 2FY8A 3FPCA 3RUEA 1UH5A 4FFRA 1LQTA 2JCXA 3WSWA 4IXTA 5F1KA 2B37A 1QR6A 2VQ3A 2X23A 1JWAB 1KY5A 2XF8A 3OEWA 4DPMA 4G2NA 3ZCXA 4NPCA 2GUGA 6ADHA 4JLWA 2TMGA 3EW7A 4OYRA 1R4MA 5JDIA 2F00A 2A9FA 1Y5RA 2YYYA 4CMKA 1KETA 1M67A 2GF2A 1N92A 1NXQA 1KEWA 3ZV4A 4YR9A 2BH9A 4XX0A 2DLDA 3OJOA 1SMKA 1YBAA 1D4FA 4Q3CA 1K0UA 2CMDA 4XGKA 4P8RA 4ALIA 2C5AA 2Q49A 1HDZA 2AQHA 2IEBA 2CUKA 4RPGA 4GWKA 5FI3A 4L4XA 5MDHA 2F1KA 3FBGA 4OIMA 1PJ2A 3U5TA 2YUTA 3T7EA 1DRWA 3GF4A 2W8ZA 3JQ8B 1CF2O 4E13A 1BVRA 1CRWG 2PZJA 4R01A 3RUFA 1LSOA 3DBRB 2I67A 3BTUA 3C7DB 4D41A 1LU9A 2DAPA 1X0VA 4M55A 2PV7A 4YJGA 3PYXA 5ENDA 2VN8A 3BHMA 3DHYA 1HDCA 2NQ8A 3C24A 1PR3A 4FR5A 4W4TA 2BFMA 1Q1NA 1U2GA 1XIVA 3WB9A 3H3JA 4DIBA 5KJFA 4BV9A 4BMNA 3FSRA 2G1UA 5I9MA 1IB6A 3L6OO 1KS9A 3FPLA 5L4LA 4CM8B 5DOZA 4UAGA 1EQ2A 2OHXA 4XQCA 4R69A 6LDHA 3D5QA 4PVDA 2ZJ1A 2O7SA 3H9GA 1NAHA 4OKIA 3BTVA 3ETEA 3U0BA 4ND1A 3RC7A 3FD8A 4J6FA 1C1XA 1E6UA 4QX6A 5DP2A 5G4LA 1PR9A 3P7MA 1R16A 2EXXA 1UZNA 1E5QA 4R9RA 2DBVO 3ZU5A 4PIVA 4H7PA 1SCUA 3F9IA 3R0IA 1ZXLA 3GGGA 1HZJA 4R5MA 1EE9A 4ZN6A 3RUIA 3EMKA 4RVFA 2P9CA 1QSGA 1Z7EA 3WYEA 4AJKA 1HDGO 5DBGA 3RUDA 1X7GA 5T64A 2O23A 2P9EA 5KVVA 1LX6A 2HRBA 3NTOA 3IP3A 1T26A 3HDYA 3FTPA 2R00A 2JHGA 3HUDA 1DOHA 2CD9A 2NUAA 3LYLA 3MEQA 1VL6A 2W2LA 3VPSA 3MOIA 4BO9A 2AA3A 3GDFA 1ZNQO 2X0JA 4IDBA 2PH3A 1NFFA 2VTEA 3PXXA 2GN6A 3VAZA 1YBVA 3BMCA 4PRKA 3ZW9A 5K6AA 4ZQHA 1IZ0A 4OKNA 4GMFA 1WDLA 3PGXA 1ONNA 4IS3A 4JIGA 1P31A 2PWZA 5KJ6A 1CETA 1FJHA 2I5PO 3JD1A 1ADGA 1FF9A 1QG6A 1A72A 5TSDA 4R9SA 5I7VA 3ONFA 2C2YA 1JWBB 3OIGA 1KVTA 3PTZA 2YHIB 3GNSA 3TZKA 3VH4A 1B8VA 1LRLA 3OETA 1VPDA 5G0UA 3RC2A 4AJ1A 4ND2A 4BKRA 5JMWA 5CP8A 3VHRA 2Y1OA 3ZWCA 1E7RA 2ET6A 1PIWA 3TOZA 3GNQA 3N74A 5G0VA 1T4DA 1HDOA 4RF3A 5CG2A 4DXHA 2BFPA 2DT5A 4ZQFA 2ZK7A 4XYEA 1GY8A 2DU8A 4Y98A 1ZMTA 2P5YA 4AJ4A 1E1MA 1JAXA 3EHEA 1N7GA 4MVJE 1L7DA 3TDKA 2VTDA 4AJOA 2ZIZA 3DBLB 3IOYA 5KJCA 1P1FA 1ZK3A 3Q2KA 4M49A 5EESA 2Y1CA 2AQKA 1NQAO 4EW6A 1WW8A 4HV4A 1U5CA 4RF5A 3PYLA 2IRWA 1MFZA 3MTJA 2FPPA 2Y0EA 3E18A 4J43A 4D3FA 4OL9A 1XSEA 4FW8A 1GR0A 2A35A 2CDCA 2Q3EA 2I3AA 2E82A 1EVYA 4YEDA 5ES3A 4INAA 3W1VA 2OOSA 1A4IA 3GZ4A 4MVJM 1JU9A 4GLOA 3AWDA 3AUAA 2GZ1A 4R1SA 4KTVE 5U1PA 4PG8A 4CM4A 2VRCD 3MJTA 1NP3A 3WIEA 4YBZA 1LLDA 4WCFA 2Q1SA 4I5DA 2ZQZA 3I1JA 5ADHA 3FF4A 3AFNA 1UP4A 1ZFNA 3RFXA 5FI5A 1D7OA 4GAEA 4XDZA 3Q11A 4EUHA 5A06A 1GEEA 1H5QA 2J3KA 3W6UA 3V1TC 3D4OA 1MB4A 1TB4A 1C1DA 3U4CA 3QV1A 3W4IA 3JQBA 1ZJZA 4WLUA 3H2SA 3GT0A 3U4IA 5KKAA 2AEMA 5CPFA 4RPKA 3DBRA 3JYPA 3FNEA 3LDHA 1HE5A 4WLFA 5JDCA 1DAPA 3JQAA 2X0IA 1IPFA 1R4NA 1F8FA 3PIDA 4P38A 5LCXA 3UXYA 4CMIA 4E12A 5KVSA 3K8ZA 3AUTA 3DR3A 1N1GA 2QRJA 1PSDA 3CEAA 2I6TA 4PN3A 1IPEA 4YJHA 4Y8VA 4BGIA 3QA9A 4M89A 3OFSA 2AG5A 3DTYA 4OXNA 2NVUB 1RWBA 3O4RA 3PZBA 3ZU4A 1I2BA 4MVJF 3K5PA 5FF9A 4C7JA 1K5HA 3ORFA 1SB8A 4FGWA 4YAGA 2P91A 3LLVA 1DPGA 4RZHA 5IDWA 1LI4A 3DO5A 1PJSA 4XR4A 2YZ7A 4XA8A 1Q7BA 3U4HA 3WMWA 1C3VA 2DKNA 2OP0A 1KVRA 2D5AA 1LQUA 3HE3A 3K2EA 3IMFA 3NAQA 1I2CA 4HFJA 4CL8A 5L95A 2NU6A 1HETA 3GFBA 2IZZA 2B4QA 1P74A 5G0SA 1XG5A 2YFHA 3VKVA 3NRCA 2DQ4A 4JBGA 2ZB3A 4PG4A 1R12A 5AYVA 3WJ7A 2HMUA 4A73A 4DWVA 4FBGA 4A03A 2NVUA 1YGYA 1OOEA 2WMDA 4WK6A 1GPJA 3VTFA 4DYDA 1Y8RB 4BNMA 4KTTE 4RPHA 2BI8A 4PLCA 3IC5A 3LT4A 4BB5A 1HSZA 2YFQA 1X0XA 3ZZNA 3KLMX 4F45A 4GPD1 3V2HA 2X5OA 3FWZA 3RJ5A 4IMPA 4CJXA 4YYZA 1PJ3A 3KTDA 2B69A 2X9GA 3ZNNA 4BKUA 2C5EA 4NBRA 3M1LA 4WUVA 1ISJA 1C14A 2NACA 3CIFA 3DBHB 2WDZA 5KKCA 2DTEA 4N5MA 1HLPA 2ZB7A 2Y68A 4IIVA 3GY0A 2QHXA 1H6CA 3WYBA 5IAAA 2CVZA 1SNYA 2XPCA 3FR7A 3PQFA 5AXBA 1LNQA 4NDNE 4TRNA 1EUZA 5CFZA 4XKJA 4BO4A 4NIMA 5T8KC 4CR7A 1NTOA 4G65A 4ZHSA 1PEDA 3C8MA 3GRKA 4GKVA 3ROQA 1HZZA 3D1LA 3WTCA 4NI5A 4DREA 2FRDA 1M2WA 2V65A 3DBHA 1F8GA 4MIEA 2NVWA 3DMTA 2HJRA 3GOHA 1NWCA 1GQQA 2FOIA 1E7YA 1RYEA 1Q0HA 4ZA2A 4DMLA 1OI7A 5COAA 3WBFA 1C0KA 1LBEA 2W2LD 3F1KA 2GDZA 3JYOA 5ENVA 3JD0A 4J2OA 1EVZA 5DCWA 3UH1A 1UDBA 2OXIA 1E3SA 1SOWA 1DDOA 5JLAA 1DIRA 4GMGA 4IDEA 1TI7A 4Z3KA 3JQ6A 4ZQBA 5DBIA 1U8XX 4EGFA 1I2ZA 2EKQA 4XDYA 3WS7A 2HAEA 2OMEA 4K9DA 1PZGA 1PZHA 4YAEA 3EAGA 1ZCJA 3CSDA 2O7QA 1DSSG 3PWZA 5B4TA 1KVSA 4RL6A 1GZ3A 1IUKA 4CLOA 2X8LA 3L77A 1IOLA 2X4GA 3ZNOA 1E7WA 1ARZA 4DA9A 2X5JO 4J7XA 4XYBA 1VSUA 3Q2IA 2JFGA 2BGKA 3MZ0A 4R68A 1AGNA 4JK3A 4L8VA 5JMPA 5HM8A 2I99A 1FMCA 4YQZA 1UP6A 4R51A 1B26A 2HMTA 1HWYA 5JYDA 4Z9XA 3A4VA 3AOEA 3INTA 2VUSA 4G5HA 3H9JA 5EIOA 1HSOA 4YRBA 2NADA 3OP4A 5EERA 4TROA 4L76A 1YOVA 3WMXA 2Q2WA 2FHSA 2O3RA 2JFHA 1ENPA 3OJEA 1G6KA 2I9PA 4RF2A 1T2EA 4BNLA 3OSUA 4BIIA 4CM7A 1R0SA 1HEUA 3W8FA 2FWMX 3VPGA 1EFLA 1JDJA 1PJLA 1YE3A 1GUYA 4ND3A 4N5NA 1OAAA 2DBZA 2YV1A 3JQCA 4G81A 3CXRA 2X9VA 1QKIA 4YTEA 1I01A 4XCVA 2QX7A 3DHEA 4RVGA 3ROPA 1XA0A 4D45A 2JCYA 1G0OA 2H1SA 1YJ8A 3QSGA 4DMMA 5ILGA 3TRIA 4M87A 1JLLA 4KDFA 4RDIA 1Z82A 5EQFA 4WASA 3H5NA 5I8WA 4IJVA 1D1TA 4MVJH 1K2WA 3LSYA 2DFVA 1ML3A 5A02A 4IDGA 4K1LA 2HSDA 4II2A 2V6FA 5CEFA 4B4UA 2WTBA 3QE3A 2WD7B 1BRMA 3GRPA 2GN9A 2HMSA 2A94A 3EDMA 1B3RA 5H81A 3PHIA 3K6JA 3TL2A 4R41A 1DIAA 4RVDA 4ALMA 4AFNA 1PGPA 1U2DA 4UREA 1CQJA 2FP4A 3ZWVA 3GEDA 2NLOA 4CPDA 2J3IA 2VHWA 4R54A 5JAQA 3V8BA 2EIHA 1KEVA 4W99A 3I52A 3WJAA 1F14A 1NHWA 4BQPA 3AY7A 2HQ1A 1I33A 1FK8A 3D4PA 4MIOA 1BTOA 2ZTUA 1VKOA 1M6HA 3I6QA 1T2FA 3ZN2A 3H6KA 3L9WA 4RORA 1IZ9A 1W6UA 3KYDA 4OJNA 1AN9A 4M8SA 4E2YA 4O6VA 2R2GA 1ZK4A 2E4AA 1WMAA 3DEYX 4UEJA 4YRDA 4A27A 5C5IA 1NVMB 4Z9YA 3ZHYA 2IE0A 5A3JA 5CDUA 1U8FO 5LDHA 1ZSYA 4X54A 3WG9A 1EVIA 1XEAA 3KEQA 4YCAA 3A9WA 2JD2A 4FS3A 2CZCA 3KLPX 3BHIA 2DPHA 4C7KA 1EE2A 4Q3AA 3PWKA 3GZNB 1Y9EA 3CPSA 3E8XA 1VI2A 4AJPA 1U7HA 4BVAA 1QP8A 1PX0A 1EDZA 4II3A 2QYTA 3GVXA 3JV7A 2HRZA 1G1AA 4M1QA 4OSOA 1SB9A 4J91A 4UUPA 4ALJA 3TZQA 4NR0A 3QWFA 1LEHA 1R0KA 2XOXA 1E7SA 3DXFA 3LT1A 4EJ0A 4GWGA 5I7EA 4RQTA 4XB2A 1KERA 4NFYA 3UICA 2V6MA 4HNHA 5ITWA 3H5AA 4L74A 3ETGA 2OBYA 4MIYA 2V7PA 4CLXA 9LDTA 4EZBA 4CR8A 2FMUA 3M6IA 4FFMA 4PLHA 5BT9A 3EUWA 3AU8A 3Q0EA 1VJ1A 3ZWXA 2UV8A 3RSHA 2Z5LA 3NTRA 1HL3A 1A5ZA 3GVHA 4N7RA 3ANLA 4Z0TA 4DLAA 4BS9A 3DONA 5C7LO 1MGOA 1Y8QB 4EUFA 4XRGA 4OOFA 4FFNA 3R3JA 4HNGA 5IF3A 5DNAA 2WE8A 4XQEA 5IDYA 5AXDA 2O50A 5DCYA 1C0IA 3PYMA 4HUJA 3ZWOA 1KVUA 4ONEA 4UEKA 3F4LA 2CDAA 5B1YA 3A14A 5KJ1A 3PK0A 2DVMA 4EJMA 1XHLA 4I9HA 3PPIA 3HADA 1SC6A 1WZIA 1AUPA 3Q1LA 3OA2A 4BV8A 2YW9A 3DMTC 5L45A 4L9RA 5JY6A 4XJSA 1UDAA 4CM3A 1BSVA 3JQ9C 3PVZA 5KJEA 4Y67A 5C7IO 3SLKA 1NPDA 3ZWAA 4RJTA 2I65A 2WYVA 1ZXBA 3NTQA 5IXSA 4N5LA 3W6ZA 1U3VA 5IDQA 1GPDG 3LLSA 1Z45A 3FBTA 1ULUA 2D2IA 3LC1O 4TMFA 1R6DA 3E9NA 1U9JA 3C1AA 3GZNA 3F6YA 4DBVO 2H5LA 3ZGYA 1R37A 3O9ZA 4D43A 3IKVA 4I8XA 1E1KA 2WYWA 3EZLA 5KVCA 5JS6A 3RKRA 5K9ZA 4OQZA 3UKOA 3TOXA 1MC5A 3I9NA 4CLOB 2EJVA 2P4QA 4CQLB 2X1HA 3GH3A 3VH3A 4CL3A 1GADO 3ETDA 1MUUA 3RIHA 3KHUA 4M54A 3SJ7A 3ZW8A 3PFWO 4QFCA 4IS2A 1WZEA 4S3MA 2H6EA 5BSGA 2I76A 5DP1A 3OJLA 1SEVA 1GQ2A 5L7TA 2GZ2A 3MWDB 4WECA 3P2OA 4NJMB 4YJFB 5A9RA 4BKPA 1DBVO 1KC3A 2AW5A 1JTVA 5BNIA 2WE7A 3NJ8A 4WNIA 4K6CA 1CEQA 3GDOA 4QFDA 3IQDB 4JJIA 4Y6PA 3PJEA 1ZH8A 1T1RA 4CM1A 5I9NA 5G0TA 1PGNA 3GG2A 3PEFA 5HS6A 4NFHA 5T6BA 5IN4A 4FB5A 3I3OA 3PFFA 2BRUA 4WCDA 1KY4A 3ASVA 1YB1A 1LDBA 2GCGA 4JGBA 4I9UA 1DFGA 4HY3A 4OM8A 3RKUA 4WCFB 3T4EA 1IHXA 3HB4X 1DXYA 3RUHA 3TJRA 4PGFA 3UHAA 1GUZA 3TFOA 2BMAA 2EV9A 1HDYA 2EW2A 3ONDA 4JX8A 4YRAA 4Z6KA 3D3EA 4BKQA 1DC4A 5JCXA 2GASA 1NBOA 3KYCB 4E33A 1ZJYA 2Y0DA 4B4WA 1N9GB 1O0SA 3NDJA 2BFOA 3SBOA 4CQMD 3QWHA 1CYDA 3KM0A 1QMGA 1ONOA 4CMGA 1RM5A 4E2XA 4IZHA 2NTJA 4MDHA 3R3SA 1B16A 3I9JA 4GGPA 1JQBA 3AI1A 1YJQA 4WOJA 3G49A 1B2LA 3ENNA 2QZ9A 1WAMA 1LLUA 2C7GA 1RM0A 2AQ8A 5A1TA 1GFSA 2J3JA 3E9MA 3DAPA 1BXGA 4FPXA 4BB6A 1P3DA 3PHJA 2EERA 4LSWA 3Q9UA 3M2PA 4D3SA 4I1IA 5JY1A 4R4JA 3AI2A 3MTGA 5CAEA 4EBFA 2VWQA 4P4NA 1SOVA 2D1YA 5HA5A 2W90A 1LXCA 5JXWA 2VHXA 1CJCA 4FDAA 1K6XA 1N1EA 1XCBA 1KOLA 4BO5A 4PG5A 3C7CB 4IDCA 4XYGA 3GAZA 2PK3A 2Q1UA 4WKGA 2LDBA 1T4BA 1X15A 5U4QA 2BGLA 2GRAA 5LDGA 2EKPA 1B14A 1ZIDA 3I9MA 2DBRA 3I9OA 3QP9A 1EK5A 4E21A 4PZCA 1Z73A 3CE6A 1LRKA 3VZSA 4D79A 3LF2A 3M2TA 4BNIA 4HADA 4YT4A 4YA6A 1LC3A 2QYSA 1TLTA 3E5RA 4NJOA 1Y8RA 1V35A 4E32A 4W9NC 2B36A 1HXHA 2FPIA 1N5DA 3H8VA 1TXGA 3NGXA 5T67A 5GZ3A 3HDHA 3T7CA 4FN4A 2O3QA 4GVXA 1WVGA 2BF7A 1GCOA 2PD4A 1NFRA 2PD6A 3RJ9A 2DTDA 2VHYA 1YDEA 1NM5A 2BLLA 4JCOA 5EINA 2AQIA 3UFXA 2Y93A 5TX7A 4CUZA 4D42A 5G2OA 2EF1A 1I24A 2JCVA 4MOWA 4CM8A 3QIVA 4UEOA 5T5QA 1UDCA 2IYOA 2QRKA 4Y6SA 5DZSA 4MP3A 3GR6A 3OJFA 1E92A 4NBUA 1LDNA 1KEPA 2HMWA 2C20A 2RBEA 1GEGA 1KEUA 1EVJA 1C1XB 3DZBA 3GK3A 1PS8A 1E3WB 3GN2A 3KUXA 3MWEB 4IJUA 4YAJA 2YHUA 3V2GA 1Z6ZA 3WR5A 4B8ZA 3L6DA 2G82A 1N9GA 3QLJA 1GYRA 3JQ7A 1W8DA 3F46A 4N54A 3SC4A 2VYNA 3D4NA 3H3FA 4IXWA 1WXDA 4KWHA 1I5RA 3AFMA 3S2IA 4PLZA 3TQHA 2CDBA 4HWKA 4R3NA 1VKNA 5COBA 4EITA 5JC1A 1RM4A 2EEZA 2QZZA 2C82A 3IL2A 3GLQA 1E3WA 1U4OA 4O5OA 1H9BA 4YVFA 3TNLA 3DBVO 1NX6A 2B0JA 3OBBA 5EN4A 4DPKA 1GUFA 2IEDA 2RH4A 5IN5A 4HFRA 1SAYA 4YAIA 3ADPA 3WOHA 4RQUA 2X9NA 1XELA 3JQFC 4YAKA 4MP8A 2Y67A 4XYLA 4L4SA 4O0LA 1KVQA 1HE3A 3KSZO 1Y1PA 3SC6A 1P77A 2GGSA 2IDZA 4CV3A 1UAYA 2BD0A 1SZJG 3DDNA 1Y6JA 1YB5A 4FJ1A 2B4TO 2Y1FA 2JD0A 2OBNA 5G4KA 2P4HX 4OO3A 4QT0A 3KYBA 1JKIA 5KWEA 1I8TA 4AJLA 2WD8A 1DLIA 2PFGA 2RHCA 3Q6IA 2YDYA 3WTBA 4CMEA 3NDIA 4YQYA 1PJCA 2Y1GA 4I5EA 2I66A 3ANMA 5L4SA 2DTXA 3QWBA 1IYZA 2AG8A 3JQBC 1OBFO 4RCVA 5B4UA 4LN1A 5CDTA 2P2SA 2HK9A 4W9NA 4KQWA 4MVJD 4BHTA 1PWZA 2CVOA 2G17A 2D8AA 4YJHB 5JNLA 3RASA 4E2WA 2PY6A 5IFLA 1HE2A 3QVOA 3GPDG 3E82A 4NNJA 4YXFA 1DIHA 1NAIA 2BKAA 1ISGA 1DFIA 3VVBA 4MVJP 3BMCB 3HFGA 4OH1A 4B7XA 4OGWA 4J0FA 2X7HA 2X6TA 1EMDA 1Q2XA 1YL7A 1GZ4A 1P33A 1UXHA 1V9LA 4TZTA 2Q99A 4GI2A 1IY8A 1K3TA 1NYTA 2POQX 3SXPA 3DZGA 3QHAA 1B15A 3HQ4O 2WJPA 3WIDA 2W98A 1S6YA 3RFTA 1GAEO 5H83A 5TT0A 3UAGA 1VL8A 3PLRA 2PGLA 1Q0QA 4OQYA 4YDRA 2NQTA 3EC7A 1HTBA 3KSUA 2D3TA 3HWRA 2NM0A 3BMQA 4H3VA 2YQ5A 4BGUA 3AOGA 3WQQA 4TQGA 2GZ3A 1GQYA 3MJCA 1DJQA 2O3JA 4CM4B 5CEEA 9LDBA 4KUHA 3VZRA 1PGQA 1LDGA 1MFPA 2WD7A 1T25A 4TWRA 5B37A 5TQVA 2Y66A 2G0TA 4CQMA 1ISFA 1K89A 4AJIA 1ZW1A 2YV2A 4C4OA 1QV6A 1XGKA 4AG3A 3B70A 4J4HA 4BQRA 1DIGA 3WGOA 2HKIA 2VCYA 3K96A 3TSCA 2Q4EA 2ZTLA 4ESOA 2PGDA 4H16A 3LQFA 1ZK2A 1PU2A 1PQWA 3MJ4A 1X13A 4BGVA 1VL0A 3CKYA 4R1NA 3KXDA 3GGOA 3JD2A 4B4VA 4TKMA 1KIFA 2Y1DA 1LLQA 3BMQB 3IIEA 4BNYA 5DULA 4B4OA 1GYPA 3ZWWA 4PLFA 3U62A 3JQAB 2BHLA 2GO1A 1Y7TA 2W4QA 3RBXA 1I32A 3NKLA 3TZCA 1I36A 3BMOA 5DT9A 3QWAA 5ER9A 3LT0A 3U3XA 4JBHA 4IMRA 5ITVA 1NWHA 5BR7A 4XR9A 3WGTA 4UUNA 3ZH2A 4MP6A 4L75A 2WWRA 1Q7CA 1B8UA 2J5KA 1U5AA 3C3XA 3GHHA 4JNKA 3JYLA 4CQLA 5DN9A 3ZI0A 4JP2A 5JAMA 1X1EA 3WQSB 4BNFA 1CQIA 1FDVA 3N58A 2OZPA 3H5RA 3O8QB 3WLEA 1Y9AA 3A1NA 1NQOA 1O5IA 3PHGA 4DTIA 1DRUA 2ZCVA 4AICA 2J6IA 3HFSA 4TKLA 2VWHA 3IAHA 1VSVA 3FWNA 2Z1NA 1PJBA 2YY7A 3NGLA 4BNXA 4R3WA 1U28A 4D44A 3NEPX 4LW8A 3RI3A 4ND5A 1TA4A 3MCVA 3N7UA 2FPGA 3ICCA 3P2YA 2BFAA 4NH4A 1UJMA 1LTHR 1HE4A 3DB2A 4ZQEA 4AL4A 2EKLA 1E3IA 3ZV3A 4CLEA 1PJTA 1J4AA 2VWPA 1Y5MA 1O8CA 3OQ6A 4HXYA 4OSPA 4E4YA 1NR7A 1MP0A 3DOJA 3NT2A 4FJ2A 4LMPA 3X2EA 4ROSA 1DEHA 1QYDA 1U3UA 3AUSA 3X2FA 1XDWA 3DZFA 4WJZA 4ZRNA 2Q46A 4CQMB 1M75A 4NBWA 2PTGA 1I3MA 4J49A 4IGFA 2O3TA 4WOKA 1VE9A 1NVTA 1GZ6A 4A7PA 2EG9A 3DFUA 2G76A 3R1IA 1E77A 4P4LA 4Z0PA 5A4DA 4YJGB 5JBIA 3UF0A 5TRTA 1T2DA 2JFFA 1J5PA 1H94A 3R6DA 4PG7A 2GD1O 4B3HA 1ZSVA 1SEPA 5BQFA 4DVJA 4RVUA 3NT4A 4JJGA 3WNVA 3JQEA 3KEOA 1AXEA 2ZCUA 4CV1A 4ZJUA 3GMDA 3K2BA 4CM6A 4U8GA 4WEOA 5IXYA 5JAIA 1P0FA 1H2HA 2PZKA 5TJHA 1R66A 2WM3A 4UVEA 4NBTA 3UVEA 1GYQA 3ONEA 1B0AA 1GV0A 4TZKA 5AOVA 3S2FA 1WPQA 1VLLA 2HLPA 1YDWA 1BG6A 3PDUA 4RF4A 1XR3A 3D5TA 3ROMA 1BMDA 1F06A 4QTZA 3KOUA 1DAOA 1R4NB 2HO5A 5KTKA 3QRWA 1D3AA 3RC1A 4NQZA 1C1DB 1N8KA 5TT1A 2VZ8A 3G3EA 4GLLA 3WQRA 5I7SA 3P5SA 3PHLA 2AMFA 1XQ1A 1MX3A 3ENKA 2AEFA 2PKQP 3DAGA 3H9UA 3B20A 1P9LA 4BOYA 4KQXA 1B7GO 1P45A 2O4CA 3FNHA 3ABIA 3EVNA 4ILKA 5EQDA 1YRLA 3F3SA 1J0XO 4EI2A 1YO6A 3AY3A 3NUGA 4B3JA 1PL7A 1T1SA 4FC7A 2CF6A 4XGNA 3RBVA 5HTOA 4KZPA 4L73A 4XB1A 4J1QA 1N2SA 1IULA 3UUWA 2Z95A 2CSUA 3BTOA 5F21A 3RVDA 3ITDA 1FDSA 1VRWA 4BKOA 1RJWA 1ONPA 3I9KA 3KYDB 4E5NA 5GY7A 3PZRA 2E48A 3KBOA 1TT7A 4ZQGA 1DRVA 4NK4A 3PJGA 2VNAA 4B8WA 2C0CA 4MPDA 4W82A 3ZHZA 1MV8A 1XWFA 3NX4A 1XLTA 3RUCA 4DYVA 4WLNA 4JN6B 1MXFA 4FCCA 4JJFA 4RGBA 4QECA 4A0SA 4P4GA 5KVQA 1HDRA 4DIFA 3MOGA 2Q4BA 4XWYA 3IS3A 1UUFA 2GNAA 1ISIA 4DLLA 3WGIA 1I3LA 2VUTA 4E31A
chains in the Genus database with same CATH superfamily
1X14A 4LDJA 4F6LA 3ER9A 2B25A 1BYIA 4PVCA 4LHZA 1DKLA 1YBMA 2IPXA 5D87A 4NCKA 2LKCA 5JW6A 2OB1A 2Z3WA 4EABA 1PS9A 2V7TA 3BWEA 1FLAA 4MUBA 1EWYA 1BEEA 4JU9A 2QYOA 1C81A 4ZVNA 1YB2A 3ICPA 3SZ3A 3NBMA 3CTMA 2NXCA 4HJXA 3GA7A 3L8CA 3EXHA 2O2SA 3L92A 3BD7A 5DMXA 1XRLA 3NANA 2YJZA 1TEZA 3A3PA 3PQDA 1T9BA 1DDIA 3F9RA 3KYCA 1PNRA 4S1VA 2VT7A 2Y4OA 2HK8A 4WNCA 3V1UA 821PA 4JI6B 1NBEA 3CH5A 4TLLB 2EYQA 2B3TA 1WIWA 1GTSA 4NPHA 1I3KA 2WB4A 5ELLA 2OC4A 3VYSB 1Y8QA 4HHEA 1S2OA 4RYLA 5EIWA 4LGVA 1T2AA 4MQMA 3BHNA 4OQEA 4CKXA 4DLTA 1I4DD 5LP6A 1Y80A 1OA0A 4OMDA 5BWCA 5K99A 3BIOA 3BB4A 2WD9A 3GXOA 2R00C 3LDAA 4U5QA 4B43A 4G4IA 4NV3A 4D9BA 3D31A 1BC5A 4MINA 4DZZA 2QPTA 1O9HA 3HBMA 4XD2A 3K70B 3AW8A 3DB1A 1VJCA 1BROA 4W5OA 1FZTA 3V4OA 4HC4A 4A16A 2YNMC 1XLTC 2J6BA 2WHXA 1OGIA 3AM1A 4LMAA 1TOAA 4CUKA 2VAPA 4O4JF 2HWKA 3AHCA 3K09C 1QGOA 3X1ZA 2RIRA 1ZKDA 1AZLA 1P1CA 2FQYA 1SVNA 1PL6A 2A4MA 4ETWA 3RRZA 3TBFA 2OCPA 4H7EA 4ZU3A 4J0GA 5A04A 1ADYA 3C39A 1J49A 4PQRA 1XCJA 1QIKA 1QF9A 2PBLA 3DFZA 4JKIA 1MNAA 1MLDA 1F2UA 3JD4A 5AI8A 5FL7D 4QO7A 5EPUA 4I08A 1CP3A 5AXCA 4EA9A 3B1FA 5GVSA 1J5EB 4HNRA 1SXHA 3HKCA 4YALA 3M9WA 1C5KA 2Q7DA 3B6IA 1N6RA 4UVDA 1PWXA 1QQ6A 4X63A 4F2GA 4Z1OA 3T7KA 4ALLA 2QG4A 3ZS8A 4LV8B 3SWWA 2JI6A 4QDKA 1M2EA 1ADFA 2DP4E 2ECQA 2NNWB 1BDMA 4EPYA 2BZ1A 4KE6A 3GB9A 4H4EA 1UODA 4FKZA 4P54A 2J4FA 2Q45A 3QLTA 4PX9A 3ZGVA 3UMYA 1YZ3A 4IINA 4PFQA 4NJEB 1R0WA 4RPJA 1GSAA 3W5CA 1V0JA 3MWKA 2A92A 1J1UA 3L9XA 3R3VA 4EUNA 2GXAA 1PUXA 2WI8A 2OAEA 4E30A 5DNEA 5SY6A 1YUMA 4KUGA 4GO1A 4B2PA 5M04A 2IQIA 3O92A 5F33A 3N0VA 5A2GA 2GWHA 2FSSA 2NXWA 3H11B 3OZRA 4RGQA 2BDTA 1JR2A 3ZIAD 4DY4A 2P68A 3IPYA 4GU5A 5CGZA 2DQSA 2AVNA 3G8DA 5FCDA 4YJ3F 4EQZA 4GRIA 3RK1A 5B2FA 3B1VA 5CK4A 2GTIA 4B79A 2AUTA 2SNIE 4D97A 1WV1A 2OGSA 2FWAA 2HJSA 3A1TA 1ZEJA 5AWFC 3BSFA 5FWXA 2H1CA 3SX2A 3H65A 3V7UA 2OK7A 5K0JA 5FD8A 4B5KA 2EL9A 3ECAA 2ODWA 4JS0A 4YRFA 1JB1A 3R0QA 3TM4A 2EZUA 3F5FA 1NQTA 2ZR7A 1IZ8A 3WGGA 4I55B 2LRHA 3UOGA 3SEAA 2XUGA 3O6VA 4JVLA 4DG8A 1BXRA 1B6SA 3SIRA 1IQUA 4RM2A 5HFNA 5AIBA 4MO2A 4RKFA 4TKVB 1LX7A 2QZPA 4RLFA 4IR7A 3RIXA 2ZRCA 4IJWA 1C8BA 1P1JA 3FTDA 3H83A 3NDPA 5DIFA 3WO0A 2QX4A 2Z57A 3H5LA 2H1WA 3ZGOA 2FETA 2PVCA 1WO8A 3EFEA 2CLMB 1DKPA 5ETJA 4DQVA 4JLPA 1SBHA 1Z88A 1OXTA 2R60A 4PM4A 2F1RA 4NV0A 5DASA 4PZ9A 4FC6A 4ZDKA 1L7BA 3DEZA 3VTZA 3TLCA 1W36D 4JROA 4NVRA 2R65A 3IQXA 2MYPA 1J7JA 1OFVA 4WIAA 4HQ0A 5KWJA 6NULA 1AH2A 4WY2A 2CLSA 1AKTA 4OK6A 4BNNA 2OV1A 4MEAA 4C0XA 3GRZA 3WBKA 4ECAA 1VHLA 1KMHB 3KV3O 3ZZ1A 3S3TA 4EUKA 1TCVA 3RSGA 1ZUHA 3AILA 1CNFA 2FTKE 1JEOA 1V41E 4UOQA 3U7QA 2NVBA 1ZZEA 2R4UA 3LBHA 2PV0A 3VI3B 1AK2A 1DAGA 4WVLA 3FJYA 3EVTA 3O31A 2A9QA 1O8BA 1YZTA 2Q6IA 3FPBA 1RYDA 1L3BA 2CVQA 5DBFA 4D8WA 3CNEA 1IN6A 4CV0A 1YJCA 1T1JA 2QD5A 5EZ6B 1DBQA 1Z33A 1IZZA 3ELYA 3KJGA 2NYVA 1WNFA 2HGSA 3QOXA 4DAEA 4CM9A 3CR8A 4GPZA 2JCBA 1JIXA 3L07A 3HMQA 5LA6F 4DLZA 2JA2A 2HBYA 3PSAA 2WYUA 4ID9A 4ERXA 2B83A 3HABA 1Y6FA 4PLTA 4GGOA 2YOFA 5THKA 3TTXA 2X22A 4URXR 1AXGA 5JI3E 4GM1A 2FGJA 3SC3A 2C2WA 1OVGA 1XQVA 4FDTA 2X2OA 3V8MA 3T5BA 1F2VA 3TLJA 3OH8A 3NW9A 1GV1A 4WCVA 3K6SB 5CFPA 2BW0A 4WXEA 5SY4A 2NV6A 3SVZA 4ZO8A 1G63A 3EPRA 3FWHA 1V3VA 1MJFA 3WAGA 3U9LA 5JALA 4IBOA 4XYMA 5F52A 1FUUA 3ABZA 1ORTA 4XFKA 3AFOA 4ZVPA 5A05A 4Z4IA 2RE8A 1OIWA 1R0BA 4J1SA 4O4JA 1CY1A 2OHOA 2O8EB 4DSZA 2FZLA 1YB4A 1M1YE 5IJZA 4M37A 4D0NA 3THRA 1I1OA 1CBUA 2I2WA 4R1UA 1GAJA 5B7PA 4CIAA 2QRZA 4B2YA 2HN9A 1LLFA 1YDGA 1NNUA 1QDLB 5BORA 1VCIA 2PRSA 1UBMS 5C2JB 4F92B 1OB2A 3T5AA 1EK0A 1G8YA 2A0YA 1EXVA 2IXTA 1SOUA 3KOMA 3VR5D 3W5IA 1UAGA 3A4IA 3OEYA 5GIOE 2EHDA 4NBNA 4QIHA 2GVNA 5K51A 5CB4A 3HJTA 4GC5A 4CMEC 2OLEA 1WR8A 4FIDA 4OUDB 2R1ZA 3IAM6 4QSMA 4LZLA 3BT7A 3BAZA 4BGEA 2TECE 1AQ6A 3OURA 2PGIA 2VOEA 1YBFA 3AI3A 3WOVA 5CA0F 3N8GA 3PPYA 3QVTA 5HE9A 2NOAA 5BUZA 1Z4IA 2J09A 2CDNA 3ESYA 5FRDA 2QTMA 1ZY2A 5B12A 4AKIA 1HYEA 4HLUC 2H4ZA 3OQPA 4RQAA 2HLDA 1D8AA 2VDVE 2PSEA 3E4DA 3EVGA 3LCUA 1PRYA 3NTVA 1IK6A 1A9YA 4EHBA 4BNHA 1R00A 2A4KA 4FLMA 3I28A 2ON6A 2PX6A 1ZQ1A 3F5QA 3QOWA 4LHWA 5EP4A 1N2OA 2I6QA 2X5KO 1L5KA 3BZBA 1Q0RA 1SC3A 3EXEA 3RV3A 1HYQA 1RW4A 2WZDA 3WA7A 3DO6A 2ZRJA 4KI7A 1G42A 3JWEA 3GPLA 1Q0SA 4OOEA 3DZHA 4M1SA 3JD3A 3M6FA 2BEVA 3MJEA 1A76A 3TCXB 1PYGA 3RS9A 4EL5A 1SQ0A 1AG9A 3FX2A 3M1YA 5DXFA 2XUHA 1T10A 2X86A 5ENZA 1H69A 5TS3A 1H0HA 3LUCA 5GM1A 5ALZA 1D8TA 2EKDA 5I7UA 4MO9A 3VHLB 1YMVA 4F7WA 3O26A 1CDOA 1MA0A 3FHJA 4TQ9A 1SH7A 2EFHB 3LY8A 1AHIA 2XOKD 4ZREA 2JGKA 4JKYA 1BWRA 1RZUA 1G0NA 1JFLA 4RHCA 4HLQB 1R15A 2WFLB 1KYVA 4KHPB 2MR6A 5TXGA 2GPWA 3I32A 2XUKA 1OSNA 4OAOA 1GPBA 4A0QA 2O07A 4NECA 4MYCA 5JO9A 3VX3A 1TPYA 2QTGA 1COWD 2WNIA 2XSZA 2O52A 3KB1A 4UHEA 1A7AA 2ZXEA 4UVGA 3UANA 3X1MA 2JL1A 3Q8XB 1K1EA 3RBZA 1BS1A 1K2VN 3KQMA 5DYGA 3ZZUA 3WKCA 2F4NA 4FEGA 2J7PD 3LFTA 1NBMD 3J80A 3RFVA 3AEUA 4DJDC 4G1VA 5GONF 4L08A 1CQIB 1E32A 1ORVA 2B2XA 2AW3A 2V4MA 2J1LA 5EJIA 3IJRA 4Q9NA 3QEMB 1RPNA 3K9QO 4FSHA 1H2EA 1WSBA 3B6ZA 3E1GA 4GECA 2BWJA 4MA5A 4EJ6A 1AQJA 5BV7A 4DSOA 1SG9A 1B0UA 1PEAA 1DOAA 1WWKA 3LPCA 1NXPA 2CHEA 2ESRA 2WJ3A 3AF4A 1ONSA 4CYMA 2JATA 4URVR 3DYVA 1WSDA 1T43A 2FPGB 1Q7RA 4MRNA 5LBIA 1HQKA 5KZMB 4LXUA 4DV1B 4BZXA 3ULKA 5I8ZA 3I61A 1L4YA 1N5JA 2QNBA 2QZSA 4Q9AA 3THOA 4URHA 4WMLA 1RU3A 3CN7A 2HRCA 3PHCA 1E6LA 2NSDA 3ILHA 4ZCRA 4KBFA 4G1CA 4TTTS 4Y2PA 1F7VA 1XXLA 5AW4A 1HDXA 4IM7A 2P5UA 4EKGA 1M9NA 2W2KB 1P4AA 3PFHA 1XKLA 3N2EA 3ZD9A 1OF1A 4LE2A 3WSVA 4G84A 4Q3NA 1GZHB 1UMKA 2EWVA 3LX6A 4ARSA 5BSKA 1J0AA 1QMPA 3F4BA 5D3QA 1W2HA 3PTAA 1BVHA 1W4ZA 3U7GA 1D2NA 2BPOA 4QJIA 4HBGA 3DQPA 4TLAA 3LLCA 4MMZB 3OZCA 1KSJA 2JH8A 2P9ZA 2EGUA 2H5IA 5CVEA 1V26A 3F49S 2C1EA 1TKRA 1S4QA 5DDIP 5C7YA 5E1DA 2V9CA 2QLJA 4HEHA 3T0GA 3HXPA 4BNWA 5J3JA 2QPOA 4NBKA 3ZNPA 3DMPA 4PNZA 1OXXK 3NP7A 4Q9HA 5LNK6 2FAXA 721PA 3EQ8A 2ORYA 3ROKA 4E14A 1G3UA 3BRWA 2M1ZA 4ASUD 1ESZA 3HN6A 1W9MA 4BBAA 2YDXA 1M1NA 4LJAA 4OQNA 3WADA 1U5BA 2MWMA 4D4JA 1EJ0A 4LI0A 3YASA 2VJKA 3E0XA 5LYJF 2FN4A 3FSEA 4DUPA 1ESNA 1AUVA 5JHGB 4KREA 1DKRA 4KJZA 4YP6A 2GNOA 3SVTA 4DJTA 3DCYA 7MDHA 1J00A 2HK7A 4QLOA 1SXQA 1FQWA 2W2XA 3GT7A 3TD2A 1S8AA 3OOHA 3WL5A 3NDRA 1HFJA 3GFQA 3HCEA 1HQCA 3F97A 4INZA 5DW0A 4C0AC 2XBUA 3BMNB 4B3IA 5C52B 4XLZA 2N9UA 2P77A 3FI9A 4JNCA 1XX6A 3I4FA 4QTXA 5DYNA 2HNAA 2Y1XA 1P4RA 2WHYA 4LSZA 2HA6A 1P9WA 5KO2A 3G59A 3OZSA 4MWGA 5C3UA 2ZSIA 2IU3A 1SXGA 3D64A 3LUJA 2FNAA 3M4NA 3NNNA 4IIGA 4RZIA 1T6YA 3L06A 4R2LA 4XGQA 2H4YA 4E5KA 1P2VA 4EPWA 2ZROA 1GNVA 3D6TB 3TIFA 1ESCA 1T2CA 1JA9A 1KYXA 1T8WA 4FIZA 3BWYA 3KSRA 4N0DA 4NZMA 3E7WA 4PLPA 3SOPA 4E5MA 4ABTA 1EUYA 2FJUA 4P2GA 1SK9A 5ICEA 4B87A 2O8DA 3X1KA 1UC5B 1X8LA 2PWBA 1OLUB 3C8UA 1QCDA 3IOMA 4WZBA 4F06A 3U17A 4OGFA 1YQXA 1JEYA 2H00A 1PI3A 4XEUA 3TBHA 5JVDA 3IEVA 5EPOA 3T4XA 5L3SA 1YS2X 1TEVA 4R2XA 5F7JA 4WINA 5TNXA 2NTNA 4Q1CA 4YWJA 1R3UA 1NT2A 3P97A 3S7ZA 1RPTA 4GSYA 3IBGA 4J1TC 1XZ8A 1E2LA 1N5RA 2GVZC 3G89A 3PDIA 4Q4HA 3I6BA 4RH0A 1OWPA 1RRFA 2W0MA 1E2BA 1A71A 3M4ZA 4U7GA 4YIHA 2WIFA 4IWNA 2CNNA 1ZU5A 2JF0A 2PUTA 1MD9A 4DCNA 4EEXA 1O08A 2GBPA 4R8MA 3ZI4A 2VP9A 2ORED 1W96A 1HYGA 2H08A 3LGSA 3UHOA 1PQ4A 1PFYA 5HF8A 5JDCC 5IT5A 5KNLA 3UATA 5KYUB 1G5QA 1U0BB 1IN8A 1KO5A 3L4BA 1M34B 1LI5A 5DCUA 4F6CA 3EY4A 1EE1A 4Q47A 3AUUA 1RM3A 1K8XB 2CWDA 4CM9D 3L7DA 1BGWA 4QAJA 3IAS1 4DUZB 4XJTA 2HA0A 3HM2A 3H17A 2YMMA 4R1PA 2JJ2D 1HG0A 3G2IA 4ADSG 4GDMA 2R6HA 2QG9A 3C7KA 3CLUC 3B7WA 3OKPA 4HX5A 1RZRA 1DBSA 1MW8X 6REQA 4ZVRA 4GP9A 1G64A 2VHTA 3VC1A 4HP8A 2D0OB 4Y9DA 3JAWA 2Z2ZA 2G4LA 1QAOA 1ZBQA 4I9GA 5L40A 3UOWA 3QBJA 3WFIA 1PTJA 3FPAA 4BDTA 1DX4A 2W83A 1N7HA 2VDJA 3H87A 4R1OA 5FEUA 4DC9A 1JLKA 1NQUA 5TMDA 2ONZA 3WLSA 2A7XA 3E7DA 3KKPA 1TA9A 2B78A 3LX4A 3I6IA 1F2DA 2GXSA 3L4EA 2FPWA 1RI5A 2HU2A 3FYDA 4XASA 3HJNA 4CIWA 3SNHA 4EKEA 1YR3A 5ELXA 4FR0A 3MRXA 3LPAA 4PIMA 4RKYA 1ISMA 3EYWA 4LCEA 5HIKA 2ZJAA 3I5YA 1G7TA 1I4EB 5JEEA 2J46A 2PKEA 3IQEA 4L07A 1FP4B 2YS7A 1Y6ZA 4B6PA 3AHDA 1GRQA 5JZMA 4PANA 1OHHD 4QSHA 3ZLVA 2HSGA 2VYND 2VL7A 1EVLA 2VNSA 3BE8A 3PJDA 2W6PA 1UR5A 2P6UA 3KL2A 4YN3A 4U9HS 3B7PA 1EHCA 4BNGA 5BRNA 3OLWA 3N2YA 1PLLA 5GADl 1ATIA 3AO0B 5HIJA 4WPGA 1L7NA 1U98A 1RS0A 2VF2A 1JZSA 1GG2A 3VDQA 1PK9A 3UMJA 5H82A 1RHKA 4P53A 4DV7B 2IIBA 2CHFA 3DFKA 4IZOA 1NVDA 3EA0A 4U2GA 2OYCA 3UT6A 2NP7A 1K9SA 4ZCTA 3NO4A 4QUDA 1QNFA 2MMGA 4GR9A 2VNJA 1QRRA 4DSTA 1QZUA 5ALGA 4HZUB 2W6JD 3HY4A 2FSVA 4QEDA 2XE6A 3GJSA 4LEIA 3HG7A 1U1GA 4GX2A 3TB4A 2C00A 2WR8A 3OX4A 3PUHA 4WERA 3ZWQA 1HNNA 2OILA 2W58A 4KDEA 1Z26A 4E51A 1HDIA 5E3JA 3B1KA 4V0ME 4DSAA 3P2JA 3WWCA 2O8FB 1YHYA 4TKUB 3EASA 1QGDA 4J9VA 3G17A 1SHTX 4TRJA 5K3AA 3W8DA 2EP7A 5CIYA 2PL1A 2H9YA 2AH5A 3OE5A 3JARA 3HN2A 3PQ3A 2HA5A 4DAOA 2YQ4A 4U0KA 1AURA 2ZUCA 3KKNA 3LS2A 3I76A 1QXSA 1SRQA 2D0IA 4EMBA 1PVVA 4ND8A 2Z9CA 4F9TA 4YLYA 3KSDO 4TWJA 3ACCA 4C06A 4E2ZA 4CDGA 2HPZA 2O3SA 2C98A 3D6AA 2AK3A 5FWYA 1XTPA 5TMBA 1FU8A 1EFVB 1PR6A 3IDSA 5K6AC 1H4VB 5CX1B 2A58A 4DUGD 2AFHE 2OFPA 1V3UA 2OXEA 1VE6A 2QBYB 2QB5A 2X58A 3ZWMA 1FXSA 1KNQA 3ZY6A 3DTVD 4L6AA 1V25A 3MINA 4Z99A 5T41A 4ZO7A 3RVBA 3HU2A 3GCWA 2HT6A 2AF3C 2JAPA 4Y7CA 2VYVA 4WK2B 3V1LA 3X1XA 5TIIA 3B53X 2FMIA 1NUAA 3D7MA 1X1QA 4YLEA 4AJ9A 2VBGA 2XX3A 2R25B 3FNQA 3PRHA 1DJNA 1PJQA 3OX1A 1U2SA 5EIBC 4AB1A 1R18A 1ZAKA 3PIRA 4OFXA 1OPXA 3ORQA 3BWXA 2BC9A 3AB8A 5E8RA 4WESA 1RWVA 1V3TA 1NLFA 1SVKA 3UCFA 1JEAA 1NVBA 1Q74A 4J1NA 4N1AA 1BMQA 2XNJA 4GFDA 4D81A 4YMHA 2FF7A 3AKDA 3N70A 2QGFA 1U7WA 5JZ9A 4KZKA 4DNPA 4AKSA 5LM3A 3PD0A 5K05A 2I22A 5IUNC 4LJ6A 3MB8A 4B84A 1M1YA 2X6RA 4X84A 1CD5A 2GEJA 2GT1A 2DLCX 2DFKB 4MR7B 5A0TA 3E3MA 2XY4A 3CLTD 4ACBA 2A59A 2RHJA 2G28A 2XQJA 2HJWA 3JQFA 4KNWA 5CVDA 2C59A 5U9CA 2F59A 3HRHA 1J0DA 2FUKA 2H1HA 5AVJA 1AMUA 1A27A 3UHPA 4BRZA 4YLGA 1PE0A 4Q66C 1Z6PA 1UDWA 4B81A 2VZ9A 8ADHA 1CRPA 3VO8A 2O48X 2V03A 4B6GA 4ZV7A 2XKKA 5HGJA 1SBIA 4M86A 5IVHA 1X3LA 4Y6GB 4LSMA 1ZRNA 1DEOA 4B7CA 3UBTA 3T0FA 4PAOA 1V1MA 1I3NA 2QJTA 2GM5A 3AY6A 3BF7A 1M0SA 3LUDA 4K6FA 1W76A 2G1JA 2IEIA 5HHTA 5A9TA 3OPYI 2FSFA 3Q7TA 3ZTTA 4WK0B 3LX8A 1U3WA 4CLDA 5M3BA 2WZCA 3ZDYB 5C8YB 2UYCA 5I4BA 2UXCB 2BUCA 1NI3A 4LY0A 3HB9A 1C9KA 5I51A 3PUIA 2BL4A 2FSIA 3OE7D 4Q16A 4D8XA 3NHPA 2O1SA 4P22A 5FEMA 3RC9A 3TVDA 4D5EA 4TL7A 1ZCZA 4MVJA 4DIOA 3QMWA 1H1TA 1XD9A 4H0CA 4JDPA 1TCAA 1N2IA 2V7BA 4GXNA 1VHJA 4REOA 3WLAA 2VH5R 3AYXB 4L27A 3R74A 1WB5A 1THMA 3WL3A 3UYLA 4EDHA 4KVAA 5EHGA 3GMSA 5DKFA 2FVXA 4PZ0A 3ST7A 2J9FA 5JNTA 3ROGA 3L40A 1TUBB 3GGPA 4AJHA 2GAOA 4H0FA 5KWSA 1KI1A 5ESXA 2RH8A 4RZ2A 4G0YA 4RIEA 3REFA 4X3CA 3KJHA 1SULA 3QVGB 2FB9A 1J7KA 5EHXA 2YJTD 1AKEA 2VDPB 3LCMA 4BO8A 3KVOA 4B7AA 4BLWA 3OG9A 4Q93A 5LQRA 2Q5IA 1U2RA 3KR2A 2VDMB 3HFJA 1A69A 1IDOA 1EFKA 1ZD1A 2OAGA 4DPLA 7REQA 5JBQA 1MN6A 3HSKA 5BQXA 2JFVA 5EMMA 1GOTA 1XKQA 3EMVA 4Q82A 3GRAA 4A0HA 4MS3B 5ALPA 3HK2A 3R76A 1CDEA 1X7DA 3I45A 4CTMA 1ISHA 4FYXA 1KBOA 2APJA 4OXXA 4FYIA 1H0KA 4KWIA 4V0QA 1OILA 4FOSA 4IOLA 5E2AA 3H6GA 1Z2DA 4MQEA 3D7KA 5D00A 1UADA 2FZWA 3NALA 3SHQA 2C4UA 1IEQA 1GPYA 1DQYA 2CUTA 3Q8LA 3HS3A 4OFZA 1BDBA 4GI3A 2AOTA 4LQ4A 5EMHA 3WGHA 4HB2A 5A03A 2WWIA 2XWSA 2XQFA 1L1FA 4JT2A 3UV6A 2CXUA 2XTMA 3MLBA 1JKJA 5BYKA 4ID3A 1IB0A 3NHAA 2XNDD 2GN1A 1VGRA 4RVOA 2E5LB 2FDCA 4P0PB 3RH0A 3DOCA 2ZJOA 4D6YA 1L4KA 1N0VC 2VK2A 2YY5A 3GPIA 4G4SP 4RV9A 2LIVA 4DDKA 1JG1A 2XOKA 1JI3A 5ABPA 1ZO8A 1V6AA 4YP7A 1R8SA 1DFHA 3SYTA 3WISA 4MULA 3SIXA 1TVKA 2QN1A 4TS4A 5DLPA 5ED0A 2EJWA 2GCEA 4NONA 3FVTA 1SPXA 2I91A 3U3MA 4HZGA 1XPJA 1QHHB 2X5XA 2ZVPX 3AIMA 2Z1MA 4JVMA 4QL3A 4A26A 4ZT5A 3R7SA 4AD8A 4QOSA 3INGA 1I3CA 1NLZA 1X1TA 5JCJD 5JFGA 3OHSX 1F0YA 4TYQA 5F64A 3I4LA 2VHZA 3GDGA 4JEUA 4M8LA 1VLZA 1YCDA 2FY8A 2ZJ8A 5FL7A 4C21A 4FFRA 3A9VA 2QM7A 1YK0A 3OKAA 2B37A 1QR6A 2FWPA 1JJBA 2X23A 1MQ8B 3A6JA 1TF7A 3GLHE 4KSCA 2OQ2A 3FDJA 5FQNA 1A3CA 2C42A 3A26A 1EJBA 4LDAA 3ZCXA 2DBYA 2ADOA 1Y3AA 3BB1A 3ILYA 4AY3A 5JDIA 5KTOA 1Y5RA 4BQFA 1ZJWA 4XUCA 3GW8A 5BMVA 2GF2A 4G26A 2G9NA 1N92A 1CQXA 3DMHA 3F6CA 3ZV4A 2ZE7A 3LXRA 3QHPA 2D1TA 3GLHB 4MW9A 3IKJA 5EUCA 4OYHA 2W2NA 3OJOA 3OY7A 1J99A 1YBAA 4OXRA 1JHAA 3KFXA 4Q3CA 2Z43A 1NF9A 3U19A 4Z53A 1AUQA 1XHEA 2A1TR 4YCLA 2HBRA 4RGVA 1RE0A 2QQFA 2BR5A 3WRVA 3GFPA 3ZJYA 2BE9A 2F1KA 1A2KC 2H92A 4BQEA 4URWR 3BF8A 2QNRA 3CNNA 2C0PA 2XMGA 2O8NA 3KZNA 1NN1A 3PPXA 1MZPA 4HEA1 2WVHA 4K9RA 2QENA 3DLIA 1YZQA 1CF2O 2XRYA 1BVRA 1JWLA 1OI4A 3ZCRA 3QH4A 1CFJA 1U8ZA 2E87A 1KY2A 2HT1A 2DAPA 3ZHVA 4YJGA 2R66A 5KB3A 2ZS7A 2HREA 2NQ8A 1M5TA 1XU4A 1A50B 2E0IA 4IKOA 1XIVA 5GJCA 4WZBE 4ZOLF 1CIPA 2W2MA 3H11A 1E0KA 5F78A 3WB9A 1L5ZA 2ZUSA 3GNLA 3HKEA 4RJIA 2M6LA 2FUNB 4BTEA 2R9VA 3AB3A 2VJBA 4BMNA 4NOJA 5I9MA 1BKDR 1G66A 3PD7A 2VSFA 4MRPA 1RYHA 3N2GB 5L4LA 4XSVA 5DOZA 2VDOB 2ID9A 4UAGA 3GV0A 2CVPA 2ZAMA 2QJRA 2OHXA 1U11A 4RXMA 4XQCA 1E61A 2ZQ5A 1CVIA 2ZJ1A 2OBXA 2VPTA 2DFTA 3N0WA 2HIAA 3VKFA 4OKIA 1T3SA 1W59A 1Z07A 1DARA 3ZK8A 4ZAVA 4DY6A 4KPYA 3KDAA 1ZGZA 1ZMRA 2GEVA 3IO3A 3HVIA 3IVXA 3ZR4B 4DSUA 5FBZA 2A0UA 3W77A 2ECOA 3KQKA 1G2IA 2QTWB 3R20A 2WFMA 4TUYA 3I2GA 1U02A 3L0IB 3R0IA 5A4MS 5JZBA 4WAUA 1HZJA 1X74A 2FSPA 1Z4JA 3A05A 3NI2A 4TKZA 4UQOA 4Q7KA 4BFZA 1EE9A 4PW0A 5BUSA 1IQRA 4BECA 3RUIA 4CG0A 4OLAA 5JCZA 5HMLA 2QSUA 3G5LA 2WWVD 2ZDGA 3WLOA 1WCIA 3P4YA 2F9MA 3SAJA 4L5JA 1CR6A 4TV9F 2HHLA 3FTEA 3KJFA 4MPJA 2WHEA 4OL0A 4RAOA 4YV7A 4W8OA 1LX6A 2WT8A 4FGLA 5SZHB 5E9WA 1F8XA 5ALEA 3TK1A 2RK6A 3TUJC 4Y1GA 1VIMA 3HDYA 1KO1A 3FTPA 2P27A 3H16A 3IB3A 4UHDA 5C0OE 4Q37A 3IR7A 4MDEA 5DTRA 1Y6RA 4BLTA 2AA3A 2BV3A 3EYAA 1ZNQO 5DSXA 3PXXA 1PR4A 2GN6A 3EPPA 3P9SA 4QTYA 2CL5A 4ZVLA 3ZW9A 4ZQHA 5FJIA 2Y1WA 4S1PA 5HKKA 4F11A 3STXA 1VKHA 4QGGA 4D26A 4JIGA 1VBNA 1JHQA 1XALA 1QQ5A 1ADGA 3DAOA 3HEBA 4KN9S 3X2SA 1QG6A 4QOJA 2CB9A 2P4SA 3T12A 2JLRA 1JWBB 3IKMB 3OIGA 1R2QA 4C04A 4ZOLA 2GBGA 5BMOA 1G38A 3KYJB 3GNSA 3VH4A 3L1IA 5F2EA 1JR6A 3TTSA 1JPJA 2PU5A 2QQGA 4M0EA 4BJ3A 2EZTA 5JMWA 1FFYA 1BO6A 2VT6A 4HRVA 2ET6A 1Z0KA 1BU8A 2QL7A 1O58A 3VHRA 3O73A 2VYFA 3TOZA 3N74A 3SC2A 1GTL1 1IY2A 1HDOA 4CG1A 1GLVA 1KYTA 5JSKA 3KNZA 3VZBA 2R84A 1YZLA 4F3CA 4DXHA 2BFPA 1BE8A 1SC4A 2PCLA 3IEUA 4YI5A 2DU8A 3GLTA 1CUWA 4G5SA 4Y98A 5CX4A 1YZHA 3DOHA 1H9CA 1ZMTA 2P5YA 3HI4A 3K05A 2QWXA 5DTJA 1UFKA 1RADA 1JAXA 2OT3B 1N7GA 1CUHA 4MVJE 3GLRA 3P26A 4FZVA 4PC3A 4GM0A 3CKKA 4PSDA 4RSHA 4X3OA 4J0JA 1Q1AA 2BGGA 1Y63A 2AIRA 3FMIA 2Q41A 1EIWA 4EVSA 2BFDB 4Q9LA 3G8AA 4F2WA 4JV5B 3CB4A 2AUNA 2ZWAA 4KRGA 2AQKA 2XI4A 5EESA 3DL4A 3I8SA 4NXMB 4A8JA 2FPLA 5DHAA 4HV4A 5EVCA 3LJKA 5IUJC 3HXOA 2WRZA 3EQZA 3OCWA 1M73E 2N46A 5EJGA 4E7OA 2AG0A 3EZNA 2WYIA 3V46A 4DS3A 3BWVA 4LF8B 4E03A 1SD5A 1MT0A 3SX0A 2D1FA 3L8ZA 4TV8B 2BZGA 2UZ1B 2WSLA 1QDEA 4GYYA 2A35A 4QOIA 4YI3A 4O2BA 4HD8A 4RELA 2Q3EA 1Q3TA 2XXAA 1ZIPA 4B9AA 4AZTA 1N77A 4W8HA 1CY6A 3SHOA 2OOSA 3GZ4A 4MVJM 4KYTA 3T7AA 3ZDZB 1JU9A 2GBLC 1X1RA 1FSSA 1Z5UA 2YY6A 3SIPA 3WB2A 3AH8A 4JQOA 3AUAA 1DWPA 2GZ1A 2O0LA 4R1SA 3A6DA 2WTEA 3EXAA 1D9XA 4OBWA 4PG8A 4CM4A 2OFXA 1WD7A 1AN0A 4O4HA 4PZPA 4YYEA 4DEYA 5AW3A 2IYZA 1NP3A 1MHTA 1SXJB 5JSYA 5IW8A 3AXSA 3L0CA 4JP1A 4UU8A 5KYGA 5M29A 2ZQZA 3I1JA 1VRVA 4FNGA 4BTLA 3AFNA 3HCPA 1UP4A 2GPNA 3BE4A 3AIKA 3Q5GA 4MPPA 3RFXA 2O5EA 1QH8A 5A4IS 5FI5A 3CLHA 2WC1A 3Q11A 3RYHB 2O2XA 4PINA 3RAPR 2QNIA 5G1PA 5KYNA 3R7FA 3W6UA 3R3YA 3LAWA 3G2PA 2BSQA 4JX9A 1P1BA 1XL1A 1C1DA 3CUEF 3HP7A 4EW1A 4G5OA 3ND5A 3E84A 4RS3A 2NV2B 2R6ZA 2ZIEA 3ZJ4A 2ZETA 3NRJA 1RRMA 2NXJA 1NUUA 4TTIA 1ZYUA 3AZQA 2ZULA 2CHUA 1F8FA 2XNDA 3PIDA 1Y3DE 4Y2XA 5LCXA 3T7SA 4BX0A 3K8ZA 4CMIA 2CV1A 2ZUEA 5K8VA 1LZKA 3M6UA 2G63A 3AUTA 4INOA 2R68A 1ICIA 2I6TA 1WF3A 3KQLA 2F8LA 1GUAA 4KRXA 5F1YA 1C30A 1S9DA 4BGIA 1IVYA 2FFRA 1JILA 2AG5A 3DTYA 4M89A 5JNWA 4JUAA 1CXZA 2PYDA 4PZZA 2NVUB 1I7DA 2X3UA 2BCJQ 3ND7A 3OUTA 4XTCS 3ZU4A 1GDTA 3CBGA 3SQMA 3K5PA 5FF9A 3SF8A 4C7JA 3R5XA 4TYPA 1H4QA 3HLTA 5KAMA 1AXRA 1MABA 4FZRA 5KYWB 2FFAA 3T1YB 4NCIA 3FVQA 1FDOA 2P91A 1NW8A 4ZZ3A 5IDWA 5AVZA 4Z9AA 4ZYTA 3L6UA 4XA8A 2W8BA 5AHOA 2XYPA 5AJHA 1PR2A 2JFPA 2DFPA 4HFJA 4MV0A 3H8WA 4CL8A 4AIRA 4FDLA 1M33A 2WOJA 1GSHA 2C77A 5B3JA 3VKVA 5JPDA 1TK9A 4RACA 1UM9B 2OBFA 6ABPA 3PSHA 3KV1A 3TR5A 4B0PA 2ICAA 2ZB3A 4JBGA 4UNSA 4ZC8A 1TO6A 4GGMX 4DIEA 4YRMA 5FORA 3CX7A 4QBFA 4EHNA 3LQ1A 3LHIA 2QJFA 2W6JA 2I4RA 1U2EA 5D6NA 5B55A 3GBPA 3Q3JB 4OX9B 3AVXA 3VTFA 1GPJA 3KEMA 3DL7A 5KYXB 4DA7A 4AMYA 4QJ3A 4M76B 1O4WA 3HXMA 3UPUA 1EFVA 1EX1A 1JYEA 4PLCA 4FDVA 1HSZA 3BKWA 1PFUA 2YFQA 1JIUA 3NFYA 3PB3A 4K8OA 4Z4QA 2MSEB 4F45A 3A1EA 3QXSA 4J7AA 4HNVA 1QO7A 1SBNE 2X5OA 3RJ5A 4IMPA 3S70A 1X2BA 8OHMA 4OX9Y 1Y8ZA 2B69A 1SY7A 3TXYA 3CW9A 1RQ2A 3ORYA 3PNKA 2C5EA 1AKWA 2PRJA 3I12A 1UFRA 4KMRA 4R2WA 1MX5A 2R8BA 3S68A 3TZEA 4D4MA 3A58B 5JSUA 5IT9A 1C14A 5CD9A 1IOWA 2GK7A 2IJGX 3CIFA 4LY3A 5E6RB 4BCDA 1ZAYA 1XJ0A 2ZB7A 3GL9A 3GY0A 1HT2E 1M8PA 3EVDA 1H6CA 4NCBA 5IAAA 2CVZA 3KD3A 2XPCA 2IY9A 1SXJA 4OM7A 1UMDB 1EUZA 4OH7A 4RY8A 3N5KA 2QTLA 5T8KC 4X1OA 1SC9A 3AUYA 4RD2A 5DTMA 2WTXA 4H3HB 2GK3A 4R2JA 1PEDA 1N6NA 1TRHA 3VU9B 2GM4A 1G5FA 3BSSA 3JWHA 3P4XA 1USVA 5HKKD 4LHSA 3TOVA 1M2WA 2V65A 3SBDA 3DBHA 4EB3A 4YMIA 4POOA 1XTUA 4OHCA 2IYWA 2WUWE 1U7DA 4EA7A 4NAHA 1GQQA 3RVNA 2FOIA 4ISCA 4P3KA 1RYEA 4DMLA 4EY7A 2ZJ3A 3PC8C 3TI9A 5COAA 2PCJA 1NYLA 4LJLA 3QSYA 1LBEA 2CJWA 1YZUA 2PIAA 3L7NA 1A8HA 2W2LD 3VGPA 3VUEA 4NFLA 5BT8A 1YFJA 5EGNA 1FDRA 3JYOA 3N75A 2J3QA 2VBIA 3JAKB 3JD0A 5GOZA 5JWHA 5I7WA 1AOXA 2VRWA 4Q1EA 1EVZA 1R9MA 3KCNA 4ZK2A 3K2IA 2XDYA 4CKWB 1UDBA 2EOAA 3ZLTA 4X7PA 2CNLA 3DE5X 3KAPA 4RV4A 2BMWA 2F2TA 3FDXA 2NO1A 3T06B 3BRWD 4IDEA 1UQRA 5JNSA 1TI7A 4XD7A 5C51B 1NKSA 1R5NA 3JQ6A 3HKDB 4BTVA 3K4QA 1R9GA 3INYA 5HFJA 3RJMA 4XDYA 3WS7A 2FPIB 1JIIA 4L2IB 1H2RS 3Q7RA 2BEUA 1ODIA 3T5CA 4FZ5A 3P9CA 3KX2A 3P8ZA 4H6WA 5A71A 4YAEA 3EAGA 4TWAA 4ZI7B 1R50A 3R5FA 5REQB 1ISRA 1N2XA 3CSDA 4W1RA 1DSSG 1FPQA 1VFPA 3PWZA 5G41A 4D9FA 4HUTA 1GZ3A 3U26A 3UAYA 2IKSA 2JAQA 1GNSA 1GL6A 1IOLA 2ZB2A 3L77A 3KQUA 3CJTA 3Q4GA 3PXGA 5TR9A 1GZ5A 4DA9A 2VHQA 3Q2IA 1L5GB 4BZZA 2INGX 3ZLUA 2QXUA 4IRUB 4H7HA 5LLDA 2Q5JA 1R64A 4MYDA 1UP6A 4WXRA 1XTRA 2NU9B 1MVLA 2UUBB 1DT5A 4P36A 3ONWA 3SQWA 3KQYA 2ZWVA 3A4VA 1Y1TA 1QGUB 3INTA 2VUSA 1HSOA 1J0CA 1C8KA 2HADA 3MCZA 3KYIB 3NHSA 2WAMA 5KHLB 1NMYA 1LWNA 2O1WA 4MQ5A 4O1IA 1T8PA 4A2WA 1YOVA 2D74A 1YCHA 2Y6VA 2RGDA 1NVXQ 2JFHA 3CQ9A 1ENPA 1US8B 4ISBA 3RK4A 3OJEA 1G6KA 2PAAA 1IRIA 3TUIC 5IJ9B 4RF2A 1T2EA 1T5TA 4BNLA 4Q7QA 3SHTA 4CM7A 2RI1A 4MV8A 3RAGA 4HDKB 2ZBRA 2ZDQA 5A4AA 1P39A 5HQ3A 1SIUA 1QUFA 3IXQA 2JH9A 2HIMA 4LZWA 4EPVA 4KE9A 5I5EA 4UM9B 1OAAA 2DBZA 2G6BA 1QKKA 2WKRA 5AKKA 1M0WA 4G81A 1SOAA 4YTEA 2B6NA 2X9VA 4BN5A 1AS2A 2GI4A 2G8LA 3T9FA 3LY7A 3DHEA 5CTJA 4D45A 2ZW9A 2R11A 3WMRA 1JRLA 1VKJA 4A6EA 1TZJA 2H1SA 4LZNA 3DEHA 4IG9A 3TRIA 1XMPA 2VH2A 1JLLA 1CZNA 1M7BA 2H3EA 4H7FA 2PX4A 1Z82A 4KDFA 4OP1A 1T4CB 2DSTA 5HOQA 3IE1A 3K2QA 4JWKA 2GPJA 4P7JA 4ZAZA 3SE7A 1Z08A 4TT8A 4IJVA 2PH1A 1QK5A 5HZGA 2BCEA 2ZSBA 2YICA 4MVJH 5DCLA 2QMHA 3U4MA 1K2WA 3LSYA 1BN6A 2CE7A 4Y0VA 1GZUA 4HH4A 4TS9A 5TGTA 4ME6A 4II2A 3SBXA 4Q0MA 1KNXA 3H97A 2VH1A 4RIFA 5CEFA 1F5NA 4PX3A 1OGJA 5ADVA 3QE3A 5ECGC 2DFLA 4GBMA 2I62A 1JH9A 4FGUA 3O8DA 3KXIA 4M1TA 2C4TA 2VF8A 1F9EA 5EKDA 4J3JA</