1XU9A

Crystal structure of the interface closed conformation of 11b-hydroxysteroid dehydrogenase isozyme 1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
publication title Conformational Flexibility in Crystal Structures of Human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xu9A00
1A27A 2J5RA 4QO7A 1WDLA 3PLRA 4Q9NA 3JD3A 4CLXA 3GN2A 2RHCA 1WP4A 2FY8A 1DRVA 4KP7A 3PTZA 4WCFC 4ZRMA 3WB9A 4U5QA 2I76A 1ZSVA 5IXYA 5KOIA 1J5PA 4YAKA 2G1UA 2VUTA 4ND5A 4IBOA 5I7VA 1ONNA 4GGPA 3RUDA 1B3BA 1U4SA 3T4EA 1BTOA 3F5SA 3GQVA 1GADO 1T1RA 3F6YA 3BMQA 4RPGA 5K6AC 4S3MA 1N5DA 3PHGA 4NZ9A 4OYRA 4DYDA 1QRRA 3JQAB 2DBQA 1IZ9A 3TPCA 1Z7BA 1ISHA 1U9JA 2FPGA 5I8WA 4FIZA 1Y8QA 3SLKA 4WLUA 5JDIC 5KCZA 4RZHA 4UAGA 1YB5A 1K5HA 4YRDA 3UKOA 1PZFA 1LRLA 2UYYA 3ZGYA 3DZFA 3OFSA 4RQTA 3ANNA 3DMYA 3QVSA 2AE2A 4BGEA 5CPFA 1H6BA 3E6AA 4UEKA 4E12A 2VZ0A 4URFA 4M89A 1HDCA 3ANMA 3FTPA 3WS7A 1P1KA 3ZNQA 3PDJA 3VPGA 1HE3A 4BO5A 7ADHA 1U3UA 4MVJG 3OQBA 1V35A 2EERA 4EUHA 3RJ9A 5CDUA 4AJLA 2QX7A 1YL7A 3OBBA 1XR3A 5DP2A 1G0OA 1YL5A 1PJSA 2X58A 5JYEA 2FR8A 4XD2A 4DIOA 4AJHA 1FF9A 3QVOA 1M6WA 1FXSA 3OA0A 3D3WB 4J3FA 3O38A 3GGGA 5JY6A 4LGVA 2UUPA 5TNXA 4YXFA 4XYBA 3QY9A 5B4UA 1L1FA 2PGJA 2Y1GA 5K0ZA 2DBZA 1P1RA 4I9UA 3ETGA 1Y5MA 1I5RA 1E7SA 4LMRA 5I7EA 3PHJA 1V8BA 3H5AA 3I23A 3PZRA 2E6UX 3M2TA 4GQAA 1IPEA 1DHRA 2NU7A 3UCEA 1GCOA 4EUEA 3BXXA 2FSSA 4D0SA 2WTBA 4AJ4A 4Y98A 1JVBA 3HN7A 3K31A 2H9IA 4RVGA 4CJXA 2NU6A 2Y99A 2VHWA 4OMUA 5JW6A 1DLIA 3BMCA 1Y81A 3NAQA 3VH3A 3Q9UA 5GZ6A 1IY8A 4JX8A 4L74A 2YW9A 1ZMOA 3ICPA 1DIHA 2BMAA 1ZJYA 3V2GA 3UFXA 3BTUA 3ZU2A 4E21A 2FSVA 1J0XO 2DPHA 1PQWA 2FHSA 2W4QA 5FF9A 4YAIA 3W4KA 1IOLA 1ADCA 4Y67A 5C7OO 1RJWA 2HRBA 3IUSA 4TRRA 1RM4A 3SLGA 1HE4A 4CLHA 1CQIA 1XG5A 2C82A 3NGLA 2RH8A 5BT9A 3I6IA 4WOKA 4PZCA 5DZSA 3PFWO 1X7GA 4YT2A 3F1LA 3TZHA 4KWHA 4IPTA 2UUOA 4CUJA 4U6SA 3WSWA 4PLHA 4PG6A 2HKIA 4N7RA 5BSGA 4R1TA 3GVHA 3ZW8A 1GUFA 4M86A 1NBOA 4WEOA 3INTA 3JQGA 1PEDA 1HDOA 4XQEA 4PG8A 3JYLA 3GGOA 3KRTA 4BNXA 4E0BA 1I3MA 5KJEA 5TT0A 1HDYA 1WNTA 1U8XX 3PZBA 3EGOA 3IKVA 2GERA 1YXMA 3K2BA 2J3KA 4YJGA 2VHXA 4DMLA 4Z0HO 3CUKA 3KYCA 3UCXA 1UXKA 1IHXA 2Q1TA 3JQ7A 1K6XA 5TJ9A 5U1PA 5DNAA 1NASA 3JTMA 4MIYA 3GVXA 4FSHA 1QSGA 1ZO8A 3GY0A 1M66A 2VZ9A 4RLHA 2D8AA 2YFHA 4JXKA 1JN0A 5DCWA 2VUSA 1AUPA 4XJTA 1LRKA 2F00A 4YB8A 3QVTA 2EJWA 2H63A 2ZATA 4FFMA 3WX0A 2ZTMA 4Z0PA 3RBVA 1RM3A 2DUUA 3DBRA 4H15A 4GX2A 4O5OA 3GMDA 1AGNA 1I32A 1ISMA 3GRKA 1Z73A 4CM8A 4E2WA 3KYDB 1HWYA 3DWFA 4M55A 1YQXA 4W4TA 4BMNA 4M1QA 1NP3A 1PR3A 4W9NA 4CLOB 1B15A 2CF5A 4DYVA 4GL4A 4A2CA 1E7QA 3EC7A 1ENZA 1DC3A 2VCYA 3RKRA 4A27A 4TKLA 4CUZA 2EWMA 2IRWA 3KB6A 3MZ0A 2PZLA 2I9PA 4B4WA 1PJCA 3GLQA 4MPDA 4NR0A 2HLPA 2D1YA 5L95A 4FGSA 4Z9YA 4WLVA 4NBVA 4KUGA 2A92A 2EGGA 2YHUA 4MKRA 4IDDA 2HMTA 4NBWA 3WR5A 2OOSA 3M6IA 5EJ2A 5J23A 5GY7A 1DXYA 1R12A 3NDIA 4JJIA 4ROSA 3AI3A 4J16A 5I9MA 2WD7A 3T4XA 1HDRA 2DT5A 4WPGA 1UZLA 1HXHA 2W8ZA 1D1SA 1JU9A 4L0QA 4O1MA 2HMVA 4CMAA 2Q4BA 4JN6B 2J3HA 3LLVA 4BNIA 4DBVO 3L4BC 4JBHA 2XAAA 6LDHA 2BGKA 2XF8A 1KY4A 2RH4A 1EUCA 3WTBA 3ORFA 4MOWA 4IDCA 4BO9A 1MG5A 4FN4A 4CMCA 5JCJD 4PVCA 5A05A 4LW8A 1VJ1A 1ZXBA 2ZCUA 3NX4A 4HFJA 4Y9DA 4R5HA 4QTZA 1VM6A 3LC1O 4DWVA 3HE3A 2DM6A 3ZWOA 5F21A 4J90A 3H8VA 3EAGA 3OIFA 3WOHA 1ADFA 4FD3A 1YVEI 1YWGO 1DEHA 2YHIB 3ITKA 4MVJD 4YAGA 2JAPA 4TWRA 1IZ0A 5L53A 2WJPA 4YPOA 1M67A 4W6ZA 4CLDA 2VT3A 2BI7A 2DTXA 2G82A 3WGHA 1NVGA 3A28A 2HK9A 3ROPA 4B4VA 1N1EA 2HQ1A 2BFPA 3EVTA 4JIGA 4E33A 4TZTA 3LT1A 5G0WA 1AHIA 1C1DA 1LSJA 3OJLA 1B16A 2GDZA 4DC0A 3EZYA 5TT1A 2PZMA 1DOHA 4RF2A 2EKPA 5TJHA 1K2WA 4FC6A 4PN3A 4EBFA 4UREA 2VHZA 1I3NA 1T4BA 2JKVA 3PWSA 1HL3A 1QR6A 1NR1A 1KYQA 3BA1A 1VJTA 1XSEA 4B8ZA 3DBVO 5ER6A 1MC5A 1ZH8A 3HFSA 3WMWA 2D2IA 1E3IA 3GEDA 1WZIA 3ZNOA 2EXXA 4C4OA 2YUTA 3ST7A 1TLTA 4PLGA 3K92A 1I2CA 1JWBB 2GCGA 4YACA 1U2DA 3U3XA 4UULA 5JY1A 4HX5A 4D45A 2WYVA 3EVNA 4QFDA 1E0DA 1BVRA 4FCCA 4J7CA 4YWJA 4BKPA 4WCFB 3TNLA 3NT2A 2EW8A 1PQUA 4Q3DA 2GSDA 4CM6A 3W4JA 1HETA 4YJHB 1P1HA 1T25A 2CVZA 5A03A 2VTDA 3DHNA 4JQCA 3DZBA 4E5NA 5JCJA 3HDYA 4FOOA 2O3QA 1QYVA 1UH5A 3HG7A 4LMPA 3P2YA 2PY6A 4N5MA 3WJ7A 1ENYA 3U5TA 1YBMA 2IZ0A 5B4TA 1LQTA 1YDWA 1PR9A 3GF4A 3Q2IA 4OQYA 3AM3A 4XJSA 1AXEA 5B12A 3FBTA 1GL3A 1C0IA 3FR8A 4CQLB 4ESOA 4YT5A 1GQYA 3MCVA 2CDCA 1YBVA 4MVJA 4XGNA 3WQSB 4E4YA 3RKUA 3CKYA 5CEJA 3AI1A 4WLEA 2PK3A 3OQ6A 1PGPA 4Y6RA 1A9YA 1LDYA 1B2LA 3ZN2A 4DPMA 1J4AA 4ZU3A 4D3DA 3QP9A 1GAEO 3EW7A 4Q3BA 5K9ZA 2DTEA 3EYWA 3ZV5A 2JHGA 5KJCA 5KKCA 2D0IA 3PYXA 1LU9A 4FFNA 3VPSA 5JXWA 1Y8RB 2Q50A 3FCOA 4H7PA 4OL9A 1O6ZA 2Q45A 4II2A 1K6JA 1IYZA 2AA3A 1OMOA 1H2BA 4J9UE 4HBGA 1Z6ZA 4Q3AA 5KVSA 4AL4A 3KYDA 2Y67A 3JSAA 1IB6A 3PJDA 5KJ6A 3ADPA 2VZ8A 4FFPA 3AY7A 1CDOA 4J1NA 3ZWPA 4CLOA 1BDBA 1YQGA 5IDYA 3NJ8A 3RC9A 3PGXA 3IUPA 1M76A 1AXGA 1T2CA 1E5QA 4ZQGA 3V1YA 3JQFC 3DTYA 4HFNA 3B1FA 4IUYA 3VDQA 2B0JA 4CMKA 2P5YA 1LLQA 2LDBA 4PLCA 5H81A 5IDWA 1O8CA 4IJKA 4A5OA 5A9SB 1LRJA 5L3ZA 4BKOA 5BR7A 4P4GA 3WFJA 1V3UA 1N1GA 3IP1A 3OSUA 5IXSA 1EQ2A 3RIHA 2X0NA 2P68A 1GTMA 1N7HA 4ILKA 1PL8A 3WGTA 3LT2A 1PZEA 4WLNA 2X4GA 4ZICA 3ULKA 3QW2A 3KSZO 4XGIA 2YDYA 3W8FA 3V2UA 4WNIA 5IZ4A 1MC4A 4B4UA 3F47A 5CAEA 4EEXA 3HADA 3JD2A 3DFUA 3TJRA 3I4CA 2BI8A 1Z7EA 2D5CA 2ZIZA 5F1KA 1QXSA 3NT5A 3NUGA 4XWYA 4AICA 1A7KA 4PG5A 4BV8A 1EBUA 3RFXA 3GDFA 4BKRA 1E3EA 3ANLA 3CE6A 2P9CA 1ZVMA 3QWIA 1SZJG 4E30A 4GX5A 2AEFA 5T5QA 1JQBA 1YDEA 1HSZA 2YHIA 5GMOA 3I9OA 3OH8A 5BNIA 5A5EA 4AJIA 1N2SA 5F1OA 1PL6A 2HJSA 3WGYA 1NR7A 1UP6A 1HRDA 1H6DA 3IC5A 4G65A 3JQ9C 2QG4A 1C0PA 3TDKA 1U2GA 5F1PA 4ALLA 5A06A 3HJAA 5C37A 1XEAA 1V3TA 3N74A 3UHAA 2IE0A 3PEFA 3EDMA 1QP8A 4CM4B 1YE3A 3RUIA 3ZWXA 2D4AA 3H9EO 2Q4EA 5KJ1A 3ZNNA 1Q7GA 3ICCA 3DBHA 1Z74A 4CMJA 2X0IA 1U3WA 2W2LD 3KO8A 5H82A 4HADA 4QUKA 2EHDA 5A4DA 2X5KO 3S1LA 2JHFA 2AQIA 2GUGA 3WNVA 2GZ3A 3FI9A 4MKXA 1ZZEA 4J0EA 4L75A 1NX6A 1GQ2A 4D41A 5I9LA 2Z1NA 3WGZA 3PLNA 2ZTLA 2I66A 4BQPA 3U4IA 2YV3A 4J49A 4MVJM 4JROA 4II3A 3GHYA 1VKOA 4E5PA 1NXQA 4A10A 3LU1A 1B8PA 5TS3A 4QEDA 1V6AA 3K2EA 4F45A 2EG9A 1R37A 4NFSA 4L9RA 1PS8A 2OP1A 3GRPA 4E2YA 3VH2A 1SB8A 4WCFA 2C59A 4BO1A 2FP4A 2X5OA 2V65A 1XWFA 3R6DA 1T24A 4OO3A 4YJHA 2J5QA 2DBVO 4I9HA 1PWXA 2O7SA 3AJRA 2O23A 5TC4A 3DAGA 4RF5A 3KV3O 3ETEA 3FF4A 3Q2KA 2OO5A 2PGDA 4UEJA 3TQHA 2JFGA 4RPKA 5TIIA 3B6ZA 4BS9A 2NU8A 3KM0A 4A0SA 5KJFA 4XGKA 4NU5A 1TVEA 1GU7A 1LSUA 4DQUA 2CDBA 2AW5A 5CDYA 2EP5A 3GNQA 5BNFA 4CM9D 2J6IA 2YJZA 1MFPA 3BHMA 4HNGA 4RVSA 1E3SA 1KVRA 4J2HA 1KVQA 4WK6A 1BXZA 3DHYA 4J1TA 4J9VA 4IY1A 3RBZA 2LDXA 3QRWA 4J43A 3OJEA 3H3JA 4TZKA 1ISFA 2EP7A 3TZKA 4BNZA 4DUPA 1DRWA 5T8KA 4YQZA 5EIOA 5AVOA 3L4SO 2Q2VA 3VAZA 8ADHA 1MG0A 1U1IA 3TFQA 1I24A 1QYCA 2FMUA 4RJTA 5AXAA 1BXGA 4MDHA 4NBRA 4BO8A 1KVUA 1PJLA 2YQ4A 3I4FA 3VVBA 1P44A 5AXCA 4E32A 2CNBA 1BMDA 2BD0A 3RI3A 2BFAA 1GY8A 1Q7CA 1WDMA 3UGKA 2W2LA 2VYVD 4RDIA 4KWIA 3CIFA 2B35A 3FPCA 4YJFB 3W8DA 4BNKA 5HRUA 3ZCXA 1PGOA 1X14A 1NFFA 4UVEA 5L4LA 1MP0A 3C8MA 3FRJA 4Q39A 2HU2A 3CPSA 1WWKA 1O95A 4KQWA 4J7XA 1QKIA 4GKVA 5AXBA 1DIGA 1R15A 4F3YA 4J2OA 1LJ8A 1UDCA 5A9SA 5AOVA 4N54A 1PS9A 4MO2A 1E6UA 1KEUA 4MP8A 1ZMTA 2BKAA 1FDTA 1JVSA 4DLBA 3IAHA 1VPDA 1U3VA 3JQBA 1I10A 4MP6A 3KSDO 2AXQA 4DTIA 4EYEA 2AEMA 2GASA 2EW2A 4B3IA 1F14A 2NTNA 3LQFA 1HDXA 1LDMA 3VH1A 1YOVA 1W8DA 2DPGA 3GHHA 4PG4A 2QHXA 5KIAA 2VOJA 3TF5A 3P2OA 2XXBA 3IMFA 2NLOA 4AJPA 1NQTA 1T2AA 1H6AA 3BTOA 1OBFO 4BNWA 1EEHA 1LNQA 3DBLA 5JAIA 3WDSA 1RKXA 3AI2A 4QX6A 1UXJA 3C1OA 4I8XA 1ZCJA 1F0YA 2YV1A 2DU8A 4CM9A 3NJ4A 3MTJA 4BKQA 2I6TA 4GWGA 1ZXLA 4YAJA 8LDHA 3KSUA 5DF1A 3NTRA 3NT4A 3AW9A 4XIJA 1RPNA 3E9MA 3VZRA 2DBRA 4HKTA 1XA0A 3KVOA 2B4TO 5EMHA 1FK8A 3HHPA 2P9GA 2JL1A 5JFOA 1G6KA 4HFMA 1U5CA 3JV7A 4RPHA 3AUSA 2DFDA 1OZAA 1YJQA 1TT7A 4O0LA 3EUWA 4EDFA 3EZLA 2OXIA 4ALMA 5L7WA 4M49A 2RHRA 4CM4A 5I8ZA 3H9QA 5IZCA 1FDWA 4ZHSA 2VYVA 2HRZA 3B20A 4GGOA 5COQA 5C7LO 1PL7A 1VSVA 4OM8A 4H16A 4PG7A 3AM5A 2IZZA 1CWUA 1CETA 4BNNA 2C7VA 4BKUA 2O3SA 5I7FA 1PIWA 1H0KA 3OJ0A 2GZ2A 2EJVA 4L4XA 3RC1A 4KMSA 4N5NA 2X7HA 1ORRA 3S2IA 4NQZA 3WG9A 1PS0A 4YDRA 4CQMB 1K6IA 2D3TA 2C29D 3NYWA 1Q7BA 3WTCA 4CM1A 2G5CA 5H83A 1A7AA 2H1SA 5HS4A 2G76A 1DAPA 2WM3A 3TOZA 5CDGA 2NTJA 3O4RA 1R0SA 4XDZA 2Y1CA 3D5TA 1HT0A 2QQ5A 1DB3A 3LC2O 3TL3A 3FD8A 1LXCA 1BDMA 3I3OA 4LSWA 4PRLA 5EINA 5DCYA 3QV1A 1DFHA 4WLOA 4IXWA 1MLDA 4GLOA 3E5MA 1JA9A 3O8QB 1SBYA 5G4LA 2DTDA 2PGLA 3VDRA 1C0LA 3DZHA 2NU9A 4LCEA 4JBGA 1EVJA 3UUWA 2ZK7A 2WMDA 4R5MA 3U09A 5KNLA 1GUZA 5JAZA 5EPOA 1D4FA 2Q1SA 2AQHA 4QECA 3VZQA 2V6GA 4IS2A 3L9XA 2VYND 3PJFA 3ONFA 4KTTE 5G4KA 4RLSA 1OAAA 2OL4A 5HTOA 1U7HA 5THKA 1A4IA 5COBA 4X54A 3FWZA 1GV1A 1NQ5A 3VKVA 2OZPA 1BXKA 3FNHA 1GQQA 4W99A 4IDEA 1QV7A 2Q3EA 2QRKA 3QQPA 4JP2A 1E3LA 2GLXA 1DSSG 1QMGA 4GSLA 4KDFA 4BNUA 2VWHA 5F5NA 1YB4A 3LT4A 1H94A 3JQAD 1ID1A 3PFFA 3JQEA 3PJGA 2WDZA 3KXDA 4HUJA 1X1EA 3GK3A 4NJMA 2J5KA 3EHEA 4XX0A 2VN8A 2HJRA 3UCFA 1PTJA 4J7UA 1MA0A 1LEHA 1N7GA 2X23A 1YB1A 3O03A 4OSOA 3V2HA 1Y1PA 1QYWA 4EJ0A 2SCUA 4IMPA 1BW9A 2HMWA 1D7OA 3PXXA 4IZIA 4CMIA 3DONA 4W7HA 3VTZA 1R4MB 3BAZA 3KLMX 3S2GA 3ABIA 3GVCA 4OXKA 2DFVA 2EIHA 3OJOA 1AN9A 2YDXA 4FDAA 4ND3A 1LLUA 2NACA 3DZJA 3HQ4O 4NG5A 3ZU3A 4CODB 2P5UA 2X22A 2JD0A 2CF6A 2JJYA 5CEFA 2HMSA 3AU9A 1B8UA 1PU2A 3U9LA 2HK8A 3T7EA 2QYSA 3RU7A 4I5GA 3JYPA 4JK3A 4ZN6A 1T4DA 1KVTA 1ZEMA 4LN1A 4IDBA 2V6BA 4IJWA 3BHIA 1EQUA 1F8FA 1JW9B 4WJZA 4HNHA 4D3FA 2AMFA 3LT0A 3FNFA 5LCXA 4DL9A 1O5IA 1MX3A 4CLRB 2R00A 3ZWNA 3I6QA 1N92A 1R66A 1TB4A 4R9SA 1ZSNA 2OMEA 3B1KA 4GX0A 5L7TA 2D59A 2VYNA 4DVJA 3JQ8B 2ZTUA 3AY6A 1MGOA 4UVIA 1VKNA 2Y0CA 4OQZA 2Y1DA 3AU8A 1FMCA 1I2ZA 4UUOA 4XQGA 1MB4A 4UEOA 4BO6A 3K5PA 3KTDA 4R01A 1KEVA 3A4VA 3SEFA 3N7UA 1YQDA 3W6UA 1ZEJA 3ZV6A 1C1XB 4K6FA 3MJ4A 3H3FA 3JQAA 1CEQA 2FWMX 1P3DA 4ND1A 3BHJA 1ENPA 3RAJA 4BL5A 2B83A 3D3EA 1LC0A 4I5FA 4E2XA 3VH4A 3ENKA 5C7IO 3WGQA 3COSA 5KVCA 2QYTA 2UDPA 4AVYA 4BOYA 3LZ6A 4U0KA 1DHTA 1A71A 4RF4A 3VHRA 3ZWYA 4ZRNA 5U4QA 2O4UX 2VWGA 3AUTA 5T64A 3WGGA 4P4NA 4DPKA 3I52A 5ILOA 1ZUD1 3QWFA 3ENNA 4OKNA 5G0SA 1R4NB 4ITUA 4D79A 4GSKA 1SEVA 2QZ9A 2A94A 3KLPX 2Q1UA 3VPXA 3I9NA 5U9CA 3PVZA 2I5PO 5DN9A 2IYOA 1GZ6A 4BV9A 3GZNB 4CR7A 4FFLA 1M2WA 3D3WA 4KQXA 4CMEC 2FPPA 3X2EA 3MOIA 2E4AA 1E7YA 2C20A 1V0JA 3KZVA 1HE5A 4DLLA 1ZK2A 3QVXA 1OC2A 4MIOA 1QORA 2DKNA 3SX2A 1VSUA 3D7LA 1IPFA 2J3IA 4RO0A 4BHTA 4RDHA 1PZGA 3HN2A 5JMWA 2IEBA 2ZYDA 4CV0A 1H93A 1WLYA 3E82A 4XIYA 1DAOA 1LLDA 5THQA 3C7CB 1RM5A 2Y0DA 2X86A 1XU7A 3F46A 4E6PA 5TLSA 5COAA 4BB6A 5IF3A 1T2DA 1VJ0A 3Q6IA 2UAGA 5CG1A 4I5DA 2FN7A 3FPLA 5TRTA 4M87A 3E1KA 4PLFA 3PK0A 1S7CA 1O0SA 2Q1WA 4E3ZA 1JTVA 1YONA 4XQ9A 3BIOA 4ALNA 5L51A 1LUAA 3H9JA 2CUKA 4Y6PA 1K89A 3D1LA 3MJTA 1R16A 5MGBA 2VRCD 1UXIA 3I5MA 4IMRA 4QQRA 3A1NA 1NHGA 3C1AA 3W8EA 5JO9A 3ASUA 1QYDA 1E7RA 3DTTA 2O7QA 5DOZA 1H5QA 2FZEA 1M6HA 2Y68A 1G0NA 4K28A 4MVJP 4R4JA 3DEYX 5EQDA 5ENDA 2HSDA 2BELA 2C54A 3CMMA 4EJ6A 4OHUA 4GBJA 5ICSA 1I2BA 1I3LA 2WEKA 1YJ8A 4IINA 4XR9A 4MKZA 4PZEA 5IN4A 4MVJF 4B7UA 1LDGA 2CY0A 4BO0A 5JNLA 1IHYA 1YL6A 2PKQO 3GOHA 4DRYA 5DCUA 2CVQA 3G1UA 5DP1A 4W9NC 3LK7A 1PSDA 2X1HA 4MIEA 5CP8A 1R4MA 2AEJA 3IIEA 1ISGA 4AJNA 4BGUA 3MJVA 1BG6A 4IJVA 1Q1NA 3DMTA 5JLAA 3C85A 4UVDA 4W7IA 5GZ1A 1O94A 3GFGA 2J8ZA 1PWZA 3DHEA 4J4TA 1L7DA 4FFRA 4IQ0A 5CG2A 1Q0QA 4BVAA 1RYEA 4E31A 1LSSA 1UDAA 3ZU5A 2E49A 2VWQA 1GCUA 4LSMA 1NPTO 4XKJA 3RASA 2PD4A 4BNFA 3F4LA 3MJCA 1U3TA 2VNSA 3TOXA 2NUAA 1B8VA 4WCDA 2FR1A 1K3TA 4TKMA 1KETA 4EW6A 4CV3A 4DMMA 4WGGA 4O63O 1SMKA 3RUCA 3CTMA 1EK6A 5CPBA 2X0JA 3H5NA 3D0OA 3WYCA 3ZWMA 4R51A 2PZJA 2YZ7A 1JKFA 1SNYA 4WLFA 1KIFA 3P5SA 4GI2A 1DFIA 2IEDA 4FJ1A 1E7MA 1T2EA 4GVXA 5G0UA 1ZIDA 4E5KA 3S2EA 3U4CA 1PGNA 1NYTA 3L6OO 4IDAA 3TSCA 5JPIA 4QFCA 4EGFA 2VRCA 3RVDA 3ZWAA 2VHVA 4NU6A 2A4KA 4P38A 3L6DA 1A4UA 1BSVA 4YRBA 3JQDA 4ONEA 4LVUA 3M2PA 5ENVA 1MV8A 5T57A 1X1TA 1P1JA 3WIDA 5JBIA 2YV2A 1ZK3A 2ZJ0A 2GGSA 1C1XA 3AOGA 5JMPA 3H2ZA 1LSOA 1IE3A 3WMXA 3F1KA 1N8KA 1PJ2A 1TT5B 4E13A 4RL6A 9LDTA 4U7WA 1VC2A 3E18A 4HY3A 5HM8A 3ONDA 3BTVA 4PZDA 4DREA 1Q0LA 3WQRA 4L4SA 1N9GB 2UVDA 2ZYAA 1YRLA 5MDHA 3H4VA 4OKIA 2C5AA 5TX7A 1EE9A 1JAYA 1CIVA 4PLVA 2UV8A 2WSBA 5A04A 3L77A 5C5IA 3FTNA 3AOEA 4Y6SA 1Q2XA 2G0TA 3A9WA 4TRMA 1XQ1A 1KEPA 1TA4A 3FBGA 4PLZA 3NGXA 1I8TA 2P4QA 5B4VA 3DAPA 1H9AA 4FR5A 3BYZA 4MVJH 3VPHA 1U7TA 2AHRA 2V7PA 1GDHA 4FJ2A 1YBAA 4NH4A 1OI7A 2O3TA 3JYOA 1E6EA 1P0FA 3GFBA 4AJ2A 4DIFA 5JDCA 3RCBA 2X6TA 3KOUA 1WMBA 2EKQA 3GZ4A 4MP3A 1CRWG 3OIGA 3F5QA 3G79A 5IDQA 2ZB3A 2JCVA 2ZTVA 3ZWVA 3IKTA 4DQVA 3ITDA 5DBFA 2IXAA 3GVPA 3BMQB 1MXFA 2Y1EA 2X9NA 1NQAO 1ZSYA 3BZUA 3LF2A 3U0BA 5IAAA 2B4QA 4CMGA 4DC1A 1B3RA 2OFPA 4NIMA 4YR9A 1Y8QB 1MFZA 1PGJA 2C2XA 1V9LA 1E1NA 1L7EA 2PD6A 3MJEA 2AG5A 3PHLA 5JAQA 2RAFA 4G5HA 3OM9A 3SC4A 1LI4A 3V5NA 5L45A 4GH5A 5DULA 4GVLA 4R54A 3ON5A 3C3XA 5IDXA 2XXJA 4K6CA 4BUCA 2RBEA 4PVDA 4ND2A 1P1FA 3FN4A 1R0KA 2NWQA 4YA6A 3BTSA 1Q0HA 3K96A 2D5AA 1ZBQA 1R6DA 3QWHA 1U28A 4ZA2A 3INRA 3LVFO 3PIIA 4Y8VA 3D5QA 4HXYA 4EJMA 1EDOA 3WYEA 3F3SA 2VTEA 3SC6A 2BHLA 1BGVA 4NK4A 3ZW9A 1KC3A 2GRAA 3GMSA 4AJKA 5K6AA 2B5WA 5L40A 3JYQA 1X7DA 3AFMA 3C7AA 4KTVE 4OJNA 4YCAA 1PJTA 1I33A 5KKAA 1BWSA 1DC5A 4QT0A 3RD5A 3K73O 4ZJUA 1ONPA 2WYWA 1HE2A 2DQ4A 3PGJA 3ZNPA 2PH5A 3DZGA 3ONEA 5JDIA 4IQ8A 4A7PA 1HZZA 2JAHA 5F5LA 4B8WA 4FPXA 3DFZA 1DBVO 4XQCA 2PFGA 4CQLA 1GYPA 3BMCB 3LYLA 1U5AA 4WE3A 2CD9A 1E1LA 1E6WA 3GAZA 3LSYA 5BSFA 5G2OA 1EMDA 3B70A 1ZK1A 3NV9A 4IM7A 3WYBA 1KOLA 5HWSA 4FGWA 4FB5A 2HK7A 1DLJA 1KC1A 3U4DA 1T1SA 2GNAA 4IXTA 5TSDA 1I30A 2B36A 3PDUA 1ZKMA 1Y8RA 3B1JA 4IIVA 2GN6A 3GAFA 4P22A 4YJDA 4C7JA 3CINA 1NQOA 3H9GA 1W0CA 4RQUA 5DDIP 3WWYA 3GC6A 3CMCO 4XRRA 1UAGA 1J6UA 2ET6A 3PQEA 2GN4A 4GWKA 1KEWA 1DJQA 1JWAB 4KDEA 4AFNA 2VWPA 2ZB7A 3PI7A 4LVCA 4TMFA 4PLTA 1ONOA 1HKUA 1Z75A 5A3JA 4IJUA 4TROA 4MINA 4D44A 2NVBA 3UN1A 2V6MA 4OGWA 5FYDA 3E48A 4NDNE 1JAXA 1KY5A 1SC6A 3I83A 3H65A 4GX1A 4OOEA 1P45A 1PGQA 2B69A 1X7HA 2OBYA 1P9LA 3OEWA 2C0CA 5A9RA 3RFVA 4XCVA 4YJGB 2IZ1A 2E37A 2VQ3A 3DXFA 4EUFA 3KYCB 1EVIA 1CERA 1UAYA 5HS6A 3VVCA 1LTHR 1ML3A 2A35A 2PLAA 1UJMA 1ISJA 3A06A 4B7XA 5AXDA 2TMGA 3UW3A 3U49A 4YVFA 2O50A 2O3RA 5KVQA 3GPDG 4N5LA 1VL0A 1EE2A 2BFOA 1HTBA 4MVJI 1E5LA 3GDOA 3WBBA 4L73A 3DBRB 3V1UA 1WDKA 3HSKA 2NQTA 4R3NA 4BNJA 3KUXA 1QV6A 1WZEA 1CQJA 1P0CA 1ULSA 3R3JA 5LDGA 3D64A 3NDJA 2QRLA 4CM7A 1DIRA 5JYDA 4R9RA 5CEEA 3AUAA 2RCYA 2NVWA 5A5FA 1B26A 3ZDFA 4FFOA 4YT8A 1A72A 3L9WA 3RC2A 4TVBA 2B37A 4GLLA 3ZHYA 1C3VA 1XQ6A 4FS3A 4WEQA 4IS3A 1EUZA 1LX6A 3OMLA 1E1MA 1X0VA 1IUKA 1E1KA 1E3JA 4IDFA 4YTEA 1LA2A 3OJFA 2FRDA 1GYRA 3ROQA 1EFLA 4CL8A 3WWZA 3M1LA 1UR5A 1BVUA 5EESA 5G0TA 3VOSA 5AQ1A 2DUWA 2GPTA 3GT0A 2WD7B 3UVEA 4Z9FA 2EKLA 1Y6JA 5TF4A 1WMAA 4L8VA 1JLLA 2NSDA 4NBUA 4XYMA 4MVJE 3KHUA 3KEQA 3Q0EA 4R1SA 4UVGA 5B1YA 2CZCA 2WWRA 1VE9A 4M8SA 4AJEA 4N18A 3TN7A 4JBIA 5BSHA 2I67A 4RVUA 1GEEA 4YT4A 1I01A 5T8KC 4B3JA 2XPCA 1RM0A 3OEYA 2YY7A 3NRCA 4O59O 2O48X 5ADHA 3E03A 3OF2A 3U4HA 1NM5A 3ASVA 3CSDA 3HB4X 4XYGA 4UVHA 2WE7A 3EK2A 3GNTA 1PQPA 1U4OA 3O9ZA 4L76A 1Y9AA 4TSKA 5TQVA 2EEZA 2I99A 4UUPA 1NFRA 3R3SA 3MEQA 5A3VA 4EZBA 4W82A 5EN4A 2P91A 4S1VA 4BNTA 3QA9A 1LLCA 5L7YA 4WUVA 3DDNA 3H2SA 4CLEA 3ZV4A 4RPLA 3PRJA 3IJRA 4D42A 2JFFA 4JJGA 1C1DB 2Q46A 4U8GA 3WJAA 2AQKA 3QHAA 3L4BA 1PJ3A 4B3HA 2EGHA 3HNPA 4R69A 4Z3DA 2OUIA 4CM5A 4EITA 3TWOA 4RGBA 2NM0A 3BMNB 1XIVA 2F1KA 1EDZA 1EK5A 4ZQBA 2X8LA 4YBZA 3JQBC 3VZSA 1EVYA 2RIRA 4NMHA 4BIIA 3OHSX 5CDTA 3RC7A 4RCVA 5T6BA 1NWHA 5EQFA 3KBOA 5JE8A 3N58A 4LK3A 3A14A 2OBNA 1WW8A 3QJ5A 5CDSA 4GMGA 3S2FA 2C07A 4WKGA 3E9QA 4JP3A 4PRKA 4QO8A 3DL2A 4YEDA 4CMEA 3KETA 4OXNA 4FJ0A 3PYMA 4DGSA 4YYZA 5I7SA 2CSUA 3S8MA 4DLAA 4XB2A 4J1SA 1V3VA 3C24A 3ZWCA 4YJFA 2R2GA 4JGBA 1NVMB 1P1IA 2PKRA 3AK4A 4FOSA 2GN9A 1H9BA 3CH6A 2HMUA 4DBZA 2JD1A 2QIOA 2H6EA 2HO5A 1NAHA 1UP4A 4CQMD 1E92A 1GEGA 3SVTA 4IGFA 2NVUB 1VRWA 3Q3CA 3MOGA 1D3AA 2PR2A 1GV0A 5JC1A 4RVDA 3FHLA 3DC2A 4D7AA 2VUUA 5JAMA 3GR6A 4OSPA 1UXHA 2BH9A 1BRMA 4BMSA 4A26A 4J1QA 3G0OA 2PA3A 1YH3A 4OXYA 4A73A 4CL3A 1F06A 2BRUA 3V1TC 4DIBA 1PZHA 4K1LA 5IZCC 4ZQEA 4NNJA 4L4RA 1S6YA 4Q3CA 5GZ3A 4LRSB 1OC4A 5CFZA 4R1NA 1DIBA 1Y9EA 3CXRA 3JYNA 4E2ZA 4JLWA 2XOXA 3JD0A 4D43A 4TRJA 4FBGA 3ROMA 1C14A 2HDHA 2X9GA 3GEMA 1I0ZA 2VNAA 4ALIA 3FR7A 1EFKA 3W1VA 3PQDA 2IDZA 2P2SA 1UP7A 2AG8A 3AM4A 5JCXA 1A9ZA 3GGPA 3JD1A 3DAFA 2OORA 3BMOB 2ZB8A 1Z45A 3SJUA 3UAGA 3W6ZA 4HV4A 4CR8A 3ZU4A 1QLJA 1LQUA 3FWNA 4FQ8A 2JCYA 2Y1FA 2Q2WA 4WECA 3WICA 4UUNA 1ARZA 1FJHA 5JSFA 2JCXA 2JFHA 3DR3A 3SJ7A 3I9JA 3AY3A 1XDWA 1ISIA 4Z0TA 2VOEA 1NFQA 4CMHA 2P9EA 5BSEA 2NQ8A 4BGIA 3K6JA 3TZ6A 3H7AA 5EERA 2OGUA 4BNYA 1SOWA 4YAEA 1HLPA 1WPQA 9LDBA 3JQ6A 1UZNA 2C5EA 2R6JA 3WSVA 2ZJ1A 3PWKA 3K8ZA 3O26A 4BO7A 4R16A 2DLDA 4H3VA 3MTGA 3DQPA 1GUYA 3H5RA 1VI2A 1UXGA 4CQMA 3PP8A 3CEAA 3TL2A 2NTVA 1MXHA 2OP0A 3IP3A 4AJ1A 3WIEA 4AJOA 1IULA 4OAQA 2FPIA 2EV9A 3PHIA 4ALJA 4K26A 3RFTA 2O2SA 1CF2O 1Y7TA 1LDBA 4LCJA 1DC6A 2Z1MA 4XRGA 3JQFA 2ZYGA 4NJOA 5KTKA 1QG6A 2W98A 3P19A 3ADOA 3HB5X 3O8QA 1RYDA 3QLJA 5T67A 2X5JO 1XLTA 1VL8A 3G49A 2Y05A 3H9UA 1W73A 3PIDA 3R1IA 1XELA 4I5EA 4C7KA 2G17A 3HFGA 4F6CA 4D3SA 2NADA 5L4NA 3PWZA 4B4OA 1XU9A 3GDGA 4BNMA 5L9AA 2IYPA 4IDGA 4JCOA 2Y66A 1PJQA 4HWKA 3PYLA 3TRIA 3IOYA 4ID9A 1GYQA 3LC7O 2AE1A 5DT9A 3ETDA 4NK5A 3GG2A 3WLEA 3TZQA 3GUYA 4CMBA 2FOIA 2CFCA 1UUFA 4I1IA 2BGMA 4XA8A 4PFJA 4HP8A 3DBHB 4Z9XA 4FC7A 3HZZA 4GPD1 1D8AA 4BMVA 2GYYA 1CYDA 3BMNA 4D0RA 1PJBA 5IN5A 3DZIA 1B14A 4B7CA 1NPYA 1NVTA 1ADBA 4F6LA 3C1TA 2Y93A 1KS9A 3TZCA 1O89A 4JNKA 1C0KA 2W2KB 2ZCVA 2PKQP 2GO1A 1Z82A 1ZJZA 4R41A 1DJNA 2R00C 4QSMA 2WD8A 3X2FA 1HZJA 2J3JA 1DRUA 2NV6A 1AHHA 3GA0A 3RBXA 2W90A 3HDHA 3LDHA 1JKJA 3NDRA 1ZNQO 4EEZA 1KVSA 4AG3A 3ZHZA 4CV1A 3GNSA 3JQ9A 1XGKA 5DBIA 1NHWA 4PIVA 3HUDA 5JS6A 1LDNA 4OIMA 1TEHA 4CUKA 3DB2A 5A02A 1J49A 4ND4A 4BO3A 4NI5A 2BF7A 2NVUA 2B4RO 4FW8A 4GMFA 1VL6A 3E5RA 3P7MA 3V8BA 1NPDA 3GH3A 1B0AA 4DPLA 1I36A 3RU9A 4A03A 3JD4A 1T26A 3IQDB 4Z6KA 1EZ4A 2V6FA 4QXMA 1NNUA 2ILTA 1FDUA 3EY4A 3LF1A 4OOFA 4BNLA 3I1JA 1UZMA 1ZK4A 3RUFA 2CMDA 3K9QO 3VC7A 1E3WB 1HYEA 1CJCA 4J4BA 4J91A 2O3UA 5A9TA 4CLRA 1GR0A 3QWBA 2BLLA 4XB1A 1HLDA 3ZWWA 1SOVA 2QZZA 3AFNA 1SAYA 3OA2A 4IGEA 2OHXA 4PLWA 3UXYA 3E9NA 4BO2A 6ADHA 3PQFA 3JQ8A 3MWDB 3HDQA 3U62A 3IL2A 3PJEA 4PLPA 3ZHBA 1BXGB 1EVZA 3JQCA 2ZB4A 1G1AA 4AJJA 4K9DA 4PGFA 1LDEA 3PPIA 3R0IA 1XCBA 1HYHA 1HSOA 5HA5A 1K0UA 2DC1A 4JJFA 1HDZA 3ZWBA 4BO4A 1GZ4A 3IS3A 3I9LA 1BHSA 3BMOA 4I9NA 3FNEA 4XDYA 2C7GA 4TVOA 2PZKA 3GEGA 3EMKA 1YS4A 2Q49A 2PWZA 3ZV3A 3OP4A 2GD1O 3Q9NA 2PTGA 3RWBA 4UUMA 4BNHA 2Y0EA 3SXPA 3WXBA 3G17A 2E82A 4J4HA 5ITWA 2E48A 3L6EA 3DOJA 4OH1A 2FZWA 3LLSA 4DA9A 4WOJA 4BB5A 1HF3A 4ZGWA 4ALKA 4EI2A 1HEUA 3IJPA 1ZK0A 3RROA 4R1UA 5A1TA 1XKQA 1ZFNA 1WXDA 1FDVA 3L0DA 1TI7A 5ER9A 3RSHA 2PH3A 1F17A 1R4NA 5ES3A 5IFLA 1VLLA 5KWEA 3QVWA 3STHA 3VTFA 4RVFA 1YOVB 1O9BA 3GZNA 4IZHA 4XYEA 4XZ3A 3S55A 1RWBA 2B5VA 3GG9A 1QYXA 1H2HA 2PV7A 1EBFA 2GR9A 3QIVA 2X0RA 3DBLB 4BGVA 1P31A 1R0LA 4CR6A 3I9KA 2GF2A 4E5MA 1SB9A 3NEPX 3RUAA 2HUNA 2ZQYA 3RUEA 3ZHXA 3UF0A 4E5YA 3L07A 3NTOA 1OOEA 1F8GA 3UOGA 1XHLA 3G3EA 3D4PA 2GN8A 4BNVA 4INAA 4TQGA 3G1TA 2IODA 5IG2A 3ZZNA 3FSRA 1HYGA 3MWEB 5ITVA 4MJLA 3QSGA 4P8RA 4WASA 4NFHA 3CZMA 1XYGA 2BFMA 2P4HX 2TMDA 3UICA 5ILGA 4Z3KA 5ICMA 1I3KA 3I9MA 1DO8A 4KOAA 5FEUA 1EUDA 3MJSA 3DMTC 4DQXA 5BQFA 3SBOA 3WBFA 1YKFA 3NKLA 3WFIA 2CDAA 2DVMA 2O4CA 5FFFA 2VHYA 3JCZA 1TXGA 3VPFA 3TFOA 4NFYA 1U8FO 5FI3A 4ZVVA 2Q99A 1GZ3A 4R68A 2H5LA 4IQGA 1T2FA 1DIAA 1NAIA 4Q3NA 5B37A 1GPJA 2QRJA 3D4NA 2HAEA 2I3GA 4GKBA 4P4LA 1LBEA 3Q11A 4RZIA 5HBRA 3CZRA 5DBGA 3WNQA 2PD3A 2EF1A 2DAPA 3NTQA 2Y1OA 1W4ZA 3FNGA 1X13A 4GAEA 2W2KA 4U0JA 1JKIA 5LDHA 3ZI0A 5LC1A 5BNTA 5TGDA 2A9FA 2VRBA 3IDSA 3PHHA 1LC3A 4XYLA 4R3WA 3QWAA 1QLHA 5FI5A 1MUUA 1KERA 2I3AA 3F9IA 3OETA 4Q3EA 1NTOA 1YO6A 1X0XA 1B7GO 4D46A 3WGIA 2JD2A 4B79A 5JO0A 4RPJA 1P33A 3DOOA 3GPIA 3W4IA 2ZKLA 2GZ1A 3WLFA 2Z5LA 4G81A 1H6CA 1P74A 2AQ8A 2QW8A 2C2YA 2NNLD 2I65A 5G4KB 1D1TA 4KUEA 1DPGA 3Q1LA 1GFSA 3ZH2A 3F4BA 2WE8A 1UDBA 3T7CA 4I08A 4WNCA 3HWRA 1GD1O 1F12A 5JC8A 5EL0A 5L4SA 1YGYA 4TRNA 1GPDG 2VT2A 3RQSA 4IIUA 1E3WA 3OICA 1E7WA 4CPDA 5IJZA 1AE1A 1NWCA 1FDSA 1WVGA 3C7DB 1HDGO 4PCVA 4XEHA 2ZQZA 3RUHA 4KZPA 3GVIA 1ADGA 1E77A 4HFRA 4LISA 4LRTB 4YRAA 1ZW1A 2O3JA 1OFGA 5I9NA 2BGLA 3DOCA 1SO8A 3AOEC 4NJMB 2IXBA 3WGOA 1W6UA 4M54A 2YQ5A 4RV9A 4CM3A 4XR4A 2Q2QA 3JQGB 4NPCA 5FWNA 4KUHA 4RVHA 4BNGA 4YQYA 1DDOA 1BW9B 1SCUA 4CMIB 1SPXA 4O6VA 3WQQA 1A5ZA 2FR0A 3D4OA 1DC4A 5JDCC 1WAMA 4J0FA 1SEPA 2Z95A 4DXHA 3GUCA 2CVOA 3K30A 1JDJA 1KBZA 1P77A 3JQ7B 4ZD6A 1TT5A 2HCTA 2O2YA 3AWDA 1ULUA 3OECA 4G2NA 2X9VA 3OIDA 1Y5RA 2YFQA 2YYYA 4NHEA 1DFGA 2PNFA 3HDJA 3KEOA 3VKUA 3AUUA 1N9GA 5CHEA 5KVVA 1IL0A 3GN1A 4PLYA 1X15A 5AYVA 3INGA 2WYUA 4U6QA 4RF3A 4J6FA 4ZQHA 4F46A 3DZKA 7MDHA 4RORA 4CM8B 3E8XA 3OQ1A 3H6KA 5DOVA 1PX0A 1M75A 3M1AA 5C3MA 3VZPA 4BQRA 3RJ5A 1PJ4A 3QE3A 3UH1A 3ROKA 1ENOA 3KYBA 4CV2A 4ZQFA 4NBTA 5F3RA 2POQX 5G0VA 3DO5A
chains in the Genus database with same CATH superfamily
4LZLA 2J5RA 2G9UA 1WDLA 3DE7X 3GBPA 4Q9NA 5A2GA 5EJ5A 5J2UA 4KP7A 1DBPA 1DRVA 1KFEB 2FY8A 1WVIA 2X0EA 1QFZA 3P2EA 4F1JA 5EJ6A 1K5PA 2VUTA 2JK0A 1QH8A 4IBOA 4JLPA 4UTOA 4I3HA 1H2YA 3W7AA 5I7VA 5L3QA 4XSGA 3S27A 2NP7A 3B3QA 1BTOA 5K6AC 1T1RA 3BMQA 1IN6A 1MX1A 1SHZA 2ZE6A 3H97A 3ISVA 2VDJA 3HEBA 1N5DA 4LBWA 2OQVA 4OYRA 2HY7A 2DBQA 3ME5A 1NW9B 1IZ9A 2HA4A 3JR7A 3IR7A 1CEXA 3ELWA 3B2NA 4L6AA 4QUEA 5H3HA 2JZOA 2QSYA 5I8WA 3O7WA 5AM1A 5DI3B 5JDIC 4YRMA 3H6HA 1W5FA 5KCZA 1ONSA 4RZHA 3WP0A 1YB5A 5HIMA 1OLXA 3O82A 1DTWA 1NIPA 1LRLA 3JZMA 1T0BA 3SJAA 4RQTA 1FTWA 4Q34A 2AE2A 2GBPA 2IX9A 4O3FA 5HF6A 4HH0A 4UEKA 4OBEA 1P2UA 4URFA 1THMA 1ZOOA 3R20A 5LXTB 1I94B 2MR5A 2R6AA 4M8NE 3IKJA 4BKMA 3ZNQA 1XF1A 1HE3A 2OXTA 5E7MA 2FW9A 1M1YE 4MVJG 2VHTA 3HJGA 4MRNA 4L7VA 3RJ9A 2I91A 1MA3A 1S7GA 4WZBB 9MHTA 2QGZA 3HJNA 3LOQA 4Y6QA 3C6XA 1YL7A 3G7SA 2Q7XA 1XR3A 1G0OA 1ULTA 5G3ZA 1DARA 2FR8A 2V4ZA 3M4YA 2ZIAA 4LC9A 1V5GA 4Q1AA 4AJHA 4KR2A 2PX0A 2Z5VA 4QPNA 4BLQA 3B60A 1L8XA 3FUTA 5IVPA 1PR6A 3O38A 2BIFA 2FPPB 3AR6A 5JANA 2B99A 5JY6A 5KTOA 2QV0A 2UUPA 2GPAA 3FA2A 4O1IA 1Z62A 2FV8A 2HNAA 3PUVA 1LKZA 3RREA 3CSUA 4E08A 4J0CA 2V7QD 2Y1GA 4OP3A 5AUPB 1KOGA 1CC1S 3CJTA 3CRVA 3GWGA 3H16A 1X94A 1I5RA 3D7MA 1E7SA 4LMRA 1P29A 3A0UA 1HLGA 1WB4A 3PZRA 1U6IA 3D1JA 1DHRA 1Z17A 3SQLA 3V1NA 1IC6A 5EXPA 1EP3B 1OLUB 3WDLA 1Z4JA 1GRQA 2WTBA 1HA3A 3AHCA 4KVAA 4XJXA 4I2NA 3K31A 4Y98A 5TQ2B 4CJXA 4O1HA 4HH4A 1YIOA 2OA0A 1RU3A 2I6SA 1CLEA 1Y81A 1Q1EA 2ZBQA 1UPUA 3DWEX 1OZHA 2JEOA 1YJCA 2RI6A 1IY8A 3Q9UA 4JX8A 3LGSA 3L05A 4L74A 4R2MA 1DIHA 3ND6A 2BMAA 3V2GA 1PCXA 3C8DA 4DLKA 3NG1A 1GZVA 1X8LA 3BTUA 4GT1A 5FF9A 2W4QA 3DW3X 2Z3ZA 3W4KA 1L5YA 3P9SA 5AOCA 2CDNA 3ILXA 4NAHA 4R1MA 1EVQA 1ULBA 5ALXA 5AOAA 3BE4A 4LYFA 3VSDA 2QPLA 4H4DA 1Y3FE 5BQPA 3S1AB 1GLGA 4TRRA 4OI2A 1HE4A 5I4BA 1CQIA 4YV1A 1XG5A 1M2EA 2C82A 2X9LA 5BT9A 2LRHA 1DKMA 3I6IA 4BNDA 4F86A 1QZ3A 5DZSA 5JLJA 2IK8A 2WLSA 2FZ4A 3PFWO 1X7GA 4U02A 5BQXA 1KJIA 3TZHA 2C5BA 1E96A 2A78A 4YPFA 2RHJA 5JUWA 2E1RA 4M6WA 5JJLA 1XMSA 4FMDF 1P61B 1NE2A 2A84A 1Z9BA 3WSWA 1FNBA 4F3TA 2VCEA 2QR5A 2QL7A 5ALQA 4U63A 1JG6A 1LF5A 2DE0X 1N2CB 3QU2A 5EA2A 1GWNA 1VL5A 1EFCA 3QUQA 3K1AA 5DX0A 3LUFA 3WKAA 3INTA 3JQGA 1V5WA 5H0IA 2A0UA 1G5PA 2EDAA 3IE0A 4R0NA 1DOZA 4XQEA 1CR0A 4B45A 2OR3A 3JYLA 5IARA 3F6RA 3KRTA 1IBSA 2WC1A 2X1MA 2KWIA 4Y1EA 5DRTA 5H4HA 5KJEA 1NE7A 4HAVA 5FOSA 5EE9A 3A6LA 3VR5D 3WQHA 4DG8A 2X2EA 3T1YB 3MFQA 5CLGA 1UDWA 2J3KA 4RD0A 4F6RA 4YHBA 5JTTA 4CEHB 4B2YA 4S1WA 4K3VA 4Z0HO 2JJ2A 1UXKA 3KB8A 3KQYA 2Q1TA 4HNTA 2FMXA 2QPAA 1EK2A 5U1PA 1EFPA 1JNYA 5J5VA 4FSHA 1F20A 3F78A 4JOBA 3WNDA 2FK8A 3C7KA 3KJZA 3KCNA 3RJTA 4QTYA 5DEIA 1JDTA 2O05A 2WKRA 1ZJ6A 3P0JA 4RLHA 1OFTA 4WKNA 5KYVA 2YIVX 2QM7A 3FZQA 4LBVA 2VUSA 3WNCA 3H1BA 3BXEA 1JX6A 2ACEA 1RCTE 4QDXA 2IWHA 1DUIA 4CT4B 2F00A 3K0KA 4PFSA 4YB8A 3S7TA 2ZATA 1C50A 4NHOA 2VJYA 2ZTMA 3GEBA 4ZEWA 2JKZA 3GMDA 4B80A 1K7SN 1C9DB 3FUXA 1UKAA 3GNLA 3I37X 1MHTA 2JVJA 2HBQA 1UC5B 3EPJA 1ULHA 3LHSA 3BGDA 3FFWA 4D9JA 2XYPA 5K0CA 4XFDA 1ZPDA 2KSQA 1F5SA 1K7EB 1QK3A 4W4TA 4M1QA 5EPEA 3IBTA 3SIXA 3V3KA 4XWKA 4H60A 1NVEA 1TW3A 4EX6A 4GL4A 4BATA 2DPMA 1UKYA 2E85A 2HCRA 4G0YA 4C1NA 3P9XA 4WFIA 5AW3A 5IWAB 1ENZA 4M83A 2MSNA 2OBBA 2CBXA 4CUZA 1IK4A 1X3LA 4OLBA 5ALOA 1N5IA 1NM5C 1ZOPA 3FVTA 4PTZA 2IGTA 2JFYA 4DSNA 5LBIA 1BYUA 3SQXA 4CN9A 5JXJA 1PBTA 3M1YA 4Z9YA 5GV8A 4NBVA 2EGGA 5ESWA 2HPVA 1J8MF 1GPYA 4XI9A 2XTZA 4NBWA 3WR5A 2CWDA 1R5NA 5EJ2A 5GY7A 4G2TA 3ITEA 1DXYA 3N2IA 4C0LA 4DFDA 5M2QA 5FWYB 4WI1A 4U4AA 1ZGGA 3BWMA 3T4XA 2VP9A 4RA6A 2CXRA 4M7WA 3R9KA 4WPGA 1UZLA 3L4EA 1HXHA 1XZQA 3MMSA 1F4LA 4BFWA 3HH8A 4L0QA 4LYHA 3T54A 3CVWA 4BNIA 4EF6A 2NZ2A 4JQOA 1C7JA 4JBHA 4TV9A 4DMHA 1WKVA 4YXWA 2VL7A 2XF8A 4AULA 2HA6A 1AK2A 4O2BB 1M6NA 3MN1A 1EWQA 2J4FA 3GARA 2YR0A 3ZPXA 1TX4B 2WFAA 3H2IA 5PGMA 5K3DA 2CHUA 2Q0HA 1QF6A 2ZUWA 3BCRA 4MWOA 5A05A 2BHSA 4X1YB 3EIFA 2NTYC 1WU7A 4HEA6 3ZGXA 4R5HA 5AKIA 1G66A 1VPLA 3OO1A 3ELUA 2ZSBA 3LC1O 4Y3UA 5EJAA 3N8DA 2YFKA 4D8WA 1KJ8A 3HE3A 4HRVA 4YRKA 2KLBA 2VTKA 3HKDB 2WT4A 3DKKA 1FRQA 3H8VA 3EAGA 3WOHA 1NJGA 1ADFA 3ZK8A 4MVJD 1YVEI 1YWGO 1DEHA 1KNXA 1VIDA 2IPAB 3E27A 5EYPB 1NVVQ 1IZ0A 3WLSA 4YAGA 4ZZ0A 1CKEA 2MTBA 3PD7A 1BDJA 4EYOA 3L04A 3NHAA 4RUKA 3M9LA 4Y2VA 4B43A 5INTA 2VT3A 2G82A 4YIKA 3WGHA 4JNCA 3TLJA 1Y42X 3AVOA 1T36A 1MB0A 1R6AA 2HF7A 3ROPA 3JX9A 2PQ2A 4IKPA 4B4VA 2BFPA 4LJ4A 4JJ8A 1ICIA 4O0MA 1AKQA 1ECFA 2OV1A 2PMCA 3D2LA 3LT1A 3SICE 4KIGA 3OP1A 5E4FA 5TQ0B 2HSGA 1YZQA 3BK1A 3EF0A 1Z39A 3CRMA 3RFUA 4DXAA 4PYJA 1WU8A 3REQB 1NQWA 4C9BA 1JHXA 1WXEA 1QO9A 4PQFA 2V3WA 4AF8A 5LKAA 4LZJA 1M72A 4D9KA 4HGOA 4DDTA 2VHZA 3HUFA 1K7YA 1V2HE 2WYIA 3NKFA 4RU1A 5JNVA 3T0FA 5MN5A 1VMEA 4EG1A 5K3AA 4B8ZA 3SXJA 3QOFA 2XITA 2GARA 3E9DA 2D00A 2JAUA 1Q84A 1Z6AA 1ZH8A 3HFSA 1SXJB 1SUIA 2D2IA 2BRUC 4G6ZA 2OKCA 3HL4A 3AG6A 2YUTA 1X7XA 1YZGA 4FGLA 4YACA 2MYUA 3AF3A 3EFHA 4L2IB 1LI5A 3HHEA 5DLYA 1P75A 5DTEA 4BVHA 5JRZA 3I05A 1G21B 1L6RA 3L06A 2IYAA 4QVGA 5AHKA 1OX4A 3GRCA 4N6OA 3M3DA 2F17A 4PHGA 5AKLA 5EZYB 3QXJA 5F4BA 4YO8A 4F92B 3FYUC 3EGCA 4YWJA 1JQAA 2ZUVA 1PQUA 4BXOB 4RKFA 3QF7A 2BKXA 3SGLA 2D3WA 1NDUA 4LI3X 2IXTA 3Q87B 3ACBA 1JHUA 3GCWA 3EAFA 3TD9A 4FZ5A 1Y7LA 3M4JA 5HOQA 4JQCA 2RG1A 5E1DA 1L5HA 3TMAA 3H6GA 2UKDA 3CRNA 2BDTA 5JCJA 1HC7A 1X19A 2B4YA 3SHQA 2O3QA 1T13A 3AHFA 3HG7A 4LMPA 4ENUA 4K0KB 3EE6A 1Q16A 3P1JA 3VR2D 3WJ7A 4WY8A 3WGJA 1QGAA 1NOJA 3CX4A 2NU8B 1PQ4A 4B6EA 1XYVA 2O7VA 3MINA 3SHVA 4IIEA 1BH2A 3NTUA 2OGSA 3A4TA 3NGMA 1Y8CA 2XWQA 4GO1A 3LFTA 3PF9A 1OXXK 2J3EA 3EF3A 3QE4A 1QANA 4XJSA 4CQLB 4ZMRA 3KK0A 3M82A 3IOBA 3P4XA 2B34A 4JYBA 3KHSA 3ZLJA 4H0CA 2VPQA 1Q0PA 3L1VA 1I7SB 4E4YA 1WW3A 2IYNA 2XQVA 3EIWA 2V5UA 1CVIA 1U8ZA 3CONA 3HCRA 3N7AA 1YR6A 2EZTA 3CF6R 4Y6RA 4OHPA 1A9YA 1YRYE 3IEPA 2OV8A 1B2LA 3LUGA 2W71A 1TEXA 3BE8A 3D8SA 3E9ZA 3OUZA 4PGMA 2DX7A 4Z1MD 3QP9A 3EW7A 1ATZA 2W0SA 3EGVA 1S2GA 4Q1EA 3N2NA 4F8YA 1RXCA 3EYWA 3ZV5A 5FTMA 2H06A 4AWAA 5KKCA 1GAQA 2D0IA 3PYXA 4FFNA 4BJ1A 5C32A 2YYSA 3UY4A 2M2IA 1E1QA 1QCZA 1Y8RB 2Q50A 3FSEA 4GYJA 2OYSA 4H7PA 4PQYA 4MR7B 3BE5A 3HZOA 5JXIA 5SYAA 1AF4A 5AW9A 3VR1A 1VG9B 4BZPA 3O2QB 4ZKDA 2AOTB 2AA3A 5DEOA 5JJIA 1OMOA 3AR3A 1H2BA 1RWPA 4HBGA 4IIJB 4Q3AA 5KVSA 4OMCA 4EFMA 4C5AA 2CFSA 1E20A 5HUQA 5JNSA 1DJLA 3JSAA 1IB6A 2VDOB 1MABB 4FFPA 1K9SA 5DIZA 1CJTC 3PR3A 4DA6A 1K6MA 3ZZ0A 2RK6A 1YZLA 1BDBA 3DE4X 1UC4B 3FG9A 3RC9A 3UPTA 2P1RA 1SXGA 1AXGA 1MJGM 1T2CA 1E5QA 3AW8A 3NIFB 4RC9A 3DTYA 4HFNA 5LSAA 1S2IA 1U0SY 1ZNWA 2G63A 3FHTA 3C3JA 4EG4A 1LW6E 1F4PA 2P5YA 3REGA 4DJTA 4HAOA 1SXJD 2VI5A 1Z6XA 4WOPA 4IJKA 4LYEA 4A5OA 3L7LA 4UPVA 3SZ3A 4EHLA 2PUJA 3KWMA 3PQ3A 2ATVA 4UOZA 3G2KA 1V3UA 4Z3OA 2CFRA 3IP1A 3T7RA 1MJHA 3VAYA 1EQ2A 3H5OA 5IXSA 2Z5GA 3RIHA 3EQ9A 4AMBA 3SFVA 1GTMA 1N7HA 2SECE 4ILKA 1G8YA 4QPDA 4RK7A 3UC9A 4AO7A 4BWFB 5BSWA 2X4GA 1JR6A 2VHQA 3HRHA 4JX9A 2FG7C 3HBJA 3IESA 3QW2A 3ULKA 3MRVA 1XWIA 2A9PA 1S2MA 2GAFA 2VJPA 2YDYA 3W8FA 2TECE 1QGZA 1EM8A 2ZBRA 3GJ0A 2WWHA 3DEFA 3PWTA 1MC4A 4WNIA 1UMDA 4KAXA 5IUNC 2OV6A 2ABWA 3U81A 3HADA 2A0YA 2H08A 3DFUA 1N3LA 3JD2A 5FBZA 5E38A 4HN2A 4Q1FA 1OLOA 2DH6A 2R85A 4RANA 3AJ9A 3CS3A 2W48A 4I55F 1P2SA 1RACA 2ODQA 2L19A 4RELA 5K7SA 1ZUIA 5KMGA 2ARKA 3NUGA 2Z58A 4AICA 4BV8A 1PKXA 3B5EA 1N1DA 1JJAA 3UHJA 5B2ZA 2HPHA 3IBSA 1NVWQ 1GGVA 1CQJB 1Y9DA 4ZDIA 5CH5A 3JQQA 4E30A 4KQ1A 3ZWDA 5BPHA 1YDEA 2YHIA 2WIGA 2EFJA 3I9OA 2KYRA 5NULA 5A5EA 2W6JA 3VSBA 3LUDA 4JUIA 5D6OA 5EZYF 1SC4A 2AEEA 4REQA 1PL6A 2COUA 3QVUA 1WM1A 5F1OA 1NR7A 3WGYA 3RVJA 3WGKA 4CKZA 4G65A 5C31A 4CDNA 3JQ9C 4WESA 3TDKA 1U2GA 2RGYA 2HU5A 4N8DA 2PT7A 3AXSA 4DKJA 1XPJA 3UHAA 3MS7A 1UOOA 1YE3A 3R9WA 2D4AA 1CW2B 3SSOA 1J1UA 2H0RA 3H9EO 4LXGA 5JI3E 5E3HA 4LY9A 1K3UB 1KRXA 3KO8A 2UYGA 5AIAA 3D3NA 3QTBA 3P9KA 2NYVA 1JHOA 4R8VA 1E2DA 2EHDA 4G89A 4XD7D 4UU1A 3S1LA 2FLWA 1QIGA 4YGXB 1QIFA 2GUGA 3MBIA 1SRRA 1U8YA 3X1DA 1Z0SA 2NOAA 1FP4B 3RVPA 1IUPA 5JHHB 1XQ9A 1Y9ZA 1GQ2A 1MVLA 1AGXA 2ZJ2A 2FMHA 4KYVA 1ZVKA 4R6XA 2GB4A 4G01B 3F90A 5E1OA 5FV7A 3RVQA 1QUFA 4B34A 4D9IA 4TOIA 5KYNA 4BQPA 2YV3A 4MVJM 1C7ZA 5TPZD 2R65A 2CE7A 4MQ5A 1TYBE 2FLVA 2F55A 1B8PA 1FUYB 2ZZNA 3OIUA 4LXXA 1RKBA 1H2EA 5DT2A 4B85A 1RABA 1SIUA 2Q5HA 2DH5A 4TLDA 1R37A 2FE4A 3IHKA 3O0TA 1QNFA 1T4CB 4Y2HA 4E2YA 1LK5A 3VH2A 1CUWA 1N77A 2CLFB 4Y1RB 4HDRB 4ECEA 4R1OA 1C9JA 5LB4A 3T3PB 3FCYA 4NPAA 1MAHA 4IIJF 2DBVO 4AZSA 1PWXA 2O7SA 4XLTA 5CXQA 2O23A 3NAZA 3DAGA 1RFGE 3TQQA 4RV4A 3AZQA 3Q2KA 2FMTA 2R66A 2AR9A 2BFBB 1SELA 2HDWA 1H2ZA 2JFGA 3LBFA 3TI7A 3LXXA 3TQHA 4YECA 2CNLA 3PXDA 5DYTA 1LZKA 1EPUA 1Y1KE 1AO3A 1C7EA 1SBIA 3MERA 4M0PA 5BQ3A 5KJFA 1Y80A 3B2QA 4WBSA 1GU7A 4DQUA 1TYAE 2WSLA 2EFYA 3OE4A 4X8MA 3L1UA 2EP5A 3U3RA 2E4XA 1MFPA 2ZR7A 3DQQA 2J85A 2M6RA 2ZITA 3BC1A 4QG7A 2Y3IA 3P52A 3VBEA 4EJSC 3BHMA 4HNGA 3ANTA 2DUMA 5C81A 2ZT7A 5KDOA 1CX9B 5M7EA 5DTQA 5F2KA 4F60A 3KSMA 4JI8B 3HY6A 2IPXA 2CMKA 3OJEA 4UHBA 5H02A 1YMUA 4TZKA 3KB2A 3TZKA 2PT9A 1DRWA 3JU3A 5T8KA 4ED9A 4I4TB 3MWLA 3QYPA 3BK2A 4UQLA 3GRFA 4POAA 2Q2VA 4EPVA 3OD5A 3RTDA 8ADHA 3EC2A 3TFQA 5ALZA 1I3CA 2OB2A 3D6UA 4NBRA 1VIMA 2VK8A 1PJLA 4A8PA 4O4HA 3OT5A 3R75A 2C7OA 4FLMA 5AXCA 3U5ZB 2EKBA 3URMA 2ZYWX 3IHTA 4HDOB 2BBOA 1GY8A 2VCHA 3HJTA 4IWYA 2W2LA 2VYVD 2VDLB 4P83A 4DUZB 3EMVA 4UE6A 5A5DA 1Z0DA 3LLUA 3TLMA 3FPCA 1Q95A 3KEMA 8OHMA 5F7XA 2ZJ5A 4POOA 5H8WA 2QUIA 3RSSA 1PGOA 2H3EA 2HW8A 2I2BA 4MEBA 5K1ZA 4TKZA 4EUNA 5DM4A 5IMBA 1EH5A 1ZH0A 2I3ZA 5K0NA 5JJCA 5AI5A 3R4CA 4NDAA 1JJBA 4Q39A 3UK0A 5K99A 3FPHA 5CIWA 5ED4A 5EJ9A 5FYQA 3VHXA 2J7PA 4GKVA 5AXBA 3FVRA 1PEYA 4FILA 1WZUA 3IOEA 1DIGA 4F3YA 1CSEE 2RBGA 1AU9A 2AYYA 1TAHA 1QAQA 2AMLA 2QSUA 2VP5A 3DL7A 3CG0A 1UDCA 3IV9A 4WY2A 5A9SA 2PGOA 1PS9A 4N54A 3B78A 4XWTA 2BAGA 4MO2A 1E6UA 1KEUA 3VV3A 2XUZA 1FDTA 4AC9A 1I10A 4MP6A 4X5OA 3HYCA 3EQ7A 3QHQA 1L2TA 2IP4A 2MJLA 2GASA 4NJEB 2GZRA 1D1PA 2AFIB 3NW9A 1L3BA 4CKBA 3A6GA 3OZBA 4GOLD 1LDMA 3FOCA 3FZGA 3SNHA 2DUJA 3TXYA 1F3LA 4PG4A 2AUMA 2QHXA 3T9BA 4EGQA 4R2XA 4WXPA 3P2OA 2XXBA 4AJPA 2J41A 4KMRA 4M3NA 4MI3A 3EVAA 4KXYA 3OTQA 1L3IA 2V45A 3ZEAA 2YRXA 4EENA 2X8WA 2Q6TA 4DV4B 5REQA 3I04M 4M21A 1Q92A 4I9GA 3AI2A 4ZZIA 3ER6A 3U7IA 2DU8A 4AZTA 3NJ4A 3VSCA 3Q0TA 2WY2D 3SYRA 3K70D 3F73A 4CU5A 2F8LA 4YAJA 2ZBFA 5JCPA 2QLJA 1VSQA 8LDHA 2PV0A 3ICWA 4MLZA 4NH0A 2XQFA 1S01A 5HKKA 4JBXA 4MYHA 3AW9A 4XIJA 1VI6A 2UUBB 2H4WA 1Z15A 3K09A 4HKTA 3VZRA 3K71B 4XM0A 1ZAYA 1F2TB 3DH0A 4TSFD 3SF8B 3A26A 4UFOA 4A6EA 2OSVA 1HT3A 5EMHA 1RYMA 1IVSA 1WJGA 4OTZA 1MDFA 4BQIA 1AKTA 3QU7A 1T1JA 4KN8A 4PGGA 4MUIA 4WH0A 1G6KA 4J7AA 1K06A 1RQNA 3AETB 4NSNA 6CHYA 4RPHA 3S2UA 1NKSA 5BWBA 3VO9A 2DSNA 4QXQA 3RSFA 1LWNA 1YJQA 2G83A 3MSCA 1H05A 3RYFA 1EK0A 1K8XB 1RNLA 2CHQA 3DE3X 3EUWA 1D09A 1G20E 1VYUA 3O90A 2IOFK 2ZPAA 1Q15A 4FWIB 2RHRA 4CM4A 2GQ0A 4RA9A 1JEQA 2PZEA 3VYSB 2ZUEA 3B20A 1AS0A 1U2EA 3N6RA 4KODA 5DXAA 3T5MA 3CRRA 1CZHA 3T6KA 3LWZA 2J33A 3EZ6A 4KU4A 4OFZA 4CF4A 1D7AA 3NHWA 2AN3A 5AW8A 1CETA 4BNNA 3PGKA 2C2GA 4ZT5A 5A3RA 1WULS 2IHUA 3RSLA 1XF9A 3TQRA 4D57A 4EAAA 3LH5A 2H85A 3B82A 2ODWA 3FPKA 4B7AA 4DKXA 1N0UA 4HGYA 4N12A 4NQZA 2WHEA 1Q1AA 1WPRA 1PS0A 4M2LA 3T8YA 5BN3B 1QFYA 4K9LA 2ZR0A 5EVJA 1NT2A 2NP6A 2D3TA 3WTCA 1JZQA 2GHRA 1SVSA 5H83A 1JT2A 2L18A 2XKAA 1G5HA 4RIIA 4AY5A 1UBRS 2XB6A 3TIIA 3ZY6A 2LTAA 4EF4A 2WSSA 3ZWQA 3N2ZB 3CUSA 1DAIA 2Y1CA 1SG6A 4HRXA 1VBFA 4LZAA 1DB3A 3TL3A 4ZJYA 3FD8A 5EINA 4IWXA 1DFHA 2BT4A 1XEXB 5K8IA 4JLMA 5K20A 4GLOA 4F1KA 1ZISA 3UJNA 1JA9A 2G8LA 2Z98A 3MPUA 1C3OB 4IDOA 1P9RA 3OFJA 2OVBA 4D9FA 1O0BA 2WFMA 3VDRA 3NIDB 1C0LA 3DZHA 5GIOE 4ETMA 2G1KA 3SYMA 3IP7A 4LCEA 3VJKA 1YZNA 4JBGA 1EVJA 3UUWA 2VUIB 2ZK7A 2WMDA 3VJMA 3U09A 4L16A 1G5FA 1GUZA 4XTRA 1JR3E 3DT8A 1C7IA 1D4FA 3K3PA 5JAZA 2Q1SA 3K1YA 3IXQA 4J8PA 1PV4A 3RIGA 3DJYA 4DCCA 2VATA 3MS4A 2FVXA 4DDVA 4HGPA 5DIFA 4BLWA 4PZ9A 4RQBA 3W5BA 2BZSA 2XLCA 1XHEA 2B9EA 4S1NA 4A8JB 4X54A 1I4EB 5BYJA 2C2MA 1JHYA 2LKCA 1CHNA 3IB6A 1L4LA 4FT2A 2NZYA 4L5CA 4QM6A 1JDUA 1QV7A 4QASA 2Z56A 4P1ZA 1DSSG 4I3FA 1GFWA 4QL3A 1R0RE 1TUBA 3A3NA 1J20A 3CX7A 1YB4A 3BWCA 2PLNA 4F3CA 1H94A 4DRZA 3JQAD 3A1VA 1KE2A 4FZRA 3JQEA 3PJGA 2WDZA 1W30A 4REOA 3SX4A 5G1NA 2RONA 4RS3A 2J5KA 1J8VA 3EHEA 3F3MA 2VN8A 4MR8B 1BCSA 1GZDA 1YAHA 1KZ1A 2JHPA 3ZVRA 1UBKS 2H92A 1LEHA 2BKLA 1IFXA 2XCQA 3TL6A 2XGJA 1OHHD 1QM5A 1N7GA 4DSTA 2AFHB 3KTAA 5ALTA 3HI6A 1VTKA 3E0XA 2SCUA 4IMPA 5BW8A 1EP1B 1UKEA 2B8WA 1PT7A 2PNJA 3DONA 4LDZA 4C4TA 4D5GA 4EG5A 1R4MB 1W96A 3QUTA 4QUBA 2PHZA 5HW0A 5F9FA 2GO7A 4OXKA 2DFVA 4MA0A 1PT5A 3DPIA 2EF0A 1Y3BE 1N5RA 2EIHA 2YDXA 4RSGA 4ND3A 2GTPA 2G28A 1LLUA 2CE2X 3JWGA 4G63A 2M6SA 1AGYA 1ZJJA 4OCZA 2I22A 3A6JA 3ZIAD 2JD0A 2QUHA 2CF6A 1B6GA 2O54A 1YQEA 2VAWA 3THXB 2OYCA 1J5EB 3RYCB 3AFGA 4RGYA 1HDEA 3LHIA 2VPYA 1JHVA 3K6SB 2XVZA 1B8UA 2ZSJA 2Q8NA 4C0AC 3NPMA 4KIFA 2HK8A 3Q6NA 3T7EA 3DXYA 3JYPA 4IZOA 3I0ZA 4JK3A 5D85A 5KU1A 2BM1A 1KVTA 3ZTYA 4BYMA 4ZVMA 3JWHA 1L5RA 1UOQA 1J22A 2WUWE 3L0PA 1O6FA 2NW6A 4M0KA 4TPKA 4F9GA 3ROFA 3Q7IA 1SVUA 1JW9B 1RYZA 2LE0A 3I09A 1FIUA 3K72B 2AMFA 4CTJA 1J2YA 4MEAA 4H4EA 4DG5A 3N0XA 3LUPA 3PFBA 1MX3A 2CJPA 5FPQA 1DUVG 2FDXA 2JJ1D 2W8BA 1U11A 2IOHA 3H9CA 4ASUD 1R66A 3C6ZA 1W2WB 2OMEA 1RZUA 1WUYA 1NBAA 3IMGA 3JTEA 2J7KA 2VYNA 4OXXA 2WM2A 5BSTA 3ZY3A 2XX3A 4DVJA 2C3MA 1QOZA 2VRWA 3BGIA 3ILVA 4QHYA 4UVIA 1USWA 3PQ7A 1AHNA 4QYMA 3EVDA 5K0BA 1UCFA 1YZHA 3C8ZA 5FOWA 2FDCA 2IIPA 1TAUA 1NF8A 1FMCA 4KQ2A 4F5EA 1MB4A 2WKPA 3DAOA 4OPMA 2NSHA 4BO6A 3KTDA 3LA8A 3D43A 3RSQA 4HLCA 3SEFA 4ACBA 1PG5A 4JLAA 5CVUA 3O8OA 3FFAA 1VJ5A 2FWIA 5ECGC 4HVAA 1CR6A 3GYGA 5AT1A 1ZM3A 4K6FA 2G77B 2Z08A 3PFCA 4ODIA 4UEWA 5IPFA 3H3FA 2FWMX 3VSEA 4ND1A 3GRZA 4F1WA 4IIYA 2DOKA 2M98A 3MWGA 4ZV9A 3U3KA 4BL5A 3QGMA 5DI3A 3BERA 3MELA 3D3EA 5ALUA 2REOA 3R0QA 4K3UA 1IWPB 3NXSA 3OOEA 5C7IO 1E9RA 3GT4A 3COSA 2JGLA 3LZ6A 3OSZA 3VU1A 2DF8A 3MQ4A 2ZI5A 3HFRA 3TLGB 2V0GA 4UD6A 2QKYA 4JC5A 1BS1A 1JHZA 4L08A 1AQ6A 4RF4A 2ORYA 4ZRNA 4C43A 1W0KA 1NN1A 2QNBA 4WAUA 4ESVA 4P4NA 4CDGA 3I52A 4Q1DA 5AQEA 2FYTA 4X61A 3DNFA 4WZBA 5DVZA 3QWFA 3ENNA 3CU5A 4KAFA 1B2RA 1R4NB 3E58A 5EJMA 1IH8A 2QZ9A 2WF7A 1WG8A 5JYCA 5U9CA 3LX6A 3PVZA 1RWWA 2XUQA 2I5PO 4H4CA 1PT8A 1JXAA 4TT3D 5I9LA 4BV9A 4IH1A 2XUFA 3DEHA 4CMEC 1Z2AA 1IQRA 3BSSA 2FPPA 1WCWA 2YNMA 4KN6A 2J6CA 4MWGA 1KR2A 1OBOA 4ACAA 1QF7A 2E4AA 1MB2A 1HE5A 3QX8A 5KYYB 1JTEA 4MIOA 1ZGHA 2DKNA 2O8VA 1WSBA 2ZVDA 2O8FB 4AZ3A 3UWDA 4Z9BA 4L1KA 5F23A 4E7OA 2BR3A 1E99A 2OEPA 1VLQA 3E82A 1OLUA 1WLYA 3JASB 1O2DA 2BKEA 5THQA 4S05A 3QMPA 2CVPA 3NTVA 1CJBA 1CQPA 2GTHA 2YVKA 3PPVA 2Y0DA 5TQ2A 4DWJA 1F38A 1RHKA 1XU7A 5TLSA 1B1CA 1V45E 3U48A 3PXGA 1R0XA 1VJ0A 2E4ZA 4LECA 4LYJA 3AO0B 3G23A 1U04A 3ONNA 3ORQA 1CQXA 4HB0A 1G8SA 2FPXA 3PK0A 1R0WA 1L7XA 4GR5A 4JLNA 4JJKA 4V0QA 2Q1WA 1NZJA 1N6LA 1T2UA 1JTVA 1UJ6A 2ONYA 2LVBA 4RJLA 4KV7A 3RPEA 1G98A 4CRWB 4ZV4A 4M9ZA 2ECFA 2CUKA 3H9JA 1CUDA 2OLKA 1K89A 4TL9A 3ZZTA 1R16A 5MGBA 2O06A 2QJRA 4ERXA 1UXIA 3I5MA 4ER5A 2XZLA 1G8GA 3MMZA 3S1AA 5TB5A 1NHGA 2Y4NA 2P8JA 4ZXPA 1F8YA 2I6FA 1UZAA 2FZEA 1M6HA 4R3UC 4CCYB 3AF0A 3NZEA 3W78A 4LJYA 1S0UA 4R4JA 1U9IC 2GJKA 4M8LA 4DEXA 5JVDF 5ENDA 2CN1A 5LNK1 4KLAA 2NNWB 3CMMA 4UBJA 4EJ6A 1E4VA 1KEKA 3KOWA 4DIDA 3WMRA 5AVTA 1OYOA 4RZXA 3TLBA 4U7DA 1I3LA 4IINA 1TYZA 2QW1A 2RGEA 4DQDA 1TQ4A 1EDDA 1JRLA 1LX7A 1XL0A 2C1XA 3P9IA 4IVNA 2ECPA 2HIAA 4RL4A 3B6KA 3X44A 4R0MA 1EXWA 1V95A 2CVQA 4AMGA 2HQSA 3EG9A 1NW8A 2G9VA 1OXVA 4NCBA 4MIEA 3ZS8A 1IN7A 1J24A 3A2LA 3IULA 2WJ4A 4ND6A 3CH5A 2V7XA 4TUYF 5SY4A 3SKYA 2H7CA 1K66A 1M34B 4IOJA 4AJNA 2HLDA 2I0FA 1BVHA 4EFLA 3OIYA 3DF9A 4YCDA 2E55A 3FAKA 2F90A 1XZCA 2CDRA 2J3LA 1N1MA 5EKUA 2WWGA 2A6PA 2F4VB 1YQ9A 2TRSB 4OLAA 2EQAA 1FFXB 1KFKB 1DVRA 1L7DA 2JPDA 3F98A 1XTPA 4IQ0A 3LKVA 1KZYC 3PPXA 3WLMA 4EMTA 1RYEA 1QTNA 3SF0A 2FQ1A 2FWBA 1AURA 2WPDD 3L7CA 4OD0A 1CV2A 2E49A 3ZU5A 4B5LA 4BQOA 3GFSA 3BF8A 1NPTO 3KX2A 4X20B 1JQLB 5BV0A 1V6CA 4BZZA 3F4LA 3TOXA 2NUAA 2JNWA 2FW7A 4WCDA 1TD1A 1ZRHA 2R11A 5DK4A 3LP6A 4E15A 1KETA 1RXUA 4CV3A 3CCFA 3EVBA 4RLFA 3O2SB 4P36A 4Z7OB 1SMKA 3ZH9B 4FUQA 4IOKA 2XGGA 2FSUA 3OT4A 4QRHA 1DCFA 1QJCA 2JZNA 1FDOA 1XDSA 2X0JA 3H5NA 5CPBA 3TAUA 5CB6A 3D0OA 3I6YA 4AN4A 1QGUB 2LIPA 4UCQA 3OFVA 1I3OA 2G06A 5KNDD 3GJQA 4I14A 2CLHB 3UPUA 3ZGZA 1B93A 3QQ5A 3WGLA 5BV1A 1JKFA 1SNYA 5A7HA 4WLFA 1W85B 4HH1A 4GI2A 5AM3A 4FJ1A 5JZ9A 3KJEA 4OP1A 4GVXA 5I7UA 4E5KA 5GJVC 3PI6A 4XWWA 2PYZA 1QO7A 2O7RA 4KLNA 1BC5A 1UM9B 5CHYA 1W4LA 1WA5A 3EZ9A 1A97A 3EAQA 3HZHA 4QFCA 5JPIA 2VRCA 3IILA 3RVDA 4EGFA 1Q74A 4H35A 1CEYA 1FVFA 1ESZA 1W4CA 1W75A 2OGWA 4EYQA 1A4UA 2HWUA 1E1RD 2JKYA 3IAS1 3AESA 1L4BA 2DT8A 4LVUA 5KUTA 5FP0A 1KH3A 1EIZA 2GEVA 4R2KA 3W79A 2QMYA 2OBFA 3D3QA 4EVSA 3PNVA 1ZUHA 2XGOA 4K9OA 3OAAA 4RY8A 1C1XA 1NDHA 3AOGA 2O59A 1FRNA 2QV7A 1W49A 3DFFA 4QC2A 5FWYA 5JMPA 2Q5OA 3HDTA 1GOTA 1NXXA 2I4TA 3F1KA 4DBLE 1VE7A 2ZT8A 1SWVA 3AWIA 3MCZA 3DDZX 3MRTA 4IGIA 3VJLA 2WLTA 2VQDA 4IHQA 1VXRA 3C87A 5ALVA 3EUEA 4HY3A 3I39X 4G8DA 4M0EA 5HM8A 1CZUA 2B6NA 3NWEA 3ONDA 4FDMA 3TVDA 3VZDA 5JNRA 1Q0LA 3AVVA 3O8DA 5ALHA 1BNCA 4MV4A 4YUXA 1XYYA 4HDSB 4D6PA 4GOND 3HWWA 2VEOA 2QMUA 1VMAA 3U6BA 2C5AA 2PGIA 2R6DA 1CIVA 4X1YA 4FHFA 2AC4A 5BORA 2VSYA 5U4XA 2WKWA 3ZVLA 4PZPA 5C5IA 1ZJWA 1V1JA 2OCAA 1FSSA 5K4AA 1K75A 5LKRA 4KPYA 1PVVA 2FWJA 2V7UA 3O4FA 1H2AS 2PBFA 1KEPA 4GPIB 4TM8A 4F72A 3HKDA 3FBGA 4PLZA 5C4GB 4MWDA 3DV2A 4JYZA 4K88A 4FR5A 4HAUA 4I8DA 4B3TB 2P9TA 1U2DC 2V7PA 1DEOA 5EYPA 2ONKA 3GXOA 1NU8A 2VSOA 1E6EA 4MW1A 3WY9A 1L5KA 4AJ2A 3NV7A 4HUQB 3HSYA 1AMNA 3PSAA 2GAJA 4FYPA 2Y0BA 1J25A 3CEPB 3U13A 2RFLA 2XGMA 2I4NA 1U0BB 4MAMA 3NVKI 2ATEA 4US0R 5IDQA 1KBOA 2ZB3A 1SVIA 3PA8A 4U1RA 5AUNB 2P1ZA 2VUHB 5HIAA 3MXOA 2PWPA 7AT1A 1GGMA 3B6JA 2Y1EA 3LPDA 2LCQA 4F4CA 1P4RA 4BE4A 1B6RA 1NQAO 1ZSYA 1QBGA 1P4SA 2PRSA 5E9WA 5TQ0A 1YI0A 3D02A 2B4QA 4IEEA 1CUFA 2IEZA 2X8JB 3GO4A 4W63A 5LMUB 2HBZA 3W9YA 4N76A 4DRXB 1XJ5A 5GTDA 1YS1X 1HKHA 5FNZA 1MQAA 1M5TA 5K8CA 3PXCX 1HMPA 4H1TA 4JUAA 4EX7A 1L7EA 2AS0A 4R8RA 1OZFA 2AG5A 2C4HA 2PU7A 2AH5A 3TX2A 4URXR 3JPYA 1YZKA 5JAQA 4CWAA 1Y7HA 4G5HA 5KINB 2RE8A 4FGZA 1EVEA 3GGSA 1VPTA 1ND6A 3NOVA 3OM9A 4DDKA 1LI4A 2ZIUB 4GH5A 4RVOA 1FFHA 4Y2QA 3MIIA 4QDTA 4R54A 3DZ8A 2PFKA 3ICOA 3E53A 5JXGA 3C3XA 1XE3A 3EEYA 3P9RA 1G21A 1O4WA 1V7ZA 4L8WB 2RBEA 3IQWA 1C3EA 1FMJA 1KTVA 1P1FA 2X0KA 1R0KA 3B7WA 2OG1A 3GEEA 1T9KA 2NWQA 4RK1A 5EZYA 1Q7EA 1Q0HA 5ALGA 2CMFA 2G0NA 1YS9A 4LOJA 1JDSA 4BXOA 1JLKA 2PKWA 5LWQA 2DSTA 3F3SA 4QXPA 2D0OB 3PPYA 2BHLA 4NK4A 3NVMB 3PC2A 4RD6A 4BEVA 4IZ6A 1KC3A 1OFHA 3ZW9A 2GRAA 2WF9A 4Q15A 5AVQA 4NE7A 1SKYB 2C7QA 1VHJA 1ZLXA 2RK3A 3JYQA 4N6NA 5HVNA 3VKGA 1NGSA 3AVQA 1KSJA 1VG8A 1Z6PA 3RHSA 2FXVA 5AW0A 5LQNA 3UHFA 5KKAA 1XPUA 1BWSA 1T9HA 1IBRA 4MRVA 2J6HA 2ZUFA 1IDOA 2DQ4A 4OJKA 2KHZA 3ELYA 5HCUA 2PH5A 1USUA 3QEKA 2W7TA 4A7PA 2CL7X 4K9KA 3ZBPA 4BWYA 1GDDA 1JFLA 2JGEA 5JYBA 1DBVO 2PFGA 4YLEA 3B52X 5A71A 1I9CA 4C6RA 4CQLA 1HORA 1JEOA 1U5AA 2G88A 1E6WA 3GAZA 4AX4A 1R5OA 2YCBA 4NBSA 3B70A 5F33A 2PEYA 1CIJA 3R7FA 2E87A 1G18A 4IM7A 3HYLA 3WYBA 4GRAA 3ZWKA 1R5BA 3NBYC 1KOLA 5HWSA 2IBMA 4FGWA 5DB4A 4FB5A 2G80A 3A7EA 3LJKA 3SWWA 3U4DA 2O6LA 4XGRA 1KI4A 1N6PA 3ZHRA 5A4MS 4V24A <