1XUJA

Trypsin-keto-babim-zn+2, ph 8.2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xujA02
1B0FA 2PKAA 3BIVH 1QL9A 3DT0H 1ZGIA 2W5EA 4ABHA 1O3LA 3MH4A 4AYYB 4B74A 1CQQA 2F91A 4TPYA 2SGAA 3IITA 4ISHH 5DP7A 1GJAB 1GWAA 1YPHE 2FOFA 2R3UA 1MKWH 4X6PA 3AW1A 3OU0A 1FY4A 5L30H 1V2JT 3GY5A 1O2IA 1VCPA 1IQJA 1IQMA 1ZRKA 5LPEA 2XC5A 3M5OA 1CA0C 3RUOA 1A7SA 2BY9X 1SQTA 3LH3A 3A7TA 1UTMA 3N7OA 1QGFA 2FS8A 4B2CA 1DLEA 1KTTB 2R2MB 4AGJA 1TA2A 1TNGA 1AVXA 3QTVH 1QNJA 4AB8A 2HVXA 1QJ1B 2ZDVH 1HAZB 3ELAH 1PPBH 2PR3A 3NPSA 4DCDA 1H9IE 1JBUH 4CBOA 1GG6B 2FIRH 1BTHH 1GBKA 1XUKA 1HDTH 5HYOA 1DXPA 1GJDB 4UONA 1ANEA 1V2RT 2GT8A 1Z8GA 2A4QA 2GP9B 1IQHA 2Z94A 3E90B 2STAE 1ELBA 2H6MA 1SLVB 4A6LA 3U1IB 1QURH 1O5AB 2ZU2A 1FY5A 4O03A 1MAXA 1Z7KA 6CHAB 2PKSB 4WWYA 1QCPA 3SQHE 4X1PU 4ZKRU 3A88A 2TBSA 1C2KA 2Y7ZA 5JDUB 2CMYA 2FI5E 5CHAB 2GZ7A 3O8BA 1SGCA 2PW8H 5DK1A 1IQGA 3SV8A 3BTEE 1L4ZA 3GICB 3SV9A 2BY5X 4NWKA 1Z71A 2ZFFH 1GVKB 2FI4E 2EI7A 2TGPZ 4DW2U 1YM0A 1YLCA 3VXFH 4K5ZA 3LDXH 2Z6BD 1GI6A 4ZROA 8LPRA 2OD3B 2PLXA 1TGBA 1AZ8A 3TNTA 2GGVB 2V35A 4TPIZ 3SU0A 2BLWA 1O3JA 2AS9A 1S0RA 2QF3A 1AKSB 1YLDA 1K22H 4ZHAA 1F0SA 2ZG0H 3KNXA 3EDXB 4FUFA 5A8ZA 3S9BA 3QGJA 1TLDA 4FUDA 1ARCA 4Z0KA 3TH2H 3GCHC 1P12E 1SFIA 1XKBC 3UQOA 2ZDAH 4X6OA 1NT1A 5FX6A 1AUTC 3FP8E 1ZR0A 2BOHB 1C2FA 4BXWA 4AN7A 2BVSH 1E38B 1P04A 3RMMH 2NU2E 1C2HA 1VCQA 2AFQB 2JH6D 3FANA 1EZSC 1PPEE 3QLPH 3OTJE 2AGIX 4MNYA 4DGJA 3SUFA 1J16A 1HJAB 1EZQA 1ZJDA 4UD9H 2BXUH 1K1JA 5DPAA 1D3PB 1GHBF 1O2SA 1EASA 4ZH8A 1AGJA 1BBRH 1HGTH 3S9AA 3MNBA 1BRCE 2FOHA 3KQCA 1VITH 5K0HA 1SGIB 5CMXH 2VU8E 1SQAA 4I8GA 2D2DA 1OP0A 2FOAA 1FN6A 3HATH 3TVJB 3GY3A 2FDAA 3MI4A 4RKOB 2Z9KA 1XXDA 3TH3H 3RMLH 3UREA 1UTNA 3ATLA 2FYQA 4JMYA 1O2RA 2CHAC 2ZPRA 1EQ9A 1LPZB 2UWOA 2XRCA 3G01A 3LC5A 1VCWA 3AAUA 2AYWA 1AFQC 1EB2A 1G2LA 4K60A 1GI9B 3FZDA 3MU4A 1CGJE 3ZYDA 1YPEH 4YTAA 3PLBA 1T32A 3W94A 1PPFE 2JKHA 2Q6DA 2Z7FE 3DA9B 3HK3B 1OWDA 3VFEA 3ZYEA 1Y5UT 1ZHRA 2P16A 3LT3A 4HFPB 1SHHB 1DWEH 1VGCC 3RC5A 4X8TH 1GI5A 2KAIB 1VJ9U 1BIOA 1UCYK 1C5TA 2FEQH 1MH0A 1UVSH 1SMFE 5DP3A 1A61H 1IOEA 1LQDB 5FPTA 4BXSA 2P3TB 5ESBA 1AQ7A 1O2HA 1EUFA 3GCTF 1ESTA 3Q77A 1C5RA 2PTCE 5LPRA 1SGRE 2VNTA 1FPHH 2EI8A 1DSUA 1P3CA 1AB9B 8GCHG 2HLCA 2WPKS 2Z3CA 1RGQA 2IN2A 1AZZA 1DUAA 2P93A 4XBBA 2OC7A 1O33A 4FVBA 2NU3E 1Z8RA 4I33A 1E0FD 1T8OA 2Y7XA 3LIWA 2XNIA 1J8AA 1YP9A 2Q6FA 1TE0A 1E34B 4IS5A 2HNTC 1CA0B 5FPYA 2DUCA 2DE9A 2BDBA 3SJ8A 5DO4H 4CRBA 5EQRA 2AGEX 1ZHMA 1DWCH 1XUGA 1C5YB 1MU6B 1FUJA 1ESAA 4AG1A 1HUTH 1GMDG 1ZRBA 3T27A 1LPGB 4Q80A 3PYHA 1TQ0B 1CE5A 1WOFA 1YPKH 1N1LA 1ZHPA 3ZZ9A 4ZKSU 1K21H 1NFXA 1SFQB 2W26A 3AW0A 5FHTA 1ACBE 2Y6TA 1GDNA 5J4QA 3NK8A 1PYTC 5EPNA 2WPMS 2SGEE 5F6MA 1QB9A 3BEFB 2BD9A 4AFSA 4RSPA 3PTBA 2HGTH 5E0JA 2XC4A 1BBRE 2SNVA 4NGAH 3GCNA 1IQLA 3PWCA 4UE7H 1UK3A 3LGIA 4Y7AA 3SO3A 3MTYA 4B1TA 2JH0D 2ILNA 1UTPA 1G37A 3RXOA 1O37A 1P8VC 1D3QB 4ZXYH 3S7HB 1ESBA 1G3BA 2GCTC 3PTNA 3SUGA 5E2PA 1VITF 2FESH 3M37A 1SB1H 5C5OA 4UFGH 3EQ0H 1K1MA 3QZQA 2BX3A 4INHA 1TOMH 1BDAA 4FVDA 1BRAA 4IC6A 3KHVA 1UHBA 3QTOH 3R0FA 1YC0A 3KN2A 4DIIH 3SHCH 2AMDA 3P8OA 3RXQA 1HAHH 4F4OC 1FONA 5LH8A 1T7CA 1GDUA 2ZEBA 1TNIA 1BMLA 3RXMA 2V0BA 1QJ6B 2VIOA 1RIWC 2O8UA 3PO1B 4BAOB 1O2VA 4NSYA 2Y82A 1OWEA 1HJ8A 4HI3A 2ZWLH 3E8LA 1HNEE 4O3TA 3RC4A 3A81A 3RU4T 4Q7XA 1A5IA 3V0XA 1EAWA 4K69A 3QO6A 4X1QU 3EE0B 5FCRA 2ANYA 1AVWA 1LO6A 5G4BA 1A0JA 4Y0YE 1ELCA 1O2XA 1UVUH 2VIPA 1ANCA 1C2GA 1UJ1A 4B76A 4OS1A 4BAHB 1TBZH 2ZGJA 1TPOA 1V2PT 1P3EA 2VWMA 3LPRA 1KLTA 2BD2A 2IPHA 2ZDNA 3QZRA 1BHXF 2WYGA 4WH8A 5A8YA 1HAPH 2WV4A 1MKXK 1CHOG 2ZF0H 5T6GA 1OSSA 1OYQA 3RC6A 1FNIA 3UR6A 4NIVA 4NA7A 2HALA 3B23B 2FZZA 1DT2A 2W3IA 1GJBB 4ZHLU 5EXNA 3K65B 1GVZA 2B0FA 2QXGA 2Y5HA 2VGCB 4YT6H 1Z1IA 5C1YA 2G5NA 3PMHB 1XUHA 1ELVA 2Y5GA 5FBIA 4YT7H 1S6FA 4A5TS 3CS0A 5E2OA 2FOCA 5IDKA 1OP8A 5DJ7A 3RXPA 3BTDE 2ANKH 4I7YH 1P57B 2ZDLA 1LVOA 3SU3A 4CR5A 1H4WA 4MPUA 1W14U 3F9FA 1IQFA 4X6NA 3TNSA 2A5KA 1C1RA 2VH0A 2W3KA 1RRKA 3ESTA 4H6TA 1SGFG 1AFQB 4UFFH 2GCHF 5EXLA 1FIWA 2AGGX 4INKA 2THFB 1ZSLA 1WTHD 3B8JA 1OWIA 4LZ1H 1NFYA 3MMGA 4X6MA 1RD3B 4Y7BA 1VGCB 4K8BA 1O35A 1DANH 1JOUB 2CV3A 1AU8A 3JZ1B 2PWXA 2ZDKA 1W7XH 5TCCA 1TA6A 3GISB 3H7TA 3Q3XA 1C4Y2 2YOLA 1KXBA 3H7OA 1O3FA 1K1IA 3U8RH 1C1SA 4DVAU 1TALA 3FVFB 3GY2A 2OXSA 2ZU1A 1TAWA 3RXAA 1FAKH 4H42U 1CU1A 1O34A 2ZP0H 5JBTA 1HIAA 3QN7A 5GPIB 1MTNB 3PB1E 3KF2A 2BY7X 4OS2A 2FWWA 1A0HB 4RKJB 3EGKH 3RMOH 4TY7A 5L2ZH 4FUHA 3TJVA 1BRUP 1PQ7A 1XUJA 2OTVA 3UOUA 2P94A 3ODDA 3RXUA 1ZOMA 2KAIA 3PM3A 1DITH 1F0RA 1TONA 4UFDH 4AB9A 4GHTA 4M7GA 3VGCB 1ZMJA 1GHXH 3M5NA 4GSOA 3A83A 4U01A 1CBWC 1LHGH 4ZKNU 1GJ6A 2H5CA 3GY6A 1UVOA 1O30A 1CGHA 1EX3A 1J14A 2SGDE 2BDIA 2QAAA 1QFKH 1RS0A 1YPMH 3A7VA 5DP9A 2P95A 1GMCF 2W7UA 2XYAA 1O2KA 1ETSH 1ELGA 1O36A 3QK1A 3TIUA 4ISLA 1NRQH 6GCHF 1GHAF 2GD4B 1BA8B 2VVVA 4Y79A 1KXDA 5AFZH 2FOBA 1SGFA 2WPLS 1QA7A 3E1XB 2UUJB 5F8TA 2VWOA 5JBBS 1F92A 2BZAA 3LGTA 1BRBE 1QBNA 3LH1A 1HXEH 1G9IE 1KXAA 1WBGB 1GBJA 1BTPA 2FOEA 1LVYA 2IJOB 3M61U 1EPTB 1C4U2 1C5OH 1SGPE 1FLEE 2PHBA 1QBOA 4CR9A 2STBE 4Y11E 3OY5U 1EZUC 1ARBA 1CT4E 3SU6A 1Y3XA 1NRNH 1NS3A 2C93B 4GAWA 3BG4C 4MNXA 2HPPH 2A31A 4OGXA 1C5XB 2ANWA 4AGKA 4AORA 1RIWB 2D26C 1S5SA 2OC1A 2Z9JA 1LHCH 3MO6A 5C2ZA 2ODPA 1KIGH 3UOPA 1KSNA 4FUGA 4ZUHA 1N8OC 1KTSB 5JPMH 5JYIA 1QL7A 1BTYA 4H6SB 3FP7E 1C5WB 2CF8H 5C1XA 1CT2E 4XE4A 2ZHEH 3CENA 3BTKE 4X1NU 5GIBA 1GBLA 2J92A 1JRSA 2JETC 2YNAA 3A84A 2ZIQH 3SOSA 1DY9A 3I77A 1NRRH 1DWBH 3SI4H 2ZA5A 3LONA 3GDSA 3O8CA 2M5TA 1O3KA 4YLUA 1FDPA 3MO9A 3WY8A 4KKDA 2VVUA 2WPIS 4XBDA 2HOBA 3EAJA 1GHBG 1MCTA 1NZQH 4KP0A 2H2ZA 3RDZA 1GMHF 1SLXB 4I8HA 4DT7B 2ZU4A 2A4RA 4XBCA 1C2MA 3IG6B 4NCYA 2FODA 1DE7H 1XVMA 2QF0A 1EAXA 4QT8C 2QXJA 1D3DB 1KXEA 1C1PA 3SNCA 2FS9A 4ESTE 5CE1A 4A7IB 1F5RA 2XBXA 4VGCC 4AG2A 3TGKE 2Z9GA 1GHVH 1ABIH 2HRVA 3ODFA 3RU4E 1LVBA 3NXPA 2GZ9A 2R3YA 4R0IA 5EPYA 1FY8E 2J34A 3OYPA 2G8TA 3FZZA 3E3TA 1UMAH 1RTFB 2A7CA 4DURA 3UTUH 4TWWA 1TWXB 3UUZA 1YPJH 1GHZA 1BJVA 1SBWA 1O39A 1NPMA 1WQSA 5T6DA 1BHXB 1MZDA 2B7DH 2F9UA 1WCZA 1GI7B 4YESB 3ZVFA 1SGNE 3A8DA 1TOCB 1TPPA 1F7ZA 1W8BH 4RN6A 3TPIZ 2H5DA 3E91A 1CA8B 1K1OA 4CHAC 1GI1A 3GYMA 1WV7H 2EC9H 1G2MA 1ELTA 3GCTG 1GCTC 3LU9B 4MQAA 5GJ4B 1HFDA 3NWUA 4HGCA 4U32A 4BTIB 4A1VA 1N6YA 1KLJH 4THNH 2SGPE 3GYLB 2A2QH 4WXVA 4BNRA 3HPTB 1TMUH 3RP2A 3HGNA 4Q2KA 4JK5A 4Y0ZE 1K1PA 5EXMA 3AASA 3VXEH 2NWNA 1SGYE 4MDSA 9ESTA 5HGGA 2GV6A 1BTUA 1NROH 4Y8YA 1C1QA 3VB4A 1C2EA 1DSTA 1HPGA 2FLBH 1F0TA 1VJAU 5TJXA 2XBVA 1L4DA 1P02A 3RXFA 1NO9H 4ABIA 1LKBA 2RG3A 4TWYA 3D65E 2CGAA 1FY3A 2P3UB 3Q76A 1QY6A 1NM6A 1J17T 2VWNA 1YGCH 3MWIU 1QRZA 2V6NA 3SV6A 1SL3A 1J9CH 3RMNH 1Z8JB 4I8JA 3ZV9A 3BTFE 4JYUH 3TJUA 3ZZ3A 3F1SB 3SV7A 1C1NA 1G3CA 1BITA 1ETRH 1MTWA 2CN0H 3M7UA 3UWJH 1G32B 1O5EH 4KTCA 1KDQA 3OY6U 3LC3A 4ABFA 3P6ZB 1DFPA 1BMNH 2PUXB 2QXIA 2P8OB 1T8MA 2XWBI 3SU4A 1SR5C 2BY6X 1NU7B 2AMQA 2HNTE 1SOTA 3SHAH 2PSXA 1CBWB 2A5AA 2BDYA 1EJMA 4Y71A 3H5CB 2ZC9H 4PROA 4MPXA 3SUDA 2F3CE 1DY8A 1W12U 4O9VA 3BF6H 2GDDA 2EI6A 1C5ZB 4DY7B 4BAKB 4ZMAH 2J94A 1O2YA 1GGDC 2ZU5A 2Z9LA 2HNTF 4K1SA 1HBTH 2OINA 1HLTH 4X2WA 1UVTH 4GUXA 2A1DB 4AFZA 1ZJKA 2ZGCA 3MNCA 3MH5A 1H9LB 4R8TB 5EGMA 3ZVCA 3MU0A 1YBWA 1GBEA 1P2QA 2ESTE 2O8MA 4H4FA 2ZQ1A 1VITG 5ABWA 3DHKH 2V3OH 1G3DA 5C3NA 1AMHA 2GMTC 2TGTA 4NA9H 2UUKB 3JZ2B 1FJSA 1P2MA 2GKVE 2PUQH 1S85A 2ANMH 3T26A 4NA8A 1T4VH 4AZ2B 1LTOA 4K8YA 1AWHB 1A2CH 4E05H 2QXHA 1JXPA 4YLQH 4D9RA 2R9PA 1V2ST 1BMAA 1J15A 4MPWA 2BLVA 2XW9A 3HKIB 1ZMNA 1FPCH 2P3FH 1C2JA 1DVAH 1ID5H 2ASUB 4YM9A 3A7WA 5HXFA 1FV9A 1C1UH 1W0ZU 3RXIA 1RFNA 1E37B 3SW2B 2F9PA 4IN1A 4FUIA 5TCAA 4ABGA 3ZZDA 3O8DA 2BD8A 1MD7A 3F9EA 5AVDA 2GX4A 2ZHWH 1EAIA 2H9EH 3T28A 1C5QA 1O38A 1EJNA 1NFWA 3ATIA 4WXIA 5PTPA 1OWHA 1KXCA 1L1NA 1P09A 1O3HA 1TABE 3ENSB 5B6OA 1O5GH 1YPLH 3UNSA 1BUIA 1O3CA 4UDWH 4ISNA 2OQ5A 1T8LA 4UFEH 4JZIA 1QB6A 4GHQA 4HTCH 5DG6A 1P2KA 1SHYA 1MBQA 1K2I1 2QY0B 1P2JA 1GDQA 1Y3UA 4BTTB 5EODA 1TX7A 1O3BA 3VB6A 2J38A 2ZCLP 4NWLA 1GBAA 1KY9A 1A4WH 2QN5T 3T5FH 4ABEA 4OS4A 8KME2 4GPGA 3R3GB 5EW2H 5JB9S 4FUCA 1HAYB 4OS6A 3C27B 5H4IB 4JCNA 2ALVA 1FQ3A 5EQSA 3ATMA 1DX5M 2AERH 2C8ZB 1CO7E 4MG3A 3A8CA 2GCHG 1V2OT 1THRH 1V2WT 2BVXH 2RDLA 5F03A 1GPZA 1V2UT 1D6WA 1TRMA 2F9OA 3A82A 1P2OA 1QA0A 3RXKA 1NY22 1L2EA 3ZZ4A 4XSKU 1O3EA 1ELDE 3GY7A 4IGDA 1O3MA 5K7RA 3SV2H 3P8NA 4Y10E 1S81A 1OPHB 5AF9H 4K3JA 3A8BA 1DDJA 3GDUA 4KGAA 3GCHB 1OS8A 3LOXA 2UWLA 1AE5A 1DXWA 1VR1H 1C4V2 1D9IA 1A5GH 1DS2E 3Q00A 1BJUA 1TPSA 1OX1A 1GJ9B 1P0SH 2O8WA 2OCVB 3LGUA 4J2YB 1UO6A 5BPEA 2FXRA 4AX9H 2ZFPH 1Y3WA 1AUJA 4K1EA 3MFJA 2BXTH 1SVPA 3SJ9A 3GCOA 2BYAX 2P59A 1O2LA 1H8DH 3P8GA 2WUBA 3A7ZA 3A86A 4Y8ZA 3V3MA 2BMGB 1YCPK 2PSYA 2ZCKP 2FLRH 1GHYH 3ZZAA 1G36A 1SGTA 2F9VA 4ZXXH 1GG6C 2BD5A 2QCYA 3UY9A 7GCHF 4X1RU 2D8WA 5J4SA 1AKSA 2XBWA 1C5UA 1F5KU 1HB0B 3BN9A 1TRNA 5C5NA 1CHGA 1WU1A 1W11U 1O3NA 5A0CA 1EXFA 1GBHA 5A0BA 3BTQE 1AI8H 4E06H 3MU1A 2ZNKH 3S7KB 1XUFA 6CHAC 2CHAB 2PKSC 4D7GA 1GMCG 2WINI 1QR3E 2IOTA 2BY8X 1P01A 3LGYA 1YCPM 5CHAC 1C5PA 1XMNB 6GCHG 1LHEH 1GHAG 4Y76A 5BRRE 1AN1E 1Y8TA 4CRCA 1MTVA 3E6PH 4D76A 4YOGA 1V2QT 2O8TA 1LQEA 3ZZ8A 5E8EH 2BQWB 2TGDA 1TGSZ 1KXFA 1ZGVA 4AFQA 3PWBA 2SNWA 1MKWK 3PMJA 4WVPE 1C5LH 1H1BA 5JB8S 2BLQA 3RXVA 1RTKA 4B2AA 1YF4A 3DD2H 1WYKA 2ALPA 1MCVA 2OC8A 1MTSA 4MNWA 1NRSH 5EW1H 4IBLH 1XVOA 1OWKA 1V2VT 3URDA 1GL1A 3MU5A 2CF9H 3LGWA 3BSQA 1IHTH 4WY3A 2EA3A 2OP9A 3MH6A 1HAOH 4UEHH 3GY8A 3BG8A 3P8FA 4KELA 1O3PB 3ZVAA 2FX6A 3W95A 1BTXA 1B0EA 4MLFB 1O2NA 3MNSA 1MBMA 1ZYOA 4FXGH 1TX8A 1GBDA 2VIWA 1C1TA 1GHWH 4ZKOU 2WV5A 2LPRA 1EB1H 1UCYE 3RXBA 4BOHA 3BEUA 1D4PB 4FUJA 1O5BB 3SU2A 2PGBB 2HPQH 1C2IA 3MOCA 3QX5H 4JK6A 5C67A 1C5MD 1TYNA 3KCGH 3MU8A 3RXHA 4E7RG 1DICA 5FBEA 1V2MT 1HJAC 5EQQA 1S84A 2ZTXA 4WMDA 2OBOA 2FX4A 1EJAA 1MQ5A 2FP7B 2FMJA 1X7AC 3ZVGA 1V2KT 4HZHA 2FI3E 4SGBE 1GMHG 3K6ZA 4IW4E 2R2WU 2XTTB 1ZMLA 3M7QA 1K1LA 3MO3A 2ZFQH 1T31A 1ZLRA 1AFEH 1L0ZA 4DJZB 1QHRB 4FU7A 2VWLA 1MKXH 5ETXA 1Z1JA 2FM2A 2CXVA 3UQVA 1Y3VA 1QRWA 4JZFH 4OS7A 3M3VA 3OX7U 3U69H 4Q7ZA 1O2PA 1INCA 1QB1A 3A7XA 1O2QA 4INLA 2ZO3H 3TJNA 5GCHF 3VB7A 6LPRA 2WYJA 1MU8B 1O2GH 3TGIE 3UPEA 5JBCS 1TBQH 2GCTB 4CRAA 1NC6A 2G55A 4TYDA 2J4IA 1P9UA 2CJIA 2AIQA 3SJIA 4MPVA 1QTFA 1LVMA 4CRGA 1ZTLA 5E0GA 3SNDA 2ULLA 4MTBA 4IN2A 2SGQE 2BLOA 1ZSJA 4ABDA 1S0QA 3ATWA 2ZQ2A 3RLWH 1EP5A 1BT7A 2BM2A 1UTOA 2BOKA 2UUFB 1AVGH 4ASHA 3KQBA 5LGOA 1FY1A 2ZTZA 1QJ7B 1O32A 2G4TA 2G51A 1FMGA 2H1UA 3BEIB 1WAYB 4JYTA 7ESTE 1UK2A 1NESE 1AB9C 1THSH 3F9GA 4ISIH 4CREA 2GT7A 4GCHF 3M3SA 3PLKA 4GLYA 3D23A 2SFAA 2R0KA 1V6DA 2XXLA 1ZPBA 3EA8A 3SNEA 3RXSA 1Q31A 1O2TA 4ABJA 1PFXC 1BBRK 4AOQA 1K28D 1UTQA 1SI5H 3EA7A 3KQDA 1XUIA 2R0LA 1DWDH 1C1MA 1NU9A 1TMTH 2C3SA 3BTWE 4O3UA 1CGIE 1QQ4A 3ZVEA 4OS5A 4O97A 1QBVH 1LDTT 2RCEA 1O3OA 4X1SU 4TY6A 1PYTD 3UR9A 4AYVB 3SGQE 3CP7A 4DG4A 2BD3A 2VJ1A 2OBQA 4WJG2 1NRPH 3MYWA 1LHFH 1O5CB 1UHBB 1FN8A 1GJCB 2QIQA 4LXBH 3KEEA 1SG8B 1Q2WA 3RXCA 1ZTJA 5F8ZA 2BHGA 2WPHS 1A0LA 1EAUA 1C2LA 1IQNA 1GVLA 1E36B 4NIYA 2ZTYA 1OP2A 5SGAE 2WPJS 2Y81A 4ZHMU 3M35A 1TNLA 1W13U 2B5TB 4IC5A 3EYDA 1IQIA 3V12A 7LPRA 1YPHC 4CH8B 2ZHFH 1E35B 2Q6GA 1EZXC 1TFXA 5DP5A 4Q7YA 4CRDA 1UK4A 1S6HA 2AEIH 3L6PA 3RXGA 3SJKA 4B75A 3RXTA 1EOLA 1TPAE 4U30A 1V2NT 1ZSKA 1BCUH 1D3TB 1TMBH 3PLPA 3QWCH 2NU1E 3A8AA 1Y59T 1TGCA 2G00A 2TPIZ 1CT0E 1XX9A 1AE8H 1O2WA 1ELAA 3ATKA 1P2NA 3C1KA 4I32A 2ZFRH 2RA3A 3ZZ5A 3A80A 1QIXB 3F9HA 2EEKA 3L3TA 3PO1C 2GVFA 1H8IH 4GVUA 2BDCA 2BQ6B 1GL0E 1UVPA 1HAGE 3TJOA 1OOKB 1KLIH 3U9AH 2C8WB 2ZZUH 1MZAA 1SLUB 3NKKA 4X8SH 4B2BA 1HAXB 1DPOA 3SNBA 4NZQA 4JZDH 1JWTA 2VVCA 1ELFA 4I8LA 5FAHA 3A87A 3V13A 3SUEA 4YZUA 1SPJA 1G3EA 3PMAB 1MAYA 1MUEB 1BTWA 2F9BH 2JH5D 1K1NA 2A4GA 1UTKA 4I31A 4XFQA 2D1JA 4D7FA 4IMQA 3L33A 1HV7A 1HXFH 4YOIA 3A7YA 2BX4A 2G52A 2H9TH 1O3IA 1MQ6A 1SC8U 4WMFA 4CBNA 1ZZZA 3DFJA 3ZVBA 3TGJE 1BB0B 1KYNA 2XWAA 4JZEH 1QRXA 1L1JA 2FTMA 3K6YA 3K9XB 2GZ8A 3E0NB 4XOJA 1A1RA 3URCA 2J95A 1BQYA 2ZHDA 1C1WH 1HJ9A 1Q3XA 1W7GH 1A5HA 1SGEE 3ZZCA 4A1TA 3VB3A 3S9CA 1GJ5H 2VGCC 1MTUA 1SSXA 1TQ7B 4LK4A 3Q3KA 4X8VH 4B73A 2J9NA 3GOVB 3VB5A 1GJ4H 2QYIA 2BD7A 1H9HE 1XM1A 1GBMA 2BTCE 1PQ5A 3D49H 1GI8B 5FXLA 1PPGE 2K1QA 2VIVA 3KQEA 3VPKA 2XCNA 1HIAB 1GCDA 1O5FH 1TNHA 2TRMA 1O2MA 3BTME 4A92A 2NU4E 1Y5AT 5F8XA 3M5LA 1C9TA 2ZDMA 2G4UA 3S69A 1TBRH 3P92A 3U8OH 5A0AE 7KMEH 5FX5A 2FPZA 2Q1JA 1VZQH 5IYTA 3PV4A 2V3HH 3PMBB 1HAVB 5L6NH 1O3GA 2F83A 4NFEA 3BG4B 1D6RA 3NCLA 3BV9B 3TU7H 5L2YH 2TGAA 2BDGA 5FPSA 1RXPA 1TGNA 3UWIA 2B9LA 1TGTA 4YOJA 3MHWU 4MVNA 3T2NA 1F2SE 1IHSH 3AAVA 1TNKA 2Z9IA 3KL6A 1N8OB 1WTGH 1S82A 2GDEH 3ITIA 3FFGA 4BTUB 1TRYA 1SQOA 4NIWA 2ZFSA 2JETB 3ZV8A 1MTNC 1Z6EA 4FUBA 1O31A 1W10U 5E0HA 3SGAE 2Z3DA 3M3TA 4LZ4B 1Z8IB 1PPZA 1T4UH 2ZU3A 3F6UH 2B8OH 1EPTA 2Y5FA 4BANB 5FCKA 2A0QB 2Z3EA 3P95A 4B71A 1DM4B 4X2XA 4JYVH 3OSYA 1GI4A 3QGNB 2H9HA 3E16B 2A7JA 2PKAB 1B5GH 3F68H 1V3XA 5HM9A 3SU5A 4AFUA 1ANDA 4FU8A 1YPGH 3VGCC 1HCGA 4BAQB 3HK6B 1C9PA 3O8RA 4DIHH 7GCHG 4K2YA 5DP6A 5T6FA 4WMEA 1P06A 1GBTA 2AIPA 1SOZA 2ZPSA 4NG9H 3SORA 4VGCB 4D9QA 1GI2A 2A4OA 1ZPCA 3U1JB 4ISOA 1EKBB 1O3AA 4Y6DA 4MNVA 4F49A 1C2DA 1OYTH 4CRFA 1GBFA 3RM2H 3ZZ6A 4LOYH 3P17H 1EOJA 1TNJA 4WH6A 3SJOA 2A2XH 3M7TA 3QDZB 3TLOA 1DUEA 5ESTE 1RTLA 5GDSH 3VEQB 1TB6H 1TX6A 1LCYA 3IWMA 1GBBA 2O8LA 2A5IA 1K9OE 2FYRA 1F0UA 4D8NA 2PGQB 4A1XA 3Q3YA 1EPTC 3RLYH 1OWJA 3BIUH 5C1UA 1O0DH 2ZGXH 1YYY1 3STIA 3A85A 5I25A 3T25A 2VINA 1LKAA 2ZPQA 4CHAB 1UCYH 1AIXH 1GCTB 1EP6A 1ZPZA 3BTHE 2PFEA 8GCHF 4YO9A 4Y8XA 2OC0A 2FOGA 1FXYA 1V2LT 4E7NA 2ZGBH 1FAXA 1C5SA 1DOJA 5DKMA 3U8TH 3I78A 1G30B 1NN6A 3QUMP 5C20A 3NZIA 4NZLA 3TK6A 2ZI2H 1A3EH 1M9UA 2GTBA 3BTTE 4NFFA 4X0WU 2VIDA 1S83A 3M36A 3NUMA 1FI8A 1HAIH 1IAUA 1P11E 1C1OA 3U98H 3FP6E 1GMDF 5A09A 4OGYA 3SGBE 1HRTH 3D62A 1CVWH 1AY6H 2W7SA 1O2ZA 1B7XB 1Y3YA 1GI3A 1AHTH 5A8XA 4SGAE 1SLWB 2BDAA 8ESTE 1LHDH 1P2IA 2AH4X 1NFUA 3UFAA 1W2KH 4K1TA 1NTPA 1P10A 2YNBA 2OLGA 2VIQA 3UIRA 1PPCE 1PQ8A 2BVRH 3DUXH 4IMZA 2F9NA 1C5VA 4WF8A 3ZZ7A 3TK9A 3FAOA 2A32A 2QV1A 3ZZBA 2DE8A 5AHGH 1BOQA 2J2UA 1F5LA 2Y80A 1O5DH 3DFLA 3BTGE 1TIOA 1ELEE 1GJ8B 1GGDB 3LJOA 4KTUA 1OKXA 4ABBA 3LJJA 2ZFTA 3LGVA 3S0NA 1WQVH 2ODQA 1Y5BT 2ZHQH 1LMWB 3SI3H 3TK5A 2I6QA 1L1GA 1MD8A 1O2UA 3SN8A 4BAMB 5GCHG 1BZXE 1SGQE 3CS7A 2QC2A 1JIMA 1XKAC 3GY4A 3KIDU 1Z6JH 2FTLE 5HM2A 2NU0E 4U2WA 1UTLM 1T8NA 2QGRA 4DOQA 3TH4H 1AD8H 4Z6AH 1A46H 2GMTB 5DP8A 1GBIA 2XC0A 5DP4A 9LPRA 2SGFE 3TITA 1IQEA 1V2TT 1JMOH 5A2MH 1ORFA 5LPFA 1P03A 1UTJA 4JZ1A 2WUCA 1CSOE 4FUEA 1GBCA 1AO5A 1KDQB 1PJPA 1N6XA 4KTSA 3T29A 1O2JA 3LKWA 2AMPA 1LPKB 1C1VH 1DLKB 2A45B 3HKJB 5JBAS 4X2VA 6ESTA 1WUNH 3E0PB 3SNAA 3I29A 2TIOA 5EU8A 4ZAEA 2I6SA 3GDVA 3UNQA 3RU4D 2G5VA 2C8YB 3SBKA 2C90B 4GCHG 3MNXA 3P70B 5DGJA 1PPHE 1A3BH 4NIXA 3RXRA 1RJXB 1ANBA 2LNCA 1P05A 2UWPA 3SZNA 1W3CA 3SQEE 3MH7A 1JIRA 1ZTKA 1QQUA 5GWZA 2ZKSA 1HYLA 5T3HA 1JRTA 1OXGA 3A89A 2ZCHP 2FO9A 3RM0H 2ZECA 1ETTH 3RXEA 2BB4A 3B9FH 1O2OA 2BZ6H 1ABJH 3SU1A 3ZVDA 5EG4A 1THPB 1EATA 2BDHA 1P9SA 5EOKA 1CHOF 4XDEA 2FOMB 1BTZA 1HAVA 2OQUA 1PQAA 5AFYH 3STJA 1IQKA 2P8OC 5GXPA 2G81E 1YCPH 2UUYA 3T62A 1AWFH 2HWLB 4FU9A 2XBYA 2RA0A 3V7TA 2VH6A 2C4FH 2ZGHA 5HMAA 2A7HA 5I46H 2C8XB 4CH2B 1WSSH 2BD4A 4NSVA 2GV7A 3PROA 2VB0A 1FZZA 1GI0A 2ODYB 2OUAA 2PTNA 4ABAA 1C5NH 1YKTA 1XXFA 2XCFA 4I8KA 1W0YH 1QL8A 3EA9A 2BQ7B 3HGPA 2PV9B 3RXDA 3KGPA 1U6QA 1SGDE 2QA9E 4X8UH 1FIZA 1BMMH 1MMJN 2O9QA 4X2YA 3AVZA 1O3DA 3RXJA 4J1YA 3K2UA 3UNRA 3RXLA 3M5MA 1GJ7B
chains in the Genus database with same CATH superfamily
1B0FA 2PKAA 3BIVH 1QL9A 3DT0H 1ZGIA 2W5EA 4ABHA 1O3LA 3MH4A 4AYYB 4B74A 1CQQA 2F91A 3F3BA 3N7EA 3PRBA 4TPYA 2SGAA 3IITA 4ISHH 5DN6D 5DP7A 1GJAB 1GWAA 1YPHE 2FOFA 2R3UA 1MKWH 4X6PA 3AW1A 3OU0A 1FY4A 5L30H 4AC9A 1V2JT 3GY5A 1O2IA 1VCPA 1IQJA 1IQMA 1ZRKA 5LPEA 2XC5A 3M5OA 1CA0C 3RUOA 1A7SA 2BY9X 1SQTA 3LH3A 3A7TA 1UTMA 3N7OA 1QGFA 2FS8A 2JIZD 1DLEA 1KTTB 2R2MB 2YMSB 4B2CA 2WSSD 4AGJA 1TA2A 1TNGA 1AVXA 3QTVH 1QNJA 2QF5A 4AB8A 2HVXA 1QJ1B 2ZDVH 1HAZB 3ELAH 4P02A 1PPBH 2PR3A 5B6LA 3NPSA 4DCDA 1E1RD 1H9IE 3H09A 1JBUH 4CBOA 2KFWA 1GG6B 2FIRH 1BTHH 1GBKA 1XUKA 1HDTH 5HYOA 1DXPA 1GJDB 4UONA 1ANEA 1V2RT 2GT8A 3F2FA 1Z8GA 2A4QA 2GP9B 1IQHA 2Z94A 3E90B 2STAE 1ELBA 2H6MA 1SLVB 4A6LA 3U1IB 1QURH 1O5AB 2ZU2A 1FY5A 4O03A 1MAXA 1Z7KA 2WHXA 6CHAB 2PKSB 4WWYA 1QCPA 3SQHE 4X1PU 4ZKRU 3A88A 2TBSA 1C2KA 2Y7ZA 5JDUB 2CMYA 2FI5E 5CHAB 2GZ7A 3O8BA 1SGCA 2PW8H 5DK1A 1IQGA 3SV8A 3BTEE 1L4ZA 3GICB 3SV9A 2BY5X 3F2HA 4NWKA 1Z71A 2ZFFH 1GVKB 2FI4E 2EI7A 1H8ED 2TGPZ 2CK3D 4DW2U 1YM0A 1YLCA 3VXFH 4K5ZA 3LDXH 2Z6BD 1GI6A 4ZROA 8LPRA 2OD3B 2PLXA 1TGBA 1AZ8A 3TNTA 2GGVB 2V35A 4TPIZ 3SU0A 2BLWA 1O3JA 2AS9A 1S0RA 2QF3A 1AKSB 1YLDA 1K22H 4ZHAA 1F0SA 2ZG0H 3KNXA 3EDXB 4FUFA 2YMSD 5A8ZA 3S9BA 3QGJA 1TLDA 4FUDA 1ARCA 4Z0KA 3TH2H 3GCHC 1P12E 2KM0A 1SFIA 1XKBC 3UQOA 2V7QD 2ZDAH 4X6OA 1NT1A 5FX6A 1AUTC 3FP8E 1ZR0A 4I86A 2BOHB 1C2FA 4BXWA 4AN7A 2BVSH 1E38B 1P04A 3RMMH 2NU2E 1C2HA 1VCQA 2AFQB 2JH6D 3FANA 1EZSC 1PPEE 3QLPH 3OTJE 1KMHB 3OEED 3DSGA 1E1QD 2AGIX 4MNYA 4DGJA 3SUFA 1J16A 1HJAB 1EZQA 1ZJDA 4UD9H 2BXUH 1K1JA 5DPAA 1D3PB 1GHBF 1O2SA 1EASA 4ZH8A 1AGJA 1BBRH 1HGTH 3S9AA 3MNBA 1BRCE 2FOHA 3KQCA 1VITH 5K0HA 1SGIB 5CMXH 2VU8E 1SQAA 4I8GA 2D2DA 1OP0A 2FOAA 1FN6A 3HATH 3TVJB 3GY3A 2FDAA 3MI4A 4RKOB 2Z9KA 1XXDA 3TH3H 3RMLH 3UREA 1UTNA 3ATLA 2FYQA 4JMYA 1O2RA 2CHAC 2ZPRA 1EQ9A 1LPZB 2UWOA 2XRCA 3G01A 3LC5A 4M9FA 1VCWA 3AAUA 2AYWA 1AFQC 1EB2A 1G2LA 4K60A 1GI9B 3FZDA 3MU4A 1CGJE 3ZYDA 1YPEH 4YTAA 3PLBA 1T32A 3W94A 1PPFE 2JKHA 3FOAA 2Q6DA 2Z7FE 3DA9B 3HK3B 1MABB 1OWDA 3VFEA 3ZYEA 3OE7D 1Y5UT 1ZHRA 2P16A 3LT3A 4HFPB 1SHHB 1DWEH 1VGCC 3RC5A 4X8TH 1GI5A 2KAIB 1VJ9U 1BIOA 1UCYK 1C5TA 2FEQH 1MH0A 1UVSH 1SMFE 5DP3A 1A61H 1IOEA 1LQDB 5FPTA 4BXSA 2P3TB 5ESBA 1AQ7A 1O2HA 1EUFA 1UW7A 3GCTF 1ESTA 3Q77A 2GJGA 1C5RA 2PTCE 2W6ID 1SGRE 5LPRA 2HLDD 2VNTA 1FPHH 2EI8A 1DSUA 1P3CA 1AB9B 8GCHG 4F48B 2HLCA 2WPKS 2Z3CA 1RGQA 2IN2A 1AZZA 1DUAA 2P93A 4XBBA 2OC7A 1O33A 4FVBA 2NU3E 1Z8RA 4I33A 1E0FD 1T8OA 2Y7XA 3LIWA 2XNIA 1J8AA 1YP9A 2Q6FA 1TE0A 1E34B 4IS5A 2HNTC 1CA0B 5FPYA 2DUCA 5EIYA 2DE9A 2BDBA 3SJ8A 5DO4H 4CRBA 5EQRA 2AGEX 1ZHMA 1DWCH 1XUGA 1C5YB 1MU6B 1FUJA 1ESAA 4AG1A 1HUTH 1GMDG 1ZRBA 3T27A 1LPGB 4Q80A 3PYHA 1TQ0B 1CE5A 2IJD1 1WOFA 1YPKH 1N1LA 1ZHPA 3ZZ9A 4ZKSU 1K21H 1NFXA 1SFQB 2W26A 3AW0A 5FHTA 1ACBE 2Y6TA 1GDNA 5J4QA 3NK8A 1PYTC 5EPNA 2WPMS 2SGEE 5F6MA 1QB9A 3BEFB 2BD9A 4AFSA 4RSPA 2JJ1D 3PTBA 2HGTH 5E0JA 2XC4A 5KEDA 1BBRE 2SNVA 4NGAH 3GCNA 1IQLA 3PWCA 4UE7H 1UK3A 3LGIA 4Y7AA 3SO3A 3MTYA 4B1TA 2JH0D 2ILNA 1UTPA 1G37A 3RXOA 1O37A 1P8VC 1D3QB 4ZXYH 3S7HB 2EY4C 1ESBA 1G3BA 2GCTC 3PTNA 3SUGA 5E2PA 1VITF 2FESH 3M37A 1SB1H 5C5OA 4UFGH 3EQ0H 1K1MA 3QZQA 2BX3A 4INHA 1SKYE 1TOMH 1BDAA 4FVDA 1BRAA 4IC6A 3KHVA 3SYJA 1UHBA 3QTOH 3R0FA 1YC0A 3KN2A 4DIIH 3SHCH 2AMDA 3P8OA 3RXQA 1HAHH 4F4OC 1FONA 5LH8A 1T7CA 1GDUA 3ZIAD 2ZEBA 1TNIA 1BMLA 3RXMA 2V0BA 1QJ6B 2VIOA 1RIWC 2O8UA 3PO1B 2VBCA 4BAOB 1O2VA 4NSYA 2Y82A 1OWEA 3N99A 1HJ8A 4FOUC 4HI3A 3UAIC 2ZWLH 3E8LA 1HNEE 4O3TA 3RC4A 3A81A 3RU4T 4Q7XA 1A5IA 3V0XA 5IK2D 1EAWA 4K69A 3QO6A 4X1QU 3EE0B 5FCRA 2ANYA 1AVWA 1LO6A 2KZ4A 5G4BA 1A0JA 4Y0YE 1ELCA 1O2XA 1UVUH 2VIPA 1ANCA 1C2GA 1UJ1A 4B76A 4OS1A 4BAHB 1TBZH 2ZGJA 1TPOA 1V2PT 1P3EA 2VWMA 3LPRA 1KLTA 2BD2A 2IPHA 2ZDNA 3QZRA 1BHXF 2WYGA 4WH8A 5A8YA 1HAPH 2WV4A 1MKXK 1CHOG 2ZF0H 5T6GA 1OSSA 1OYQA 3RC6A 1FNIA 3UR6A 4NIVA 4NA7A 2HALA 3B23B 2FZZA 1DT2A 2W3IA 1GJBB 3OEHD 4ZHLU 5EXNA 3K65B 1GVZA 2B0FA 2QXGA 2Y5HA 2VGCB 4YT6H 1Z1IA 5C1YA 2G5NA 3PMHB 1XUHA 1ELVA 2Y5GA 5FBIA 4YT7H 1S6FA 4F55A 4A5TS 3CS0A 5E2OA 2FOCA 5IDKA 1OP8A 5DJ7A 3RXPA 3BTDE 2ANKH 1WXRA 4I7YH 1P57B 2ZDLA 1LVOA 3SU3A 4CR5A 1H4WA 4MPUA 1W14U 3F9FA 1IQFA 4X6NA 3TNSA 2A5KA 1C1RA 2VH0A 2W3KA 1RRKA 3ESTA 4H6TA 5C0UA 1SGFG 1AFQB 4UFFH 2GCHF 5EXLA 1FIWA 2AGGX 4INKA 2THFB 1ZSLA 1WTHD 3B8JA 1OWIA 4LZ1H 1NFYA 3MMGA 4X6MA 1RD3B 4Y7BA 1VGCB 4K8BA 1O35A 1DANH 1JOUB 2CV3A 1AU8A 3JZ1B 2PWXA 2ZDKA 1W7XH 5TCCA 1TA6A 3GISB 3H7TA 3Q3XA 1C4Y2 2YOLA 1KXBA 3H7OA 1O3FA 1K1IA 3U8RH 1C1SA 4DVAU 1TALA 3FVFB 3GY2A 5C17A 2OXSA 2ZU1A 1TAWA 3RXAA 1FAKH 4H42U 1CU1A 1O34A 2ZP0H 5JBTA 1HIAA 3QN7A 5GPIB 1MTNB 3PB1E 3KF2A 2BY7X 4OS2A 2FWWA 1A0HB 4RKJB 3EGKH 3RMOH 4TY7A 5L2ZH 4FUHA 3TJVA 1BRUP 1PQ7A 1XUJA 2OTVA 3UOUA 2P94A 3ODDA 3RXUA 1ZOMA 2KAIA 3PM3A 4B6EA 1DITH 1F0RA 1TONA 4UFDH 4AB9A 4GHTA 4M7GA 3VGCB 1ZMJA 1GHXH 3M5NA 4GSOA 3A83A 4U01A 1CBWC 1LHGH 4ZKNU 1GJ6A 2H5CA 3GY6A 1UVOA 1O30A 1CGHA 1EX3A 1J14A 2SGDE 2BDIA 2QAAA 1QFKH 2PP6A 1RS0A 1YPMH 3A7VA 5DP9A 2P95A 1GMCF 2W7UA 2XYAA 1O2KA 1ETSH 1ELGA 1O36A 3QK1A 3TIUA 4ISLA 4Z1MD 1NRQH 4P00A 6GCHF 1GHAF 2GD4B 1BA8B 2VVVA 4Y79A 1KXDA 5AFZH 2FOBA 1SGFA 2WPLS 3WW7A 1QA7A 3E1XB 2UUJB 5F8TA 2VWOA 5JBBS 1F92A 2BZAA 3LGTA 1BRBE 1QBNA 3PV5A 3LH1A 1HXEH 1G9IE 1KXAA 1WBGB 1GBJA 1BTPA 2FOEA 1LVYA 2IJOB 3M61U 1EPTB 1C4U2 4TSFD 1C5OH 1SGPE 1FLEE 2PHBA 1QBOA 4CR9A 2STBE 4Y11E 2AHME 1EZUC 3OY5U 2RDEA 3FKSD 1ARBA 1CT4E 3SU6A 3VG8A 1Y3XA 1NRNH 1NS3A 2C93B 4GAWA 3BG4C 4MNXA 2HPPH 2A31A 4OGXA 1C5XB 2ANWA 4AGKA 4AORA 1RIWB 2D26C 1S5SA 2OC1A 2Z9JA 1LHCH 3MO6A 5C2ZA 2ODPA 2M2AA 4ACBA 1KIGH 3UOPA 1KSNA 4FUGA 4ZUHA 1N8OC 1KTSB 5JPMH 5JYIA 1QL7A 2WV9A 1BTYA 4H6SB 3FP7E 3OAAD 1C5WB 2CF8H 5C1XA 1CT2E 4XE4A 2ZHEH 3CENA 3BTKE 4X1NU 5GIBA 1GBLA 2J92A 1JRSA 2JETC 2YNAA 3A84A 2ZIQH 3SOSA 4RI0A 1DY9A 3I77A 1NRRH 1DWBH 3SI4H 2ZA5A 3LONA 3GDSA 3O8CA 2M5TA 1O3KA 4YLUA 1FDPA 3KQ5A 3MO9A 5CHBA 3WY8A 4KKDA 2VVUA 2J98A 2WPIS 4XBDA 2HOBA 3EAJA 1GHBG 1MCTA 1NZQH 4KP0A 2H2ZA 3RDZA 1GMHF 1SLXB 4I8HA 4DT7B 2ZU4A 2A4RA 4XBCA 1C2MA 3IG6B 4NCYA 2FODA 4FETA 1DE7H 1XVMA 2QF0A 1EAXA 4QT8C 2QXJA 1D3DB 1KXEA 1C1PA 2LELA 2FS9A 3SNCA 4ESTE 5CE1A 4A7IB 1F5RA 2XBXA 4VGCC 4AG2A 3TGKE 2Z9GA 1GHVH 1ABIH 3SZEA 2HRVA 3ODFA 3RU4E 1LVBA 3NXPA 2GZ9A 2R3YA 4R0IA 5EPYA 1FY8E 2J34A 3OYPA 2G8TA 3FZZA 3E3TA 1UMAH 1RTFB 2A7CA 4DURA 3UTUH 4TWWA 1TWXB 3UUZA 1YPJH 1GHZA 1BJVA 1SBWA 1O39A 5KECA 2V3MA 1NPMA 1WQSA 5T6DA 1BHXB 1MZDA 2B7DH 4RT1A 2F9UA 1WCZA 1GI7B 4YESB 3ZVFA 1SGNE 3A8DA 1TOCB 1TPPA 1F7ZA 1W8BH 4RN6A 3TPIZ 2H5DA 3E91A 3AK5A 1CA8B 1K1OA 4CHAC 1GI1A 3GYMA 1WV7H 2EC9H 1G2MA 1ELTA 3GCTG 1GCTC 3LU9B 4MQAA 5GJ4B 1HFDA 3NWUA 4HGCA 4U32A 4BTIB 4A1VA 1N6YA 1KLJH 4THNH 4DT4A 2SGPE 3GYLB 2A2QH 4WXVA 4BNRA 3HPTB 1TMUH 3RP2A 3HGNA 4Q2KA 4JK5A 2LP6A 1K1PA 4Y0ZE 3AASA 5EXMA 2NWNA 3VXEH 1SGYE 4MDSA 9ESTA 5HGGA 2GV6A 1BTUA 1NROH 4Y8YA 1C1QA 3VB4A 1C2EA 1DSTA 1HPGA 2FLBH 1F0TA 1VJAU 5TJXA 2XBVA 1L4DA 1P02A 3RXFA 1NO9H 4ABIA 1LKBA 2RG3A 4TWYA 3D65E 2CGAA 1FY3A 2P3UB 3Q76A 1QY6A 1NM6A 1J17T 2VWNA 1YGCH 3MWIU 1QRZA 2V6NA 3SV6A 1SL3A 1J9CH 3RMNH 1Z8JB 4I8JA 3ZV9A 3BTFE 4JYUH 3TJUA 3ZZ3A 3F1SB 3SV7A 1C1NA 1G3CA 1BITA 1ETRH 1MTWA 2CN0H 3M7UA 3UWJH 1G32B 1O5EH 4KTCA 1KDQA 3OY6U 3LC3A 4ABFA 3P6ZB 1DFPA 1BMNH 2PUXB 2QXIA 2P8OB 1T8MA 2XWBI 3SU4A 1SR5C 2BY6X 1NU7B 2AMQA 2HNTE 1SOTA 3SHAH 5EJLA 4ACAA 2PSXA 1CBWB 2A5AA 2BDYA 1EJMA 4Y71A 5DSFA 3H5CB 2ZC9H 4PROA 4MPXA 3SUDA 2F3CE 1DY8A 1W12U 4O9VA 3BF6H 2GDDA 2EI6A 1C5ZB 4DY7B 4BAKB 4ZMAH 2J94A 1O2YA 1GGDC 3OFND 2ZU5A 2Z9LA 2HNTF 4K1SA 2K8IA 1HBTH 2OINA 1HLTH 4X2WA 1UVTH 4GUXA 2A1DB 4AFZA 1ZJKA 2ZGCA 3MNCA 3MH5A 1H9LB 2KCAA 4R8TB 5EGMA 3ZVCA 2QF4A 3MU0A 1YBWA 1GBEA 1P2QA 2ESTE 2O8MA 4H4FA 2ZQ1A 1VITG 5ABWA 3DHKH 2V3OH 1G3DA 5C3NA 1AMHA 2GMTC 2TGTA 4NA9H 2UUKB 3JZ2B 1FJSA 1P2MA 2GKVE 3F0OA 2PUQH 1S85A 2ANMH 3T26A 4NA8A 1T4VH 4AZ2B 1LTOA 4K8YA 1AWHB 1A2CH 4E05H 2QXHA 1JXPA 4YLQH 4D9RA 2R9PA 1V2ST 1BMAA 1J15A 4MPWA 2BLVA 2XW9A 3HKIB 1ZMNA 1FPCH 2P3FH 1C2JA 1DVAH 1ID5H 2ASUB 4YM9A 3A7WA 5HXFA 1FV9A 1C1UH 1W0ZU 3RXIA 1RFNA 1E37B 3SW2B 2F9PA 3EE7A 4FUIA 4IN1A 5TCAA 4ABGA 3ZZDA 3O8DA 2BD8A 1MD7A 3F9EA 5AVDA 2GX4A 2ZHWH 1EAIA 2H9EH 3T28A 1C5QA 1O38A 1EJNA 1NFWA 3ATIA 4WXIA 5PTPA 1OWHA 1KXCA 3OTPA 1L1NA 1P09A 1O3HA 1TABE 3ENSB 5B6OA 1O5GH 1YPLH 3UNSA 1BUIA 1O3CA 4UDWH 4ISNA 2OQ5A 1T8LA 4UFEH 4JZIA 1QB6A 4GHQA 4HTCH 5DG6A 1P2KA 1SHYA 2F4LA 1MBQA 1K2I1 2QY0B 1P2JA 1GDQA 1Y3UA 4BTTB 5EODA 1TX7A 1O3BA 3VB6A 2J38A 2ZCLP 4NWLA 1GBAA 1KY9A 1A4WH 2QN5T 1YY3A 3T5FH 4ABEA 4OS4A 8KME2 4GPGA 5CDFE 3R3GB 5EW2H 5JB9S 4FUCA 1HAYB 4Q4LA 4OS6A 3C27B 5H4IB 4JCNA 2ALVA 1FQ3A 5EQSA 3ATMA 1DX5M 2AERH 2C8ZB 1CO7E 4MG3A 3A8CA 2GCHG 1V2OT 1THRH 1V2WT 2BVXH 2RDLA 5F03A 1GPZA 1V2UT 1D6WA 1TRMA 2F9OA 3A82A 1P2OA 1QA0A 3RXKA 5HIYA 1NY22 1L2EA 3ZZ4A 4XSKU 1O3EA 1ELDE 3GY7A 4IGDA 1O3MA 5K7RA 3SV2H 3P8NA 4Y10E 1S81A 1OPHB 5AF9H 4K3JA 3A8BA 1DDJA 3GDUA 4KGAA 3GCHB 1OS8A 3LOXA 2UWLA 1AE5A 1DXWA 1VR1H 1C4V2 1D9IA 1A5GH 1DS2E 3Q00A 1BJUA 1TPSA 1OX1A 1GJ9B 1P0SH 2O8WA 2OCVB 3LGUA 4J2YB 1UO6A 5BPEA 2JDID 2YMSC 2FXRA 4AX9H 2ZFPH 1Y3WA 1AUJA 4K1EA 3MFJA 2BXTH 1SVPA 3SJ9A 3GCOA 2BYAX 2P59A 1O2LA 1H8DH 3P8GA 2WUBA 3A7ZA 3A86A 4Y8ZA 3V3MA 2BMGB 1YCPK 2PSYA 2ZCKP 3KYGA 2FLRH 1GHYH 3ZZAA 1G36A 1SGTA 2F9VA 4ZXXH 1GG6C 2BD5A 2QCYA 3UY9A 7GCHF 4X1RU 2D8WA 5J4SA 1AKSA 2XBWA 1C5UA 1F5KU 1HB0B 2IPQX 3BN9A 1TRNA 5C5NA 1CHGA 1WU1A 1W11U 1O3NA 5A0CA 1EXFA 1GBHA 5A0BA 3BTQE 1AI8H 4E06H 3MU1A 2ZNKH 3S7KB 1XUFA 3DCLA 6CHAC 2CHAB 4ASUD 2PKSC 4D7GA 1GMCG 2WINI 1QR3E 2KX4A 2IOTA 2BY8X 1P01A 3LGYA 1YCPM 5CHAC 1C5PA 1XMNB 6GCHG 1LHEH 1GHAG 4Y76A 5BRRE 1AN1E 1Y8TA 4CRCA 1MTVA 3E6PH 4D76A 4YOGA 1V2QT 2O8TA 1LQEA 3ZZ8A 5E8EH 2BQWB 2TGDA 1TGSZ 1KXFA 1ZGVA 4AFQA 3PWBA 3UB0A 2SNWA 1MKWK 3PMJA 4WVPE 1C5LH 1H1BA 5JB8S 2BLQA 3RXVA 1RTKA 4B2AA 1YF4A 3DD2H 1WYKA 2ALPA 1MCVA 2OC8A 1MTSA 4MNWA 3N7DA 1VKYA 1NRSH 5EW1H 4IBLH 1XVOA 3WWBA 1OWKA 1V2VT 3URDA 1GL1A 3MU5A 2CF9H 3LGWA 3BSQA 1IHTH 4WY3A 2EA3A 2OP9A 3MH6A 1HAOH 4UEHH 3GY8A 3BG8A 3P8FA 4KELA 1O3PB 3ZVAA 2FX6A 3W95A 1BTXA 1B0EA 4MLFB 1O2NA 3MNSA 1MBMA 1ZYOA 4FXGH 1TX8A 1GBDA 2VIWA 1C1TA 1GHWH 4ZKOU 2WV5A 2LPRA 1EB1H 1UCYE 3RXBA 4BOHA 3BEUA 1D4PB 2L6OA 4FUJA 1O5BB 3SU2A 2PGBB 2HPQH 1C2IA 3MOCA 2KCYA 4ZCNA 3QX5H 4JK6A 5C67A 1C5MD 1TYNA 3KCGH 3MU8A 3RXHA 4E7RG 1DICA 5FBEA 1V2MT 1HJAC 5EQQA 1BMFD 1S84A 2ZTXA 4WMDA 2OBOA 2FX4A 1EJAA 1MQ5A 2FP7B 2FMJA 1X7AC 3ZVGA 1V2KT 3DSOA 4HZHA 2FI3E 4SGBE 1GMHG 3K6ZA 4IW4E 2R2WU 2XTTB 1ZMLA 3M7QA 1K1LA 3MO3A 2ZFQH 1T31A 1ZLRA 1AFEH 1L0ZA 2J5UA 4DJZB 1QHRB 4FU7A 2VWLA 1MKXH 5ETXA 1Z1JA 2FM2A 2CXVA 3UQVA 1Y3VA 1QRWA 4JZFH 4TT3D 4OS7A 3M3VA 3OX7U 3U69H 4Q7ZA 1O2PA 1INCA 1QB1A 3PV2A 3A7XA 1O2QA 4INLA 2ZO3H 3TJNA 5GCHF 3VB7A 6LPRA 2WYJA 1MU8B 1O2GH 3TGIE 3UPEA 5JBCS 1TBQH 2GCTB 4CRAA 1NC6A 2G55A 4TYDA 2J4IA 1P9UA 2CJIA 2AIQA 3SJIA 4MPVA 1QTFA 1LVMA 4CRGA 1ZTLA 5E0GA 3SNDA 2ULLA 4MTBA 4IN2A 1YWUA 2SGQE 2BLOA 1ZSJA 4ABDA 1S0QA 3ATWA 2ZQ2A 3RLWH 1EP5A 5HKKD 1BT7A 2BM2A 1UTOA 2BOKA 2UUFB 1AVGH 4ASHA 3KQBA 5LGOA 1FY1A 2ZTZA 1QJ7B 1O32A 2G4TA 2W6JD 2G51A 1FMGA 2H1UA 3BEIB 1WAYB 4JYTA 7ESTE 1UK2A 1NESE 1AB9C 1THSH 3F9GA 4ISIH 4CREA 2GT7A 4GCHF 3M3SA 1WDIA 2KR7A 3PLKA 3D23A 4GLYA 1K0HA 2SFAA 2R0KA 1V6DA 2XXLA 1S6LA 1ZPBA 3EA8A 3SNEA 3RXSA 1Q31A 1O2TA 4ABJA 1PFXC 1BBRK 1COWD 4AOQA 1K28D 1UTQA 1SI5H 3EA7A 2KCPA 3KQDA 1XUIA 2R0LA 1DWDH 1C1MA 1NU9A 1TMTH 2C3SA 3BTWE 4O3UA 1CGIE 1QQ4A 1NBME 5EJZA 3ZVEA 4OS5A 4O97A 1QBVH 1LDTT 2RCEA 1O3OA 4X1SU 4TY6A 1PYTD 3UR9A 4AYVB 3SGQE 3CP7A 4DG4A 2BD3A 2VJ1A 2OBQA 4OM9A 4WJG2 1NRPH 2WZQA 3MYWA 1LHFH 1O5CB 1UHBB 1FN8A 1GJCB 2QIQA 4LXBH 3KEEA 1SG8B 1Q2WA 3RXCA 1ZTJA 5F8ZA 2BHGA 2WPHS 1A0LA 1EAUA 1C2LA 1IQNA 1GVLA 1E36B 4NIYA 2ZTYA 1OP2A 5SGAE 2WPJS 2Y81A 4ZHMU 3M35A 1TNLA 1W13U 2B5TB 4IC5A 3EYDA 1IQIA 3V12A 7LPRA 1YPHC 4CH8B 2ZHFH 1E35B 2Q6GA 1EZXC 1TFXA 5DP5A 4Q7YA 4CRDA 1UK4A 2EQNA 1S6HA 2AEIH 3L6PA 3RXGA 3SJKA 4B75A 3RXTA 1EOLA 1TPAE 4U30A 1V2NT 1ZSKA 1BCUH 1D3TB 1TMBH 3PLPA 3QWCH 2NU1E 3A8AA 1Y59T 1TGCA 2G00A 3KYFA 2TPIZ 1CT0E 1FX0B 1XX9A 1AE8H 2F43B 1O2WA 1ELAA 3ATKA 1P2NA 3C1KA 4I32A 2ZFRH 2RA3A 3ZZ5A 3A80A 1QIXB 3F9HA 2EEKA 3L3TA 3PO1C 2GVFA 1H8IH 4GVUA 2BDCA 2BQ6B 1GL0E 1UVPA 2KCOA 1HAGE 3TJOA 1OOKB 1KLIH 3U9AH 2C8WB 1E79D 2ZZUH 1MZAA 1SLUB 3NKKA 4X8SH 5EJ1A 4B2BA 1HAXB 1DPOA 3SNBA 4NZQA 4JZDH 2XOKD 1JWTA 2QE7D 2VVCA 1ELFA 4I8LA 5FAHA 3F0PA 3A87A 3V13A 3SUEA 4YZUA 1SPJA 1G3EA 3PMAB 1MAYA 1MUEB 1BTWA 2F9BH 2JH5D 1K1NA 2A4GA 1UTKA 4I31A 4XFQA 2D1JA 4D7FA 4IMQA 3L33A 1HV7A 1HXFH 4YOIA 3A7YA 2BX4A 2G52A 2H9TH 1O3IA 1MQ6A 5T1VA 1SC8U 4WMFA 4CBNA 1ZZZA 5GNDA 3DFJA 3ZVBA 3TGJE 1BB0B 1KYNA 2XWAA 4JZEH 1QRXA 1L1JA 2FTMA 3K6YA 3K9XB 2GZ8A 3E0NB 4XOJA 1A1RA 3URCA 2J95A 1BQYA 2ZHDA 1C1WH 1HJ9A 1Q3XA 1W7GH 1A5HA 1SGEE 3ZZCA 4A1TA 3VB3A 3S9CA 1GJ5H 2VGCC 1MTUA 1SSXA 1TQ7B 4LK4A 3Q3KA 4X8VH 4B73A 1OHHD 2J9NA 3GOVB 3VB5A 1GJ4H 2QYIA 2BD7A 1H9HE 1XM1A 1GBMA 2BTCE 1PQ5A 3D49H 1GI8B 5FXLA 1PPGE 2K1QA 2VIVA 3KQEA 3VPKA 2XCNA 1HIAB 1GCDA 1O5FH 1TNHA 2TRMA 1O2MA 3BTME 4A92A 2NU4E 1Y5AT 5F8XA 5KGOA 3M5LA 3MQKC 1C9TA 2ZDMA 2G4UA 3S69A 1TBRH 3P92A 3U8OH 5A0AE 7KMEH 5FX5A 2FPZA 2Q1JA 1VZQH 5IYTA 3PV4A 2V3HH 3PMBB 1HAVB 5C0TA 5L6NH 1O3GA 2F83A 4NFEA 3BG4B 1D6RA 3NCLA 3BV9B 3TU7H 5L2YH 2TGAA 2BDGA 5FPSA 1RXPA 1TGNA 3UWIA 2B9LA 1TGTA 4YOJA 3MHWU 4MVNA 3T2NA 1F2SE 1IHSH 3AAVA 1TNKA 2Z9IA 3KL6A 1N8OB 1WTGH 1S82A 2GDEH 3ITIA 3FFGA 4BTUB 1TRYA 3PRDA 1SQOA 4NIWA 2ZFSA 2JETB 3ZV8A 1MTNC 1Z6EA 4FUBA 1O31A 1W10U 5E0HA 3SGAE 2Z3DA 3M3TA 4LZ4B 1Z8IB 1PPZA 1T4UH 2ZU3A 3F6UH 2B8OH 1EPTA 2Y5FA 4BANB 5FCKA 2A0QB 2Z3EA 3P95A 4B71A 1DM4B 4X2XA 4JYVH 3OSYA 1GI4A 3QGNB 2H9HA 3E16B 2A7JA 2PKAB 1B5GH 3F68H 1W0JD 1V3XA 5HM9A 3SU5A 3CNRA 4AFUA 1ANDA 4FU8A 1YPGH 3VGCC 1HCGA 4BAQB 3HK6B 1C9PA 3O8RA 4DIHH 7GCHG 4K2YA 5DP6A 5T6FA 4WMEA 1P06A 1GBTA 2AIPA 1SOZA 2ZPSA 4NG9H 4XRNA 3SORA 4VGCB 3GS9A 4D9QA 1GI2A 2A4OA 1ZPCA 3U1JB 4ISOA 1EKBB 1O3AA 4Y6DA 4MNVA 4F49A 1C2DA 1OYTH 4CRFA 1GBFA 3RM2H 3ZZ6A 4LOYH 3P17H 1EOJA 1TNJA 3NRLA 4WH6A 3SJOA 2A2XH 3M7TA 3QDZB 3TLOA 1DUEA 5ESTE 1RTLA 5GDSH 3VEQB 1TB6H 1TX6A 1LCYA 3IWMA 1GBBA 2O8LA 2A5IA 1K9OE 2FYRA 1F0UA 4D8NA 2PGQB 4A1XA 3Q3YA 1EPTC 3RLYH 1OWJA 3BIUH 5C1UA 1O0DH 2ZGXH 1YYY1 3STIA 2J98B 5F53A 3A85A 5I25A 3T25A 2VINA 1LKAA 2ZPQA 4CHAB 1UCYH 1AIXH 1GCTB 1EP6A 1ZPZA 1YLNA 3BTHE 2PFEA 8GCHF 4YO9A 4Y8XA 2OC0A 2FOGA 1FXYA 1V2LT 4E7NA 2ZGBH 1FAXA 1C5SA 1DOJA 5DKMA 3U8TH 3I78A 1G30B 1NN6A 3QUMP 5C20A 3NZIA 4NZLA 3TK6A 2ZI2H 1A3EH 1H8HD 3FN8A 1M9UA 2OK5A 2GTBA 3BTTE 4NFFA 4X0WU 2VIDA 1S83A 3M36A 3NUMA 3FO8D 1FI8A 1HAIH 1IAUA 1P11E 1C1OA 3U98H 3FP6E 1GMDF 5A09A 4OGYA 2K0QA 3SGBE 1HRTH 3D62A 1CVWH 1AY6H 2W7SA 1O2ZA 1B7XB 1Y3YA 1GI3A 1AHTH 5A8XA 4SGAE 1SLWB 2BDAA 8ESTE 1LHDH 1P2IA 2AH4X 1NFUA 3UFAA 1W2KH 4K1TA 1NTPA 1P10A 2YNBA 2OLGA 2VIQA 3UIRA 1PPCE 1PQ8A 2BVRH 3DUXH 4IMZA 2F9NA 1C5VA 4WF8A 3ZZ7A 3TK9A 3FAOA 2A32A 2QV1A 5FL7D 3DSPA 3ZZBA 2DE8A 5AHGH 1BOQA 2J2UA 1F5LA 2Y80A 1O5DH 3DFLA 3BTGE 1TIOA 1ELEE 1GJ8B 1GGDB 3LJOA 4KTUA 1OKXA 4ABBA 3LJJA 2ZFTA 3LGVA 3S0NA 1WQVH 2ODQA 1Y5BT 2ZHQH 1LMWB 3SI3H 3TK5A 2I6QA 1L1GA 1MD8A 1O2UA 3SN8A 4BAMB 5GCHG 1BZXE 1SGQE 2J97A 3CS7A 4XD7D 2QC2A 1JIMA 1XKAC 3GY4A 3KIDU 4RT0A 1Z6JH 2FTLE 2RFKC 5HM2A 2NU0E 4U2WA 1QZ8A 1UTLM 1T8NA 2QGRA 1NBMD 4DOQA 3TH4H 1AD8H 4Z6AH 1A46H 2GMTB 5DP8A 1GBIA 2XC0A 5DP4A 9LPRA 2HVYB 2SGFE 3TITA 1IQEA 1V2TT 1JMOH 5A2MH 1ORFA 5LPFA 1P03A 1UTJA 4JZ1A 2WUCA 1CSOE 4FUEA 1GBCA 1AO5A 1KDQB 1PJPA 1N6XA 2L74A 4KTSA 3T29A 1O2JA 3LKWA 5C94A 2AMPA 1LPKB 1C1VH 1DLKB 2A45B 3HKJB 5JBAS 4X2VA 6ESTA 1WUNH 4B6FA 3E0PB 3SNAA 3I29A 2TIOA 5EU8A 4ZAEA 2I6SA 3GDVA 3UNQA 3RU4D 2G5VA 2C8YB 3SBKA 2C90B 4GCHG 3MNXA 3P70B 5DGJA 1PPHE 1A3BH 4NIXA 3RXRA 1RJXB 1ANBA 2LNCA 1P05A 2UWPA 3SZNA 1W3CA 3SQEE 3MH7A 1JIRA 1ZTKA 1QQUA 5GWZA 2ZKSA 1HYLA 5T3HA 1JRTA 1OXGA 3A89A 2ZCHP 2FO9A 3RM0H 2ZECA 1ETTH 3RXEA 2BB4A 3B9FH 1O2OA 2BZ6H 3W1EA 1ABJH 3SU1A 3ZVDA 5EG4A 1THPB 2WPDD 1EATA 3U28C 4YXWD 2BDHA 1P9SA 5EOKA 1CHOF 4XDEA 3WWFA 2FOMB 3F2GA 1BTZA 1HAVA 2OQUA 1PQAA 5AFYH 3STJA 1IQKA 2P8OC 5GXPA 2G81E 1YCPH 1EFRD 2UUYA 3T62A 1AWFH 2HWLB 4FU9A 2XBYA 2RA0A 3V7TA 2VH6A 2C4FH 2ZGHA 5HMAA 2A7HA 5I46H 2C8XB 4CH2B 1WSSH 2BD4A 4NSVA 2GV7A 3PROA 2VB0A 1FZZA 1GI0A 2ODYB 2OUAA 2PTNA 4ABAA 1C5NH 1YKTA 4Q63A 1XXFA 1W0KD 2XCFA 4I8KA 1W0YH 1QL8A 3EA9A 2BQ7B 3HGPA 2PV9B 4HG6A 2XNDD 3RXDA 1SQRA 3KGPA 1U6QA 1SGDE 2QA9E 4X8UH 1FIZA 2JJ2D 1BMMH 1MMJN 2O9QA 4X2YA 3AVZA 1O3DA 3RXJA 4J1YA 5HIZA 3K2UA 3UNRA 3RXLA 3M5MA 1GJ7B
chains in the Genus database with same CATH topology
1B0FA 2PKAA 3BIVH 1QL9A 3DT0H 1ZGIA 2W5EA 4ABHA 1O3LA 3MH4A 4AYYB 4B74A 1CQQA 2F91A 4TPYA 2SGAA 3IITA 4ISHH 5DP7A 1GJAB 1GWAA 1YPHE 2FOFA 2R3UA 1MKWH 4X6PA 3AW1A 3OU0A 1FY4A 5L30H 1V2JT 3GY5A 1O2IA 1VCPA 1IQJA 1IQMA 1ZRKA 5LPEA 2XC5A 3M5OA 1CA0C 3RUOA 1A7SA 2BY9X 1SQTA 3LH3A 3A7TA 1UTMA 3N7OA 1QGFA 2FS8A 4B2CA 1DLEA 1KTTB 2R2MB 4AGJA 1TA2A 1TNGA 1AVXA 3QTVH 1QNJA 4AB8A 2HVXA 1QJ1B 2ZDVH 1HAZB 3ELAH 1PPBH 2PR3A 3NPSA 4DCDA 1H9IE 1JBUH 4CBOA 1GG6B 2FIRH 1BTHH 1GBKA 1XUKA 1HDTH 5HYOA 1DXPA 1GJDB 4UONA 1ANEA 1V2RT 2GT8A 1Z8GA 2A4QA 2GP9B 1IQHA 2Z94A 3E90B 2STAE 1ELBA 2H6MA 1SLVB 4A6LA 3U1IB 1QURH 1O5AB 2ZU2A 1FY5A 4O03A 1MAXA 1Z7KA 6CHAB 2PKSB 4WWYA 1QCPA 3SQHE 4X1PU 4ZKRU 3A88A 2TBSA 1C2KA 2Y7ZA 5JDUB 2CMYA 2FI5E 5CHAB 2GZ7A 3O8BA 1SGCA 2PW8H 5DK1A 1IQGA 3SV8A 3BTEE 1L4ZA 3GICB 3SV9A 2BY5X 4NWKA 1Z71A 2ZFFH 1GVKB 2FI4E 2EI7A 2TGPZ 4DW2U 1YM0A 1YLCA 3VXFH 4K5ZA 3LDXH 2Z6BD 1GI6A 4ZROA 8LPRA 2OD3B 2PLXA 1TGBA 1AZ8A 3TNTA 2GGVB 2V35A 4TPIZ 3SU0A 2BLWA 1O3JA 2AS9A 1S0RA 2QF3A 1AKSB 1YLDA 1K22H 4ZHAA 1F0SA 2ZG0H 3KNXA 3EDXB 4FUFA 5A8ZA 3S9BA 3QGJA 1TLDA 4FUDA 1ARCA 4Z0KA 3TH2H 3GCHC 1P12E 1SFIA 1XKBC 3UQOA 2ZDAH 4X6OA 1NT1A 5FX6A 1AUTC 3FP8E 1ZR0A 2BOHB 1C2FA 4BXWA 4AN7A 2BVSH 1E38B 1P04A 3RMMH 2NU2E 1C2HA 1VCQA 2AFQB 2JH6D 3FANA 1EZSC 1PPEE 3QLPH 3OTJE 2AGIX 4MNYA 4DGJA 3SUFA 1J16A 1HJAB 1EZQA 1ZJDA 4UD9H 2BXUH 1K1JA 5DPAA 1D3PB 1GHBF 1O2SA 1EASA 4ZH8A 1AGJA 1BBRH 1HGTH 3S9AA 3MNBA 1BRCE 2FOHA 3KQCA 1VITH 5K0HA 1SGIB 5CMXH 2VU8E 1SQAA 4I8GA 2D2DA 1OP0A 2FOAA 1FN6A 3HATH 3TVJB 3GY3A 2FDAA 3MI4A 4RKOB 2Z9KA 1XXDA 3TH3H 3RMLH 3UREA 1UTNA 3ATLA 2FYQA 4JMYA 1O2RA 2CHAC 2ZPRA 1EQ9A 1LPZB 2UWOA 2XRCA 3G01A 3LC5A 1VCWA 3AAUA 2AYWA 1AFQC 1EB2A 1G2LA 4K60A 1GI9B 3FZDA 3MU4A 1CGJE 3ZYDA 1YPEH 4YTAA 3PLBA 1T32A 3W94A 1PPFE 2JKHA 2Q6DA 2Z7FE 3DA9B 3HK3B 1OWDA 3VFEA 3ZYEA 1Y5UT 1ZHRA 2P16A 3LT3A 4HFPB 1SHHB 1DWEH 1VGCC 3RC5A 4X8TH 1GI5A 2KAIB 1VJ9U 1BIOA 1UCYK 1C5TA 2FEQH 1MH0A 1UVSH 1SMFE 5DP3A 1A61H 1IOEA 1LQDB 5FPTA 4BXSA 2P3TB 5ESBA 1AQ7A 1O2HA 1EUFA 3GCTF 1ESTA 3Q77A 1C5RA 2PTCE 5LPRA 1SGRE 2VNTA 1FPHH 2EI8A 1DSUA 1P3CA 1AB9B 8GCHG 2HLCA 2WPKS 2Z3CA 1RGQA 2IN2A 1AZZA 1DUAA 2P93A 4XBBA 2OC7A 1O33A 4FVBA 2NU3E 1Z8RA 4I33A 1E0FD 1T8OA 2Y7XA 3LIWA 2XNIA 1J8AA 1YP9A 2Q6FA 1TE0A 1E34B 4IS5A 2HNTC 1CA0B 5FPYA 2DUCA 2DE9A 2BDBA 3SJ8A 5DO4H 4CRBA 5EQRA 2AGEX 1ZHMA 1DWCH 1XUGA 1C5YB 1MU6B 1FUJA 1ESAA 4AG1A 1HUTH 1GMDG 1ZRBA 3T27A 1LPGB 4Q80A 3PYHA 1TQ0B 1CE5A 1WOFA 1YPKH 1N1LA 1ZHPA 3ZZ9A 4ZKSU 1K21H 1NFXA 1SFQB 2W26A 3AW0A 5FHTA 1ACBE 2Y6TA 1GDNA 5J4QA 3NK8A 1PYTC 5EPNA 2WPMS 2SGEE 5F6MA 1QB9A 3BEFB 2BD9A 4AFSA 4RSPA 3PTBA 2HGTH 5E0JA 2XC4A 1BBRE 2SNVA 4NGAH 3GCNA 1IQLA 3PWCA 4UE7H 1UK3A 3LGIA 4Y7AA 3SO3A 3MTYA 4B1TA 2JH0D 2ILNA 1UTPA 1G37A 3RXOA 1O37A 1P8VC 1D3QB 4ZXYH 3S7HB 1ESBA 1G3BA 2GCTC 3PTNA 3SUGA 5E2PA 1VITF 2FESH 3M37A 1SB1H 5C5OA 4UFGH 3EQ0H 1K1MA 3QZQA 2BX3A 4INHA 1TOMH 1BDAA 4FVDA 1BRAA 4IC6A 3KHVA 1UHBA 3QTOH 3R0FA 1YC0A 3KN2A 4DIIH 3SHCH 2AMDA 3P8OA 3RXQA 1HAHH 4F4OC 1FONA 5LH8A 1T7CA 1GDUA 2ZEBA 1TNIA 1BMLA 3RXMA 2V0BA 1QJ6B 2VIOA 1RIWC 2O8UA 3PO1B 4BAOB 1O2VA 4NSYA 2Y82A 1OWEA 1HJ8A 4HI3A 2ZWLH 3E8LA 1HNEE 4O3TA 3RC4A 3A81A 3RU4T 4Q7XA 1A5IA 3V0XA 1EAWA 4K69A 3QO6A 4X1QU 3EE0B 5FCRA 2ANYA 1AVWA 1LO6A 5G4BA 1A0JA 4Y0YE 1ELCA 1O2XA 1UVUH 2VIPA 1ANCA 1C2GA 1UJ1A 4B76A 4OS1A 4BAHB 1TBZH 2ZGJA 1TPOA 1V2PT 1P3EA 2VWMA 3LPRA 1KLTA 2BD2A 2IPHA 2ZDNA 3QZRA 1BHXF 2WYGA 4WH8A 5A8YA 1HAPH 2WV4A 1MKXK 1CHOG 2ZF0H 5T6GA 1OSSA 1OYQA 3RC6A 1FNIA 3UR6A 4NIVA 4NA7A 2HALA 3B23B 2FZZA 1DT2A 2W3IA 1GJBB 4ZHLU 5EXNA 3K65B 1GVZA 2B0FA 2QXGA 2Y5HA 2VGCB 4YT6H 1Z1IA 5C1YA 2G5NA 3PMHB 1XUHA 1ELVA 2Y5GA 5FBIA 4YT7H 1S6FA 4A5TS 3CS0A 5E2OA 2FOCA 5IDKA 1OP8A 5DJ7A 3RXPA 3BTDE 2ANKH 4I7YH 1P57B 2ZDLA 1LVOA 3SU3A 4CR5A 1H4WA 4MPUA 1W14U 3F9FA 1IQFA 4X6NA 3TNSA 2A5KA 1C1RA 2VH0A 2W3KA 1RRKA 3ESTA 4H6TA 1SGFG 1AFQB 4UFFH 2GCHF 5EXLA 1FIWA 2AGGX 4INKA 2THFB 1ZSLA 1WTHD 3B8JA 1OWIA 4LZ1H 1NFYA 3MMGA 4X6MA 1RD3B 4Y7BA 1VGCB 4K8BA 1O35A 1DANH 1JOUB 2CV3A 1AU8A 3JZ1B 2PWXA 2ZDKA 1W7XH 5TCCA 1TA6A 3GISB 3H7TA 3Q3XA 1C4Y2 2YOLA 1KXBA 3H7OA 1O3FA 1K1IA 3U8RH 1C1SA 4DVAU 1TALA 3FVFB 3GY2A 2OXSA 2ZU1A 1TAWA 3RXAA 1FAKH 4H42U 1CU1A 1O34A 2ZP0H 5JBTA 1HIAA 3QN7A 5GPIB 1MTNB 3PB1E 3KF2A 2BY7X 4OS2A 2FWWA 1A0HB 4RKJB 3EGKH 3RMOH 4TY7A 5L2ZH 4FUHA 3TJVA 1BRUP 1PQ7A 1XUJA 2OTVA 3UOUA 2P94A 3ODDA 3RXUA 1ZOMA 2KAIA 3PM3A 1DITH 1F0RA 1TONA 4UFDH 4AB9A 4GHTA 4M7GA 3VGCB 1ZMJA 1GHXH 3M5NA 4GSOA 3A83A 4U01A 1CBWC 1LHGH 4ZKNU 1GJ6A 2H5CA 3GY6A 1UVOA 1O30A 1CGHA 1EX3A 1J14A 2SGDE 2BDIA 2QAAA 1QFKH 1RS0A 1YPMH 3A7VA 5DP9A 2P95A 1GMCF 2W7UA 2XYAA 1O2KA 1ETSH 1ELGA 1O36A 3QK1A 3TIUA 4ISLA 1NRQH 6GCHF 1GHAF 2GD4B 1BA8B 2VVVA 4Y79A 1KXDA 5AFZH 2FOBA 1SGFA 2WPLS 1QA7A 3E1XB 2UUJB 5F8TA 2VWOA 5JBBS 1F92A 2BZAA 3LGTA 1BRBE 1QBNA 3LH1A 1HXEH 1G9IE 1KXAA 1WBGB 1GBJA 1BTPA 2FOEA 1LVYA 2IJOB 3M61U 1EPTB 1C4U2 1C5OH 1SGPE 1FLEE 2PHBA 1QBOA 4CR9A 2STBE 4Y11E 3OY5U 1EZUC 1ARBA 1CT4E 3SU6A 1Y3XA 1NRNH 1NS3A 2C93B 4GAWA 3BG4C 4MNXA 2HPPH 2A31A 4OGXA 1C5XB 2ANWA 4AGKA 4AORA 1RIWB 2D26C 1S5SA 2OC1A 2Z9JA 1LHCH 3MO6A 5C2ZA 2ODPA 1KIGH 3UOPA 1KSNA 4FUGA 4ZUHA 1N8OC 1KTSB 5JPMH 5JYIA 1QL7A 1BTYA 4H6SB 3FP7E 1C5WB 2CF8H 5C1XA 1CT2E 4XE4A 2ZHEH 3CENA 3BTKE 4X1NU 5GIBA 1GBLA 2J92A 1JRSA 2JETC 2YNAA 3A84A 2ZIQH 3SOSA 1DY9A 3I77A 1NRRH 1DWBH 3SI4H 2ZA5A 3LONA 3GDSA 3O8CA 2M5TA 1O3KA 4YLUA 1FDPA 3MO9A 3WY8A 4KKDA 2VVUA 2WPIS 4XBDA 2HOBA 3EAJA 1GHBG 1MCTA 1NZQH 4KP0A 2H2ZA 3RDZA 1GMHF 1SLXB 4I8HA 4DT7B 2ZU4A 2A4RA 4XBCA 1C2MA 3IG6B 4NCYA 2FODA 1DE7H 1XVMA 2QF0A 1EAXA 4QT8C 2QXJA 1D3DB 1KXEA 1C1PA 3SNCA 2FS9A 4ESTE 5CE1A 4A7IB 1F5RA 2XBXA 4VGCC 4AG2A 3TGKE 2Z9GA 1GHVH 1ABIH 2HRVA 3ODFA 3RU4E 1LVBA 3NXPA 2GZ9A 2R3YA 4R0IA 5EPYA 1FY8E 2J34A 3OYPA 2G8TA 3FZZA 3E3TA 1UMAH 1RTFB 2A7CA 4DURA 3UTUH 4TWWA 1TWXB 3UUZA 1YPJH 1GHZA 1BJVA 1SBWA 1O39A 1NPMA 1WQSA 5T6DA 1BHXB 1MZDA 2B7DH 2F9UA 1WCZA 1GI7B 4YESB 3ZVFA 1SGNE 3A8DA 1TOCB 1TPPA 1F7ZA 1W8BH 4RN6A 3TPIZ 2H5DA 3E91A 1CA8B 1K1OA 4CHAC 1GI1A 3GYMA 1WV7H 2EC9H 1G2MA 1ELTA 3GCTG 1GCTC 3LU9B 4MQAA 5GJ4B 1HFDA 3NWUA 4HGCA 4U32A 4BTIB 4A1VA 1N6YA 1KLJH 4THNH 2SGPE 3GYLB 2A2QH 4WXVA 4BNRA 3HPTB 1TMUH 3RP2A 3HGNA 4Q2KA 4JK5A 4Y0ZE 1K1PA 5EXMA 3AASA 3VXEH 2NWNA 1SGYE 4MDSA 9ESTA 5HGGA 2GV6A 1BTUA 1NROH 4Y8YA 1C1QA 3VB4A 1C2EA 1DSTA 1HPGA 2FLBH 1F0TA 1VJAU 5TJXA 2XBVA 1L4DA 1P02A 3RXFA 1NO9H 4ABIA 1LKBA 2RG3A 4TWYA 3D65E 2CGAA 1FY3A 2P3UB 3Q76A 1QY6A 1NM6A 1J17T 2VWNA 1YGCH 3MWIU 1QRZA 2V6NA 3SV6A 1SL3A 1J9CH 3RMNH 1Z8JB 4I8JA 3ZV9A 3BTFE 4JYUH 3TJUA 3ZZ3A 3F1SB 3SV7A 1C1NA 1G3CA 1BITA 1ETRH 1MTWA 2CN0H 3M7UA 3UWJH 1G32B 1O5EH 4KTCA 1KDQA 3OY6U 3LC3A 4ABFA 3P6ZB 1DFPA 1BMNH 2PUXB 2QXIA 2P8OB 1T8MA 2XWBI 3SU4A 1SR5C 2BY6X 1NU7B 2AMQA 2HNTE 1SOTA 3SHAH 2PSXA 1CBWB 2A5AA 2BDYA 1EJMA 4Y71A 3H5CB 2ZC9H 4PROA 4MPXA 3SUDA 2F3CE 1DY8A 1W12U 4O9VA 3BF6H 2GDDA 2EI6A 1C5ZB 4DY7B 4BAKB 4ZMAH 2J94A 1O2YA 1GGDC 2ZU5A 2Z9LA 2HNTF 4K1SA 1HBTH 2OINA 1HLTH 4X2WA 1UVTH 4GUXA 2A1DB 4AFZA 1ZJKA 2ZGCA 3MNCA 3MH5A 1H9LB 4R8TB 5EGMA 3ZVCA 3MU0A 1YBWA 1GBEA 1P2QA 2ESTE 2O8MA 4H4FA 2ZQ1A 1VITG 5ABWA 3DHKH 2V3OH 1G3DA 5C3NA 1AMHA 2GMTC 2TGTA 4NA9H 2UUKB 3JZ2B 1FJSA 1P2MA 2GKVE 2PUQH 1S85A 2ANMH 3T26A 4NA8A 1T4VH 4AZ2B 1LTOA 4K8YA 1AWHB 1A2CH 4E05H 2QXHA 1JXPA 4YLQH 4D9RA 2R9PA 1V2ST 1BMAA 1J15A 4MPWA 2BLVA 2XW9A 3HKIB 1ZMNA 1FPCH 2P3FH 1C2JA 1DVAH 1ID5H 2ASUB 4YM9A 3A7WA 5HXFA 1FV9A 1C1UH 1W0ZU 3RXIA 1RFNA 1E37B 3SW2B 2F9PA 4IN1A 4FUIA 5TCAA 4ABGA 3ZZDA 3O8DA 2BD8A 1MD7A 3F9EA 5AVDA 2GX4A 2ZHWH 1EAIA 2H9EH 3T28A 1C5QA 1O38A 1EJNA 1NFWA 3ATIA 4WXIA 5PTPA 1OWHA 1KXCA 1L1NA 1P09A 1O3HA 1TABE 3ENSB 5B6OA 1O5GH 1YPLH 3UNSA 1BUIA 1O3CA 4UDWH 4ISNA 2OQ5A 1T8LA 4UFEH 4JZIA 1QB6A 4GHQA 4HTCH 5DG6A 1P2KA 1SHYA 1MBQA 1K2I1 2QY0B 1P2JA 1GDQA 1Y3UA 4BTTB 5EODA 1TX7A