1XUKA

Trypsin-babim-sulfate, ph 5.9
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xukA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xukA02
1O2RA 3SU3A 3ZZ9A 2GCHG 4GPGA 1ZGIA 1EP5A 3MH4A 1YPJH 1A5IA 3ELAH 1ZPZA 3MMGA 1ZLRA 1TWXB 1ELTA 4D9QA 5FCRA 1FY5A 6CHAB 4IMQA 1B0EA 3BN9A 4KTSA 1SLXB 3W95A 2ZIQH 3Q3YA 3E91A 3SI4H 1MU6B 2ZDKA 1O31A 3D65E 2R9PA 2ZPQA 3PO1C 1S85A 1GBFA 1HDTH 2OTVA 2A1DB 3A7TA 2FP7B 2CF8H 2ZU2A 1IQJA 1WQSA 1TNIA 4I8HA 3H7OA 2CN0H 2FOGA 1KXBA 5GXPA 3JZ2B 1AFQC 1O2LA 2ZTYA 1A61H 1QL9A 3P8GA 1NFXA 8LPRA 3MU5A 2IJOB 1V6DA 1XM1A 4O3UA 1F0SA 1PQ5A 1EAUA 3A81A 1O33A 1DDJA 2VGCB 4HZHA 3GDSA 2BY7X 3UQOA 3GCTG 4U01A 5FAHA 1LHCH 4JMYA 1GBTA 1QY6A 4LZ1H 2BDCA 3UREA 2C8XB 4ZKRU 2BLWA 4WMFA 4I33A 4HI3A 3URCA 4MPXA 4TY7A 5HM2A 1DOJA 1Y5AT 3M5OA 2WYGA 1Z8RA 4MNYA 3N7OA 1AGJA 3FP8E 3SJ8A 1SG8B 1W2KH 5EU8A 1GGDB 4BTIB 4GLYA 1XKBC 1FZZA 2XBWA 1MKWH 1UTNA 4NFFA 1NT1A 1AB9B 2BX3A 3SU1A 5JB9S 5FPSA 2ANWA 2BQ6B 1DXPA 1P2QA 2EI6A 1O5AB 2Y82A 1RIWC 1SQTA 4QT8C 1Q31A 4B71A 2BYAX 2Q6FA 3RXUA 2BVXH 2W3IA 3T25A 3UOUA 1GJ8B 4JCNA 1G30B 1WV7H 1MCVA 2AERH 2BY8X 2QIQA 3TH2H 4ABHA 1N8OB 2ZGXH 2VIQA 1K9OE 1TBZH 2P95A 4X8UH 3LONA 1QFKH 1V3XA 2TRMA 3PTNA 5FHTA 3GCHB 2BD7A 1HAXB 1N1LA 2ANMH 3FFGA 4AOQA 1TRNA 1VGCB 3QZRA 1RRKA 3TIUA 2D2DA 1AUJA 2XTTB 4ZXXH 3ENSB 3UY9A 3HPTB 1QJ7B 1CE5A 2BMGB 1Z71A 2HNTE 3O8BA 3FZDA 2ZU3A 2A2QH 1V2UT 2ZGJA 4Y0YE 2G55A 2NU2E 1GCTC 2JETB 2UUKB 2HPPH 4H4FA 2UWLA 1FAKH 3DT0H 3AVZA 1GHAG 4X6NA 1DS2E 1UJ1A 2M5TA 4ISOA 2OBQA 2FODA 3M3TA 1G9IE 3MO9A 1IQEA 5FBIA 2OLGA 6GCHF 1RJXB 1Y59T 1A0LA 2V35A 4ASHA 5C20A 4INHA 4D76A 2PGQB 3ZZ5A 4AB8A 1YC0A 2TGAA 4ISHH 2H5CA 3VB7A 1QHRB 1Y3VA 2QXHA 3QLPH 1P0SH 4OGXA 5EPNA 1U6QA 1SC8U 2P59A 2C4FH 5BRRE 3LGVA 1IAUA 4Q7ZA 1ZHRA 3VXFH 2QN5T 4E06H 3LC3A 2K1QA 4NZQA 1ANCA 2GCHF 1HAGE 1RTFB 1AU8A 1EZUC 4B2CA 3NZIA 3P8NA 1UTOA 1W7GH 1KLTA 3SV8A 1W14U 1BT7A 3RXCA 1UK3A 1UK2A 2NU1E 5DJ7A 4ABEA 3T26A 1V2WT 2FEQH 4H6SB 1GBHA 3PB1E 2B0FA 4X8SH 3L3TA 4JYTA 1DY8A 1X7AC 2A4QA 3QGJA 1QJ6B 1GBLA 1GL0E 1O2YA 3ZVFA 2TIOA 4A7IB 3AW1A 1TB6H 1C2KA 1AVGH 2VWOA 1CHOG 3NUMA 1O3EA 2G51A 3A7ZA 2HPQH 1DT2A 1TALA 4Y6DA 3KL6A 2UUYA 5FXLA 2BQWB 3GY4A 2CXVA 1QNJA 3ZVEA 3I77A 1O3LA 1O2SA 1DFPA 1E37B 1P2MA 2ZHWH 4X2XA 5E0HA 1O2VA 3IITA 1LVOA 1N6YA 1JMOH 1P2JA 4X2WA 4MNVA 4NA9H 1QCPA 1AKSA 4RSPA 3S0NA 3BTDE 1O2OA 3GCTF 2GX4A 4Q80A 1SFQB 3SV6A 2JKHA 2FX6A 3SNAA 4NZLA 4DG4A 5DPAA 1D3DB 1O3JA 3RXGA 4TPYA 1DANH 2AGEX 4CR5A 1S82A 1ABJH 1GI3A 2CGAA 3B9FH 4UONA 5F8ZA 2FPZA 2STBE 4K8BA 3GCOA 1ELCA 2IOTA 1BBRE 1HJAC 1C5RA 2KAIA 2GZ9A 4SGAE 3RM0H 2RA0A 3E3TA 1Y3YA 1ZJDA 4XFQA 2Z3DA 3M36A 3LGWA 3TK9A 3TPIZ 2BOKA 1ETRH 1OP0A 1MBQA 3ZZ4A 1O2WA 3PMHB 1S81A 3IG6B 5TCCA 1QRXA 1P12E 2ZWLH 4K69A 3TH3H 1NESE 1AVXA 1ESAA 1P9UA 3UR9A 1C4V2 3TNSA 2FDAA 5C3NA 1F2SE 3T29A 1CU1A 1SOTA 1H8DH 4ZMAH 2AGIX 1C5PA 2WUBA 2YNBA 2GV7A 1S5SA 2GVFA 1O2NA 4X8VH 4DOQA 2HRVA 3KIDU 1L1GA 1YYY1 1V2TT 3K9XB 1ZMNA 1AWFH 4R0IA 1TX8A 2G00A 4XBDA 2FI3E 2JH0D 3S7HB 1A0JA 2XC0A 1CGIE 2B9LA 1TAWA 2JH5D 2Z9IA 3SUFA 3TGKE 1V2NT 1GHAF 4K60A 1H9HE 3GY5A 2XC4A 2P93A 5EQRA 3JZ1B 1OYTH 2STAE 3KQBA 3RXOA 4Y10E 1QQUA 3A80A 5L6NH 1EAIA 2QXGA 3UOPA 4CRDA 1MUEB 4A5TS 2SGAA 5A0CA 4JK6A 2WPIS 4CR9A 1BZXE 1WYKA 3QX5H 3RXJA 1QBNA 2EA3A 4DJZB 4R8TB 2WYJA 1ANBA 3C1KA 1BTPA 1IQNA 2J38A 1AMHA 1MTNC 2A4RA 5A8XA 3SV2H 1S0RA 1XUGA 1NRNH 1BHXF 1C4Y2 2BDGA 1HAVB 1UTKA 3EA8A 2F83A 3M5MA 2ASUB 1P03A 1IQKA 2I6SA 5JBTA 1O2HA 4Q2KA 2G5VA 1FXYA 4IS5A 2BD9A 4BANB 3S9BA 1C4U2 2VVCA 2PKSB 3UFAA 1P01A 1ZTKA 1A3BH 1MQ6A 2SNVA 4ABBA 2OC8A 5F8TA 4TYDA 1AE5A 1S84A 4KTCA 1QA0A 3TJOA 3UWJH 1K21H 1CHOF 2W5EA 4NA8A 3SHCH 5C5NA 1LHEH 4MPWA 2ZTXA 1YPHE 3MH5A 1MH0A 3F6UH 1C1PA 1HAOH 1K22H 3V0XA 9LPRA 1EPTC 3PLPA 1FAXA 1V2LT 4UFDH 2RA3A 4YOIA 3SUGA 2ZO3H 2Z9GA 1SBWA 3NWUA 2WPKS 2HALA 3P6ZB 1C5TA 3U8RH 5GJ4B 1ACBE 1C1TA 1GBEA 1PQ8A 2AYWA 1DSTA 1V2JT 1KLIH 1EJMA 1CBWB 5EXNA 3M61U 1C2IA 1T8LA 5DP4A 1YCPK 3RM2H 2HVXA 3URDA 4ABIA 3ZZ7A 2J2UA 3GDUA 1WQVH 1NFUA 1D3QB 5IYTA 5DP9A 1A7SA 1LKAA 3NCLA 1EX3A 4X0WU 1MKXH 4NWKA 3TK5A 1O5BB 3ZVBA 3UNSA 2Z6BD 3RXKA 4AGJA 1HUTH 1BHXB 1SGFA 1S6FA 1HAZB 3E16B 1DWDH 3BTHE 5J4QA 3P95A 2PFEA 1G3DA 3QUMP 1GMDG 3U8OH 3RXTA 2FOBA 1AE8H 4AGKA 1ELBA 3LC5A 1TNLA 4OS7A 1THSH 7LPRA 1ANDA 1PYTD 4DCDA 2P3UB 2NU4E 2LPRA 4GAWA 1BA8B 1IQLA 1BRUP 3K6ZA 4OS1A 1A1RA 5A2MH 1FY3A 5CE1A 1SVPA 2C90B 2Q1JA 3A8CA 4ZH8A 2SNWA 3BG4B 3AAUA 4XOJA 3TGIE 2OC1A 1O36A 1KXAA 1EJAA 4FU8A 4B2BA 1C2HA 1ELFA 3P17H 3P8OA 3ATMA 5TCAA 1BTZA 1FPHH 1OSSA 1UMAH 2A7JA 4GCHG 2O8LA 2ILNA 2W26A 3PMAB 3ZV8A 2BM2A 1AO5A 2ULLA 1P57B 1GG6C 1YPKH 2C8YB 3EA7A 4IGDA 1KSNA 2BX4A 1O3PB 4ISLA 4FUDA 4F4OC 1K1IA 5EG4A 5AVDA 4O3TA 1AVWA 1FY4A 4NWLA 3D49H 1LDTT 1OWIA 4BAKB 1T31A 1ZHMA 1SGCA 4Y8YA 1ANEA 1AZ8A 1AIXH 1MAYA 1VITG 4VGCC 1C5LH 2GMTC 2OCVB 1ELAA 1QA7A 2ZF0H 3P8FA 4CRCA 4NIYA 1C5UA 1O3GA 3UIRA 3OX7U 1GPZA 1TGTA 3AAVA 2F9BH 1TPPA 2ZI2H 2WPLS 1O3DA 4RN6A 4XBBA 1TLDA 1BMLA 1HNEE 5JB8S 5C1XA 1F5RA 4A1VA 1F5LA 3FAOA 1J16A 3A89A 4BXSA 1L4ZA 2ODYB 3PO1B 1SGFG 3CS0A 1DWEH 1CA0C 4FUFA 1GL1A 1W3CA 1T7CA 1BTHH 1TPOA 1GJCB 4BOHA 2ANYA 4ZKOU 1C9PA 5BPEA 1NU9A 1C5YB 7GCHG 1C5MD 4KTUA 1ELVA 3OTJE 3RXPA 3A7VA 6ESTA 4E7RG 2G4UA 3ATLA 2Y81A 1W10U 2TGPZ 3PMJA 3K6YA 4IBLH 2VWNA 1GHYH 3SGBE 3NKKA 5A09A 1VCPA 4CHAB 2ZDAH 1SI5H 1GMHG 2BY5X 3HATH 2Z7FE 3EAJA 3MH7A 5EGMA 1AZZA 1C2EA 3PWBA 2WV4A 1XUFA 3QK1A 3RLWH 4A1TA 1QJ1B 2D1JA 2P8OC 3NXPA 3SBKA 1CQQA 2Y80A 1JRTA 5A8ZA 2VU8E 2ZGHA 3U69H 1O2GH 2HNTF 1AKSB 1C2LA 2ZC9H 5JBAS 2XRCA 4GHQA 3A7WA 3Q3XA 4RKJB 1LHFH 1GDQA 3R3GB 1FONA 1NY22 1ZRBA 2ZFQH 1V2PT 2ZP0H 3HK3B 1SL3A 1NRPH 5EW1H 1INCA 4JK5A 3Q00A 3ZYEA 1C2JA 1JXPA 1EZSC 2ZFFH 2BD2A 2OQUA 1H9LB 1AN1E 2HWLB 3OY6U 2A5AA 2FS8A 2Y6TA 3QO6A 4MPVA 2KAIB 3MNXA 3F9GA 1QIXB 1BJUA 2QXJA 2CHAC 3GY2A 2AS9A 3LOXA 5C67A 3O8CA 1Y3XA 1F0TA 3A84A 5LPFA 8GCHF 2ZNKH 3ZZCA 1GMDF 2H9TH 1S6HA 4KGAA 1YGCH 4UFFH 1UO6A 2PV9B 1O2ZA 4K3JA 4IC5A 6CHAC 3U8TH 1Z1JA 4Y8XA 2GGVB 3EA9A 2PWXA 2ZQ1A 2XWBI 4KELA 1BCUH 3BV9B 2R0KA 3FP7E 3T28A 4Z6AH 4WF8A 1KTSB 1O5CB 1GI2A 3ZZAA 1PPEE 3GY3A 1TA6A 1ABIH 3LDXH 1TFXA 2RG3A 2YNAA 1PQAA 4WY3A 3M35A 4B75A 4I8GA 1IHTH 1DY9A 3ODDA 3M5NA 3LT3A 1C5WB 4NIWA 3F9FA 5DK1A 3KQDA 1XVOA 2BLVA 2A7CA 4LXBH 1OS8A 2R2WU 4FUCA 3TJVA 1C5ZB 4MNWA 2VGCC 3RXHA 2AMDA 4IW4E 2G5NA 1K1JA 3FP6E 4SGBE 4H42U 3M3SA 2ZFTA 1VITF 2ZHFH 1CGJE 1QB1A 3LGIA 2ZZUH 2TBSA 1J9CH 2C93B 3V12A 1IQHA 3ZZDA 1SMFE 4NCYA 1VR1H 1TBQH 4KP0A 3UNQA 2FESH 2R3YA 1GGDC 5DO4H 1TNHA 2C8ZB 2GCTB 1GJ9B 1GJ4H 1AB9C 2FYQA 3SNEA 1C1VH 2P3FH 1TGBA 1O2XA 1WAYB 1SGDE 2XBYA 1YPLH 1ZOMA 2ZPSA 2F9PA 3TVJB 2FOHA 3U1JB 3MO6A 3ATWA 3Q3KA 2SGQE 2PUQH 1BITA 1GJ5H 4WWYA 7GCHF 1KDQA 2BLOA 2ZQ2A 4HTCH 1N8OC 3ZVGA 4CRFA 1GJAB 1J8AA 1LPGB 1SGQE 3QZQA 2FIRH 3SJKA 1BTXA 4AFUA 3GCHC 1GI5A 3RXIA 1LPKB 1M9UA 1VGCC 4YO9A 2HNTC 1GMHF 3QN7A 4WJG2 2FOMB 1C5OH 1GBKA 1E36B 1K1MA 4X1SU 3VGCB 3BTQE 1Z8IB 3C27B 1GVKB 5GPIB 1DLKB 1BQYA 5T3HA 1TNJA 3PMBB 1O2JA 2NWNA 2JETC 1UTJA 1KXFA 5JYIA 5LPRA 2A4GA 4FU9A 1O2KA 1Y5UT 1G36A 4Q7YA 1A4WH 1EXFA 1P09A 1TA2A 1SGYE 1QB9A 1QURH 3A83A 4Q7XA 2XCNA 3R0FA 1P3CA 1CO7E 4X1RU 1NO9H 2QC2A 2RCEA 5T6FA 1MMJN 4OS2A 3TLOA 3SORA 1NROH 1LO6A 2JH6D 2AGGX 5A0AE 3MU1A 4CH8B 1O37A 2W7UA 2G8TA 3SJOA 1ZJKA 1WCZA 2FWWA 5E8EH 4BTUB 3GCNA 1IQIA 1GBJA 1P3EA 3GDVA 1O3OA 2J4IA 1GI4A 1UVSH 1Q2WA 1MQ5A 5DKMA 1P8VC 2BD5A 1HAYB 2GP9B 4INKA 3PTBA 4AB9A 3MU0A 3DFJA 4XDEA 2AIQA 1UCYE 4CRAA 3RC6A 4HFPB 3PROA 2BOHB 4KKDA 2PR3A 1CHGA 4BXWA 1KXEA 1IQMA 2GZ8A 1YLDA 3RXSA 1EAXA 3MYWA 1G3EA 1QRZA 3HKJB 3MTYA 4TY6A 1EAWA 3VB6A 5L2YH 1QL7A 5AFZH 4JZIA 3SUEA 1O38A 5CHAB 4BAOB 2BQ7B 2FI5E 1ZSJA 3D62A 3M3VA 3QTOH 4DT7B 1GI6A 2ZU5A 4AFQA 2F91A 2ZEBA 8KME2 2P3TB 1ZSKA 3KGPA 1WTHD 2UUFB 2B8OH 2CJIA 4B2AA 5H4IB 4WVPE 1LHGH 1LMWB 3DA9B 1GHWH 1GI9B 2XCFA 1Z6EA 1OXGA 1VCWA 2WPMS 3RXRA 3NK8A 1W0ZU 2PSXA 2D8WA 1O2UA 2OP9A 3F9EA 3GY8A 1C1NA 2YOLA 3EYDA 3ZVAA 1AUTC 4INLA 1GWAA 1QGFA 1EZQA 2BTCE 1RFNA 3QWCH 5A8YA 1GJ6A 2XBVA 3P92A 4WMEA 5B6OA 4JZFH 2D26C 3PYHA 3A8BA 1O30A 4K5ZA 1O5FH 1GDNA 2H1UA 1EP6A 1UHBB 2PW8H 1ARBA 4IMZA 1F7ZA 2BVRH 4ABJA 3G01A 1P02A 1FNIA 2W3KA 1Q3XA 1D4PB 4O03A 1FIZA 2P94A 4NA7A 5PTPA 2H6MA 3SV7A 2H5DA 3VB3A 1SFIA 3KNXA 5CMXH 4I8LA 3S9AA 4CBNA 1SB1H 3LJOA 2THFB 1EOLA 2SGEE 4AG2A 1TNKA 2ZCHP 1LTOA 3LH1A 5K0HA 5AF9H 4JYVH 1BRCE 1LVBA 1GDUA 1PPZA 1OYQA 3SNBA 2H9HA 4YM9A 4M7GA 2XWAA 2VVVA 1ELGA 2CMYA 2BY9X 2F9VA 1DWBH 4A1XA 1DE7H 2ZA5A 1FDPA 1NFWA 3GY7A 2BD8A 3KHVA 2Q6DA 1A5GH 4JZEH 3BG8A 4Y0ZE 2WINI 1DITH 3RMNH 1PQ7A 1RD3B 3LPRA 1H8IH 1AFEH 1JIRA 2C3SA 1OWJA 3CS7A 2AH4X 1PPGE 1ZMJA 5IDKA 3T2NA 2AEIH 2PGBB 1LVMA 1K1OA 1NC6A 1A46H 2IN2A 3MNBA 1O3KA 1ESBA 1EOJA 1K2I1 2RDLA 2ZDMA 3MOCA 1JIMA 3TNTA 3A88A 3SU0A 3ZV9A 2G4TA 1SOZA 4GSOA 4Y7BA 1C5NH 4NG9H 1G3CA 2FOEA 5EQSA 4FVDA 1HYLA 2CF9H 4Y71A 3E8LA 2XNIA 2QY0B 1O5EH 1GHBG 5ESBA 1BDAA 2V3HH 2VNTA 1ZTLA 5FX6A 3A8AA 2DE8A 1AI8H 4JZDH 1LKBA 1Z7KA 4D8NA 1DVAH 3LJJA 1YCPH 2SFAA 1KLJH 1E34B 1YPHC 3BTME 1W8BH 4H6TA 3SU5A 1THRH 3RXMA 1Y3UA 2A31A 1G2MA 5EXLA 1O3MA 2F9UA 4BTTB 3RC5A 3MU4A 5JBCS 1MTSA 5LH8A 4E05H 4CBOA 1HRTH 1BTWA 1UCYK 4K1SA 1VJ9U 3LU9B 5AFYH 2FI4E 4IN2A 1BBRK 1G37A 1BOQA 1IHSH 4LK4A 4Y79A 1SQOA 3PM3A 3RMOH 4I32A 1GBIA 1BJVA 1FY1A 2GDDA 5HM9A 1TYNA 2AIPA 1CBWC 2F9OA 3TJNA 1G32B 1NPMA 2PTNA 4O9VA 2WV5A 4Y8ZA 4ABGA 1BIOA 2BDYA 1ID5H 5I46H 1UVOA 1KXDA 4Y7AA 3T5FH 4X1NU 1SR5C 3V3MA 1WOFA 4CREA 1YBWA 5ESTE 3ZZ8A 2F3CE 1MAXA 5TJXA 2FM2A 1BBRH 4A6LA 1PFXC 1TGCA 4OS5A 3ZVCA 5JDUB 3O8DA 3HGNA 4XBCA 2HLCA 4ISIH 4B76A 1B5GH 3EE0B 1A3EH 4AG1A 3EDXB 5C1UA 4ZAEA 4ZHAA 1KIGH 1ZGVA 1HAIH 4B74A 3BTTE 2A2XH 5C1YA 1KDQB 1XMNB 4DVAU 1UHBA 1ZSLA 1C1WH 2ZHEH 3H7TA 3ZZ3A 4E7NA 2A7HA 1NZQH 5AHGH 3BTEE 4ABFA 1FUJA 2FX4A 3A87A 1GBMA 2QF0A 2W7SA 1JOUB 1TQ0B 1HIAA 3RP2A 3S69A 5T6GA 1O5DH 5FBEA 1HB0B 3T62A 3M7QA 5DP6A 3RLYH 1UVPA 1XUHA 2J34A 1UTLM 1GHXH 4OGYA 5HMAA 2AMQA 2WUCA 2XXLA 3HGPA 3I78A 1H4WA 1IOEA 1SSXA 3BG4C 2PKAA 1EPTA 3GY6A 4K1TA 2Y5HA 5HGGA 1G2LA 2QCYA 5GCHG 1AFQB 2ZCKP 1MZAA 1C2MA 2BD3A 1KXCA 4ZROA 1UTPA 3D23A 1O0DH 3AW0A 1F0UA 1DUAA 4UDWH 1E38B 2O8MA 4FUIA 4UE7H 1ELDE 2ZFSA 1CA8B 1EASA 5HXFA 4ISNA 1N6XA 1O34A 1YM0A 1NRRH 5L30H 1ZYOA 5EXMA 1XVMA 4U30A 4ZKSU 1PPHE 1LQEA 3FANA 1T8MA 4A92A 1HCGA 3L6PA 1MZDA 2Z3EA 1ZZZA 2J92A 1MU8B 2ZHDA 3A8DA 3I29A 2OINA 4AFZA 1XX9A 1VJAU 2XYAA 1EATA 1V2RT 3TITA 3UTUH 3SJ9A 3BEIB 2OXSA 1THPB 4X1QU 1C1OA 2FTLE 1SGIB 1V2VT 1RIWB 4YT7H 2FXRA 2XBXA 2BZAA 3O8RA 1HPGA 4CRBA 2LNCA 2QXIA 1MTWA 1TIOA 1K28D 1FI8A 4AORA 3DUXH 3P70B 1O32A 1YCPM 1GHBF 2Y5FA 1TGSZ 1K1PA 4AFSA 1TOCB 3KQCA 2SGPE 2ZU4A 4MPUA 3B23B 1W12U 1AHTH 1AQ7A 2ZGCA 2ZKSA 5G4BA 4FUJA 3SZNA 1HJ8A 1WU1A 1MCTA 1HJ9A 2QV1A 4X2VA 1FPCH 2XW9A 4J2YB 2HOBA 1MKWK 3RC4A 4DY7B 1C1SA 5E0GA 2FOFA 2A32A 9ESTA 2FLRH 2VVUA 4CHAC 3AASA 1GI8B 3E90B 3MU8A 1IQFA 1E35B 1HXEH 4MG3A 2ZHQH 1O3BA 3GISB 1PPCE 1GCTB 2PSYA 1CT2E 1MTVA 5EPYA 1LPZB 2ZTZA 3ATKA 3RXVA 2J9NA 3UQVA 2A4OA 1C9TA 1E0FD 3GOVB 1CT4E 1T8OA 1Z6JH 2BDHA 4K2YA 3VPKA 2J95A 3Q76A 2EC9H 4Z0KA 1O2PA 1C1RA 4JZ1A 3L33A 1MBMA 4LOYH 4GCHF 3SUDA 1GBCA 1TNGA 4THNH 1OWEA 2H2ZA 3VEQB 1YKTA 2ZFRH 5GDSH 5LGOA 4Y11E 2BLQA 7KMEH 3TJUA 1GMCG 5K7RA 1D9IA 3BIVH 1P2NA 4YESB 1TMUH 1UK4A 1C2GA 1EZXC 3A86A 1O3IA 2FZZA 3LGYA 1SGPE 1NFYA 4I31A 2J94A 1L0ZA 1JRSA 4WXIA 1TRYA 2NU3E 4ABDA 1D6RA 1JBUH 2B5TB 1Y5BT 1NRQH 1P05A 1RTLA 2AFQB 3F1SB 1PJPA 4O97A 5DP7A 3SI3H 5L2ZH 4U32A 2VH0A 3B8JA 1YLCA 1S0QA 3E6PH 1DICA 1LVYA 3UNRA 1HBTH 1T4UH 1W0YH 3ODFA 4NSYA 1J17T 5FPYA 3VFEA 1O2QA 4YLQH 2FOAA 4NIXA 3M5LA 3Q77A 3VXEH 4MDSA 1YPGH 2P16A 3K2UA 1ZTJA 1QB6A 2ZFPH 1A2CH 5F6MA 2BZ6H 3BIUH 3RU4T 1O5GH 1TOMH 3BTGE 5GCHF 1PPFE 1GBAA 3V13A 4I8KA 1TONA 1ZPBA 2FLBH 2ZU1A 1ORFA 2OUAA 5E0JA 4YT6H 1W11U 1TMBH 3KF2A 1QQ4A 5DP5A 1L1NA 4YLUA 1J14A 1T32A 1RTKA 3MH6A 2H9EH 3WY8A 3S7KB 2R2MB 2XC5A 1MTUA 5GWZA 1YPMH 3A7YA 4X1PU 1UTMA 4YOGA 2FYRA 5SGAE 1TE0A 5T6DA 2BHGA 4WH8A 4AZ2B 2FO9A 2WPHS 1ZPCA 4FU7A 3QDZB 4BAMB 2BY6X 1B7XB 2R0LA 1Z8JB 1C1QA 2Z94A 1C1MA 3RU4D 1VCQA 1AWHB 1HJAB 2FTMA 3U98H 1PPBH 3H5CB 1SLUB 1SLWB 2O8UA 4B73A 4BNRA 3E0PB 2GKVE 2GCTC 1YF4A 1WTGH 3NPSA 2BXUH 4WH6A 4ZHLU 3ITIA 2A45B 5DG6A 2VJ1A 2VIVA 3RXLA 2GDEH 4JYUH 3M7UA 4OS4A 1TPSA 3M7TA 4NIVA 1CSOE 6LPRA 1FV9A 1GCDA 4UEHH 1CT0E 1CVWH 1F0RA 1V2KT 1TQ7B 3LKWA 3M37A 3GYLB 1ARCA 3HK6B 1A5HA 4CH2B 1L2EA 3A82A 3SV9A 3UR6A 2O8TA 4HGCA 3BSQA 1TABE 2OQ5A 1VZQH 1OP2A 2DUCA 2ZCLP 5ABWA 4IC6A 1XUKA 4AYYB 2C8WB 3PLKA 1XKAC 1P2IA 1YP9A 1F5KU 2Y7ZA 1FY8E 1GJBB 3VGCC 2Z3CA 2PLXA 4DURA 5LPEA 2BB4A 1PYTC 1G3BA 3BTFE 1WSSH 8ESTE 4TWYA 1TMTH 1T8NA 1NRSH 3RDZA 1QTFA 3SU6A 2BDIA 2ALVA 4WMDA 5EW2H 3MNCA 4D7FA 4AX9H 3SQEE 1ELEE 3A85A 4ZKNU 1OPHB 2VINA 2Z9JA 2QGRA 1O35A 2Z9LA 4I8JA 3FVFB 4J1YA 2G81E 1OX1A 2B7DH 2A0QB 1K1LA 4MNXA 3RUOA 2QA9E 3E1XB 3PWCA 1HXFH 1GMCF 3TGJE 2IPHA 1QBOA 1K1NA 3ATIA 1DSUA 1FMGA 1EB2A 1H1BA 1MTNB 2NU0E 5JPMH 1BRAA 3GYMA 3TH4H 5EODA 3RXQA 2UUJB 5DGJA 2OBOA 4FUBA 5E2PA 1OWDA 1DM4B 3MWIU 2VIPA 2SGDE 2BDBA 4NGAH 1P2OA 1D3TB 3OY5U 1WBGB 3RXBA 1ZR0A 1W7XH 2VB0A 1AD8H 3V7TA 1IQGA 3RMLH 2HGTH 1TRMA 1LCYA 3VB5A 3QTVH 1QR3E 2EI8A 2O8WA 3ESTA 5I25A 3SNCA 2WPJS 3K65B 4WXVA 4DIIH 1P11E 1HIAB 1TPAE 1UVUH 1HAPH 2BVSH 1O2MA 1GJ7B 1LQDB 1UTQA 2R3UA 5CHAC 1HV7A 4YOJA 3STIA 1GI1A 3KN2A 1AY6H 1O3CA 2V6NA 2Z9KA 2G52A 4GUXA 1P10A 3TU7H 1BMNH 2PKAB 1EPTB 4MTBA 4LZ4B 1D6WA 3SNDA 1O3FA 3T27A 1EJNA 1HAHH 4ZHMU 1DXWA 3RXEA 1EUFA 3DD2H 4UFEH 1NU7B 1C1UH 1Z1IA 4BAHB 4UD9H 4XE4A 1BTUA 3MO3A 3LH3A 5F03A 1W13U 4TPIZ 2Y5GA 3SU4A 2UWPA 1BMAA 2SGFE 2ODPA 2DE9A 4MVNA 4K1EA 1BUIA 3FZZA 2OC0A 5HYOA 1B0FA 1O2TA 1D3PB 2FS9A 3SGAE 5EOKA 1SQAA 4FUGA 5FPTA 4B1TA 1XUJA 1P9SA 1BTYA 3BEFB 2O9QA 1H9IE 2QYIA 1Y8TA 2ZG0H 2AMPA 1EKBB 1FLEE 4ABAA 2F9NA 1O2IA 3RMMH 1SGRE 4K8YA 2Y7XA 4F49A 4DIHH 1OOKB 1CGHA 5DP8A 3SHAH 1BRBE 3SJIA 2PHBA 4AN7A 2EEKA 1C2FA 1FIWA 1XXFA 1GVLA 3A7XA 3DFLA 1O3HA 1KTTB 2VWLA 3UWIA 3IWMA 1XUIA 2CV3A 1A0HB 3SU2A 3CP7A 3ZYDA 1V2MT 1KYNA 1ESTA 2VWMA 2GTBA 1O39A 1T4VH 1ZMLA 1OKXA 1GHZA 3BTWE 4DW2U 1FN6A 5C5OA 2TPIZ 1SLVB 2FOCA 2BXTH 1MKXK 1O3NA 3SN8A 1RS0A 3EGKH 4FVBA 1TX7A 1TX6A 4GHTA 1P2KA 1EQ9A 4PROA 2EI7A 5C2ZA 4X8TH 3PV4A 4TWWA 2A5KA 3OSYA 3UUZA 1BB0B 1DUEA 3ZVDA 2PKSC 1FQ3A 5JBBS 2TGTA 3CENA 1OP8A 1GVZA 1JWTA 2ZDVH 3DHKH 2V0BA 1GG6B 5DP3A 3OYPA 1MD7A 1C5SA 1NN6A 1SGNE 1ETSH 3GICB 3STJA 1Y3WA 1RGQA 4CRGA 3MFJA 3MNSA 1NTPA 4ZXYH 3PLBA 4XSKU 1FN8A 4BAQB 1YPEH 3F9HA 1P04A 3ZZBA 1TBRH 3SW2B 3EQ0H 4VGCB 2GMTB 2OC7A 8GCHG 3LGUA 2GT8A 1P06A 3SO3A 4IN1A 3VB4A 4FXGH 2VIDA 2VIOA 4ESTE 1DLEA 2ALPA 2ESTE 1VITH 2GD4B 5F8XA 2PUXB 1EB1H 3RXFA 5J4SA 1V2OT 1UVTH 1WUNH 1DWCH 5E2OA 2ZGBH 5A0BA 4X2YA 3HKIB 2I6QA 3KEEA 4X6MA 1GBDA 1CA0B 1SHYA 3MHWU 1UCYH 1DPOA 2PTCE 2ANKH 3SGQE 4AYVB 1BMMH 3RU4E 1DX5M 2GV6A 4YZUA 3SQHE 4DGJA 3E0NB 3RXAA 1C5VA 1SPJA 1ZRKA 2UWOA 1L4DA 1MD8A 1QRWA 3TK6A 4OS6A 1RXPA 3U1IB 2FMJA 3F68H 4D9RA 1GHVH 4U2WA 4YTAA 1QL8A 4X6PA 4ZUHA 3W94A 4FUEA 1FJSA 5ETXA 4UFGH 3KCGH 2P8OB 4MLFB 1O3AA 1HGTH 3BEUA 2Q6GA 1ETTH 2V3OH 3ZZ6A 1XXDA 4I7YH 3BF6H 2BDAA 1C5XB 1HFDA 1L1JA 1GI0A 1OWHA 1TGNA 2TGDA 1C2DA 1V2ST 1F92A 3KQEA 1GI7B 5FX5A 1SGEE 5FCKA 1J15A 3MI4A 1C5QA 3OU0A 4Y76A 1NS3A 2ODQA 2ZECA 1KY9A 2QAAA 4FUHA 4NSVA 5EQQA 3UPEA 6GCHG 3U9AH 1SGTA 3LIWA 4GVUA 4X6OA 1Z8GA 2BD4A 2GT7A 2VIWA 4RKOB 7ESTE 1OWKA 2A5IA 4MQAA 2OD3B 1HLTH 3SOSA 1SHHB 3BTKE 1V2QT 3S9CA 4D7GA 3QGNB 3RXDA 2ZDLA 1ZHPA 4NFEA 1QBVH 2CHAB 1GBBA 2QF3A 1GJDB 1LHDH 1S83A 1HAVA 5GIBA 1NM6A 2VH6A 3LGTA 2ZDNA 2GZ7A 2ZPRA
chains in the Genus database with same CATH superfamily
1O2RA 3SU3A 3ZZ9A 2GCHG 4GPGA 1ZGIA 1EP5A 3MH4A 1YPJH 1A5IA 3ELAH 1ZPZA 3MMGA 1ZLRA 1TWXB 1ELTA 4D9QA 5FCRA 1FY5A 6CHAB 4IMQA 1B0EA 3BN9A 4KTSA 1SLXB 3W95A 2ZIQH 3Q3YA 3E91A 3SI4H 1MU6B 2ZDKA 1O31A 3D65E 2R9PA 2ZPQA 3PO1C 1S85A 5EJ1A 1GBFA 2XOKD 1HDTH 2OTVA 2A1DB 3A7TA 2FP7B 2CF8H 2ZU2A 1IQJA 1WQSA 1TNIA 4I8HA 3H7OA 2CN0H 2FOGA 1KXBA 4ZCNA 5GXPA 3JZ2B 1AFQC 1O2LA 2ZTYA 5C0UA 1A61H 1QL9A 3P8GA 1NFXA 8LPRA 3MU5A 2IJOB 1V6DA 2YMSB 1XM1A 4O3UA 1F0SA 1PQ5A 1EAUA 3A81A 1O33A 1DDJA 2VGCB 4HZHA 3GDSA 2BY7X 3UQOA 3GCTG 5DN6D 4U01A 5FAHA 1LHCH 4JMYA 2LELA 1GBTA 1QY6A 4LZ1H 5IK2D 2BDCA 3UREA 2C8XB 4ZKRU 2BLWA 4WMFA 4I33A 4HI3A 3URCA 4MPXA 4TY7A 5HM2A 1DOJA 1Y5AT 3M5OA 2WYGA 1Z8RA 4MNYA 3N7OA 1AGJA 3FP8E 3SJ8A 4TSFD 1SG8B 1W2KH 5EU8A 1GGDB 4BTIB 4GLYA 1XKBC 1FZZA 2XBWA 1MKWH 1UTNA 4NFFA 1NT1A 1AB9B 2BX3A 3SU1A 5JB9S 5FPSA 2ANWA 2BQ6B 1DXPA 1P2QA 2EI6A 3PV5A 1O5AB 2JIZD 1RIWC 1SQTA 2Y82A 1Q31A 4QT8C 4B71A 2BYAX 2Q6FA 3RXUA 2BVXH 2W3IA 3T25A 3U28C 3UOUA 1GJ8B 4JCNA 1G30B 2HLDD 1WV7H 1MCVA 2AERH 2BY8X 2QIQA 3TH2H 4ABHA 1N8OB 2ZGXH 2VIQA 1K9OE 1TBZH 2P95A 4X8UH 2J5UA 3LONA 1QFKH 1V3XA 2TRMA 3PTNA 5FHTA 3GCHB 2BD7A 1HAXB 1N1LA 2ANMH 3FFGA 4AOQA 1TRNA 1VGCB 3QZRA 1RRKA 3TIUA 4XD7D 2D2DA 1AUJA 2XTTB 4ZXXH 3ENSB 3UY9A 3HPTB 1QJ7B 1CE5A 2BMGB 4RT1A 1Z71A 2HNTE 3O8BA 3FZDA 2ZU3A 2A2QH 1V2UT 2ZGJA 4Y0YE 2G55A 4AC9A 2NU2E 1GCTC 2JETB 2UUKB 2HPPH 4H4FA 2UWLA 1FAKH 3DT0H 3AVZA 1GHAG 4X6NA 1DS2E 1UJ1A 2M5TA 4ISOA 2OBQA 2FODA 3M3TA 5HIZA 1G9IE 3MO9A 1IQEA 5FBIA 2OLGA 6GCHF 1RJXB 1Y59T 1A0LA 2V35A 4ASHA 5C20A 4INHA 4D76A 2PGQB 3KYGA 3ZZ5A 4AB8A 1YC0A 2TGAA 4ISHH 2H5CA 1S6LA 3VB7A 1QHRB 1Y3VA 2QXHA 3QLPH 4YXWD 1P0SH 4OGXA 5EPNA 1U6QA 1SC8U 2P59A 2C4FH 5BRRE 3LGVA 1IAUA 4Q7ZA 1KMHB 1ZHRA 3PRDA 3VXFH 2QN5T 4E06H 3LC3A 2K1QA 2JJ1D 4NZQA 1ANCA 2GCHF 1HAGE 3DSGA 1RTFB 1AU8A 1EZUC 4B2CA 3NZIA 5HKKD 3P8NA 1UTOA 1W7GH 1KLTA 3SV8A 1W14U 1BT7A 3RXCA 1UK3A 1UK2A 2NU1E 5DJ7A 4ABEA 3T26A 1V2WT 2FEQH 4H6SB 1GBHA 3PB1E 2B0FA 3N7DA 4X8SH 3L3TA 4JYTA 1DY8A 1X7AC 2A4QA 2WPDD 3QGJA 1QJ6B 1GBLA 1GL0E 1O2YA 3ZVFA 2TIOA 4A7IB 3AW1A 1TB6H 1C2KA 1AVGH 2VWOA 1CHOG 3NUMA 1O3EA 2G51A 3A7ZA 2HPQH 1DT2A 1TALA 2VBCA 3KL6A 2UUYA 4Y6DA 5FXLA 2BQWB 3GY4A 2CXVA 1QNJA 3ZVEA 3I77A 1O3LA 1O2SA 1DFPA 1E37B 1P2MA 2ZHWH 4FOUC 4X2XA 5E0HA 1O2VA 3IITA 1LVOA 1N6YA 1JMOH 1P2JA 4X2WA 4MNVA 4NA9H 1QCPA 1AKSA 4RSPA 3S0NA 3BTDE 1O2OA 3GCTF 2GX4A 4Q80A 1SFQB 3SV6A 2JKHA 2FX6A 3SNAA 4NZLA 4DG4A 5DPAA 1D3DB 5C17A 1O3JA 5KECA 3RXGA 2CK3D 4TPYA 1DANH 3OEED 2AGEX 4CR5A 1S82A 1ABJH 1GI3A 2CGAA 3B9FH 4UONA 5F8ZA 2FPZA 2STBE 1E1QD 4K8BA 3GCOA 1ELCA 2IOTA 1BBRE 1HJAC 1C5RA 2KAIA 2GZ9A 4SGAE 3RM0H 2RA0A 2PP6A 3E3TA 1Y3YA 1ZJDA 4XFQA 2WSSD 2Z3DA 3M36A 3LGWA 3TK9A 3TPIZ 2BOKA 1OHHD 1ETRH 1OP0A 1MBQA 1QZ8A 3ZZ4A 1O2WA 1UW7A 3PMHB 1S81A 3IG6B 5TCCA 1QRXA 1P12E 2ZWLH 4K69A 3TH3H 1NESE 1AVXA 1ESAA 1P9UA 3UR9A 1C4V2 3TNSA 2FDAA 5C3NA 1F2SE 3T29A 1CU1A 1SOTA 1H8DH 2M2AA 4ZMAH 2AGIX 1C5PA 2WUBA 2YNBA 2GV7A 1S5SA 5C0TA 2GVFA 1O2NA 4X8VH 4DOQA 2HRVA 3KIDU 1L1GA 1YYY1 1V2TT 3K9XB 1ZMNA 1AWFH 3GS9A 4R0IA 1TX8A 2G00A 4XBDA 2FI3E 2JH0D 3S7HB 1A0JA 2XC0A 1CGIE 2B9LA 1TAWA 2JH5D 2Z9IA 3SUFA 3TGKE 2RFKC 1V2NT 1GHAF 4K60A 1H9HE 3GY5A 2XC4A 2P93A 5EQRA 3JZ1B 1OYTH 2STAE 3KQBA 3RXOA 4Y10E 1QQUA 3A80A 5L6NH 1EAIA 2QXGA 3UOPA 4CRDA 1MUEB 4A5TS 2SGAA 5A0CA 4JK6A 2WPIS 4CR9A 1BZXE 1WYKA 3QX5H 3RXJA 1QBNA 2EA3A 4DJZB 4R8TB 2WYJA 1ANBA 3C1KA 1BTPA 1IQNA 2J38A 1AMHA 1MTNC 2A4RA 5A8XA 3SV2H 1YLNA 1S0RA 1XUGA 1NRNH 1BHXF 1C4Y2 2BDGA 1HAVB 1UTKA 2KCAA 3EA8A 1NBME 2F83A 3M5MA 2ASUB 1P03A 1IQKA 2I6SA 5JBTA 1O2HA 4Q2KA 2G5VA 1FXYA 4IS5A 2BD9A 4BANB 3OEHD 3S9BA 1C4U2 2VVCA 2PKSB 3OTPA 1COWD 3UFAA 1P01A 1ZTKA 1A3BH 1MQ6A 2SNVA 4ABBA 2OC8A 5F8TA 4TYDA 1AE5A 1S84A 4KTCA 1QA0A 3TJOA 3UWJH 1K21H 1CHOF 2W5EA 2JJ2D 2V7QD 4NA8A 3SHCH 5C5NA 1LHEH 4MPWA 2ZTXA 1YPHE 3MH5A 1MH0A 3F6UH 1C1PA 1HAOH 1K22H 3V0XA 9LPRA 1EPTC 3PLPA 1FAXA 1V2LT 4UFDH 2RA3A 4YOIA 3SUGA 2ZO3H 2Z9GA 1SBWA 3NWUA 2WPKS 2HALA 3P6ZB 1C5TA 3U8RH 5KEDA 5GJ4B 1ACBE 1C1TA 1GBEA 1PQ8A 2AYWA 1DSTA 1V2JT 1KLIH 1EJMA 5GNDA 1CBWB 5EXNA 3M61U 2V3MA 1C2IA 1T8LA 5DP4A 1YCPK 3RM2H 2HVXA 3URDA 4ABIA 3ZZ7A 2J2UA 3GDUA 1WQVH 1NFUA 1D3QB 5IYTA 5DP9A 1A7SA 1LKAA 3NCLA 1EX3A 4X0WU 1MKXH 4NWKA 3TK5A 1O5BB 3ZVBA 3F2HA 3UNSA 2Z6BD 3RXKA 4AGJA 1HUTH 1BHXB 1SGFA 1S6FA 1HAZB 3N7EA 3E16B 1DWDH 3BTHE 5J4QA 3P95A 2PFEA 1G3DA 3QUMP 1GMDG 3U8OH 3RXTA 2FOBA 1AE8H 4AGKA 1ELBA 3LC5A 1TNLA 4OS7A 1THSH 7LPRA 1ANDA 3KQ5A 1PYTD 2EY4C 4DCDA 2P3UB 2NU4E 4Q4LA 2LPRA 4GAWA 1BA8B 1IQLA 1BRUP 3K6ZA 4OS1A 1A1RA 5A2MH 1FY3A 5CE1A 1SVPA 2C90B 2Q1JA 3A8CA 4ZH8A 2SNWA 3BG4B 3AAUA 4XOJA 3TGIE 2OC1A 1O36A 1K0HA 1KXAA 1EJAA 4FU8A 4B2BA 2WV9A 1C2HA 1ELFA 3P17H 3P8OA 3ATMA 5TCAA 1BTZA 1FPHH 2K8IA 1OSSA 1UMAH 2A7JA 4GCHG 2O8LA 2ILNA 2W26A 3PMAB 3ZV8A 2BM2A 1AO5A 4B6EA 2ULLA 1P57B 1GG6C 1YPKH 2C8YB 3EA7A 4IGDA 1KSNA 2BX4A 1O3PB 4ISLA 4FUDA 4F4OC 1K1IA 5EG4A 5AVDA 4O3TA 1AVWA 1FY4A 4NWLA 3D49H 1LDTT 1OWIA 4BAKB 1T31A 1ZHMA 1SGCA 4Y8YA 1ANEA 1AZ8A 1AIXH 1MAYA 1VITG 4VGCC 1C5LH 2GMTC 2OCVB 1ELAA 1QA7A 2ZF0H 3P8FA 4CRCA 4NIYA 1C5UA 1O3GA 3UIRA 3OX7U 1GPZA 1TGTA 3AAVA 2F9BH 1TPPA 2ZI2H 2WPLS 1O3DA 4RN6A 4XBBA 1TLDA 4FETA 1BMLA 1HNEE 5JB8S 5C1XA 1F5RA 4A1VA 1F5LA 3FAOA 1J16A 3A89A 4BXSA 1L4ZA 2ODYB 3PO1B 1SGFG 3CS0A 1DWEH 1CA0C 4FUFA 1GL1A 1W3CA 2KCYA 1T7CA 3UB0A 1BTHH 1TPOA 1GJCB 4BOHA 2ANYA 4ZKOU 1C9PA 5BPEA 1NU9A 1C5YB 7GCHG 1C5MD 4KTUA 1ELVA 3OTJE 3RXPA 3A7VA 6ESTA 4E7RG 2G4UA 3ATLA 2KFWA 2Y81A 1W10U 2TGPZ 3PMJA 3K6YA 4IBLH 2EQNA 2VWNA 1GHYH 3SGBE 3NKKA 5A09A 1VCPA 4CHAB 2ZDAH 1SI5H 1GMHG 2BY5X 3HATH 2Z7FE 3EAJA 3MH7A 5EGMA 1AZZA 1C2EA 3PWBA 2WV4A 1XUFA 1YWUA 3QK1A 4Q63A 3RLWH 4A1TA 4Z1MD 1QJ1B 2D1JA 2P8OC 3NXPA 3SBKA 1CQQA 2Y80A 1JRTA 5A8ZA 2VU8E 2ZGHA 3U69H 2KZ4A 1O2GH 2HNTF 1AKSB 1C2LA 2ZC9H 5JBAS 2XRCA 4GHQA 3A7WA 5FL7D 3Q3XA 4RKJB 1LHFH 1GDQA 3R3GB 1FONA 1NY22 1ZRBA 2ZFQH 1V2PT 2ZP0H 3HK3B 2QF5A 1SL3A 1NRPH 3EE7A 5EW1H 1INCA 4JK5A 3Q00A 3ZYEA 1C2JA 1JXPA 1EZSC 2ZFFH 2L6OA 2BD2A 2OQUA 1H9LB 1AN1E 2HWLB 3OY6U 2A5AA 2FS8A 2Y6TA 3QO6A 4MPVA 2KAIB 3MNXA 3F9GA 1QIXB 1BJUA 2QXJA 2CHAC 3GY2A 2AS9A 3LOXA 5C67A 3O8CA 1Y3XA 1F0TA 3A84A 5LPFA 8GCHF 2ZNKH 3ZZCA 1GMDF 2H9TH 1S6HA 4KGAA 1YGCH 4UFFH 1UO6A 2PV9B 1O2ZA 4K3JA 4IC5A 6CHAC 3U8TH 1Z1JA 4Y8XA 1E79D 2GGVB 3EA9A 2PWXA 2ZQ1A 2XWBI 4KELA 1BCUH 3BV9B 2R0KA 3FP7E 3MQKC 3T28A 4Z6AH 4WF8A 1KTSB 1O5CB 2QF4A 1GI2A 3ZZAA 1PPEE 2LP6A 3GY3A 1TA6A 1ABIH 3LDXH 4RI0A 1TFXA 2RG3A 2J98A 3FKSD 2YNAA 1PQAA 2RDEA 4WY3A 3M35A 4B75A 3ZIAD 4I8GA 1IHTH 1DY9A 3ODDA 3M5NA 3FO8D 3LT3A 1C5WB 4NIWA 3F9FA 5DK1A 3KQDA 1XVOA 2YMSC 2BLVA 2A7CA 4LXBH 1OS8A 2R2WU 4FUCA 3TJVA 1C5ZB 4MNWA 2VGCC 3RXHA 2AMDA 4IW4E 2G5NA 1K1JA 3FP6E 4SGBE 4H42U 3M3SA 2ZFTA 1YY3A 1VITF 2ZHFH 1CGJE 1QB1A 3LGIA 2ZZUH 2TBSA 1J9CH 2C93B 3V12A 1IQHA 3ZZDA 1SMFE 4NCYA 1VR1H 1TBQH 4KP0A 3UNQA 2FESH 2R3YA 1GGDC 5DO4H 1TNHA 2C8ZB 2GCTB 1GJ9B 1GJ4H 1AB9C 2FYQA 3SNEA 1C1VH 2P3FH 1TGBA 1O2XA 1WAYB 1SGDE 2XBYA 1YPLH 1ZOMA 2ZPSA 2F9PA 3TVJB 2FOHA 3U1JB 3MO6A 3ATWA 3Q3KA 2SGQE 2PUQH 1BITA 1GJ5H 4WWYA 7GCHF 1KDQA 2BLOA 2ZQ2A 4HTCH 1N8OC 3ZVGA 4CRFA 1GJAB 1J8AA 1LPGB 1SGQE 3QZQA 2FIRH 3SJKA 1BTXA 4AFUA 3GCHC 1GI5A 3RXIA 1BMFD 1LPKB 1M9UA 1VGCC 4YO9A 2HNTC 1GMHF 3QN7A 4WJG2 2FOMB 1C5OH 1GBKA 1E36B 1K1MA 4X1SU 5EIYA 3VGCB 3BTQE 1Z8IB 3C27B 1GVKB 5GPIB 1DLKB 1BQYA 5T3HA 3FN8A 1TNJA 3PMBB 1O2JA 2NWNA 2JETC 1UTJA 1KXFA 5JYIA 5LPRA 2A4GA 4FU9A 1O2KA 1Y5UT 1G36A 4Q7YA 1A4WH 1EXFA 1P09A 1TA2A 1SGYE 1QB9A 1QURH 3A83A 4Q7XA 2XCNA 3WW7A 3R0FA 1P3CA 1CO7E 4X1RU 1NO9H 2QC2A 2RCEA 5T6FA 1MMJN 1H8HD 4OS2A 3TLOA 3SORA 1NROH 1LO6A 2JH6D 2AGGX 5B6LA 5A0AE 3MU1A 4CH8B 1O37A 2W7UA 2G8TA 3SJOA 1ZJKA 1WCZA 2FWWA 5E8EH 4BTUB 3GCNA 1IQIA 1GBJA 1P3EA 3GDVA 1O3OA 2J4IA 1GI4A 1UVSH 1Q2WA 1MQ5A 5DKMA 1P8VC 2BD5A 1HAYB 2GP9B 4INKA 3PTBA 4AB9A 3MU0A 3DFJA 4XDEA 2AIQA 1UCYE 4CRAA 3RC6A 4HFPB 3PROA 2BOHB 4KKDA 2PR3A 1CHGA 4BXWA 1KXEA 1IQMA 2GZ8A 4I86A 1YLDA 3RXSA 1EAXA 3MYWA 1G3EA 1QRZA 3HKJB 3MTYA 4TY6A 1EAWA 3VB6A 5L2YH 1QL7A 5AFZH 4JZIA 3SUEA 1O38A 5CHAB 4ACAA 4BAOB 2BQ7B 2FI5E 1ZSJA 3D62A 3M3VA 3QTOH 4DT7B 1GI6A 2ZU5A 4AFQA 2F91A 2ZEBA 8KME2 2P3TB 1ZSKA 3KGPA 1WTHD 2UUFB 2B8OH 2CJIA 4B2AA 5H4IB 4WVPE 1LHGH 1LMWB 3DA9B 1GHWH 1GI9B 2XCFA 1Z6EA 1OXGA 1VCWA 2WPMS 3F3BA 3NK8A 3RXRA 1W0ZU 2PSXA 2D8WA 1O2UA 2OP9A 3F9EA 3GY8A 1C1NA 2YOLA 3EYDA 3ZVAA 1AUTC 1MABB 4INLA 1GWAA 1QGFA 1EZQA 2BTCE 1RFNA 3QWCH 5A8YA 1GJ6A 2XBVA 3P92A 4WMEA 5B6OA 4JZFH 4P02A 2D26C 3PYHA 3A8BA 1O30A 4K5ZA 1O5FH 1GDNA 2H1UA 1EP6A 1UHBB 2PW8H 1ARBA 4IMZA 2KX4A 1F7ZA 2BVRH 4ABJA 3G01A 1P02A 1FNIA 2W3KA 1Q3XA 1D4PB 4O03A 2YMSD 1FIZA 2P94A 4NA7A 5PTPA 2H6MA 3SV7A 2H5DA 3VB3A 1SFIA 3KNXA 5CMXH 4I8LA 3S9AA 4CBNA 1SB1H 3LJOA 2THFB 1EOLA 2SGEE 4AG2A 1TNKA 2ZCHP 1LTOA 3LH1A 5K0HA 5AF9H 4JYVH 1BRCE 1LVBA 1GDUA 1PPZA 1OYQA 3SNBA 2H9HA 4YM9A 5C94A 1WXRA 4M7GA 2XWAA 2VVVA 4ASUD 1ELGA 2CMYA 2BY9X 2F9VA 1DWBH 4A1XA 1DE7H 2ZA5A 1FDPA 1NFWA 3GY7A 2BD8A 2W6JD 3KHVA 2Q6DA 1A5GH 4JZEH 3BG8A 4Y0ZE 2WINI 1DITH 3RMNH 1PQ7A 1RD3B 3LPRA 1H8IH 1AFEH 1JIRA 2C3SA 1OWJA 3NRLA 3CS7A 3F0PA 2AH4X 1PPGE 1ZMJA 5IDKA 4HG6A 3VG8A 3T2NA 2AEIH 2PGBB 1LVMA 1K1OA 1NC6A 1A46H 2IN2A 3MNBA 1O3KA 1ESBA 1EOJA 1K2I1 2RDLA 2ZDMA 3DSPA 1JIMA 3MOCA 2F43B 3TNTA 3A88A 3SU0A 3ZV9A 2G4TA 1SOZA 4GSOA 4Y7BA 1C5NH 4NG9H 1G3CA 2FOEA 5EQSA 4ACBA 4FVDA 1HYLA 2CF9H 4Y71A 3E8LA 2XNIA 2QY0B 1O5EH 1GHBG 5ESBA 4XRNA 1BDAA 2V3HH 2VNTA 1ZTLA 5FX6A 3A8AA 2DE8A 1AI8H 4JZDH 1LKBA 1Z7KA 4D8NA 1DVAH 3LJJA 1YCPH 2SFAA 1KLJH 1E34B 1YPHC 3BTME 1W8BH 4H6TA 3SU5A 1THRH 3RXMA 1Y3UA 2A31A 1G2MA 2J98B 1O3MA 5EXLA 2F9UA 4BTTB 3RC5A 1EFRD 3MU4A 5JBCS 1MTSA 5LH8A 4E05H 4CBOA 1HRTH 1BTWA 1UCYK 4K1SA 1VJ9U 3LU9B 5AFYH 2FI4E 4IN2A 1BBRK 1G37A 1BOQA 1IHSH 4LK4A 4Y79A 1SQOA 3PM3A 3RMOH 4I32A 1H8ED 1GBIA 1BJVA 1FY1A 2GDDA 4RT0A 1TYNA 2AIPA 5HM9A 1CBWC 5DSFA 2F9OA 3TJNA 1G32B 1NPMA 2PTNA 4O9VA 2WV5A 4Y8ZA 4ABGA 3FOAA 1BIOA 2BDYA 1ID5H 5I46H 1UVOA 1KXDA 4Y7AA 3T5FH 4X1NU 1SR5C 3V3MA 1WOFA 4CREA 1YBWA 5ESTE 3ZZ8A 2F3CE 2KCPA 1MAXA 5TJXA 2FM2A 1BBRH 4A6LA 1PFXC 1TGCA 4OS5A 3ZVCA 5JDUB 3O8DA 2JDID 3HGNA 4XBCA 2HLCA 4ISIH 4B76A 1B5GH 3EE0B 1A3EH 4AG1A 3EDXB 5C1UA 3KYFA 4ZAEA 4ZHAA 1KIGH 1ZGVA 1HAIH 4B74A 3BTTE 2A2XH 5C1YA 1KDQB 1XMNB 4DVAU 1UHBA 1ZSLA 1C1WH 2ZHEH 3H7TA 3ZZ3A 1W0JD 4E7NA 2A7HA 2IPQX 1NZQH 5AHGH 3BTEE 4ABFA 1FUJA 2FX4A 3A87A 1GBMA 2QF0A 2W7SA 1JOUB 1TQ0B 1HIAA 3RP2A 3S69A 5T6GA 1O5DH 5FBEA 1HB0B 3T62A 3M7QA 5DP6A 3RLYH 1UVPA 1XUHA 2J34A 4M9FA 1UTLM 1GHXH 4OGYA 5HMAA 2AMQA 2WUCA 2XXLA 3HGPA 3I78A 1H4WA 1IOEA 1SSXA 3BG4C 2PKAA 1EPTA 3GY6A 4K1TA 2Y5HA 4DT4A 5HGGA 1G2LA 2QCYA 5GCHG 1AFQB 2ZCKP 1MZAA 1C2MA 2BD3A 1KXCA 4ZROA 1UTPA 3D23A 1VKYA 1O0DH 3AW0A 1F0UA 1DUAA 4UDWH 1E38B 2O8MA 4FUIA 4UE7H 1ELDE 2ZFSA 1CA8B 1EASA 5HXFA 4ISNA 1N6XA 1O34A 1YM0A 1NRRH 2OK5A 5L30H 1ZYOA 5EXMA 1XVMA 4U30A 4ZKSU 1PPHE 1LQEA 3FANA 1T8MA 4A92A 4F55A 1HCGA 3L6PA 1MZDA 2Z3EA 1ZZZA 2J92A 1MU8B 2ZHDA 3A8DA 3I29A 2OINA 4AFZA 1XX9A 1VJAU 2XYAA 1EATA 1V2RT 3TITA 3UTUH 3SJ9A 3BEIB 2OXSA 1THPB 4X1QU 1C1OA 2FTLE 1SGIB 1V2VT 1RIWB 4YT7H 2FXRA 2XBXA 2BZAA 3O8RA 1HPGA 4CRBA 2LNCA 2QXIA 1MTWA 1TIOA 1K28D 1FI8A 4AORA 3DUXH 3P70B 1O32A 1YCPM 1GHBF 2Y5FA 1TGSZ 1K1PA 4AFSA 1TOCB 3KQCA 2SGPE 2ZU4A 4MPUA 3B23B 1W12U 1AHTH 1AQ7A 2ZGCA 2ZKSA 5G4BA 4FUJA 3SZNA 1HJ8A 1WU1A 1MCTA 1HJ9A 2QV1A 4X2VA 1FPCH 2XW9A 4J2YB 2HOBA 1MKWK 3RC4A 4DY7B 1C1SA 5E0GA 2FOFA 1SQRA 2A32A 9ESTA 2FLRH 2VVUA 4CHAC 3AASA 1GI8B 3E90B 3MU8A 1IQFA 1E35B 1HXEH 4MG3A 2ZHQH 3W1EA 1O3BA 3GISB 1PPCE 1GCTB 3PRBA 1NBMD 2PSYA 1CT2E 1MTVA 5EPYA 1LPZB 2ZTZA 3ATKA 3RXVA 2J9NA 3OE7D 3UQVA 2A4OA 1C9TA 1E0FD 3GOVB 1CT4E 4P00A 1T8OA 1Z6JH 2BDHA 5CHBA 4K2YA 3VPKA 2J95A 3Q76A 2EC9H 4Z0KA 1O2PA 1C1RA 4JZ1A 3L33A 1MBMA 4B6FA 4LOYH 4GCHF 3SUDA 1GBCA 1TNGA 4THNH 1OWEA 2H2ZA 3VEQB 1YKTA 2ZFRH 5GDSH 5LGOA 4Y11E 2BLQA 7KMEH 3TJUA 1GMCG 5K7RA 1D9IA 3BIVH 1P2NA 4YESB 1TMUH 1UK4A 1C2GA 1EZXC 3A86A 1O3IA 2FZZA 3LGYA 1SGPE 1NFYA 4I31A 2J94A 1L0ZA 1JRSA 4WXIA 1TRYA 2NU3E 4ABDA 1D6RA 1JBUH 2B5TB 4F48B 1Y5BT 1NRQH 3AK5A 1P05A 1RTLA 2AFQB 3F1SB 1PJPA 4O97A 4OM9A 5DP7A 3SI3H 5L2ZH 4U32A 2VH0A 2GJGA 3B8JA 1YLCA 1S0QA 3E6PH 1DICA 1LVYA 3UNRA 1HBTH 1T4UH 1W0YH 3ODFA 4NSYA 1J17T 5FPYA 3VFEA 1O2QA 4YLQH 5EJZA 2FOAA 4NIXA 3M5LA 3Q77A 3VXEH 4MDSA 1YPGH 2P16A 3K2UA 1ZTJA 1QB6A 2ZFPH 1A2CH 5F6MA 2BZ6H 3BIUH 3RU4T 1O5GH 1TOMH 3BTGE 5GCHF 1PPFE 1GBAA 3V13A 4I8KA 1TONA 1ZPBA 2AHME 2FLBH 2ZU1A 1ORFA 2OUAA 5E0JA 4YT6H 1W11U 1TMBH 3KF2A 1QQ4A 5DP5A 3PV2A 1L1NA 4YLUA 1J14A 5CDFE 1T32A 1RTKA 3MH6A 2H9EH 3WY8A 1E1RD 3S7KB 2KM0A 2R2MB 2XC5A 1MTUA 5GWZA 3DSOA 1YPMH 3A7YA 4X1PU 1UTMA 4YOGA 2FYRA 5SGAE 1TE0A 5T6DA 2BHGA 4WH8A 4AZ2B 2FO9A 2WPHS 1ZPCA 4FU7A 3QDZB 5KGOA 4BAMB 2BY6X 1B7XB 5EJLA 2R0LA 1Z8JB 1C1QA 2Z94A 1C1MA 3RU4D 1VCQA 1AWHB 1HJAB 2QE7D 2FTMA 3U98H 1PPBH 3H5CB 1SLUB 1SLWB 2O8UA 4B73A 4BNRA 3E0PB 2GKVE 3F2FA 2GCTC 1YF4A 1WTGH 3NPSA 2BXUH 4WH6A 4ZHLU 3ITIA 2A45B 5DG6A 2VJ1A 2VIVA 3RXLA 2GDEH 4JYUH 3M7UA 4OS4A 1TPSA 3F0OA 3M7TA 4NIVA 1CSOE 6LPRA 1FV9A 1GCDA 4UEHH 1CT0E 1CVWH 1F0RA 1V2KT 1TQ7B 3LKWA 3M37A 3GYLB 1ARCA 3HK6B 1A5HA 4CH2B 1L2EA 3A82A 3SV9A 3UR6A 2O8TA 3OFND 4HGCA 3BSQA 1TABE 2OQ5A 1VZQH 1OP2A 2DUCA 2ZCLP 5ABWA 4IC6A 1XUKA 4AYYB 2C8WB 2K0QA 3PLKA 1XKAC 1P2IA 1YP9A 1F5KU 2Y7ZA 1FY8E 1GJBB 3VGCC 2Z3CA 2PLXA 4DURA 5LPEA 2BB4A 1PYTC 1G3BA 3BTFE 1WSSH 8ESTE 4TWYA 1TMTH 1T8NA 1NRSH 3RDZA 1QTFA 3SU6A 2BDIA 2ALVA 4WMDA 5EW2H 3MNCA 4D7FA 2HVYB 4AX9H 3SQEE 1ELEE 3A85A 4ZKNU 1OPHB 2VINA 2Z9JA 3UAIC 2QGRA 1O35A 2Z9LA 4TT3D 4I8JA 3FVFB 4J1YA 2G81E 1OX1A 2B7DH 2A0QB 1K1LA 4MNXA 3RUOA 2QA9E 3E1XB 3N99A 3PWCA 1HXFH 1GMCF 3TGJE 2IPHA 1QBOA 1K1NA 3ATIA 1DSUA 1FMGA 1EB2A 1H1BA 1MTNB 2NU0E 5JPMH 1BRAA 3GYMA 3TH4H 5EODA 2W6ID 3RXQA 2UUJB 5DGJA 2OBOA 4FUBA 5E2PA 1OWDA 1DM4B 3MWIU 2VIPA 2SGDE 2BDBA 4NGAH 1P2OA 1D3TB 3OY5U 1WBGB 3RXBA 1ZR0A 1W7XH 2VB0A 1AD8H 3V7TA 1IQGA 3RMLH 2HGTH 1TRMA 2WZQA 1LCYA 3VB5A 3QTVH 3DCLA 1QR3E 2EI8A 2O8WA 3ESTA 5I25A 3SNCA 2WPJS 3K65B 4WXVA 4DIIH 1P11E 3CNRA 1HIAB 1TPAE 1UVUH 1WDIA 1HAPH 2BVSH 1O2MA 1GJ7B 1LQDB 1UTQA 2R3UA 5CHAC 1HV7A 4YOJA 3STIA 1GI1A 3KN2A 1AY6H 1O3CA 2V6NA 2Z9KA 2G52A 4GUXA 1P10A 3TU7H 1BMNH 2PKAB 1EPTB 4MTBA 4LZ4B 1D6WA 3SNDA 1O3FA 3T27A 1EJNA 1HAHH 4ZHMU 1DXWA 3RXEA 1EUFA 3DD2H 4UFEH 1NU7B 1C1UH 1Z1IA 4BAHB 4UD9H 4XE4A 1BTUA 3MO3A 3LH3A 5F03A 1W13U 4TPIZ 2Y5GA 3SU4A 2UWPA 1BMAA 2SGFE 2ODPA 2DE9A 4MVNA 4K1EA 1BUIA 3FZZA 2OC0A 5HYOA 1B0FA 1O2TA 1D3PB 2FS9A 3SGAE 5EOKA 1SQAA 4FUGA 5FPTA 4B1TA 1XUJA 1P9SA 1BTYA 3BEFB 1W0KD 1SKYE 2O9QA 1H9IE 2QYIA 3H09A 1Y8TA 2ZG0H 2AMPA 1EKBB 1FLEE 4ABAA 2F9NA 1O2IA 3RMMH 1SGRE 4K8YA 2Y7XA 3OAAD 4F49A 4DIHH 5F53A 1OOKB 1CGHA 5T1VA 5DP8A 3SHAH 1BRBE 3SJIA 2PHBA 4AN7A 2EEKA 1C2FA 1FIWA 1XXFA 1GVLA 2J97A 3A7XA 3DFLA 1O3HA 1KTTB 2VWLA 3UWIA 3IWMA 1XUIA 2CV3A 1A0HB 3SU2A 3CP7A 3ZYDA 1V2MT 1KYNA 1ESTA 2VWMA 2GTBA 1O39A 1T4VH 1ZMLA 1OKXA 1GHZA 3BTWE 4DW2U 1FN6A 5C5OA 2TPIZ 1SLVB 2FOCA 2BXTH 1MKXK 1O3NA 3SN8A 1RS0A 3EGKH 4FVBA 1TX7A 1TX6A 4GHTA 1P2KA 1EQ9A 4PROA 2EI7A 5C2ZA 4X8TH 3PV4A 4TWWA 2A5KA 3OSYA 3UUZA 1BB0B 1DUEA 3ZVDA 2PKSC 1FQ3A 5JBBS 2TGTA 3CENA 1OP8A 1GVZA 1JWTA 2ZDVH 3DHKH 2V0BA 1GG6B 5DP3A 3OYPA 1MD7A 1C5SA 1NN6A 1SGNE 1ETSH 3GICB 3STJA 1Y3WA 2IJD1 1RGQA 4CRGA 3MFJA 3MNSA 1NTPA 4ZXYH 3PLBA 4XSKU 1FN8A 4BAQB 1YPEH 3F9HA 2KR7A 1P04A 3ZZBA 1TBRH 3SW2B 3EQ0H 3WWFA 4VGCB 2GMTB 2OC7A 8GCHG 3LGUA 2GT8A 1P06A 3SO3A 4IN1A 3VB4A 4FXGH 2VIDA 2VIOA 4ESTE 1DLEA 2ALPA 3SZEA 2ESTE 1VITH 2GD4B 5F8XA 2PUXB 1EB1H 3RXFA 5J4SA 1V2OT 1UVTH 1WUNH 1DWCH 5E2OA 2ZGBH 5A0BA 4X2YA 3HKIB 2I6QA 3KEEA 4X6MA 5HIYA 1GBDA 1CA0B 3F2GA 1SHYA 2KCOA 3MHWU 1UCYH 1DPOA 2PTCE 2ANKH 3SGQE 4AYVB 1BMMH 3RU4E 1DX5M 2GV6A 4YZUA 3SQHE 4DGJA 3E0NB 3RXAA 1C5VA 1SPJA 1ZRKA 2UWOA 1L4DA 1MD8A 1QRWA 3TK6A 4OS6A 1RXPA 3U1IB 2FMJA 3F68H 4D9RA 1FX0B 1GHVH 4U2WA 4YTAA 1QL8A 4X6PA 4ZUHA 3W94A 4FUEA 1FJSA 5ETXA 4UFGH 3KCGH 2P8OB 4MLFB 1O3AA 1HGTH 3BEUA 2Q6GA 1ETTH 2V3OH 3ZZ6A 1XXDA 4I7YH 3BF6H 2BDAA 1C5XB 1HFDA 1L1JA 1GI0A 1OWHA 1TGNA 2TGDA 1C2DA 1V2ST 1F92A 2L74A 3KQEA 3WWBA 1GI7B 5FX5A 1SGEE 2WHXA 5FCKA 1J15A 3MI4A 1C5QA 2XNDD 3OU0A 4Y76A 1NS3A 2ODQA 2ZECA 1KY9A 2QAAA 4FUHA 4NSVA 5EQQA 3SYJA 3UPEA 6GCHG 3U9AH 1SGTA 3LIWA 4GVUA 4X6OA 1Z8GA 2BD4A 2GT7A 2VIWA 4RKOB 7ESTE 1OWKA 2A5IA 4MQAA 2OD3B 1HLTH 3SOSA 1SHHB 3BTKE 1V2QT 3S9CA 4D7GA 3QGNB 3RXDA 2ZDLA 1ZHPA 4NFEA 1QBVH 2F4LA 2CHAB 1GBBA 2QF3A 1GJDB 1LHDH 1S83A 1HAVA 5GIBA 1NM6A 2VH6A 3LGTA 2ZDNA 2GZ7A 2ZPRA
chains in the Genus database with same CATH topology
1O2RA 3SU3A 3ZZ9A 2GCHG 4GPGA 1ZGIA 1EP5A 3MH4A 1YPJH 1A5IA 3ELAH 1ZPZA 3MMGA 1ZLRA 1TWXB 1ELTA 4D9QA 5FCRA 1FY5A 6CHAB 4IMQA 1B0EA 3BN9A 4KTSA 1SLXB 3W95A 2ZIQH 3Q3YA 3E91A 3SI4H 1MU6B 2ZDKA 1O31A 3D65E 2R9PA 2ZPQA 3PO1C 1S85A 1GBFA 1HDTH 2OTVA 2A1DB 3A7TA 2FP7B 2CF8H 2ZU2A 1IQJA 1WQSA 1TNIA 4I8HA 3H7OA 2CN0H 2FOGA 1KXBA 5GXPA 3JZ2B 1AFQC 1O2LA 2ZTYA 1A61H 1QL9A 3P8GA 1NFXA 8LPRA 3MU5A 2IJOB 1V6DA 1XM1A 4O3UA 1F0SA 1PQ5A 1EAUA 3A81A 1O33A 1DDJA 2VGCB 4HZHA 3GDSA 2BY7X 3UQOA 3GCTG 4U01A 5FAHA 1LHCH 4JMYA 1GBTA 1QY6A 4LZ1H 2BDCA 3UREA 2C8XB 4ZKRU 2BLWA 4WMFA 4I33A 4HI3A 3URCA 4MPXA 4TY7A 5HM2A 1DOJA 1Y5AT 3M5OA 2WYGA 1Z8RA 4MNYA 3N7OA 1AGJA 3FP8E 3SJ8A 1SG8B 1W2KH 5EU8A 1GGDB 4BTIB 4GLYA 1XKBC 1FZZA 2XBWA 1MKWH 1UTNA 4NFFA 1NT1A 1AB9B 2BX3A 3SU1A 5JB9S 5FPSA 2ANWA 2BQ6B 1DXPA 1P2QA 2EI6A 1O5AB 2Y82A 1RIWC 1SQTA 4QT8C 1Q31A 4B71A 2BYAX 2Q6FA 3RXUA 2BVXH 2W3IA 3T25A 3UOUA 1GJ8B 4JCNA 1G30B 1WV7H 1MCVA 2AERH 2BY8X 2QIQA 3TH2H 4ABHA 1N8OB 2ZGXH 2VIQA 1K9OE 1TBZH 2P95A 4X8UH 3LONA 1QFKH 1V3XA 2TRMA 3PTNA 5FHTA 3GCHB 2BD7A 1HAXB 1N1LA 2ANMH 3FFGA 4AOQA 1TRNA 1VGCB 3QZRA 1RRKA 3TIUA 2D2DA 1AUJA 2XTTB 4ZXXH 3ENSB 3UY9A 3HPTB 1QJ7B 1CE5A 2BMGB 1Z71A 2HNTE 3O8BA 3FZDA 2ZU3A 2A2QH 1V2UT 2ZGJA 4Y0YE 2G55A 2NU2E 1GCTC 2JETB 2UUKB 2HPPH 4H4FA 2UWLA 1FAKH 3DT0H 3AVZA 1GHAG 4X6NA 1DS2E 1UJ1A 2M5TA 4ISOA 2OBQA 2FODA 3M3TA 1G9IE 3MO9A 1IQEA 5FBIA 2OLGA 6GCHF 1RJXB 1Y59T 1A0LA 2V35A 4ASHA 5C20A 4INHA 4D76A 2PGQB 3ZZ5A 4AB8A 1YC0A 2TGAA 4ISHH 2H5CA 3VB7A 1QHRB 1Y3VA 2QXHA 3QLPH 1P0SH 4OGXA 5EPNA 1U6QA 1SC8U 2P59A 2C4FH 5BRRE 3LGVA 1IAUA 4Q7ZA 1ZHRA 3VXFH 2QN5T 4E06H 3LC3A 2K1QA 4NZQA 1ANCA 2GCHF 1HAGE 1RTFB 1AU8A 1EZUC 4B2CA 3NZIA 3P8NA 1UTOA 1W7GH 1KLTA 3SV8A 1W14U 1BT7A 3RXCA 1UK3A 1UK2A 2NU1E 5DJ7A 4ABEA 3T26A 1V2WT 2FEQH 4H6SB 1GBHA 3PB1E 2B0FA 4X8SH 3L3TA 4JYTA 1DY8A 1X7AC 2A4QA 3QGJA 1QJ6B 1GBLA 1GL0E 1O2YA 3ZVFA 2TIOA 4A7IB 3AW1A 1TB6H 1C2KA 1AVGH 2VWOA 1CHOG 3NUMA 1O3EA 2G51A 3A7ZA 2HPQH 1DT2A 1TALA 4Y6DA 3KL6A 2UUYA 5FXLA 2BQWB 3GY4A 2CXVA 1QNJA 3ZVEA 3I77A 1O3LA 1O2SA 1DFPA 1E37B 1P2MA 2ZHWH 4X2XA 5E0HA 1O2VA 3IITA 1LVOA 1N6YA 1JMOH 1P2JA 4X2WA 4MNVA 4NA9H 1QCPA 1AKSA 4RSPA 3S0NA 3BTDE 1O2OA 3GCTF 2GX4A 4Q80A 1SFQB 3SV6A 2JKHA 2FX6A 3SNAA 4NZLA 4DG4A 5DPAA 1D3DB 1O3JA 3RXGA 4TPYA 1DANH 2AGEX 4CR5A 1S82A 1ABJH 1GI3A 2CGAA 3B9FH 4UONA 5F8ZA 2FPZA 2STBE 4K8BA 3GCOA 1ELCA 2IOTA 1BBRE 1HJAC 1C5RA 2KAIA 2GZ9A 4SGAE 3RM0H 2RA0A 3E3TA 1Y3YA 1ZJDA 4XFQA 2Z3DA 3M36A 3LGWA 3TK9A 3TPIZ 2BOKA 1ETRH 1OP0A 1MBQA 3ZZ4A 1O2WA 3PMHB 1S81A 3IG6B 5TCCA 1QRXA 1P12E 2ZWLH 4K69A 3TH3H 1NESE 1AVXA 1ESAA 1P9UA 3UR9A 1C4V2 3TNSA 2FDAA 5C3NA 1F2SE 3T29A 1CU1A 1SOTA 1H8DH 4ZMAH 2AGIX 1C5PA 2WUBA 2YNBA 2GV7A 1S5SA 2GVFA 1O2NA 4X8VH 4DOQA 2HRVA 3KIDU 1L1GA 1YYY1 1V2TT 3K9XB 1ZMNA 1AWFH 4R0IA 1TX8A 2G00A 4XBDA 2FI3E 2JH0D 3S7HB 1A0JA 2XC0A 1CGIE 2B9LA 1TAWA 2JH5D 2Z9IA 3SUFA 3TGKE 1V2NT 1GHAF 4K60A 1H9HE 3GY5A 2XC4A 2P93A 5EQRA 3JZ1B 1OYTH 2STAE 3KQBA 3RXOA 4Y10E 1QQUA 3A80A 5L6NH 1EAIA 2QXGA 3UOPA 4CRDA 1MUEB 4A5TS 2SGAA 5A0CA 4JK6A 2WPIS 4CR9A 1BZXE 1WYKA 3QX5H 3RXJA 1QBNA 2EA3A 4DJZB 4R8TB 2WYJA 1ANBA 3C1KA 1BTPA 1IQNA 2J38A 1AMHA 1MTNC 2A4RA 5A8XA 3SV2H 1S0RA 1XUGA 1NRNH 1BHXF 1C4Y2 2BDGA 1HAVB 1UTKA 3EA8A 2F83A 3M5MA 2ASUB 1P03A 1IQKA 2I6SA 5JBTA 1O2HA 4Q2KA 2G5VA 1FXYA 4IS5A 2BD9A 4BANB 3S9BA 1C4U2 2VVCA 2PKSB 3UFAA 1P01A 1ZTKA 1A3BH 1MQ6A 2SNVA 4ABBA 2OC8A 5F8TA 4TYDA 1AE5A 1S84A 4KTCA 1QA0A 3TJOA 3UWJH 1K21H 1CHOF 2W5EA 4NA8A 3SHCH 5C5NA 1LHEH 4MPWA 2ZTXA 1YPHE 3MH5A 1MH0A 3F6UH 1C1PA 1HAOH 1K22H 3V0XA 9LPRA 1EPTC 3PLPA 1FAXA 1V2LT 4UFDH 2RA3A 4YOIA 3SUGA 2ZO3H 2Z9GA 1SBWA 3NWUA 2WPKS 2HALA 3P6ZB 1C5TA 3U8RH 5GJ4B 1ACBE 1C1TA 1GBEA 1PQ8A 2AYWA 1DSTA 1V2JT 1KLIH 1EJMA 1CBWB 5EXNA 3M61U 1C2IA 1T8LA 5DP4A 1YCPK 3RM2H 2HVXA 3URDA 4ABIA 3ZZ7A 2J2UA 3GDUA 1WQVH 1NFUA 1D3QB 5IYTA 5DP9A 1A7SA 1LKAA 3NCLA 1EX3A 4X0WU 1MKXH 4NWKA 3TK5A 1O5BB 3ZVBA 3UNSA 2Z6BD 3RXKA 4AGJA 1HUTH 1BHXB 1SGFA 1S6FA 1HAZB 3E16B 1DWDH 3BTHE 5J4QA 3P95A 2PFEA 1G3DA 3QUMP 1GMDG 3U8OH 3RXTA 2FOBA 1AE8H 4AGKA 1ELBA 3LC5A 1TNLA 4OS7A 1THSH 7LPRA 1ANDA 1PYTD 4DCDA 2P3UB 2NU4E 2LPRA 4GAWA 1BA8B 1IQLA 1BRUP 3K6ZA 4OS1A 1A1RA 5A2MH 1FY3A 5CE1A 1SVPA 2C90B 2Q1JA 3A8CA 4ZH8A 2SNWA 3BG4B 3AAUA 4XOJA 3TGIE 2OC1A 1O36A 1KXAA 1EJAA 4FU8A 4B2BA 1C2HA 1ELFA 3P17H 3P8OA 3ATMA 5TCAA 1BTZA 1FPHH 1OSSA 1UMAH 2A7JA 4GCHG 2O8LA 2ILNA 2W26A 3PMAB 3ZV8A 2BM2A 1AO5A 2ULLA 1P57B 1GG6C 1YPKH 2C8YB 3EA7A 4IGDA 1KSNA 2BX4A 1O3PB 4ISLA 4FUDA 4F4OC 1K1IA 5EG4A 5AVDA 4O3TA 1AVWA 1FY4A 4NWLA 3D49H 1LDTT 1OWIA 4BAKB 1T31A 1ZHMA 1SGCA 4Y8YA 1ANEA 1AZ8A 1AIXH 1MAYA 1VITG 4VGCC 1C5LH 2GMTC 2OCVB 1ELAA 1QA7A 2ZF0H 3P8FA 4CRCA 4NIYA 1C5UA 1O3GA 3UIRA 3OX7U 1GPZA 1TGTA 3AAVA 2F9BH 1TPPA 2ZI2H 2WPLS 1O3DA 4RN6A 4XBBA 1TLDA 1BMLA 1HNEE 5JB8S 5C1XA 1F5RA 4A1VA 1F5LA 3FAOA 1J16A 3A89A 4BXSA 1L4ZA 2ODYB 3PO1B 1SGFG 3CS0A 1DWEH 1CA0C 4FUFA 1GL1A 1W3CA 1T7CA 1BTHH 1TPOA 1GJCB 4BOHA 2ANYA 4ZKOU 1C9PA 5BPEA 1NU9A 1C5YB 7GCHG 1C5MD 4KTUA 1ELVA 3OTJE 3RXPA 3A7VA 6ESTA 4E7RG 2G4UA 3ATLA 2Y81A 1W10U 2TGPZ 3PMJA 3K6YA 4IBLH 2VWNA 1GHYH 3SGBE 3NKKA 5A09A 1VCPA 4CHAB 2ZDAH 1SI5H 1GMHG 2BY5X 3HATH 2Z7FE 3EAJA 3MH7A 5EGMA 1AZZA 1C2EA 3PWBA 2WV4A 1XUFA 3QK1A 3RLWH 4A1TA 1QJ1B 2D1JA 2P8OC 3NXPA 3SBKA 1CQQA 2Y80A 1JRTA 5A8ZA 2VU8E 2ZGHA 3U69H 1O2GH 2HNTF 1AKSB 1C2LA 2ZC9H 5JBAS 2XRCA 4GHQA 3A7WA 3Q3XA 4RKJB 1LHFH 1GDQA 3R3GB 1FONA 1NY22 1ZRBA 2ZFQH 1V2PT 2ZP0H 3HK3B 1SL3A 1NRPH 5EW1H 1INCA 4JK5A 3Q00A 3ZYEA 1C2JA 1JXPA 1EZSC 2ZFFH 2BD2A 2OQUA 1H9LB 1AN1E 2HWLB 3OY6U 2A5AA 2FS8A 2Y6TA 3QO6A 4MPVA 2KAIB 3MNXA 3F9GA 1QIXB 1BJUA 2QXJA 2CHAC 3GY2A 2AS9A 3LOXA 5C67A 3O8CA 1Y3XA 1F0TA 3A84A 5LPFA 8GCHF 2ZNKH 3ZZCA 1GMDF 2H9TH 1S6HA 4KGAA 1YGCH 4UFFH 1UO6A 2PV9B 1O2ZA 4K3JA 4IC5A 6CHAC 3U8TH 1Z1JA 4Y8XA 2GGVB 3EA9A 2PWXA 2ZQ1A 2XWBI 4KELA 1BCUH 3BV9B 2R0KA 3FP7E 3T28A 4Z6AH 4WF8A 1KTSB 1O5CB 1GI2A 3ZZAA 1PPEE 3GY3A 1TA6A 1ABIH 3LDXH 1TFXA 2RG3A 2YNAA 1PQAA 4WY3A 3M35A 4B75A 4I8GA 1IHTH 1DY9A 3ODDA 3M5NA 3LT3A 1C5WB 4NIWA 3F9FA 5DK1A 3KQDA 1XVOA 2BLVA 2A7CA 4LXBH 1OS8A 2R2WU 4FUCA 3TJVA 1C5ZB 4MNWA 2VGCC 3RXHA 2AMDA 4IW4E 2G5NA 1K1JA 3FP6E 4SGBE 4H42U 3M3SA 2ZFTA 1VITF 2ZHFH 1CGJE 1QB1A 3LGIA 2ZZUH 2TBSA 1J9CH 2C93B 3V12A 1IQHA 3ZZDA 1SMFE 4NCYA 1VR1H 1TBQH 4KP0A 3UNQA 2FESH 2R3YA 1GGDC 5DO4H 1TNHA 2C8ZB 2GCTB 1GJ9B 1GJ4H 1AB9C 2FYQA 3SNEA 1C1VH 2P3FH 1TGBA 1O2XA 1WAYB 1SGDE 2XBYA 1YPLH 1ZOMA 2ZPSA 2F9PA 3TVJB 2FOHA 3U1JB 3MO6A 3ATWA 3Q3KA 2SGQE 2PUQH 1BITA 1GJ5H 4WWYA 7GCHF 1KDQA 2BLOA 2ZQ2A 4HTCH 1N8OC 3ZVGA 4CRFA 1GJAB 1J8AA 1LPGB 1SGQE 3QZQA 2FIRH 3SJKA 1BTXA 4AFUA 3GCHC 1GI5A 3RXIA 1LPKB 1M9UA 1VGCC 4YO9A 2HNTC 1GMHF 3QN7A 4WJG2 2FOMB 1C5OH 1GBKA 1E36B 1K1MA 4X1SU 3VGCB 3BTQE 1Z8IB 3C27B 1GVKB 5GPIB 1DLKB 1BQYA 5T3HA 1TNJA 3PMBB 1O2JA 2NWNA 2JETC 1UTJA 1KXFA 5JYIA 5LPRA 2A4GA 4FU9A 1O2KA 1Y5UT 1G36A 4Q7YA 1A4WH 1EXFA 1P09A 1TA2A 1SGYE 1QB9A 1QURH 3A83A 4Q7XA 2XCNA 3R0FA 1P3CA 1CO7E 4X1RU 1NO9H 2QC2A 2RCEA 5T6FA 1MMJN 4OS2A 3TLOA 3SORA 1NROH 1LO6A 2JH6D 2AGGX 5A0AE 3MU1A 4CH8B 1O37A 2W7UA 2G8TA 3SJOA 1ZJKA 1WCZA 2FWWA 5E8EH 4BTUB 3GCNA 1IQIA 1GBJA 1P3EA 3GDVA 1O3OA 2J4IA 1GI4A 1UVSH 1Q2WA 1MQ5A 5DKMA 1P8VC 2BD5A 1HAYB 2GP9B 4INKA 3PTBA 4AB9A 3MU0A 3DFJA 4XDEA 2AIQA 1UCYE 4CRAA 3RC6A 4HFPB 3PROA 2BOHB 4KKDA 2PR3A 1CHGA 4BXWA 1KXEA 1IQMA 2GZ8A 1YLDA 3RXSA 1EAXA 3MYWA 1G3EA 1QRZA 3HKJB 3MTYA 4TY6A 1EAWA 3VB6A 5L2YH 1QL7A 5AFZH 4JZIA 3SUEA 1O38A 5CHAB 4BAOB 2BQ7B 2FI5E 1ZSJA 3D62A 3M3VA 3QTOH 4DT7B 1GI6A 2ZU5A 4AFQA 2F91A 2ZEBA 8KME2 2P3TB 1ZSKA 3KGPA 1WTHD 2UUFB 2B8OH 2CJIA 4B2AA 5H4IB 4WVPE 1LHGH 1LMWB 3DA9B 1GHWH 1GI9B 2XCFA 1Z6EA 1OXGA 1VCWA 2WPMS 3RXRA 3NK8A 1W0ZU 2PSXA 2D8WA 1O2UA 2OP9A 3F9EA 3GY8A 1C1NA 2YOLA 3EYDA 3ZVAA 1AUTC 4INLA 1GWAA 1QGFA 1EZQA 2BTCE 1RFNA 3QWCH 5A8YA 1GJ6A 2XBVA 3P92A 4WMEA