1XUQA

Crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
200
structure length
200
Chain Sequence
KHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 72
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xuqA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xuqA02
1N0NA 5AG2A 4GUNA 3DC6A 1GN6A 1I0HA 3BFRA 2RCVA 3AK1A 1AVMA 2QKAA 4YIPA 3TJTA 1AP5A 1BT8A 1WB8A 1XUQA 3RN4A 3AK3A 5A9GA 4JYYA 1XILA 2GDSA 4JZGA 1EN4A 1JR9A 2QKCA 1IX9A 4X9QA 1MSDA 3IC9A 1KKCA 1BS3A 1XREA 4BR6A 1N0JA 1GN3A 4E4EA 1I08A 1SZXA 2ADQB 3DC5A 1MNGA 4FFKA 1VARA 1ZTEA 1BSMA 1VEWA 1MA1A 4YIOA 1LUWA 1P7GA 3KKYA 1QNMA 1EN5A 1GN2A 3EVKA 1B06A 4F6EA 1EM1A 1GN4A 1AP6A 3LSUA 1AR4A 3MDSA 1LUVA 1EN6A 3K9SA 2CE4A 1ZLZA 1PM9A 2ADPA 1AR5A 3AK2A 3C3SA 4JZ2A 1D5NA 1MMMA 2CDYA 4C7UA 1Y67A 1ZSPA 3QVNA 2P4KA 2AW9A 1WB7A 3OT7A 3CEIA 1JA8A 1IXBA 1PL4A 3C3TA 1ZUQA 1IDSA 1XDCA
chains in the Genus database with same CATH superfamily
1YDXA 3ZHQA 3DC6A 1SERA 1RSOA 2JDIG 1FXKC 1SC5B 1XUQA 1DK1A 3AG7A 1R3IC 5KHGA 1MOFA 4LF9B 3M7MX 5A9GA 4TSFG 2P7TC 1AI5A 4FLWA 4BW5A 4I55B 4X64B 5J2TA 1N32O 3UT5A 3VQWA 4LFBO 1Y4MA 3E86A 1SKVA 1GM7A 3B8NA 5BXZA 4KFMA 4JGSA 1MNGA 4O4JA 5EBWC 4JI1B 1PNLA 4NTYA 2DW4A 2YDEA 2OT5A 3P3PA 2Y4TA 3A0RA 2BSKA 2LQTA 4I9WA 1RM1B 4DR2O 1YEWA 3OW2U 1OCCB 4DV1B 2AGAA 4CS3A 1QVFU 4Z1VA 1KMIZ 4MSWC 2ILMA 3K9SA 2CE4A 1TVKB 3JD3A 1XNQO 3JAWA 1Q6IA 3CRAA 1N34O 5JVDB 3L75H 3HKDA 3ZMVA 2PI4A 5J2UB 4ICGA 3ZHUA 2ARHA 3C90A 2ZIMA 2OTJV 4J7ZA 1SQGA 2PTMA 1AR1B 3OT7A 4LF9O 4JF3A 2A7WA 4OPHA 1JA8A 4DV3B 5IJ0A 3K57A 1QQCA 2EZOA 3CCQV 5EYPB 3J80N 4JAUA 1PNMA 3CP1A 3T1YO 3ABKC 4N23A 5AG2A 4B08A 1R6TA 4OPAA 4I7ZB 5CBHA 3FX7A 4X1YA 1D2DA 3K59A 1GMGA 4I50B 1HW7A 2PYJA 4DR1B 4JI1O 1YZBA 3EHBB 3L70H 4JZGA 4LP8A 2ATKC 4NYKA 4PHZA 5H2FZ 2HJFC 1NS1A 5GTHZ 4GCZA 3A0BZ 5C93A 2ZIOA 4JI0B 1DTOA 4DV1O 4JTAB 2IBZH 2UXDB 2WLJA 5B5EZ 1EZJA 1VF6C 4Z2WA 2AZ2A 3GVMA 3CC2V 1AILA 3UKMA 1Y74B 1AI6A 3RT3C 3OUSA 2VQFB 4LF5B 5L3FA 3ZN1A 2YI8A 5B1AC 3OGCC 2Y4UA 4EKWA 3G6EV 5IDJA 1RP3B 1M57C 4QPJA 2Q5ZA 3K3WA 4MTOA 1ENVA 3CC7V 4CC6A 5ITZB 5JJEB 4JYAB 5EC1C 2ZD9A 4A5UB 4AILC 3F5WC 2MK3A 5JJNB 1S5LZ 4JASA 4X8AA 4EFBA 4TQFA 5KA6A 1PL0A 5LMNB 3OR7C 4DR1O 2DYRC 2HG5C 1PD3A 2EINC 2XAQA 1ZUQA 1ZAUA 2Q7HA 2R9AA 4O4IB 4JI0O 3W7WA 3VBBA 2UXDO 5LHIA 1MZFA 4B7KA 2EIKB 4ABMA 1YTFD 1VP7A 1YITV 3I55V 1BMFG 1K4CC 4UCUA 1THZA 3SYPA 3BPZA 3T1HB 2FYUH 4EEQA 4CS2A 2VQFO 3E35A 4LF5O 2QKCA 2X6CA 1SA0B 1M57B 4FM1A 2X7RB 1JCHA 2E74B 1N36B 5EBMC 1MSDA 3H1KH 2Q7EA 3WB1A 3LNNA 3JCUZ 4MT8A 4I5SA 1KU9A 4LNUB 1GN3A 2XAFA 3O9OA 1SQPH 3HKBA 1ZTEA 1YTFB 2LJ2A 3N2GB 3BY6A 3ZHVA 1X4TA 4PDVA 3OMIB 3JAMN 1LUWA 2YIDA 1QNMA 1XL4A 4RUEA 1EN5A 5CBFA 1AROP 1FS0G 3QNEA 1AP6A 1S3JA 4MVQA 1QU7A 5LMNO 1XBLA 4CH3A 4X20B 2ZR3A 1R3JC 4ASUG 2DOSA 4DRXB 5LMUO 3K5MA 4JI7B 2QJ1A 2ADPA 1SF9A 4FLUA 3SYCA 1BGYH 4JI2B 2Y69B 3IJ4A 5KHIA 2NR5A 2VWJA 4RAIA 1VQ4V 2WLKA 4J7JA 4YJ2B 2YXYA 1WNSA 2P4KA 2C2AA 4X1KA 1JOYA 4DR7B 4FJCC 1VMGA 5KLVH 5CB4A 3AG3C 3T1HO 4YY3B 1GH6A 2GHYA 1XDCA 1N36O 2WSSG 3D36C 2DYSB 1RPRA 1GN6A 2BCCH 4NXNB 3M8AA 3ZN0A 4LF7B 4FZ0A 1S76D 4KL1A 1KYOF 2QSAA 4LWSA 4JYBA 3BHPA 3SPIA 2GSMB 4JYYA 4LF4O 2ZDIA 1JR9A 4J9YB 4LFAB 5KMGB 4K8ZA 1QLNA 3ABMB 3GB7C 5F2VO 2QWNB 3DXRB 1BS3A 3JD0A 1XQ8A 2GTSA 3U10A 1N0JA 2JGDB 1GRJA 5LGUA 1NH2D 5IJ9A 2LW1A 3DC5A 1SQXH 2OIGA 4JI7O 1VARA 2WLHA 2ZE8A 3RYCB 3JATA 3CCMV 2PUSA 1Q5OA 4LR3A 1SQVH 5EBLC 4J7KA 4G27B 4JI5B 5FPOA 3E2EA 1EM1A 2IJIA 3AG3B 4GX5A 3K0GA 4HAMA 1FFXA 4DR7O 2X0LA 1H2GA 1VQOV 2OCHA 1US6A 2ZR2A 4J42A 4YY3O 5LP6A 1FPOA 1LUVA 3UQ8A 2AZ0A 4DR3B 4ZBMA 1ZLZA 1YCIA 4WCEV 1NH2B 3SGIA 3X2QB 3MAQA 3RYFB 4JV5B 5CA0A 1N33B 3ETDA 1F4NA 1GAXA 2ZNIA 3HKEA 2CGNA 1BHAA 4NXNO 1VQ7V 1HDJA 2YEVA 4LF7O 3UM7A 3CS5A 2Z0AA 3SJQC 2DWDC 2KG7B 5GONB 4JAVA 3N2KB 2YC0A 1I5YA 1NT2B 5H9CA 1JNBA 4ZI7A 3JYCA 2UXXA 1AJQA 1FD9A 1H2LA 4LFAO 1VIBA 3JD1A 1Y6XA 4UCTA 4TV9A 2A0LA 1YHQV 2XAGA 4AHCA 3CD6V 4G2KA 1HR0B 5LGTA 4B3MB 5KAFZ 4UV9A 2F43G 4IIJA 2L6LA 3B09A 5JH7B 4FFBA 4E2LA 5LA6B 4TV8B 2GDSA 2V7QG 2OYQA 1CPYA 4IGGA 1VQ8V 2WAMA 3T4DA 2W6IG 4JI5O 5KHJA 3ZHRA 3F5TA 1OCZB 3L73H 3VOUA 1KC8W 3CJHA 4TOIA 4XDLA 1BQ0A 4DR3O 1GKFA 3JD2A 5BR8B 3CX5F 2UXBB 4HYOA 3ZHSA 4JV5O 1NI8A 3E8GA 3JAKA 3OE7G 2ZXWB 3IAYA 4TQDA 2F66C 2Y0PA 3F7VC 1B06A 3G4SV 1XMQB 2GBOA 1TUEB 4TT3G 2HVJC 4FLXA 3CMAV 4DYLA 4X89A 3TXQA 1K4DC 2PY5A 2LFRA 3FAVB 2B1IA 4WBNA 3SJAC 3CCEV 3E8HA 3RGBA 5KX5A 4O4LA 3AG4C 2RMKB 3E22A 2G38A 4WFGA 4JI8B 2DE0X 4C7UA 4HBNA 2CH7B 1HR0O 4DV7B 4B3MO 2Z5UA 4LFBB 4F6RB 5JCOA 3NR7A 5B1BC 3J7AU 1TA8A 2JGUA 5L3CA 2DWEC 3OM3B 4DR4O 2EILC 4GX0A 1DF5A 2HP8A 2W6JG 1IDSA 4OX9O 1YSCA 4TUYB 4R50A 1XHZA 3B2EE 3JARB 4DUYB 3AG1C 3JALA 1AVMA 2QKAA 4YJ3A 5LYJA 3U0ZA 5BR8O 4I0XA 5IE9A 1MZEA 2EIMB 5EZYB 4MVRA 4ZKIA 4XDKA 4H13B 3B8MA 5IYBO 1B04A 2ZM6B 1XMQO 4FLVA 4BIUA 3B77A 2B9ZA 1N34B 3RYIA 4X1IA 3W7SA 2R9RB 1JFFA 4O4HA 4K8XA 1Y66A 5CMUA 3A2FA 3WFVA 2WLLB 2BTQB 3ASNC 4JI8O 1EFRG 3D3IA 3T1YB 4X65O 4DV7O 3JASB 4F6EA 3RW0A 2IH3C 1CP9A 2OIEA 4PA4A 2XOKG 4EB6B 3MD0A 1TUBB 4PA6A 1KP2A 5D5QA 3VQYA 1EN6A 5LBQA 4I4TB 1ZWIC 1TGOA 1F23A 2DMXA 2Z3YA 5FL7G 4PV1B 4PJ0Z 5J9PC 1V54C 2P4VA 1KECA 4DUYO 1NTKH 4O2AB 4O2BB 1CEZA 5KHKA 3DSQA 4OXSA 1FYJA 2F23A 2UUCB 2E5LB 1VQ6V 3TCUA 5CA1B 1V55C 1G6UA 3OAAG 4U7NA 4PDLA 2MW2B 2AXTZ 4D7TA 2QR4A 2ZM6O 1L0NH 1FAFA 5FNVB 1FXKB 3BFRA 2RCVA 2KKWA 4YIPA 1WB8A 2CTRA 5CA3A 3KDRA 1YIJV 3QTCA 4DXWA 5DEDA 3ZJZA 3EFFK 4I55A 1P4RA 1Q8IA 1WPBA 1HNWB 2WLIB 2ITDC 4JAAA 5JJJB 3U11A 3E83A 4D6TH 1P84F 3K58A 1JPXA 1UPGA 3ZHTA 4HZ3A 1KKCA 5GW7A 5IYZB 2NLJC 4AQYB 1M1KW 3APOA 4H0LB 4QPKA 1QHTA 4UUJC 2BTOA 1YJ9V 1EZVH 3M99B 3LNMB 1V54B 2FL4A 4MW8A 3JCZA 3W7TA 1MA1A 1ROPA 4GX2A 1NQTA 4HNAB 4FLTA 1O9HA 1WJZA 2YUAA 1QLEC 4AI8A 1JX9A 1NR7A 4DV6B 2HVKC 4NR1A 2RNBA 1YXBA 3G80A 1NKDA 1V55B 3SYQA 1SESA 2UUCO 2E5LO 5LHHA 1IBKB 1TVKA 3KCYA 1B3QA 2H3OA 5C8YB 4B3SB 1Y76B 2QM4A 5JVDA 4QGPA 5J2UA 2Q0OC 1B6QA 5L3EA 2Y48A 2NN4A 1ZL8B 1SS3A 2EX3A 2PI5A 1Q90D 3CB2A 1PP9H 1WAZA 4WFBV 2DQ3A 2Q6AA 2YIBA 5EYPA 2M7WA 3RVZA 4MVSA 3ABKB 4QNHB 2HHHB 1HNWO 1A32A 3OR6C 1J95A 2WWWA 2WA4A 1FOUA 1J5EB 1M56C 3Q4HB 4AQYO 4I50A 3QO5A 3SYAA 3ETGA 2OWOA 4EFEA 1K34A 1SRYA 1KKDA 2R72A 1K7DA 1WP8A 3AK3A 2GV9A 2N05A 1QLEB 1Z5VA 2VQEO 1IURA 2QTOA 5LMUB 4ZIBA 1QR9A 4DV6O 2QM7A 2WA3A 1WA8B 3A8TA 2EBOA 3A0HZ 2ZDIC 1GM9A 1OCRC 2EIJC 1IBKO 2HEPA 3H1HH 3RYHB 4E4EA 3K5NA 1Y74A 4WFHA 1Q7YW 4B3SO 1WN7A 5B1AB 5E79Z 3FB8C 2XT9A 2VRZA 3ASOC 1U97A 4H33A 4JTDB 1DGSA 1SQFA 4FVMA 1JMKC 1NZ6A 5ITZA 3IGAC 4FM0A 3STZC 2HHHO 5DN6G 5JQGB 3IC7A 2JEXA 2LP7A 2P22C 4LF4B 2ZE7A 1YI2V 2EULA 3FB6C 1J5EO 2IJJA 4NTWA 4MVMA 1ZSPA 2DYRB 2P06A 3OMAB 2EINB 3W7XA 2W0FC 2Q73A 4PI2A 3S3XA 4O4IA 3MHHC 1KP3A 4R8CA 1H5WA 1VF6A 3H1JH 1OCRB 4LF8B 3K06A 4QE9A 4YHHB 2LGWA 2F4VB 4ZOLB 2GUZB 4DV0B 4KXRA 3TJTA 1QCEA 2OTLV 4WFEA 4Q6GA 4J9ZB 1SA0A 2OCCC 3GWOA 1BCCH 1HP8A 1Z5WA 4QIWF 5B3SC 2KSDA 4LH6A 1UJWB 4JI4B 3UO2A 4BIOA 4LNUA 1Q43A 3OTFA 3ABLC 1T5EA 4H37A 3N2GA 3ZEDA 4F4LA 4PELA 3H9VA 1M90W 4MTGA 5LL6Y 1P7GA 1LR1A 3BA9A 1E1QG 1GN2A 2UUBB 1I94B 3KCXA 3OGIB 4IYHA 3D8CA 4UCOA 4ZHQB 4X20A 5GTIZ 1R6NA 4DRXA 4IHJB 4JI6B 5CBGA 3LUTB 2WLMA 3BRCA 4IYIA 2A3QA 4NKGB 5H6RA 1PM9A 1H2NA 4LF8O 3HKCB 4PD4F 4YHHO 4YJ2A 4JZ2A 3CSXA 2F4VO 1KBHA 4DV0O 2R9IA 3QVNA 2OCCB 1KQSU 4B3TB 2XASA 4FLYA 1Q6HA 1NJIW 3CEIA 4MVUA 3ZRWB 5B3SB 1R73A 3G6BA 1WLEA 1H2SB 1S72V 3ZS8C 2KB1A 5JCOC 4UCSA 5K1XA 1N0NA 5FLXN 4JI4O 1R1BA 3K79A 3T2MA 5LOVB 2Q4PA 1QR8A 3H1LH 3JSLA 4WFAV 1AI4A 3AG2C 1OCOC 3OEHG 3WB2A 3K03A 1AB3A 2YICA 2IJHA 1K73W 1AJNA 1XILA 5KMGA 3BCCH 1Q3EA 4UCVA 1MSWD 3H01A 2UUBO 1I94O 4MVZA 3DXRA 1MG1A 1GO3F 2JGDA 3IC9A 1XREA 1I7FA 3UCSC 3E8BA 4JI6O 1S0VA 1I08A 3RYCA 4CC5A 3LSQA 1G8MA 4DR4B 4UCRA 1PV0A 2CUGA 5BMVB 4DV5O 4OX9B 2WPDG 3EVKA 2RJZA 4LBEC 2QWRB 3CXHF 1I5XA 2QE7G 5EIBC 4B3TO 3CC4V 3LSUA 4UV8A 2ZQMA 3STLC 2LGQA 1NBMG 3RYFA 2HFEC 1YF2A 2CAZC 1H2MA 2QDOA 3JSNA 3AG2B 4DR6B 1D5NA 2KG7A 5GONA 2P90A 3N2KA 2PGGA 3L72H 2JVDA 3ZRXA 4FMTA 2DQ0A 3DGEA 3CXCU 4U3JB 4MW3A 5EK0A 3CRMA 4K0KB 3G71V 3ETQA 2KQXA 5B1NA 3OD4A 5EIBD 2LW7A 1H8HG 1D5AA 4N21A 2QEXV 1E79G 3N27A 3CRRA 3ZMTA 3MHSC 2JJ2G 2IU3A 4BWAA 4CH6A 3R66A 1I0HA 2RN9A 3SJBC 1NTMH 4X65B 5JH7A 4GKKO 4W4LA 5LA6A 4TV8A 2P67A 1RSOB 1N8RW 4K35A 1DLBA 3IFXA 4KUMA 4PI0A 1K92A 4L8JA 1K5QA 2H8PC 4H44B 4XDJA 1YJNV 5J2TB 4J41A 4BR6A 5EC2C 3UT5B 4GKJB 1R3KC 3I5DA 4RUFA 3KZIZ 3NXSA 4BW9A 3OFNG 2AHZA 4FFKA 3TGUH 3VQVA 2Y0IA 2UU9B 3SPGA 1VEWA 4IT5A 1NR1A 1SQBH 4O4JB 4DR6O 1H8EG 3LDEA 4LCUC 1BE3H 2ZT9B 1Q6UA 2BSKB 1SQQH 1KUQA 4GYCB 1YVWA 4K0KO 4FK5C 3FAVA 4L87A 1RM1C 2L35A 4OGQB 4X66B 3R65A 1OCCC 2DN9A 3AG4B 4Z1MG 2BOBC 3WB0A 2CH7A 1H38A 5KA5A 3JAWB 4X62O 4F6RA 5B1BB 1NVPD 3T1CA 2XNDG 3DTUB 2XAHA 3HKDB 1ZX3A 2EILB 1IXMA 5E1AC 1COWG 1XHXA 3SR2C 3E89A 1N4CA 1AI7A 4TUYA 3K5OA 5IWAO 5IJ0B 3AG1B 3LDCA 3JARA 3H1IH 2DJVA 1L1FA 1SETA 4GKJO 3PJSK 5LXTB 1NVPB 5EZYA 3RFRA 1BT8A 4X1YB 3BEHA 2UXCB 4DW1A 2UU9O 4GT1A 4P2ZA 4DUZB 2FMLA 2ZE6A 3FB7C 3OMNB 1E1RG 2QKSA 4RO2A 1JJOA 2RQ6A 2HJDA 5L3GA 3TETA 3P3NA 1JJ2U 5DECA 2YIBD 2K9PA 2A06H 3B40A 4X66O 3ASNB 2WLLA 2Q9LA 3FKSG 3RWRD 2K1EA 2BTQA 2Q68A 3B4SA 4B7EA 3LDDA 4BIZA 3KKYA 3JASA 4GX1A 4EB6A 2IH1C 5L3DA 4WF9V 1TUBA 3ABTA 4TWKA 1F51A 4D7SA 3CRCA 4I4TA 1LNQA 4DW0A 5A2QN 1WP7A 3T4ZA 4P9OA 4X64O 1K3EA 1K8AW 1BQZA 1FFTB 4O2AA 4O2BA 2VQEB 1V9PA 5LXTA 3CRQA 4LC1A 1IVSA 4DV4B 2H94A 1L8DA 2AW9A 4NVPA 1ORQC 2UXCO 4UFZA 5CA1A 3KG2A 3QO7A 4DUZO 1VQPV 4J80A 1S5JA 5FNVA 1FXKA 3FD9A 3EXAA 1HNZB 4U3FH 1U96A 2EJ7A 3L74H 4LH7A 1S77D 3ZMUA 3SPHA 1O9GA 3HB3B 1BHBA 3E8FA 3BABA 4RQEA 2ZCEA 5D5PA 4DV2B 3OUFA 2FB5A 3RN4A 3HR0A 2WLIA 4QE7A 2LFSA 1EBOA 3AEIA 4PA9A 1P7BA 1GTOA 2EIKC 1VF7A 2YS8A 1W0JG 3APQA 4B3RB 2XAJA 3HPLC 5B66Z 4UVCA 2JIZG 5HFLA 5IYZA 2Q69A 3THOA 1NTZH 3CE2A 2ETNA 3GWKC 4DK0A 2JJ1G 4WFFA 4DV3O 2IU0A 4DR5B 2ADQB 2R70A 3SPJA 1M93A 4HNAA 2VS0A 1RPOA 2V4DA 4YIOA 3HKBB 4FLZA 3ZCCA 2YSUB 3BA8A 4XBFA 3CCSV 1FJGB 3QF7A 3ICXA 4DV4O 4LF6B 4IL6Z 5H6QA 4UB8Z 5B1OA 5C8YA 1K97A 2JRIA 3CCVV 1Y76A 4MVOA 2IW5A 2V1DA 1HNZO 1G1XB 1HWYA 2PF4E 2Q7GA 2M6YA 1K9MW 1ZL8A 2ITCC 1H2KA 3TK1A 2WLNA 2ZKOA 3BAAA 2CDYA 3LSSA 4LFCB 2IJKA 2Y69C 2HKOA 4DV2O 1K33A 1FXHA 4GLXA 5CN0A 4W4KA 3W7UA 4X1KB 4B3RO 5CB4B 1M56B 5JWPA 4MS2A 1W2BU 2D2CB 3Q4HA 1VQLV 4DO2A 5LP6C 1X59A 2W0XA 2IM9A 3K9AA 4UB6Z 1IBLB 2B5UA 3AK1A 2DYSC 3SYOA 1AP5A 3CCJV 1BZKA 3G67A 4DR5O 1VF5B 4JYAO 5IYCO 3ZMZA 4LWSB 3OTOB 2GTAA 1EN4A 2ZNJA 4UXNA 1FJGO 3D3QA 1WA8A 4MTXA 2NNUA 1W0KG 2QGNA 2X6AA 2EIJB 4LF6O 1IJGA 4U7OA 3FYEB 2JK5C 3RYHA 3K08A 2HR3A 4X88A 3ABMC 4RWUA 2Q8VA 1Q86W 1JVMA 4JTCB 4CS4A 3ASOB 5TISZ 3L71H 1F7YA 1CXZB 5IJ9B 3ZIAG 1VQ9V 4P9PA 4LFCO 3JATB 4NB5A 3P32A 5H5NA 1VQ5V 1PKXA 4KP4A 5JQGA 3RBZA 2UXNA 1AR4A 1FFXB 1QBZA 3CWBH 3ZMSA 2FKXA 5LP6B 1F4MA 3AK2A 4QJFB 1R6KA 2O57A 1OZ0A 2P5OA 3X2QC 5CA0B 2QWQB 1IBLO 3HKEB 4CZZA 3J81N 4DK1A 1KB9F 4YXWG 5IY5C 2E3CA 2YEVB 3F7YC 5IYDO 2D3OW 4FZ1A 3S3WA 3OTOO 3L9DA 4MTFA 1M9NA 4PDRA 4JPRA 1YJWV 3TXSA 4PA7A 1M4UA 1DF4A 3FYIB 3O65A 4ZI7B 2N74A 4ZOLA 2GUZA 1IBMB 2VWKA 2F95B 4DV5B 3ZX6A 4G28B 4KHPB 4TV9B 2E76B 3K5LA 4NTXA 3P30A 2HLDG 3SJCC 3WU2Z 2UUAB 5FPRA 3CYOA 1FKAO 2A9HA 4IIJB 4JI2O 4FFBB 2YXLA 1URFA 4X9QA 5HFMA 1XMOB 4JI3B 2A79B 4UVAA 3ABLB 1K5SA 2RDCA 1PNKA 1NU1H 5BY1A 1Q81W 1VQKV 4PA3A 1G4YB 3CCRV 2XUMA 2QWPB 1OCZC 1M5IA 3QG5A 1R3LC 2XHBA 3CJHB 1VQMV 1OV9A 3CMEV 3UO3A 1SZXA 3CCLV 2CTPA 1HNXB 5KUKA 4J10A 2PZSA 3ABUA 5IY5B 4ZHQA 4FM2A 3JAKB 2ZXWC 5KUMA 5L3BA 1GN4A 3JD4A 4IHJA 4FIPC 3CHXA 3ZRSA 5LHGA 4NXMB 1XEQA 2Q0AA 4GKKB 2CGOA 2JS5A 1W59A 5KAIZ 4UVBA 3RVYA 4GZRB 3HKCA 1XNRB 5K1PA 2YXHA 4WBNB 2P6JA 1IBMO 1Q82W 2LO1A 4KHPO 1Y67A 5KX5B 4O4LB 5IT9N 3E22B 3I56V 1WB7A 3ZRWA 2N04A 2UUAO 1XL6A 3D36A 1S5HC 1KD1W 2CK3G 4J11A 2EZPA 5LOVA 1AJPA 1XMOO 4JI3O 4CH4A 4I9QA 4RQFA 4GUNA 3ZRVA 2QTSA 1XI1A 1OCOB 2JS3A 2EJRA 4P30A 3CCUV 5DM6V 4Q20A 3K0DA 3JALB 3OEEG 3SDLA 1HNXO 4YJ3B 2QA4V 1QVGU 2F1MA 5LYJB 4I0XB 1N33O 1MABG 3CPWU 1IX9A 1RFYA 2EIMC 1PPJH 3ZBHA 2BE3A 4CH5A 1IZ3A 2F93B 4PDMA 3WG7C 2CTWA 2ZINA 4NXMO 4X62B 3FB5C 3K04A 1Z2GA 4CBCA 5BZBA 3BVOA 4JYCA 2QM8A 4BAYA 2XTAA 1OJHA 1XNRO 3RYIB 3VQXA 4X1IB 2BOCC 1OHHG 5BMVA 1JFFB 1BSMA 3PN1A 2FTKA 4O4HB 1UFIA 5IWAB 2CTQA 2Q67A 2YI9A 3FFQA 1N32B 2AHYA 5LGNA 3MDSA 1GK9A 2QWOB 1P49A 1AR5A 1XOUA 1WPXA 2X6BA 3C3SA 2ODMA 1JQ0A 4FPPA 1GM8A 1MMMA 4U3JA 3ETEA 2YIAA 2PYLA 4K3AA 4DR2B 1L0LH 3QO8A 2B1GA 2UXBO 5KHHA 1SZTA 3ML0A 1FXVA 2E75B 2JEUA 1TAEA 4R6ZA 1IXBA 1PL4A 3C3TA 3SPCA 2ZE5A 3WG7B 1VQNV 1BL8A 1XNQB 4R7CA
chains in the Genus database with same CATH topology
1N0NA 5AG2A 4GUNA 3DC6A 1GN6A 1I0HA 3BFRA 2RCVA 3AK1A 1AVMA 2QKAA 4YIPA 3TJTA 1AP5A 1BT8A 1WB8A 1XUQA 3RN4A 3KDRA 3AK3A 5A9GA 4JYYA 1XILA 2GDSA 4JZGA 1EN4A 1JR9A 2QKCA 1IX9A 4X9QA 1MSDA 3IC9A 1KKCA 1BS3A 1XREA 4BR6A 1N0JA 1GN3A 4E4EA 1I08A 1SZXA 2ADQB 3DC5A 1MNGA 4FFKA 1VARA 1ZTEA 1BSMA 1VEWA 1MA1A 4YIOA 1LUWA 1P7GA 3KKYA 1QNMA 1EN5A 1GN2A 3EVKA 1B06A 4F6EA 1EM1A 1GN4A 1AP6A 3LSUA 1AR4A 3MDSA 1LUVA 1EN6A 3K9SA 2CE4A 1ZLZA 1PM9A 2ADPA 1AR5A 3AK2A 3C3SA 4JZ2A 1D5NA 1MMMA 2CDYA 4C7UA 1Y67A 1ZSPA 3QVNA 2P4KA 2AW9A 1WB7A 3OT7A 3CEIA 1JA8A 1IXBA 1PL4A 3C3TA 1ZUQA 1IDSA 1XDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0N A;  5AG2 A;  4GUN A;  3DC6 A;  1GN6 A;  1I0H A;  3BFR A;  2RCV A;  3AK1 A;  1AVM A;  2QKA A;  4YIP A;  3TJT A;  1AP5 A;  1BT8 A;  1WB8 A;  1XUQ A;  3RN4 A;  3AK3 A;  5A9G A;  4JYY A;  1XIL A;  2GDS A;  4JZG A;  1EN4 A;  1JR9 A;  2QKC A;  1IX9 A;  4X9Q A;  1MSD A;  3IC9 A;  1KKC A;  1BS3 A;  1XRE A;  4BR6 A;  1N0J A;  1GN3 A;  4E4E A;  1I08 A;  1SZX A;  2ADQ B;  3DC5 A;  1MNG A;  4FFK A;  1VAR A;  1ZTE A;  1BSM A;  1VEW A;  1MA1 A;  4YIO A;  1LUW A;  1P7G A;  3KKY A;  1QNM A;  1EN5 A;  1GN2 A;  3EVK A;  1B06 A;  4F6E A;  1EM1 A;  1GN4 A;  1AP6 A;  3LSU A;  1AR4 A;  3MDS A;  1LUV A;  1EN6 A;  3K9S A;  2CE4 A;  1ZLZ A;  1PM9 A;  2ADP A;  1AR5 A;  3AK2 A;  3C3S A;  4JZ2 A;  1D5N A;  1MMM A;  2CDY A;  4C7U A;  1Y67 A;  1ZSP A;  3QVN A;  2P4K A;  2AW9 A;  1WB7 A;  3OT7 A;  3CEI A;  1JA8 A;  1IXB A;  1PL4 A;  3C3T A;  1ZUQ A;  1IDS A;  1XDC A; 
#chains in the Genus database with same CATH topology
 1YDX A;  3ZHQ A;  3DC6 A;  1SER A;  1RSO A;  2JDI G;  1FXK C;  1SC5 B;  1XUQ A;  1DK1 A;  3AG7 A;  1R3I C;  5KHG A;  1MOF A;  4LF9 B;  3M7M X;  5A9G A;  4TSF G;  2P7T C;  1AI5 A;  4FLW A;  4BW5 A;  4I55 B;  4X64 B;  5J2T A;  1N32 O;  3UT5 A;  3VQW A;  4LFB O;  1Y4M A;  3E86 A;  1SKV A;  1GM7 A;  3B8N A;  5BXZ A;  4KFM A;  4JGS A;  1MNG A;  4O4J A;  5EBW C;  4JI1 B;  1PNL A;  4NTY A;  2DW4 A;  2YDE A;  2OT5 A;  3P3P A;  2Y4T A;  3A0R A;  2BSK A;  2LQT A;  4I9W A;  1RM1 B;  4DR2 O;  1YEW A;  3OW2 U;  1OCC B;  4DV1 B;  2AGA A;  4CS3 A;  1QVF U;  4Z1V A;  1KMI Z;  4MSW C;  2ILM A;  3K9S A;  2CE4 A;  1TVK B;  3JD3 A;  1XNQ O;  3JAW A;  1Q6I A;  3CRA A;  1N34 O;  5JVD B;  3L75 H;  3HKD A;  3ZMV A;  2PI4 A;  5J2U B;  4ICG A;  3ZHU A;  2ARH A;  3C90 A;  2ZIM A;  2OTJ V;  4J7Z A;  1SQG A;  2PTM A;  1AR1 B;  3OT7 A;  4LF9 O;  4JF3 A;  2A7W A;  4OPH A;  1JA8 A;  4DV3 B;  5IJ0 A;  3K57 A;  1QQC A;  2EZO A;  3CCQ V;  5EYP B;  3J80 N;  4JAU A;  1PNM A;  3CP1 A;  3T1Y O;  3ABK C;  4N23 A;  5AG2 A;  4B08 A;  1R6T A;  4OPA A;  4I7Z B;  5CBH A;  3FX7 A;  4X1Y A;  1D2D A;  3K59 A;  1GMG A;  4I50 B;  1HW7 A;  2PYJ A;  4DR1 B;  4JI1 O;  1YZB A;  3EHB B;  3L70 H;  4JZG A;  4LP8 A;  2ATK C;  4NYK A;  4PHZ A;  5H2F Z;  2HJF C;  1NS1 A;  5GTH Z;  4GCZ A;  3A0B Z;  5C93 A;  2ZIO A;  4JI0 B;  1DTO A;  4DV1 O;  4JTA B;  2IBZ H;  2UXD B;  2WLJ A;  5B5E Z;  1EZJ A;  1VF6 C;  4Z2W A;  2AZ2 A;  3GVM A;  3CC2 V;  1AIL A;  3UKM A;  1Y74 B;  1AI6 A;  3RT3 C;  3OUS A;  2VQF B;  4LF5 B;  5L3F A;  3ZN1 A;  2YI8 A;  5B1A C;  3OGC C;  2Y4U A;  4EKW A;  3G6E V;  5IDJ A;  1RP3 B;  1M57 C;  4QPJ A;  2Q5Z A;  3K3W A;  4MTO A;  1ENV A;  3CC7 V;  4CC6 A;  5ITZ B;  5JJE B;  4JYA B;  5EC1 C;  2ZD9 A;  4A5U B;  4AIL C;  3F5W C;  2MK3 A;  5JJN B;  1S5L Z;  4JAS A;  4X8A A;  4EFB A;  4TQF A;  5KA6 A;  1PL0 A;  5LMN B;  3OR7 C;  4DR1 O;  2DYR C;  2HG5 C;  1PD3 A;  2EIN C;  2XAQ A;  1ZUQ A;  1ZAU A;  2Q7H A;  2R9A A;  4O4I B;  4JI0 O;  3W7W A;  3VBB A;  2UXD O;  5LHI A;  1MZF A;  4B7K A;  2EIK B;  4ABM A;  1YTF D;  1VP7 A;  1YIT V;  3I55 V;  1BMF G;  1K4C C;  4UCU A;  1THZ A;  3SYP A;  3BPZ A;  3T1H B;  2FYU H;  4EEQ A;  4CS2 A;  2VQF O;  3E35 A;  4LF5 O;  2QKC A;  2X6C A;  1SA0 B;  1M57 B;  4FM1 A;  2X7R B;  1JCH A;  2E74 B;  1N36 B;  5EBM C;  1MSD A;  3H1K H;  2Q7E A;  3WB1 A;  3LNN A;  3JCU Z;  4MT8 A;  4I5S A;  1KU9 A;  4LNU B;  1GN3 A;  2XAF A;  3O9O A;  1SQP H;  3HKB A;  1ZTE A;  1YTF B;  2LJ2 A;  3N2G B;  3BY6 A;  3ZHV A;  1X4T A;  4PDV A;  3OMI B;  3JAM N;  1LUW A;  2YID A;  1QNM A;  1XL4 A;  4RUE A;  1EN5 A;  5CBF A;  1ARO P;  1FS0 G;  3QNE A;  1AP6 A;  1S3J A;  4MVQ A;  1QU7 A;  5LMN O;  1XBL A;  4CH3 A;  4X20 B;  2ZR3 A;  1R3J C;  4ASU G;  2DOS A;  4DRX B;  5LMU O;  3K5M A;  4JI7 B;  2QJ1 A;  2ADP A;  1SF9 A;  4FLU A;  3SYC A;  1BGY H;  4JI2 B;  2Y69 B;  3IJ4 A;  5KHI A;  2NR5 A;  2VWJ A;  4RAI A;  1VQ4 V;  2WLK A;  4J7J A;  4YJ2 B;  2YXY A;  1WNS A;  2P4K A;  2C2A A;  4X1K A;  1JOY A;  4DR7 B;  4FJC C;  1VMG A;  5KLV H;  5CB4 A;  3AG3 C;  3T1H O;  4YY3 B;  1GH6 A;  2GHY A;  1XDC A;  1N36 O;  2WSS G;  3D36 C;  2DYS B;  1RPR A;  1GN6 A;  2BCC H;  4NXN B;  3M8A A;  3ZN0 A;  4LF7 B;  4FZ0 A;  1S76 D;  4KL1 A;  1KYO F;  2QSA A;  4LWS A;  4JYB A;  3BHP A;  3SPI A;  2GSM B;  4JYY A;  4LF4 O;  2ZDI A;  1JR9 A;  4J9Y B;  4LFA B;  5KMG B;  4K8Z A;  1QLN A;  3ABM B;  3GB7 C;  5F2V O;  2QWN B;  3DXR B;  1BS3 A;  3JD0 A;  1XQ8 A;  2GTS A;  3U10 A;  1N0J A;  2JGD B;  1GRJ A;  5LGU A;  1NH2 D;  5IJ9 A;  2LW1 A;  3DC5 A;  1SQX H;  2OIG A;  4JI7 O;  1VAR A;  2WLH A;  2ZE8 A;  3RYC B;  3JAT A;  3CCM V;  2PUS A;  1Q5O A;  4LR3 A;  1SQV H;  5EBL C;  4J7K A;  4G27 B;  4JI5 B;  5FPO A;  3E2E A;  1EM1 A;  2IJI A;  3AG3 B;  4GX5 A;  3K0G A;  4HAM A;  1FFX A;  4DR7 O;  2X0L A;  1H2G A;  1VQO V;  2OCH A;  1US6 A;  2ZR2 A;  4J42 A;  4YY3 O;  5LP6 A;  1FPO A;  1LUV A;  3UQ8 A;  2AZ0 A;  4DR3 B;  4ZBM A;  1ZLZ A;  1YCI A;  4WCE V;  1NH2 B;  3SGI A;  3X2Q B;  3MAQ A;  3RYF B;  4JV5 B;  5CA0 A;  1N33 B;  3ETD A;  1F4N A;  1GAX A;  2ZNI A;  3HKE A;  2CGN A;  1BHA A;  4NXN O;  1VQ7 V;  1HDJ A;  2YEV A;  4LF7 O;  3UM7 A;  3CS5 A;  2Z0A A;  3SJQ C;  2DWD C;  2KG7 B;  5GON B;  4JAV A;  3N2K B;  2YC0 A;  1I5Y A;  1NT2 B;  5H9C A;  1JNB A;  4ZI7 A;  3JYC A;  2UXX A;  1AJQ A;  1FD9 A;  1H2L A;  4LFA O;  1VIB A;  3JD1 A;  1Y6X A;  4UCT A;  4TV9 A;  2A0L A;  1YHQ V;  2XAG A;  4AHC A;  3CD6 V;  4G2K A;  1HR0 B;  5LGT A;  4B3M B;  5KAF Z;  4UV9 A;  2F43 G;  4IIJ A;  2L6L A;  3B09 A;  5JH7 B;  4FFB A;  4E2L A;  5LA6 B;  4TV8 B;  2GDS A;  2V7Q G;  2OYQ A;  1CPY A;  4IGG A;  1VQ8 V;  2WAM A;  3T4D A;  2W6I G;  4JI5 O;  5KHJ A;  3ZHR A;  3F5T A;  1OCZ B;  3L73 H;  3VOU A;  1KC8 W;  3CJH A;  4TOI A;  4XDL A;  1BQ0 A;  4DR3 O;  1GKF A;  3JD2 A;  5BR8 B;  3CX5 F;  2UXB B;  4HYO A;  3ZHS A;  4JV5 O;  1NI8 A;  3E8G A;  3JAK A;  3OE7 G;  2ZXW B;  3IAY A;  4TQD A;  2F66 C;  2Y0P A;  3F7V C;  1B06 A;  3G4S V;  1XMQ B;  2GBO A;  1TUE B;  4TT3 G;  2HVJ C;  4FLX A;  3CMA V;  4DYL A;  4X89 A;  3TXQ A;  1K4D C;  2PY5 A;  2LFR A;  3FAV B;  2B1I A;  4WBN A;  3SJA C;  3CCE V;  3E8H A;  3RGB A;  5KX5 A;  4O4L A;  3AG4 C;  2RMK B;  3E22 A;  2G38 A;  4WFG A;  4JI8 B;  2DE0 X;  4C7U A;  4HBN A;  2CH7 B;  1HR0 O;  4DV7 B;  4B3M O;  2Z5U A;  4LFB B;  4F6R B;  5JCO A;  3NR7 A;  5B1B C;  3J7A U;  1TA8 A;  2JGU A;  5L3C A;  2DWE C;  3OM3 B;  4DR4 O;  2EIL C;  4GX0 A;  1DF5 A;  2HP8 A;  2W6J G;  1IDS A;  4OX9 O;  1YSC A;  4TUY B;  4R50 A;  1XHZ A;  3B2E E;  3JAR B;  4DUY B;  3AG1 C;  3JAL A;  1AVM A;  2QKA A;  4YJ3 A;  5LYJ A;  3U0Z A;  5BR8 O;  4I0X A;  5IE9 A;  1MZE A;  2EIM B;  5EZY B;  4MVR A;  4ZKI A;  4XDK A;  4H13 B;  3B8M A;  5IYB O;  1B04 A;  2ZM6 B;  1XMQ O;  4FLV A;  4BIU A;  3B77 A;  2B9Z A;  1N34 B;  3RYI A;  4X1I A;  3W7S A;  2R9R B;  1JFF A;  4O4H A;  4K8X A;  1Y66 A;  5CMU A;  3A2F A;  3WFV A;  2WLL B;  2BTQ B;  3ASN C;  4JI8 O;  1EFR G;  3D3I A;  3T1Y B;  4X65 O;  4DV7 O;  3JAS B;  4F6E A;  3RW0 A;  2IH3 C;  1CP9 A;  2OIE A;  4PA4 A;  2XOK G;  4EB6 B;  3MD0 A;  1TUB B;  4PA6 A;  1KP2 A;  5D5Q A;  3VQY A;  1EN6 A;  5LBQ A;  4I4T B;  1ZWI C;  1TGO A;  1F23 A;  2DMX A;  2Z3Y A;  5FL7 G;  4PV1 B;  4PJ0 Z;  5J9P C;  1V54 C;  2P4V A;  1KEC A;  4DUY O;  1NTK H;  4O2A B;  4O2B B;  1CEZ A;  5KHK A;  3DSQ A;  4OXS A;  1FYJ A;  2F23 A;  2UUC B;  2E5L B;  1VQ6 V;  3TCU A;  5CA1 B;  1V55 C;  1G6U A;  3OAA G;  4U7N A;  4PDL A;  2MW2 B;  2AXT Z;  4D7T A;  2QR4 A;  2ZM6 O;  1L0N H;  1FAF A;  5FNV B;  1FXK B;  3BFR A;  2RCV A;  2KKW A;  4YIP A;  1WB8 A;  2CTR A;  5CA3 A;  3KDR A;  1YIJ V;  3QTC A;  4DXW A;  5DED A;  3ZJZ A;  3EFF K;  4I55 A;  1P4R A;  1Q8I A;  1WPB A;  1HNW B;  2WLI B;  2ITD C;  4JAA A;  5JJJ B;  3U11 A;  3E83 A;  4D6T H;  1P84 F;  3K58 A;  1JPX A;  1UPG A;  3ZHT A;  4HZ3 A;  1KKC A;  5GW7 A;  5IYZ B;  2NLJ C;  4AQY B;  1M1K W;  3APO A;  4H0L B;  4QPK A;  1QHT A;  4UUJ C;  2BTO A;  1YJ9 V;  1EZV H;  3M99 B;  3LNM B;  1V54 B;  2FL4 A;  4MW8 A;  3JCZ A;  3W7T A;  1MA1 A;  1ROP A;  4GX2 A;  1NQT A;  4HNA B;  4FLT A;  1O9H A;  1WJZ A;  2YUA A;  1QLE C;  4AI8 A;  1JX9 A;  1NR7 A;  4DV6 B;  2HVK C;  4NR1 A;  2RNB A;  1YXB A;  3G80 A;  1NKD A;  1V55 B;  3SYQ A;  1SES A;  2UUC O;  2E5L O;  5LHH A;  1IBK B;  1TVK A;  3KCY A;  1B3Q A;  2H3O A;  5C8Y B;  4B3S B;  1Y76 B;  2QM4 A;  5JVD A;  4QGP A;  5J2U A;  2Q0O C;  1B6Q A;  5L3E A;  2Y48 A;  2NN4 A;  1ZL8 B;  1SS3 A;  2EX3 A;  2PI5 A;  1Q90 D;  3CB2 A;  1PP9 H;  1WAZ A;  4WFB V;  2DQ3 A;  2Q6A A;  2YIB A;  5EYP A;  2M7W A;  3RVZ A;  4MVS A;  3ABK B;  4QNH B;  2HHH B;  1HNW O;  1A32 A;  3OR6 C;  1J95 A;  2WWW A;  2WA4 A;  1FOU A;  1J5E B;  1M56 C;  3Q4H B;  4AQY O;  4I50 A;  3QO5 A;  3SYA A;  3ETG A;  2OWO A;  4EFE A;  1K34 A;  1SRY A;  1KKD A;  2R72 A;  1K7D A;  1WP8 A;  3AK3 A;  2GV9 A;  2N05 A;  1QLE B;  1Z5V A;  2VQE O;  1IUR A;  2QTO A;  5LMU B;  4ZIB A;  1QR9 A;  4DV6 O;  2QM7 A;  2WA3 A;  1WA8 B;  3A8T A;  2EBO A;  3A0H Z;  2ZDI C;  1GM9 A;  1OCR C;  2EIJ C;  1IBK O;  2HEP A;  3H1H H;  3RYH B;  4E4E A;  3K5N A;  1Y74 A;  4WFH A;  1Q7Y W;  4B3S O;  1WN7 A;  5B1A B;  5E79 Z;  3FB8 C;  2XT9 A;  2VRZ A;  3ASO C;  1U97 A;  4H33 A;  4JTD B;  1DGS A;  1SQF A;  4FVM A;  1JMK C;  1NZ6 A;  5ITZ A;  3IGA C;  4FM0 A;  3STZ C;  2HHH O;  5DN6 G;  5JQG B;  3IC7 A;  2JEX A;  2LP7 A;  2P22 C;  4LF4 B;  2ZE7 A;  1YI2 V;  2EUL A;  3FB6 C;  1J5E O;  2IJJ A;  4NTW A;  4MVM A;  1ZSP A;  2DYR B;  2P06 A;  3OMA B;  2EIN B;  3W7X A;  2W0F C;  2Q73 A;  4PI2 A;  3S3X A;  4O4I A;  3MHH C;  1KP3 A;  4R8C A;  1H5W A;  1VF6 A;  3H1J H;  1OCR B;  4LF8 B;  3K06 A;  4QE9 A;  4YHH B;  2LGW A;  2F4V B;  4ZOL B;  2GUZ B;  4DV0 B;  4KXR A;  3TJT A;  1QCE A;  2OTL V;  4WFE A;  4Q6G A;  4J9Z B;  1SA0 A;  2OCC C;  3GWO A;  1BCC H;  1HP8 A;  1Z5W A;  4QIW F;  5B3S C;  2KSD A;  4LH6 A;  1UJW B;  4JI4 B;  3UO2 A;  4BIO A;  4LNU A;  1Q43 A;  3OTF A;  3ABL C;  1T5E A;  4H37 A;  3N2G A;  3ZED A;  4F4L A;  4PEL A;  3H9V A;  1M90 W;  4MTG A;  5LL6 Y;  1P7G A;  1LR1 A;  3BA9 A;  1E1Q G;  1GN2 A;  2UUB B;  1I94 B;  3KCX A;  3OGI B;  4IYH A;  3D8C A;  4UCO A;  4ZHQ B;  4X20 A;  5GTI Z;  1R6N A;  4DRX A;  4IHJ B;  4JI6 B;  5CBG A;  3LUT B;  2WLM A;  3BRC A;  4IYI A;  2A3Q A;  4NKG B;  5H6R A;  1PM9 A;  1H2N A;  4LF8 O;  3HKC B;  4PD4 F;  4YHH O;  4YJ2 A;  4JZ2 A;  3CSX A;  2F4V O;  1KBH A;  4DV0 O;  2R9I A;  3QVN A;  2OCC B;  1KQS U;  4B3T B;  2XAS A;  4FLY A;  1Q6H A;  1NJI W;  3CEI A;  4MVU A;  3ZRW B;  5B3S B;  1R73 A;  3G6B A;  1WLE A;  1H2S B;  1S72 V;  3ZS8 C;  2KB1 A;  5JCO C;  4UCS A;  5K1X A;  1N0N A;  5FLX N;  4JI4 O;  1R1B A;  3K79 A;  3T2M A;  5LOV B;  2Q4P A;  1QR8 A;  3H1L H;  3JSL A;  4WFA V;  1AI4 A;  3AG2 C;  1OCO C;  3OEH G;  3WB2 A;  3K03 A;  1AB3 A;  2YIC A;  2IJH A;  1K73 W;  1AJN A;  1XIL A;  5KMG A;  3BCC H;  1Q3E A;  4UCV A;  1MSW D;  3H01 A;  2UUB O;  1I94 O;  4MVZ A;  3DXR A;  1MG1 A;  1GO3 F;  2JGD A;  3IC9 A;  1XRE A;  1I7F A;  3UCS C;  3E8B A;  4JI6 O;  1S0V A;  1I08 A;  3RYC A;  4CC5 A;  3LSQ A;  1G8M A;  4DR4 B;  4UCR A;  1PV0 A;  2CUG A;  5BMV B;  4DV5 O;  4OX9 B;  2WPD G;  3EVK A;  2RJZ A;  4LBE C;  2QWR B;  3CXH F;  1I5X A;  2QE7 G;  5EIB C;  4B3T O;  3CC4 V;  3LSU A;  4UV8 A;  2ZQM A;  3STL C;  2LGQ A;  1NBM G;  3RYF A;  2HFE C;  1YF2 A;  2CAZ C;  1H2M A;  2QDO A;  3JSN A;  3AG2 B;  4DR6 B;  1D5N A;  2KG7 A;  5GON A;  2P90 A;  3N2K A;  2PGG A;  3L72 H;  2JVD A;  3ZRX A;  4FMT A;  2DQ0 A;  3DGE A;  3CXC U;  4U3J B;  4MW3 A;  5EK0 A;  3CRM A;  4K0K B;  3G71 V;  3ETQ A;  2KQX A;  5B1N A;  3OD4 A;  5EIB D;  2LW7 A;  1H8H G;  1D5A A;  4N21 A;  2QEX V;  1E79 G;  3N27 A;  3CRR A;  3ZMT A;  3MHS C;  2JJ2 G;  2IU3 A;  4BWA A;  4CH6 A;  3R66 A;  1I0H A;  2RN9 A;  3SJB C;  1NTM H;  4X65 B;  5JH7 A;  4GKK O;  4W4L A;  5LA6 A;  4TV8 A;  2P67 A;  1RSO B;  1N8R W;  4K35 A;  1DLB A;  3IFX A;  4KUM A;  4PI0 A;  1K92 A;  4L8J A;  1K5Q A;  2H8P C;  4H44 B;  4XDJ A;  1YJN V;  5J2T B;  4J41 A;  4BR6 A;  5EC2 C;  3UT5 B;  4GKJ B;  1R3K C;  3I5D A;  4RUF A;  3KZI Z;  3NXS A;  4BW9 A;  3OFN G;  2AHZ A;  4FFK A;  3TGU H;  3VQV A;  2Y0I A;  2UU9 B;  3SPG A;  1VEW A;  4IT5 A;  1NR1 A;  1SQB H;  4O4J B;  4DR6 O;  1H8E G;  3LDE A;  4LCU C;  1BE3 H;  2ZT9 B;  1Q6U A;  2BSK B;  1SQQ H;  1KUQ A;  4GYC B;  1YVW A;  4K0K O;  4FK5 C;  3FAV A;  4L87 A;  1RM1 C;  2L35 A;  4OGQ B;  4X66 B;  3R65 A;  1OCC C;  2DN9 A;  3AG4 B;  4Z1M G;  2BOB C;  3WB0 A;  2CH7 A;  1H38 A;  5KA5 A;  3JAW B;  4X62 O;  4F6R A;  5B1B B;  1NVP D;  3T1C A;  2XND G;  3DTU B;  2XAH A;  3HKD B;  1ZX3 A;  2EIL B;  1IXM A;  5E1A C;  1COW G;  1XHX A;  3SR2 C;  3E89 A;  1N4C A;  1AI7 A;  4TUY A;  3K5O A;  5IWA O;  5IJ0 B;  3AG1 B;  3LDC A;  3JAR A;  3H1I H;  2DJV A;  1L1F A;  1SET A;  4GKJ O;  3PJS K;  5LXT B;  1NVP B;  5EZY A;  3RFR A;  1BT8 A;  4X1Y B;  3BEH A;  2UXC B;  4DW1 A;  2UU9 O;  4GT1 A;  4P2Z A;  4DUZ B;  2FML A;  2ZE6 A;  3FB7 C;  3OMN B;  1E1R G;  2QKS A;  4RO2 A;  1JJO A;  2RQ6 A;  2HJD A;  5L3G A;  3TET A;  3P3N A;  1JJ2 U;  5DEC A;  2YIB D;  2K9P A;  2A06 H;  3B40 A;  4X66 O;  3ASN B;  2WLL A;  2Q9L A;  3FKS G;  3RWR D;  2K1E A;  2BTQ A;  2Q68 A;  3B4S A;  4B7E A;  3LDD A;  4BIZ A;  3KKY A;  3JAS A;  4GX1 A;  4EB6 A;  2IH1 C;  5L3D A;  4WF9 V;  1TUB A;  3ABT A;  4TWK A;  1F51 A;  4D7S A;  3CRC A;  4I4T A;  1LNQ A;  4DW0 A;  5A2Q N;  1WP7 A;  3T4Z A;  4P9O A;  4X64 O;  1K3E A;  1K8A W;  1BQZ A;  1FFT B;  4O2A A;  4O2B A;  2VQE B;  1V9P A;  5LXT A;  3CRQ A;  4LC1 A;  1IVS A;  4DV4 B;  2H94 A;  1L8D A;  2AW9 A;  4NVP A;  1ORQ C;  2UXC O;  4UFZ A;  5CA1 A;  3KG2 A;  3QO7 A;  4DUZ O;  1VQP V;  4J80 A;  1S5J A;  5FNV A;  1FXK A;  3FD9 A;  3EXA A;  1HNZ B;  4U3F H;  1U96 A;  2EJ7 A;  3L74 H;  4LH7 A;  1S77 D;  3ZMU A;  3SPH A;  1O9G A;  3HB3 B;  1BHB A;  3E8F A;  3BAB A;  4RQE A;  2ZCE A;  5D5P A;  4DV2 B;  3OUF A;  2FB5 A;  3RN4 A;  3HR0 A;  2WLI A;  4QE7 A;  2LFS A;  1EBO A;  3AEI A;  4PA9 A;  1P7B A;  1GTO A;  2EIK C;  1VF7 A;  2YS8 A;  1W0J G;  3APQ A;  4B3R B;  2XAJ A;  3HPL C;  5B66 Z;  4UVC A;  2JIZ G;  5HFL A;  5IYZ A;  2Q69 A;  3THO A;  1NTZ H;  3CE2 A;  2ETN A;  3GWK C;  4DK0 A;  2JJ1 G;  4WFF A;  4DV3 O;  2IU0 A;  4DR5 B;  2ADQ B;  2R70 A;  3SPJ A;  1M93 A;  4HNA A;  2VS0 A;  1RPO A;  2V4D A;  4YIO A;  3HKB B;  4FLZ A;  3ZCC A;  2YSU B;  3BA8 A;  4XBF A;  3CCS V;  1FJG B;  3QF7 A;  3ICX A;  4DV4 O;  4LF6 B;  4IL6 Z;  5H6Q A;  4UB8 Z;  5B1O A;  5C8Y A;  1K97 A;  2JRI A;  3CCV V;  1Y76 A;  4MVO A;  2IW5 A;  2V1D A;  1HNZ O;  1G1X B;  1HWY A;  2PF4 E;  2Q7G A;  2M6Y A;  1K9M W;  1ZL8 A;  2ITC C;  1H2K A;  3TK1 A;  2WLN A;  2ZKO A;  3BAA A;  2CDY A;  3LSS A;  4LFC B;  2IJK A;  2Y69 C;  2HKO A;  4DV2 O;  1K33 A;  1FXH A;  4GLX A;  5CN0 A;  4W4K A;  3W7U A;  4X1K B;  4B3R O;  5CB4 B;  1M56 B;  5JWP A;  4MS2 A;  1W2B U;  2D2C B;  3Q4H A;  1VQL V;  4DO2 A;  5LP6 C;  1X59 A;  2W0X A;  2IM9 A;  3K9A A;  4UB6 Z;  1IBL B;  2B5U A;  3AK1 A;  2DYS C;  3SYO A;  1AP5 A;  3CCJ V;  1BZK A;  3G67 A;  4DR5 O;  1VF5 B;  4JYA O;  5IYC O;  3ZMZ A;  4LWS B;  3OTO B;  2GTA A;  1EN4 A;  2ZNJ A;  4UXN A;  1FJG O;  3D3Q A;  1WA8 A;  4MTX A;  2NNU A;  1W0K G;  2QGN A;  2X6A A;  2EIJ B;  4LF6 O;  1IJG A;  4U7O A;  3FYE B;  2JK5 C;  3RYH A;  3K08 A;  2HR3 A;  4X88 A;  3ABM C;  4RWU A;  2Q8V A;  1Q86 W;  1JVM A;  4JTC B;  4CS4 A;  3ASO B;  5TIS Z;  3L71 H;  1F7Y A;  1CXZ B;  5IJ9 B;  3ZIA G;  1VQ9 V;  4P9P A;  4LFC O;  3JAT B;  4NB5 A;  3P32 A;  5H5N A;  1VQ5 V;  1PKX A;  4KP4 A;  5JQG A;  3RBZ A;  2UXN A;  1AR4 A;  1FFX B;  1QBZ A;  3CWB H;  3ZMS A;  2FKX A;  5LP6 B;  1F4M A;  3AK2 A;  4QJF B;  1R6K A;  2O57 A;  1OZ0 A;  2P5O A;  3X2Q C;  5CA0 B;  2QWQ B;  1IBL O;  3HKE B;  4CZZ A;  3J81 N;  4DK1 A;  1KB9 F;  4YXW G;  5IY5 C;  2E3C A;  2YEV B;  3F7Y C;  5IYD O;  2D3O W;  4FZ1 A;  3S3W A;  3OTO O;  3L9D A;  4MTF A;  1M9N A;  4PDR A;  4JPR A;  1YJW V;  3TXS A;  4PA7 A;  1M4U A;  1DF4 A;  3FYI B;  3O65 A;  4ZI7 B;  2N74 A;  4ZOL A;  2GUZ A;  1IBM B;  2VWK A;  2F95 B;  4DV5 B;  3ZX6 A;  4G28 B;  4KHP B;  4TV9 B;  2E76 B;  3K5L A;  4NTX A;  3P30 A;  2HLD G;  3SJC C;  3WU2 Z;  2UUA B;  5FPR A;  3CYO A;  1FKA O;  2A9H A;  4IIJ B;  4JI2 O;  4FFB B;  2YXL A;  1URF A;  4X9Q A;  5HFM A;  1XMO B;  4JI3 B;  2A79 B;  4UVA A;  3ABL B;  1K5S A;  2RDC A;  1PNK A;  1NU1 H;  5BY1 A;  1Q81 W;  1VQK V;  4PA3 A;  1G4Y B;  3CCR V;  2XUM A;  2QWP B;  1OCZ C;  1M5I A;  3QG5 A;  1R3L C;  2XHB A;  3CJH B;  1VQM V;  1OV9 A;  3CME V;  3UO3 A;  1SZX A;  3CCL V;  2CTP A;  1HNX B;  5KUK A;  4J10 A;  2PZS A;  3ABU A;  5IY5 B;  4ZHQ A;  4FM2 A;  3JAK B;  2ZXW C;  5KUM A;  5L3B A;  1GN4 A;  3JD4 A;  4IHJ A;  4FIP C;  3CHX A;  3ZRS A;  5LHG A;  4NXM B;  1XEQ A;  2Q0A A;  4GKK B;  2CGO A;  2JS5 A;  1W59 A;  5KAI Z;  4UVB A;  3RVY A;  4GZR B;  3HKC A;  1XNR B;  5K1P A;  2YXH A;  4WBN B;  2P6J A;  1IBM O;  1Q82 W;  2LO1 A;  4KHP O;  1Y67 A;  5KX5 B;  4O4L B;  5IT9 N;  3E22 B;  3I56 V;  1WB7 A;  3ZRW A;  2N04 A;  2UUA O;  1XL6 A;  3D36 A;  1S5H C;  1KD1 W;  2CK3 G;  4J11 A;  2EZP A;  5LOV A;  1AJP A;  1XMO O;  4JI3 O;  4CH4 A;  4I9Q A;  4RQF A;  4GUN A;  3ZRV A;  2QTS A;  1XI1 A;  1OCO B;  2JS3 A;  2EJR A;  4P30 A;  3CCU V;  5DM6 V;  4Q20 A;  3K0D A;  3JAL B;  3OEE G;  3SDL A;  1HNX O;  4YJ3 B;  2QA4 V;  1QVG U;  2F1M A;  5LYJ B;  4I0X B;  1N33 O;  1MAB G;  3CPW U;  1IX9 A;  1RFY A;  2EIM C;  1PPJ H;  3ZBH A;  2BE3 A;  4CH5 A;  1IZ3 A;  2F93 B;  4PDM A;  3WG7 C;  2CTW A;  2ZIN A;  4NXM O;  4X62 B;  3FB5 C;  3K04 A;  1Z2G A;  4CBC A;  5BZB A;  3BVO A;  4JYC A;  2QM8 A;  4BAY A;  2XTA A;  1OJH A;  1XNR O;  3RYI B;  3VQX A;  4X1I B;  2BOC C;  1OHH G;  5BMV A;  1JFF B;  1BSM A;  3PN1 A;  2FTK A;  4O4H B;  1UFI A;  5IWA B;  2CTQ A;  2Q67 A;  2YI9 A;  3FFQ A;  1N32 B;  2AHY A;  5LGN A;  3MDS A;  1GK9 A;  2QWO B;  1P49 A;  1AR5 A;  1XOU A;  1WPX A;  2X6B A;  3C3S A;  2ODM A;  1JQ0 A;  4FPP A;  1GM8 A;  1MMM A;  4U3J A;  3ETE A;  2YIA A;  2PYL A;  4K3A A;  4DR2 B;  1L0L H;  3QO8 A;  2B1G A;  2UXB O;  5KHH A;  1SZT A;  3ML0 A;  1FXV A;  2E75 B;  2JEU A;  1TAE A;  4R6Z A;  1IXB A;  1PL4 A;  3C3T A;  3SPC A;  2ZE5 A;  3WG7 B;  1VQN V;  1BL8 A;  1XNQ B;  4R7C A; 
#chains in the Genus database with same CATH homology
 1N0N A;  5AG2 A;  4GUN A;  3DC6 A;  1GN6 A;  1I0H A;  3BFR A;  2RCV A;  3AK1 A;  1AVM A;  2QKA A;  4YIP A;  3TJT A;  1AP5 A;  1BT8 A;  1WB8 A;  1XUQ A;  3RN4 A;  3KDR A;  3AK3 A;  5A9G A;  4JYY A;  1XIL A;  2GDS A;  4JZG A;  1EN4 A;  1JR9 A;  2QKC A;  1IX9 A;  4X9Q A;  1MSD A;  3IC9 A;  1KKC A;  1BS3 A;  1XRE A;  4BR6 A;  1N0J A;  1GN3 A;  4E4E A;  1I08 A;  1SZX A;  2ADQ B;  3DC5 A;  1MNG A;  4FFK A;  1VAR A;  1ZTE A;  1BSM A;  1VEW A;  1MA1 A;  4YIO A;  1LUW A;  1P7G A;  3KKY A;  1QNM A;  1EN5 A;  1GN2 A;  3EVK A;  1B06 A;  4F6E A;  1EM1 A;  1GN4 A;  1AP6 A;  3LSU A;  1AR4 A;  3MDS A;  1LUV A;  1EN6 A;  3K9S A;  2CE4 A;  1ZLZ A;  1PM9 A;  2ADP A;  1AR5 A;  3AK2 A;  3C3S A;  4JZ2 A;  1D5N A;  1MMM A;  2CDY A;  4C7U A;  1Y67 A;  1ZSP A;  3QVN A;  2P4K A;  2AW9 A;  1WB7 A;  3OT7 A;  3CEI A;  1JA8 A;  1IXB A;  1PL4 A;  3C3T A;  1ZUQ A;  1IDS A;  1XDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...