1XUQA

Crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
200
structure length
200
Chain Sequence
b'KHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 72
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xuqA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xuqA02
1BT8A 1GN6A 1JR9A 2ADQB 1XUQA 1AP6A 1WB8A 1BSMA 1JA8A 3IC9A 3AK3A 3OT7A 3DC5A 1GN4A 1N0JA 3LSUA 5AG2A 3RN4A 4YIPA 4BR6A 1GN3A 1MMMA 1EN5A 1AR5A 1XREA 1GN2A 4X9QA 2QKCA 5A9GA 1ZUQA 3TJTA 1SZXA 3MDSA 1ZSPA 1MA1A 1VARA 2ADPA 2QKAA 1IXBA 1P7GA 3DC6A 4YIOA 1EN6A 1BS3A 1AP5A 3BFRA 1N0NA 3C3SA 4F6EA 3C3TA 1ZLZA 1AVMA 1MSDA 1EN4A 3AK2A 4JYYA 1I08A 1ZTEA 1I0HA 1IDSA 1B06A 1WB7A 4C7UA 1LUVA 1XILA 1AR4A 1MNGA 1QNMA 3EVKA 3AK1A 1XDCA 4E4EA 3QVNA 3K9SA 1LUWA 1IX9A 1Y67A 1D5NA 2GDSA 2P4KA 4GUNA 2CDYA 4JZGA 1EM1A 4JZ2A 2CE4A 1PM9A 3CEIA 2RCVA 3KKYA 1VEWA 2AW9A 4FFKA 1KKCA 1PL4A
chains in the Genus database with same CATH superfamily
1FKAO 1NVPD 1QU7A 3BY6A 5EC2C 1Q6HA 2ILMA 3A0BZ 3E35A 4TOIA 2K9PA 4DV2O 2EIKB 1AP6A 1Q5OA 3BEHA 5EIBD 3SR2C 3FD9A 1PKXA 4WBNA 1NTKH 3OGCC 1E1QG 4JI2B 4B3SB 3BPZA 3QG5A 1I94O 1BE3H 4R6ZA 5CA1A 3APQA 2HLDG 4WBNB 1R73A 3FB8C 1V54C 4GKKB 1XNRB 3K58A 1N33O 1ZSPA 2JK5C 4DV1B 4MS2A 4TQFA 4YY3B 4JPRA 3CMAV 1WNSA 5JJNB 1ZX3A 4MTGA 4WFBV 1NR1A 4JI6O 3UT5A 4X62O 1AP5A 1HNWB 2Z5UA 3OMAB 1NTZH 3K04A 1S5LZ 3ZCCA 1SQVH 5LMUO 2Q9LA 2Y4UA 3P3NA 5C8YA 2WLHA 1NI8A 5JH7B 4Z1MG 5LA6B 1K33A 5EC1C 3RW0A 4RAIA 4WCEV 1BQZA 4JI7B 4LCUC 2YIBD 4WFFA 1KMIZ 3ZHTA 2XAHA 1H38A 3G6BA 2E5LO 2XUMA 4DV4O 1WA8B 3UQ8A 1YJNV 4X8AA 3OM3B 3G71V 1OCCB 3L70H 2WA3A 1M56C 3RT3C 2ZE5A 3STZC 4LBEC 4F6RA 5KX5B 3CC4V 4JV5O 4UVAA 3DSQA 3RWRD 2AHZA 3J81N 4WFHA 2X6CA 2DYSC 3CWBH 1BQ0A 2PI4A 4CZZA 4WFAV 3W7XA 3JAWB 2QE7G 1JR9A 1V9PA 3E8FA 5DN6G 4DW0A 4F6RB 2F4VB 4NTXA 1QLEC 4I4TB 4TUYB 1AJQA 2FL4A 1EZVH 3CS5A 2YI9A 2ZR2A 4B3RO 1DTOA 4ZBMA 2OWOA 2EILC 3CCJV 1IVSA 3AG1C 1FXKB 1EN5A 1XNQB 1GM8A 2D2CB 4TV9B 1Q86W 4G28B 4RQEA 2E76B 3RYCB 4ZHQB 4X89A 5LHGA 3JCUZ 3CCRV 4AILC 4DR2B 2MK3A 2VQFB 1W0KG 5KHKA 1YSCA 2P22C 3AK2A 3E86A 3OD4A 3CCVV 1PV0A 3OGIB 4O4IA 1KU9A 3D36C 2DYRC 4LH7A 2XOKG 4GX5A 3BAAA 2LP7A 4EFBA 2MW2B 4E4EA 2LW1A 4FLTA 2O57A 3N27A 2Q0OC 2KG7B 2KSDA 1XI1A 1V54B 1Y6XA 1SESA 1VIBA 5LOVA 5LMNB 1L0LH 1K5SA 3VBBA 1Q3EA 3JARA 4DRXB 1EM1A 1XL6A 3H1IH 5DEDA 3ZX6A 4FFKA 2WLMA 4UCTA 2UXXA 1ZL8A 5KMGB 1Q7YW 3M7MX 3RYHA 3FB6C 5LOVB 3K79A 3C90A 3D8CA 2QM4A 5J2UB 1YVWA 3B8NA 1YI2V 3HKCA 1Y74B 1YZBA 4DV0O 4U3JB 1K73W 3KCXA 1N0JA 1ZL8B 2UXBB 4DYLA 1F4MA 4RUEA 1XNRO 3CRMA 4I0XA 3JD1A 4BR6A 4DW1A 4EB6B 1VQMV 1GN3A 3E22A 4OPAA 4YY3O 4LFBO 3W7TA 1IURA 5BY1A 3JALA 1QVFU 1X59A 1HNWO 2XAQA 1VQ4V 2ADPA 1L0NH 1DLBA 4X1KB 1FFXA 4GKJB 4FZ1A 4Q20A 3VQYA 1FJGO 3CJHA 4LF4O 3OMIB 4NXMB 1YF2A 3T1HB 1X4TA 2ZE6A 4IT5A 2JDIG 2IM9A 4FK5C 2PTMA 5LP6C 1M57C 5CA3A 3B2EE 5LXTB 2JGDB 2A9HA 4C7UA 3IC7A 5EK0A 5B1OA 2M7WA 3VQVA 1VQ8V 3QVNA 1N32B 3FAVB 2ZD9A 4AQYB 4IYHA 1CP9A 2IJHA 3WB1A 2X6BA 5HFLA 2OCHA 2GDSA 1CEZA 3CC7V 3RVZA 4DR4B 3H9VA 4LFCB 2XNDG 1MABG 1AI4A 3JYCA 3I55V 4LNUA 1AJNA 4JTCB 3D36A 1FS0G 3B40A 4PA7A 1VQ7V 4QPKA 2R70A 2ZDIC 2JGUA 1NZ6A 2PYJA 4NR1A 1N36B 5LGTA 1F23A 2YC0A 3SDLA 2VS0A 4LNUB 2LFSA 3WG7B 2EJRA 3G67A 1KD1W 5GONB 4I50A 1XNQO 4PV1B 3RFRA 2QKSA 2NN4A 5B1AB 1JNBA 1M9NA 2WLJA 2Q68A 1HWYA 2X6AA 1MOFA 2IU3A 1N4CA 4I50B 3QF7A 3K59A 3MDSA 4N23A 3K5LA 4I5SA 4DR2O 2VQFO 4J9YB 2YUAA 3CPWU 1VARA 4UCOA 2HR3A 3ZMTA 1HR0O 2UU9B 4YIOA 5D5PA 3ZRXA 2EIMB 2YDEA 1K3EA 3BFRA 3JASA 1K7DA 2IH1C 3ZN1A 1AI6A 3CX5F 2EIJB 3ASNC 1AROP 4X65O 2QJ1A 3ZRVA 3ABKC 4O2AA 4X20A 2DJVA 4QPJA 4B7KA 2OTLV 4B08A 4PDLA 4U3FH 1N33B 2QA4V 1QR9A 2E74B 1T5EA 3JAKA 5BR8O 4JI6B 5HFMA 2NR5A 5JVDA 4X62B 5LP6A 5IJ0B 4CH5A 3HKDA 3WB0A 1WAZA 2IJJA 3CEIA 1TA8A 4MTFA 3HKBA 1GTOA 1PL4A 4JI0O 5LMUB 1B6QA 5B3SB 4JAUA 4JTDB 3A0RA 2Y48A 4JF3A 3BA9A 1JJOA 2AXTZ 4G2KA 5EBLC 2UXBO 3BRCA 4XDKA 2XT9A 4PHZA 2YIBA 3CC2V 1YJ9V 3IC9A 3F7YC 3T1YB 1JCHA 1SZTA 1VQLV 3F5WC 3BVOA 3QO7A 3UO2A 2E5LB 2XAGA 1OCOB 4JI5O 5AG2A 2N04A 4F4LA 4QGPA 2ZDIA 2IU0A 4ZI7B 5CBHA 4PA6A 3HPLC 3TETA 1D2DA 4YJ3A 2BOBC 3RYIA 4FFBA 4GKJO 2G38A 1SZXA 3SPIA 4J41A 2RQ6A 4LR3A 4P9PA 4NXMO 4JYCA 3SPJA 2RN9A 3T1HO 1Y66A 2EZOA 3DXRB 4KXRA 2GUZA 4UB8Z 3JSLA 4UCUA 3C3SA 2QEXV 2JVDA 1Z5VA 1K4DC 1IXMA 3UO3A 4B3RB 4FIPC 2YXLA 4AQYO 1Q6UA 5B1NA 1WB7A 1OCCC 2NLJC 2GUZB 2GTSA 4J7ZA 2Q7EA 4DR4O 1VF5B 1QNMA 1H2SB 1G4YB 1G1XB 1P7BA 1VF6C 2QSAA 2WAMA 3P3PA 2FB5A 1GKFA 2A0LA 4DR5B 5ITZB 4N21A 2HJDA 4J42A 1RP3B 1AR1B 2F43G 1RM1B 1N36O 4IGGA 4O4HB 1O9GA 2LW7A 4MT8A 4X1YA 2DW4A 2VQEB 2ZNJA 1N34O 2GTAA 2QM7A 3A0HZ 4MSWC 5L3FA 2JJ2G 5J2TA 3ABLC 3K03A 1FXKC 5DM6V 3ABKB 4BIZA 3W7UA 3VQWA 3J80N 2P5OA 1K92A 4EKWA 1R6TA 4OX9B 1QQCA 3KG2A 1QVGU 2JS5A 3SPGA 2XTAA 5K1PA 3L74H 3KCYA 2UU9O 1XQ8A 2UUBB 3O9OA 3TXQA 3TJTA 3L71H 1DF4A 1PNMA 3B77A 2ZE8A 4UXNA 1ROPA 3BHPA 2BTQB 2LGQA 3BA8A 3JCZA 4DV0B 1XL4A 3ZHUA 1VQNV 3SPHA 2IBZH 2CH7B 1AI5A 1TAEA 2B9ZA 5IY5B 1SQPH 4NXNO 2CTQA 5LYJA 1SETA 4LFBB 3H1JH 5JH7A 3FB7C 1S0VA 3U11A 5LA6A 2ZXWB 4EEQA 4DUZB 2UXCO 4TQDA 1S72V 5JJJB 1NJIW 1FJGB 5LYJB 2CDYA 4LF4B 4DV5O 1NU1H 3E2EA 1WA8A 2N74A 2OCCB 1COWG 5LL6Y 4LF9O 4FLZA 5KX5A 3AG4B 1S76D 3AG3C 1VF6A 3OFNG 1G8MA 2N05A 3T1YO 3RGBA 4I9WA 4AI8A 3JAWA 3W7SA 4MVMA 1DK1A 4IL6Z 4UCSA 4LWSB 1OCZB 1J5EB 5E1AC 4I4TA 1B04A 3L75H 4DUYO 4TUYA 3MAQA 3BCCH 3ZRWB 4AHCA 3QO5A 5BMVA 3CRCA 2QGNA 2UXDO 1NKDA 3H01A 1AR5A 2EULA 1FXKA 5CA0B 3B8MA 4TV9A 4UV9A 4I9QA 3RYCA 1J95A 4BWAA 4ZHQA 4W4LA 5BMVB 4X1IA 4PI0A 1VP7A 5LBQA 1FXVA 3ABLB 3VQXA 2VWJA 4FPPA 2WWWA 1M93A 3K57A 2PI5A 2A79B 3CCQV 1LR1A 3U10A 3LDCA 1B06A 1AILA 2R9RB 1AR4A 4X1IB 2Q73A 2P6JA 2WLLB 3SPCA 4DR5O 3AK1A 4A5UB 4GX0A 1OJHA 2CUGA 2PF4E 3W7WA 1XHZA 4HNAA 3H1KH 2C2AA 1HR0B 2LGWA 2JEXA 5BZBA 1SF9A 2VQEO 4KP4A 4RQFA 2UUAB 2KG7A 3WG7C 3SYCA 3E8BA 1PPJH 2YEVB 3L9DA 2BOCC 3ZIAG 4DRXA 1KKCA 2Q7GA 4HNAB 4X65B 4DR3O 4H13B 5B1AC 4D7TA 1HNXB 5KMGA 3H1HH 1KKDA 2QWNB 3MD0A 2ETNA 4OX9O 1BHAA 5J2UA 1JA8A 3DC5A 4JI4O 1D5AA 4D6TH 1Y74A 3LSUA 2UUBO 5BR8B 1KBHA 4U3JA 2R9IA 3IAYA 4NTWA 2DOSA 2EIMC 2YIDA 5EYPA 4X88A 4TWKA 1Q6IA 2JRIA 5JQGB 4EB6A 2F1MA 4ABMA 3M99B 2Z3YA 1W2BU 3OTOO 2EIJC 4JI0B 3ABTA 4DV7B 1KP3A 3ZBHA 2RMKB 5EIBC 1PNLA 3ETEA 4UB6Z 1TVKB 4HBNA 5EYPB 1G6UA 4FLVA 3AG3B 4K35A 1Y76B 4DR1B 2YI8A 4X1KA 3EFFK 5FLXN 1YTFB 4FLXA 2Q4PA 2Y0PA 2DWEC 3CXHF 3MHSC 4MTOA 2QTOA 5B1BC 1YDXA 1YITV 1BMFG 1L8DA 4L8JA 4JI5B 2EINC 1S3JA 4CS2A 1MG1A 4CH4A 4DUZO 2PZSA 4BIUA 1BGYH 3EVKA 3P30A 5LXTA 2JGDA 4PA4A 1F7YA 1K9MW 2B1GA 2KQXA 5B3SC 3FAVA 3CYOA 4P2ZA 2UUCB 4B7EA 4PI2A 3CD6V 1Q81W 4FVMA 4YHHB 4Q6GA 3OAAG 4JZGA 3G4SV 2XHBA 4DR6B 1VQ5V 1WLEA 4BW9A 2JS3A 4FLWA 4W4KA 2GHYA 1ORQC 3H1LH 2EZPA 1IBKB 1OCOC 1U96A 2W6IG 4GT1A 1J5EO 4I55B 1JX9A 2WPDG 2ARHA 4B3MB 2CTWA 3DGEA 3AK3A 3E8GA 2PYLA 2XASA 1IZ3A 3ZHRA 5GONA 1VQ9V 5EZYB 1CPYA 3ZMUA 2ZIOA 2OTJV 4TV8B 2L6LA 1MMMA 2D3OW 1IBLB 5C93A 5H9CA 4GX2A 1N34B 1JOYA 3APOA 4FJCC 1KUQA 4RUFA 4J11A 3IGAC 2P90A 2Q7HA 1P7GA 1OV9A 1YCIA 1EBOA 1FPOA 3OEEG 4DV6B 3CCMV 1BS3A 5LGNA 1TUBB 2PGGA 3NXSA 2QWOB 4F6EA 4Z2WA 4LF6B 2HEPA 4ASUG 1WPBA 3X2QC 3CCEV 4JYYA 1I08A 1V55C 4B3TB 5IJ9A 1LUVA 4ZKIA 4J7JA 3SYPA 1RM1C 4ZIBA 3LDEA 4MVRA 1GM7A 3OR6C 3J7AU 1H2MA 2UUAO 1JQ0A 3UCSC 1XEQA 3JD3A 5IYZB 4LFAB 5IJ9B 2BSKA 1MSWD 1N8RW 1NS1A 3HR0A 4O4LB 4UV8A 2A3QA 5LGUA 1HNXO 3G6EV 3K06A 2ZQMA 5L3BA 4OPHA 5IJ0A 1H2LA 3WFVA 5FNVB 2F66C 2LQTA 1SS3A 3K5NA 5H6RA 1E79G 5KAIZ 1SA0B 5KUKA 2BSKB 3N2GA 3HKEB 4NXNB 5B1BB 2ADQB 4DO2A 4OGQB 4YJ2B 3JAMN 2EINB 5GW7A 4IHJB 3TXSA 2Q0AA 5BXZA 1XOUA 1SQQH 1S5HC 2W0FC 2QWRB 2UXCB 1YTFD 2YSUB 4E2LA 4DV7O 5IT9N 1SQFA 3GB7C 2IJIA 3N2GB 4YIPA 3JD2A 4WFGA 4DK1A 4DV5B 1NH2D 2CGOA 4XBFA 3S3XA 4ZI7A 5TISZ 4LF9B 1S77D 4R8CA 1TGOA 3WB2A 5JCOC 1GH6A 2YXYA 2Y0IA 4DR1O 5KUMA 2CTRA 4P30A 1BCCH 3OEHG 1K34A 2QR4A 5IY5C 4LP8A 3K5MA 1MZEA 1M5IA 4K3AA 2DN9A 3ABMB 1EN6A 1JVMA 2Q69A 5FPOA 2RJZA 4PJ0Z 1N0NA 3DXRA 1PNKA 1PP9H 2ZXWC 3ZHQA 4NB5A 4DK0A 4DUYB 4ICGA 2XAFA 4PA9A 5JWPA 4G27B 3RYFB 3ZHSA 2UXDB 4MVZA 3CCLV 2UUCO 2OCCC 1P84F 2Q5ZA 2ZINA 2JJ1G 4YHHO 3AG2B 1I5XA 2DWDC 1RPOA 2W0XA 3AG4C 3E8HA 4MVOA 3BABA 1VMGA 4DR6O 4Z1VA 1R3IC 1O9HA 4I7ZB 3T2MA 1WP8A 2ZCEA 1CXZB 2ZIMA 4GUNA 1SQXH 1IBKO 5CB4B 4UCVA 1SQBH 1R3KC 2GSMB 2HFEC 2FYUH 2CGNA 5ITZA 3L73H 2AZ2A 3PJSK 1S5JA 2WLKA 1OCZC 1FYJA 1IBMB 4B3MO 4O4HA 3E89A 3TCUA 3ABUA 2YXHA 1GMGA 5KAFZ 4PDMA 3X2QB 5KHGA 4KFMA 2V1DA 2AGAA 2YIAA 4UUJC 1RFYA 2BE3A 1V55B 1FFTB 3EHBB 2UXNA 4J80A 5DECA 4JTAB 1Q8IA 4DV3B 5B66Z 5CBFA 2VRZA 2QTSA 1DGSA 2P7TC 4FLYA 4NTYA 1IBLO 2ZM6O 4MVQA 1HDJA 2NNUA 1QLNA 2QWPB 4JI3B 1WN7A 1Z2GA 1H8EG 1LNQA 1EFRG 4IIJA 1US6A 3UKMA 4DV6O 3K0GA 1FXHA 3Q4HA 3SJQC 3CRQA 4DR3B 1MA1A 3K08A 4LF6O 1NR7A 1U97A 1Z5WA 4CC6A 3CRRA 2HHHO 2ITCC 1NBMG 3ZRSA 5IE9A 4B3TO 2XAJA 4IIJB 1Q90D 2BTQA 5F2VO 4JI4B 2E75B 1ZLZA 1KP2A 3Q4HB 1I7FA 4QE7A 1H5WA 1ZTEA 1I0HA 4H33A 4P9OA 5JCOA 2HKOA 4LF7O 2CH7A 2F93B 5KHIA 3SYAA 4LFAO 4MW3A 2LFRA 3L72H 1K4CC 4CS4A 1IX9A 1LUWA 3OTOB 2WLIB 2IW5A 1JFFB 2FTKA 1OCRC 2P4KA 2OT5A 4JAAA 2Q67A 2CK3G 2M6YA 1ZWIC 4U7NA 3I56V 4KHPO 1FOUA 4KL1A 5B5EZ 4PA3A 2B5UA 4UVCA 3STLC 1URFA 4X66B 1SRYA 3FYEB 3D3IA 4X64O 3GVMA 3K0DA 5GTIZ 3VOUA 1YIJV 2ZE7A 4YXWG 1GN4A 4R50A 2JIZG 4WFEA 5CA1B 3JATA 3FKSG 4LWSA 1GRJA 3M8AA 2EBOA 4NVPA 3ZRWA 3WU2Z 1XREA 1HW7A 2YS8A 4NKGB 2OIGA 4ZOLA 3ASOB 5A9GA 5KLVH 3JATB 3UT5B 5CA0A 1FD9A 1RSOA 3ZS8C 2QM8A 2QDOA 4ZOLB 4JI8O 1R6KA 1A32A 4NYKA 5D5QA 5C8YB 4JAVA 5J9PC 3R66A 3U0ZA 1M4UA 3QO8A 3T4DA 3QNEA 1RSOB 4GZRB 2Y69B 3OW2U 1YJWV 1XDCA 4H0LB 5IDJA 2WLLA 2DQ0A 5CBGA 4LF5B 2CAZC 5LHHA 5LHIA 1PL0A 3ZEDA 1IBMO 1VF7A 3ETDA 4O2BA 4JYAB 2HG5C 4JZ2A 1R3JC 4J9ZB 2CE4A 5IWAO 3AEIA 2HP8A 3OTFA 3TK1A 2W6JG 4JASA 3CCSV 1HNZB 3GWKC 2YEVA 4PELA 1H2KA 3ZMSA 4K8XA 1WPXA 1KYOF 2RDCA 2H3OA 4DV3O 4O2BB 1GN6A 5KHJA 4L87A 4HAMA 5FPRA 2V4DA 4LF8B 4EFEA 4JI3O 4DXWA 1NTMH 4RWUA 3ZHVA 1W0JG 3SYQA 1BL8A 3F7VC 4BAYA 1OCRB 1DF5A 1M1KW 1XMOB 3HB3B 4OXSA 3CSXA 2X7RB 4XDJA 4TT3G 1TUEB 2EX3A 1ZUQA 4FMTA 4QIWF 2HVKC 5JQGA 1ZAUA 3DTUB 3F5TA 2QKAA 4LH6A 3MHHC 3ZN0A 2AZ0A 2Q8VA 1XMQB 4JI1B 5A2QN 4FZ0A 2HVJC 4GCZA 1TVKA 2P4VA 4O4IB 4CH3A 5L3EA 1Y76A 4QE9A 5JJEB 1SQGA 5EBMC 1VQKV 1KC8W 1WJZA 2JEUA 3SGIA 4GLXA 1YXBA 3A2FA 1K8AW 3NR7A 3CXCU 3P32A 3ICXA 5E79Z 2A06H 1AJPA 2KB1A 3OE7G 3JARB 4UVBA 3CB2A 4JI2O 1NH2B 1KECA 4B3SO 5IYBO 3OR7C 4UCRA 4X66O 3ZMZA 3SJAC 1PM9A 4U7OA 4GKKO 3RYHB 2F95B 3LUTB 1UJWB 4FM0A 4DV1O 1XHXA 1YHQV 1BT8A 2YICA 3HKCB 2HJFC 4PD4F 2LJ2A 1Q82W 1M56B 1WB8A 2BCCH 3AG7A 3K3WA 4I55A 4I0XB 1JJ2U 3K9AA 2L35A 4PDVA 3E22B 2DMXA 2DYSB 1L1FA 3N2KA 4IYIA 4K8ZA 3PN1A 2AHYA 4GX1A 3ABMC 1WP7A 3B4SA 2ZT9B 3B09A 1GO3F 3JALB 4CH6A 2E3CA 4TSFG 5EZYA 4TV8A 3OUFA 4JI7O 2QKCA 1QLEB 4K0KB 3G80A 1W59A 3FYIB 5K1XA 3OMNB 1FFXB 3FX7A 2WSSG 3N2KB 3CJHB 2EILB 4GYCB 5IYCO 4J7KA 3AG1B 1AB3A 2RNBA 2BTOA 3AG2C 1KQSU 4O4JA 5L3DA 3C3TA 1HP8A 1AVMA 1TUBA 4KUMA 2ATKC 2A7WA 2ZM6B 1QR8A 4LF5O 1XILA 1E1RG 3IFXA 1BZKA 1Q43A 1R6NA 2F4VO 1UPGA 4R7CA 4O4JB 3CHXA 1Y67A 5GTHZ 4JYAO 5IYDO 1D5NA 2K1EA 3D3QA 1B3QA 3FFQA 2F23A 2OYQA 1GAXA 3T4ZA 4MVSA 2DYRB 1MZFA 2Q6AA 2HHHB 3SJBC 1HNZO 2X0LA 5IYZA 2ZKOA 2CTPA 2ITDC 1AI7A 3JSNA 2RCVA 3ML0A 4DR7B 2V7QG 4CBCA 4O4LA 3LNMB 3QTCA 1K97A 2R9AA 4LF8O 3FB5C 1ENVA 1VQPV 3CP1A 5FNVA 4LF7B 1M90W 1P49A 1SC5B 1SA0A 3HKEA 4YJ2A 1XMOO 4IHJA 5H5NA 3SJCC 4DV2B 4HYOA 3K5OA 1UFIA 4UFZA 1FAFA 1NVPB 4KHPB 1P4RA 4WF9V 4HZ3A 1OZ0A 1XMQO 4JI1O 4X9QA 1H2NA 4FM2A 1F4NA 4CC5A 1I94B 1BHBA 4FLUA 2GV9A 3JASB 4X64B 4RO2A 5LMNO 3O65A 2ZR3A 3LSSA 2Z0AA 1R3LC 2H8PC 4QJFB 3I5DA 3ZJZA 1MSDA 1EN4A 5EBWC 2EJ7A 4O2AB 5H6QA 2EIKC 4X20B 4QNHB 1IDSA 2H94A 3CMEV 1SERA 2PUSA 1VQOV 1MNGA 3ZMVA 1YEWA 4PDRA 1XBLA 2B1IA 4BW5A 3RYFA 3S3WA 1QBZA 1K5QA 3LSQA 3JAKB 1SKVA 1QCEA 5JVDB 5LP6B 5KA6A 1KB9F 1M57B 1RPRA 3HKDB 4FM1A 3KDRA 3HKBB 1QHTA 3KZIZ 4JI8B 2P67A 4DV4B 3KKYA 5CB4A 1NT2B 3ETGA 3JD0A 3OUSA 3RBZA 1R1BA 2OIEA 4JV5B 2DQ3A 5CMUA 1XUQA 3TGUH 4JYBA 1IJGA 3CE2A 1BSMA 1EZJA 3ASOC 2FKXA 4XDLA 3OT7A 2GBOA 2VWKA 1JPXA 4MW8A 4YJ3B 2KKWA 4MVUA 3RYIB 4K0KO 3RN4A 4JGSA 3IJ4A 4FFBB 5L3CA 5KA5A 1H8HG 1Y4MA 1H2GA 5IWAB 4D7SA 4BIOA 1GN2A 1N32O 3A8TA 2ODMA 3UM7A 3JD4A 4H37A 2PY5A 3T1CA 4CS3A 2R72A 3E83A 1IXBA 3DC6A 2Y69C 1F51A 2WA4A 4LFCO 1GM9A 4MTXA 2ZNIA 5H2FZ 4H44B 2DE0X 1VQ6V 2WLNA 2IH3C 3EXAA 2IJKA 5L3GA 5CN0A 1JMKC 3R65A 3ETQA 3K9SA 3LNNA 1PD3A 3CRAA 1GK9A 3RVYA 3SYOA 5FL7G 3ASNB 2P06A 2WLIA 4LC1A 3THOA 4DR7O 1JFFA 3LDDA 5KHHA 1NQTA 4X1YB 1I5YA 2QWQB 3CCUV 3GWOA 2LO1A 2Y4TA 1VEWA 2AW9A 5J2TB 2FMLA 1THZA 4J10A 1OHHG
chains in the Genus database with same CATH topology
1BT8A 1GN6A 1JR9A 2ADQB 1XUQA 1AP6A 1WB8A 1BSMA 1JA8A 3IC9A 3AK3A 3OT7A 3DC5A 1GN4A 1N0JA 3LSUA 5AG2A 3RN4A 4YIPA 4BR6A 1GN3A 1MMMA 1EN5A 1AR5A 1XREA 1GN2A 4X9QA 2QKCA 5A9GA 1ZUQA 3TJTA 1SZXA 3MDSA 1ZSPA 1MA1A 1VARA 2ADPA 2QKAA 1IXBA 1P7GA 3DC6A 4YIOA 1EN6A 1BS3A 1AP5A 3BFRA 1N0NA 3C3SA 4F6EA 3C3TA 1ZLZA 1AVMA 1MSDA 1EN4A 3AK2A 4JYYA 1I08A 1ZTEA 1I0HA 1IDSA 1B06A 1WB7A 4C7UA 1LUVA 1XILA 1AR4A 1MNGA 1QNMA 3EVKA 3AK1A 1XDCA 4E4EA 3QVNA 3K9SA 1LUWA 1IX9A 1Y67A 1D5NA 2GDSA 2P4KA 4GUNA 3KDRA 2CDYA 4JZGA 1EM1A 4JZ2A 2CE4A 1PM9A 3CEIA 2RCVA 3KKYA 1VEWA 2AW9A 4FFKA 1KKCA 1PL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT8 A;  1GN6 A;  1JR9 A;  2ADQ B;  1XUQ A;  1AP6 A;  1WB8 A;  1BSM A;  1JA8 A;  3IC9 A;  3AK3 A;  3OT7 A;  3DC5 A;  1GN4 A;  1N0J A;  3LSU A;  5AG2 A;  3RN4 A;  4YIP A;  4BR6 A;  1GN3 A;  1MMM A;  1EN5 A;  1AR5 A;  1XRE A;  1GN2 A;  4X9Q A;  2QKC A;  5A9G A;  1ZUQ A;  3TJT A;  1SZX A;  3MDS A;  1ZSP A;  1MA1 A;  1VAR A;  2ADP A;  2QKA A;  1IXB A;  1P7G A;  3DC6 A;  4YIO A;  1EN6 A;  1BS3 A;  1AP5 A;  3BFR A;  1N0N A;  3C3S A;  4F6E A;  3C3T A;  1ZLZ A;  1AVM A;  1MSD A;  1EN4 A;  3AK2 A;  4JYY A;  1I08 A;  1ZTE A;  1I0H A;  1IDS A;  1B06 A;  1WB7 A;  4C7U A;  1LUV A;  1XIL A;  1AR4 A;  1MNG A;  1QNM A;  3EVK A;  3AK1 A;  1XDC A;  4E4E A;  3QVN A;  3K9S A;  1LUW A;  1IX9 A;  1Y67 A;  1D5N A;  2GDS A;  2P4K A;  4GUN A;  2CDY A;  4JZG A;  1EM1 A;  4JZ2 A;  2CE4 A;  1PM9 A;  3CEI A;  2RCV A;  3KKY A;  1VEW A;  2AW9 A;  4FFK A;  1KKC A;  1PL4 A; 
#chains in the Genus database with same CATH topology
 1FKA O;  1NVP D;  1QU7 A;  3BY6 A;  5EC2 C;  1Q6H A;  2ILM A;  3A0B Z;  3E35 A;  4TOI A;  2K9P A;  4DV2 O;  2EIK B;  1AP6 A;  1Q5O A;  3BEH A;  5EIB D;  3SR2 C;  3FD9 A;  1PKX A;  4WBN A;  1NTK H;  3OGC C;  1E1Q G;  4JI2 B;  4B3S B;  3BPZ A;  3QG5 A;  1I94 O;  1BE3 H;  4R6Z A;  5CA1 A;  3APQ A;  2HLD G;  4WBN B;  1R73 A;  3FB8 C;  1V54 C;  4GKK B;  1XNR B;  3K58 A;  1N33 O;  1ZSP A;  2JK5 C;  4DV1 B;  4MS2 A;  4TQF A;  4YY3 B;  4JPR A;  3CMA V;  1WNS A;  5JJN B;  1ZX3 A;  4MTG A;  4WFB V;  1NR1 A;  4JI6 O;  3UT5 A;  4X62 O;  1AP5 A;  1HNW B;  2Z5U A;  3OMA B;  1NTZ H;  3K04 A;  1S5L Z;  3ZCC A;  1SQV H;  5LMU O;  2Q9L A;  2Y4U A;  3P3N A;  5C8Y A;  2WLH A;  1NI8 A;  5JH7 B;  4Z1M G;  5LA6 B;  1K33 A;  5EC1 C;  3RW0 A;  4RAI A;  4WCE V;  1BQZ A;  4JI7 B;  4LCU C;  2YIB D;  4WFF A;  1KMI Z;  3ZHT A;  2XAH A;  1H38 A;  3G6B A;  2E5L O;  2XUM A;  4DV4 O;  1WA8 B;  3UQ8 A;  1YJN V;  4X8A A;  3OM3 B;  3G71 V;  1OCC B;  3L70 H;  2WA3 A;  1M56 C;  3RT3 C;  2ZE5 A;  3STZ C;  4LBE C;  4F6R A;  5KX5 B;  3CC4 V;  4JV5 O;  4UVA A;  3DSQ A;  3RWR D;  2AHZ A;  3J81 N;  4WFH A;  2X6C A;  2DYS C;  3CWB H;  1BQ0 A;  2PI4 A;  4CZZ A;  4WFA V;  3W7X A;  3JAW B;  2QE7 G;  1JR9 A;  1V9P A;  3E8F A;  5DN6 G;  4DW0 A;  4F6R B;  2F4V B;  4NTX A;  1QLE C;  4I4T B;  4TUY B;  1AJQ A;  2FL4 A;  1EZV H;  3CS5 A;  2YI9 A;  2ZR2 A;  4B3R O;  1DTO A;  4ZBM A;  2OWO A;  2EIL C;  3CCJ V;  1IVS A;  3AG1 C;  1FXK B;  1EN5 A;  1XNQ B;  1GM8 A;  2D2C B;  4TV9 B;  1Q86 W;  4G28 B;  4RQE A;  2E76 B;  3RYC B;  4ZHQ B;  4X89 A;  5LHG A;  3JCU Z;  3CCR V;  4AIL C;  4DR2 B;  2MK3 A;  2VQF B;  1W0K G;  5KHK A;  1YSC A;  2P22 C;  3AK2 A;  3E86 A;  3OD4 A;  3CCV V;  1PV0 A;  3OGI B;  4O4I A;  1KU9 A;  3D36 C;  2DYR C;  4LH7 A;  2XOK G;  4GX5 A;  3BAA A;  2LP7 A;  4EFB A;  2MW2 B;  4E4E A;  2LW1 A;  4FLT A;  2O57 A;  3N27 A;  2Q0O C;  2KG7 B;  2KSD A;  1XI1 A;  1V54 B;  1Y6X A;  1SES A;  1VIB A;  5LOV A;  5LMN B;  1L0L H;  1K5S A;  3VBB A;  1Q3E A;  3JAR A;  4DRX B;  1EM1 A;  1XL6 A;  3H1I H;  5DED A;  3ZX6 A;  4FFK A;  2WLM A;  4UCT A;  2UXX A;  1ZL8 A;  5KMG B;  1Q7Y W;  3M7M X;  3RYH A;  3FB6 C;  5LOV B;  3K79 A;  3C90 A;  3D8C A;  2QM4 A;  5J2U B;  1YVW A;  3B8N A;  1YI2 V;  3HKC A;  1Y74 B;  1YZB A;  4DV0 O;  4U3J B;  1K73 W;  3KCX A;  1N0J A;  1ZL8 B;  2UXB B;  4DYL A;  1F4M A;  4RUE A;  1XNR O;  3CRM A;  4I0X A;  3JD1 A;  4BR6 A;  4DW1 A;  4EB6 B;  1VQM V;  1GN3 A;  3E22 A;  4OPA A;  4YY3 O;  4LFB O;  3W7T A;  1IUR A;  5BY1 A;  3JAL A;  1QVF U;  1X59 A;  1HNW O;  2XAQ A;  1VQ4 V;  2ADP A;  1L0N H;  1DLB A;  4X1K B;  1FFX A;  4GKJ B;  4FZ1 A;  4Q20 A;  3VQY A;  1FJG O;  3CJH A;  4LF4 O;  3OMI B;  4NXM B;  1YF2 A;  3T1H B;  1X4T A;  2ZE6 A;  4IT5 A;  2JDI G;  2IM9 A;  4FK5 C;  2PTM A;  5LP6 C;  1M57 C;  5CA3 A;  3B2E E;  5LXT B;  2JGD B;  2A9H A;  4C7U A;  3IC7 A;  5EK0 A;  5B1O A;  2M7W A;  3VQV A;  1VQ8 V;  3QVN A;  1N32 B;  3FAV B;  2ZD9 A;  4AQY B;  4IYH A;  1CP9 A;  2IJH A;  3WB1 A;  2X6B A;  5HFL A;  2OCH A;  2GDS A;  1CEZ A;  3CC7 V;  3RVZ A;  4DR4 B;  3H9V A;  4LFC B;  2XND G;  1MAB G;  1AI4 A;  3JYC A;  3I55 V;  4LNU A;  1AJN A;  4JTC B;  3D36 A;  1FS0 G;  3B40 A;  4PA7 A;  1VQ7 V;  4QPK A;  2R70 A;  2ZDI C;  2JGU A;  1NZ6 A;  2PYJ A;  4NR1 A;  1N36 B;  5LGT A;  1F23 A;  2YC0 A;  3SDL A;  2VS0 A;  4LNU B;  2LFS A;  3WG7 B;  2EJR A;  3G67 A;  1KD1 W;  5GON B;  4I50 A;  1XNQ O;  4PV1 B;  3RFR A;  2QKS A;  2NN4 A;  5B1A B;  1JNB A;  1M9N A;  2WLJ A;  2Q68 A;  1HWY A;  2X6A A;  1MOF A;  2IU3 A;  1N4C A;  4I50 B;  3QF7 A;  3K59 A;  3MDS A;  4N23 A;  3K5L A;  4I5S A;  4DR2 O;  2VQF O;  4J9Y B;  2YUA A;  3CPW U;  1VAR A;  4UCO A;  2HR3 A;  3ZMT A;  1HR0 O;  2UU9 B;  4YIO A;  5D5P A;  3ZRX A;  2EIM B;  2YDE A;  1K3E A;  3BFR A;  3JAS A;  1K7D A;  2IH1 C;  3ZN1 A;  1AI6 A;  3CX5 F;  2EIJ B;  3ASN C;  1ARO P;  4X65 O;  2QJ1 A;  3ZRV A;  3ABK C;  4O2A A;  4X20 A;  2DJV A;  4QPJ A;  4B7K A;  2OTL V;  4B08 A;  4PDL A;  4U3F H;  1N33 B;  2QA4 V;  1QR9 A;  2E74 B;  1T5E A;  3JAK A;  5BR8 O;  4JI6 B;  5HFM A;  2NR5 A;  5JVD A;  4X62 B;  5LP6 A;  5IJ0 B;  4CH5 A;  3HKD A;  3WB0 A;  1WAZ A;  2IJJ A;  3CEI A;  1TA8 A;  4MTF A;  3HKB A;  1GTO A;  1PL4 A;  4JI0 O;  5LMU B;  1B6Q A;  5B3S B;  4JAU A;  4JTD B;  3A0R A;  2Y48 A;  4JF3 A;  3BA9 A;  1JJO A;  2AXT Z;  4G2K A;  5EBL C;  2UXB O;  3BRC A;  4XDK A;  2XT9 A;  4PHZ A;  2YIB A;  3CC2 V;  1YJ9 V;  3IC9 A;  3F7Y C;  3T1Y B;  1JCH A;  1SZT A;  1VQL V;  3F5W C;  3BVO A;  3QO7 A;  3UO2 A;  2E5L B;  2XAG A;  1OCO B;  4JI5 O;  5AG2 A;  2N04 A;  4F4L A;  4QGP A;  2ZDI A;  2IU0 A;  4ZI7 B;  5CBH A;  4PA6 A;  3HPL C;  3TET A;  1D2D A;  4YJ3 A;  2BOB C;  3RYI A;  4FFB A;  4GKJ O;  2G38 A;  1SZX A;  3SPI A;  4J41 A;  2RQ6 A;  4LR3 A;  4P9P A;  4NXM O;  4JYC A;  3SPJ A;  2RN9 A;  3T1H O;  1Y66 A;  2EZO A;  3DXR B;  4KXR A;  2GUZ A;  4UB8 Z;  3JSL A;  4UCU A;  3C3S A;  2QEX V;  2JVD A;  1Z5V A;  1K4D C;  1IXM A;  3UO3 A;  4B3R B;  4FIP C;  2YXL A;  4AQY O;  1Q6U A;  5B1N A;  1WB7 A;  1OCC C;  2NLJ C;  2GUZ B;  2GTS A;  4J7Z A;  2Q7E A;  4DR4 O;  1VF5 B;  1QNM A;  1H2S B;  1G4Y B;  1G1X B;  1P7B A;  1VF6 C;  2QSA A;  2WAM A;  3P3P A;  2FB5 A;  1GKF A;  2A0L A;  4DR5 B;  5ITZ B;  4N21 A;  2HJD A;  4J42 A;  1RP3 B;  1AR1 B;  2F43 G;  1RM1 B;  1N36 O;  4IGG A;  4O4H B;  1O9G A;  2LW7 A;  4MT8 A;  4X1Y A;  2DW4 A;  2VQE B;  2ZNJ A;  1N34 O;  2GTA A;  2QM7 A;  3A0H Z;  4MSW C;  5L3F A;  2JJ2 G;  5J2T A;  3ABL C;  3K03 A;  1FXK C;  5DM6 V;  3ABK B;  4BIZ A;  3W7U A;  3VQW A;  3J80 N;  2P5O A;  1K92 A;  4EKW A;  1R6T A;  4OX9 B;  1QQC A;  3KG2 A;  1QVG U;  2JS5 A;  3SPG A;  2XTA A;  5K1P A;  3L74 H;  3KCY A;  2UU9 O;  1XQ8 A;  2UUB B;  3O9O A;  3TXQ A;  3TJT A;  3L71 H;  1DF4 A;  1PNM A;  3B77 A;  2ZE8 A;  4UXN A;  1ROP A;  3BHP A;  2BTQ B;  2LGQ A;  3BA8 A;  3JCZ A;  4DV0 B;  1XL4 A;  3ZHU A;  1VQN V;  3SPH A;  2IBZ H;  2CH7 B;  1AI5 A;  1TAE A;  2B9Z A;  5IY5 B;  1SQP H;  4NXN O;  2CTQ A;  5LYJ A;  1SET A;  4LFB B;  3H1J H;  5JH7 A;  3FB7 C;  1S0V A;  3U11 A;  5LA6 A;  2ZXW B;  4EEQ A;  4DUZ B;  2UXC O;  4TQD A;  1S72 V;  5JJJ B;  1NJI W;  1FJG B;  5LYJ B;  2CDY A;  4LF4 B;  4DV5 O;  1NU1 H;  3E2E A;  1WA8 A;  2N74 A;  2OCC B;  1COW G;  5LL6 Y;  4LF9 O;  4FLZ A;  5KX5 A;  3AG4 B;  1S76 D;  3AG3 C;  1VF6 A;  3OFN G;  1G8M A;  2N05 A;  3T1Y O;  3RGB A;  4I9W A;  4AI8 A;  3JAW A;  3W7S A;  4MVM A;  1DK1 A;  4IL6 Z;  4UCS A;  4LWS B;  1OCZ B;  1J5E B;  5E1A C;  4I4T A;  1B04 A;  3L75 H;  4DUY O;  4TUY A;  3MAQ A;  3BCC H;  3ZRW B;  4AHC A;  3QO5 A;  5BMV A;  3CRC A;  2QGN A;  2UXD O;  1NKD A;  3H01 A;  1AR5 A;  2EUL A;  1FXK A;  5CA0 B;  3B8M A;  4TV9 A;  4UV9 A;  4I9Q A;  3RYC A;  1J95 A;  4BWA A;  4ZHQ A;  4W4L A;  5BMV B;  4X1I A;  4PI0 A;  1VP7 A;  5LBQ A;  1FXV A;  3ABL B;  3VQX A;  2VWJ A;  4FPP A;  2WWW A;  1M93 A;  3K57 A;  2PI5 A;  2A79 B;  3CCQ V;  1LR1 A;  3U10 A;  3LDC A;  1B06 A;  1AIL A;  2R9R B;  1AR4 A;  4X1I B;  2Q73 A;  2P6J A;  2WLL B;  3SPC A;  4DR5 O;  3AK1 A;  4A5U B;  4GX0 A;  1OJH A;  2CUG A;  2PF4 E;  3W7W A;  1XHZ A;  4HNA A;  3H1K H;  2C2A A;  1HR0 B;  2LGW A;  2JEX A;  5BZB A;  1SF9 A;  2VQE O;  4KP4 A;  4RQF A;  2UUA B;  2KG7 A;  3WG7 C;  3SYC A;  3E8B A;  1PPJ H;  2YEV B;  3L9D A;  2BOC C;  3ZIA G;  4DRX A;  1KKC A;  2Q7G A;  4HNA B;  4X65 B;  4DR3 O;  4H13 B;  5B1A C;  4D7T A;  1HNX B;  5KMG A;  3H1H H;  1KKD A;  2QWN B;  3MD0 A;  2ETN A;  4OX9 O;  1BHA A;  5J2U A;  1JA8 A;  3DC5 A;  4JI4 O;  1D5A A;  4D6T H;  1Y74 A;  3LSU A;  2UUB O;  5BR8 B;  1KBH A;  4U3J A;  2R9I A;  3IAY A;  4NTW A;  2DOS A;  2EIM C;  2YID A;  5EYP A;  4X88 A;  4TWK A;  1Q6I A;  2JRI A;  5JQG B;  4EB6 A;  2F1M A;  4ABM A;  3M99 B;  2Z3Y A;  1W2B U;  3OTO O;  2EIJ C;  4JI0 B;  3ABT A;  4DV7 B;  1KP3 A;  3ZBH A;  2RMK B;  5EIB C;  1PNL A;  3ETE A;  4UB6 Z;  1TVK B;  4HBN A;  5EYP B;  1G6U A;  4FLV A;  3AG3 B;  4K35 A;  1Y76 B;  4DR1 B;  2YI8 A;  4X1K A;  3EFF K;  5FLX N;  1YTF B;  4FLX A;  2Q4P A;  2Y0P A;  2DWE C;  3CXH F;  3MHS C;  4MTO A;  2QTO A;  5B1B C;  1YDX A;  1YIT V;  1BMF G;  1L8D A;  4L8J A;  4JI5 B;  2EIN C;  1S3J A;  4CS2 A;  1MG1 A;  4CH4 A;  4DUZ O;  2PZS A;  4BIU A;  1BGY H;  3EVK A;  3P30 A;  5LXT A;  2JGD A;  4PA4 A;  1F7Y A;  1K9M W;  2B1G A;  2KQX A;  5B3S C;  3FAV A;  3CYO A;  4P2Z A;  2UUC B;  4B7E A;  4PI2 A;  3CD6 V;  1Q81 W;  4FVM A;  4YHH B;  4Q6G A;  3OAA G;  4JZG A;  3G4S V;  2XHB A;  4DR6 B;  1VQ5 V;  1WLE A;  4BW9 A;  2JS3 A;  4FLW A;  4W4K A;  2GHY A;  1ORQ C;  3H1L H;  2EZP A;  1IBK B;  1OCO C;  1U96 A;  2W6I G;  4GT1 A;  1J5E O;  4I55 B;  1JX9 A;  2WPD G;  2ARH A;  4B3M B;  2CTW A;  3DGE A;  3AK3 A;  3E8G A;  2PYL A;  2XAS A;  1IZ3 A;  3ZHR A;  5GON A;  1VQ9 V;  5EZY B;  1CPY A;  3ZMU A;  2ZIO A;  2OTJ V;  4TV8 B;  2L6L A;  1MMM A;  2D3O W;  1IBL B;  5C93 A;  5H9C A;  4GX2 A;  1N34 B;  1JOY A;  3APO A;  4FJC C;  1KUQ A;  4RUF A;  4J11 A;  3IGA C;  2P90 A;  2Q7H A;  1P7G A;  1OV9 A;  1YCI A;  1EBO A;  1FPO A;  3OEE G;  4DV6 B;  3CCM V;  1BS3 A;  5LGN A;  1TUB B;  2PGG A;  3NXS A;  2QWO B;  4F6E A;  4Z2W A;  4LF6 B;  2HEP A;  4ASU G;  1WPB A;  3X2Q C;  3CCE V;  4JYY A;  1I08 A;  1V55 C;  4B3T B;  5IJ9 A;  1LUV A;  4ZKI A;  4J7J A;  3SYP A;  1RM1 C;  4ZIB A;  3LDE A;  4MVR A;  1GM7 A;  3OR6 C;  3J7A U;  1H2M A;  2UUA O;  1JQ0 A;  3UCS C;  1XEQ A;  3JD3 A;  5IYZ B;  4LFA B;  5IJ9 B;  2BSK A;  1MSW D;  1N8R W;  1NS1 A;  3HR0 A;  4O4L B;  4UV8 A;  2A3Q A;  5LGU A;  1HNX O;  3G6E V;  3K06 A;  2ZQM A;  5L3B A;  4OPH A;  5IJ0 A;  1H2L A;  3WFV A;  5FNV B;  2F66 C;  2LQT A;  1SS3 A;  3K5N A;  5H6R A;  1E79 G;  5KAI Z;  1SA0 B;  5KUK A;  2BSK B;  3N2G A;  3HKE B;  4NXN B;  5B1B B;  2ADQ B;  4DO2 A;  4OGQ B;  4YJ2 B;  3JAM N;  2EIN B;  5GW7 A;  4IHJ B;  3TXS A;  2Q0A A;  5BXZ A;  1XOU A;  1SQQ H;  1S5H C;  2W0F C;  2QWR B;  2UXC B;  1YTF D;  2YSU B;  4E2L A;  4DV7 O;  5IT9 N;  1SQF A;  3GB7 C;  2IJI A;  3N2G B;  4YIP A;  3JD2 A;  4WFG A;  4DK1 A;  4DV5 B;  1NH2 D;  2CGO A;  4XBF A;  3S3X A;  4ZI7 A;  5TIS Z;  4LF9 B;  1S77 D;  4R8C A;  1TGO A;  3WB2 A;  5JCO C;  1GH6 A;  2YXY A;  2Y0I A;  4DR1 O;  5KUM A;  2CTR A;  4P30 A;  1BCC H;  3OEH G;  1K34 A;  2QR4 A;  5IY5 C;  4LP8 A;  3K5M A;  1MZE A;  1M5I A;  4K3A A;  2DN9 A;  3ABM B;  1EN6 A;  1JVM A;  2Q69 A;  5FPO A;  2RJZ A;  4PJ0 Z;  1N0N A;  3DXR A;  1PNK A;  1PP9 H;  2ZXW C;  3ZHQ A;  4NB5 A;  4DK0 A;  4DUY B;  4ICG A;  2XAF A;  4PA9 A;  5JWP A;  4G27 B;  3RYF B;  3ZHS A;  2UXD B;  4MVZ A;  3CCL V;  2UUC O;  2OCC C;  1P84 F;  2Q5Z A;  2ZIN A;  2JJ1 G;  4YHH O;  3AG2 B;  1I5X A;  2DWD C;  1RPO A;  2W0X A;  3AG4 C;  3E8H A;  4MVO A;  3BAB A;  1VMG A;  4DR6 O;  4Z1V A;  1R3I C;  1O9H A;  4I7Z B;  3T2M A;  1WP8 A;  2ZCE A;  1CXZ B;  2ZIM A;  4GUN A;  1SQX H;  1IBK O;  5CB4 B;  4UCV A;  1SQB H;  1R3K C;  2GSM B;  2HFE C;  2FYU H;  2CGN A;  5ITZ A;  3L73 H;  2AZ2 A;  3PJS K;  1S5J A;  2WLK A;  1OCZ C;  1FYJ A;  1IBM B;  4B3M O;  4O4H A;  3E89 A;  3TCU A;  3ABU A;  2YXH A;  1GMG A;  5KAF Z;  4PDM A;  3X2Q B;  5KHG A;  4KFM A;  2V1D A;  2AGA A;  2YIA A;  4UUJ C;  1RFY A;  2BE3 A;  1V55 B;  1FFT B;  3EHB B;  2UXN A;  4J80 A;  5DEC A;  4JTA B;  1Q8I A;  4DV3 B;  5B66 Z;  5CBF A;  2VRZ A;  2QTS A;  1DGS A;  2P7T C;  4FLY A;  4NTY A;  1IBL O;  2ZM6 O;  4MVQ A;  1HDJ A;  2NNU A;  1QLN A;  2QWP B;  4JI3 B;  1WN7 A;  1Z2G A;  1H8E G;  1LNQ A;  1EFR G;  4IIJ A;  1US6 A;  3UKM A;  4DV6 O;  3K0G A;  1FXH A;  3Q4H A;  3SJQ C;  3CRQ A;  4DR3 B;  1MA1 A;  3K08 A;  4LF6 O;  1NR7 A;  1U97 A;  1Z5W A;  4CC6 A;  3CRR A;  2HHH O;  2ITC C;  1NBM G;  3ZRS A;  5IE9 A;  4B3T O;  2XAJ A;  4IIJ B;  1Q90 D;  2BTQ A;  5F2V O;  4JI4 B;  2E75 B;  1ZLZ A;  1KP2 A;  3Q4H B;  1I7F A;  4QE7 A;  1H5W A;  1ZTE A;  1I0H A;  4H33 A;  4P9O A;  5JCO A;  2HKO A;  4LF7 O;  2CH7 A;  2F93 B;  5KHI A;  3SYA A;  4LFA O;  4MW3 A;  2LFR A;  3L72 H;  1K4C C;  4CS4 A;  1IX9 A;  1LUW A;  3OTO B;  2WLI B;  2IW5 A;  1JFF B;  2FTK A;  1OCR C;  2P4K A;  2OT5 A;  4JAA A;  2Q67 A;  2CK3 G;  2M6Y A;  1ZWI C;  4U7N A;  3I56 V;  4KHP O;  1FOU A;  4KL1 A;  5B5E Z;  4PA3 A;  2B5U A;  4UVC A;  3STL C;  1URF A;  4X66 B;  1SRY A;  3FYE B;  3D3I A;  4X64 O;  3GVM A;  3K0D A;  5GTI Z;  3VOU A;  1YIJ V;  2ZE7 A;  4YXW G;  1GN4 A;  4R50 A;  2JIZ G;  4WFE A;  5CA1 B;  3JAT A;  3FKS G;  4LWS A;  1GRJ A;  3M8A A;  2EBO A;  4NVP A;  3ZRW A;  3WU2 Z;  1XRE A;  1HW7 A;  2YS8 A;  4NKG B;  2OIG A;  4ZOL A;  3ASO B;  5A9G A;  5KLV H;  3JAT B;  3UT5 B;  5CA0 A;  1FD9 A;  1RSO A;  3ZS8 C;  2QM8 A;  2QDO A;  4ZOL B;  4JI8 O;  1R6K A;  1A32 A;  4NYK A;  5D5Q A;  5C8Y B;  4JAV A;  5J9P C;  3R66 A;  3U0Z A;  1M4U A;  3QO8 A;  3T4D A;  3QNE A;  1RSO B;  4GZR B;  2Y69 B;  3OW2 U;  1YJW V;  1XDC A;  4H0L B;  5IDJ A;  2WLL A;  2DQ0 A;  5CBG A;  4LF5 B;  2CAZ C;  5LHH A;  5LHI A;  1PL0 A;  3ZED A;  1IBM O;  1VF7 A;  3ETD A;  4O2B A;  4JYA B;  2HG5 C;  4JZ2 A;  1R3J C;  4J9Z B;  2CE4 A;  5IWA O;  3AEI A;  2HP8 A;  3OTF A;  3TK1 A;  2W6J G;  4JAS A;  3CCS V;  1HNZ B;  3GWK C;  2YEV A;  4PEL A;  1H2K A;  3ZMS A;  4K8X A;  1WPX A;  1KYO F;  2RDC A;  2H3O A;  4DV3 O;  4O2B B;  1GN6 A;  5KHJ A;  4L87 A;  4HAM A;  5FPR A;  2V4D A;  4LF8 B;  4EFE A;  4JI3 O;  4DXW A;  1NTM H;  4RWU A;  3ZHV A;  1W0J G;  3SYQ A;  1BL8 A;  3F7V C;  4BAY A;  1OCR B;  1DF5 A;  1M1K W;  1XMO B;  3HB3 B;  4OXS A;  3CSX A;  2X7R B;  4XDJ A;  4TT3 G;  1TUE B;  2EX3 A;  1ZUQ A;  4FMT A;  4QIW F;  2HVK C;  5JQG A;  1ZAU A;  3DTU B;  3F5T A;  2QKA A;  4LH6 A;  3MHH C;  3ZN0 A;  2AZ0 A;  2Q8V A;  1XMQ B;  4JI1 B;  5A2Q N;  4FZ0 A;  2HVJ C;  4GCZ A;  1TVK A;  2P4V A;  4O4I B;  4CH3 A;  5L3E A;  1Y76 A;  4QE9 A;  5JJE B;  1SQG A;  5EBM C;  1VQK V;  1KC8 W;  1WJZ A;  2JEU A;  3SGI A;  4GLX A;  1YXB A;  3A2F A;  1K8A W;  3NR7 A;  3CXC U;  3P32 A;  3ICX A;  5E79 Z;  2A06 H;  1AJP A;  2KB1 A;  3OE7 G;  3JAR B;  4UVB A;  3CB2 A;  4JI2 O;  1NH2 B;  1KEC A;  4B3S O;  5IYB O;  3OR7 C;  4UCR A;  4X66 O;  3ZMZ A;  3SJA C;  1PM9 A;  4U7O A;  4GKK O;  3RYH B;  2F95 B;  3LUT B;  1UJW B;  4FM0 A;  4DV1 O;  1XHX A;  1YHQ V;  1BT8 A;  2YIC A;  3HKC B;  2HJF C;  4PD4 F;  2LJ2 A;  1Q82 W;  1M56 B;  1WB8 A;  2BCC H;  3AG7 A;  3K3W A;  4I55 A;  4I0X B;  1JJ2 U;  3K9A A;  2L35 A;  4PDV A;  3E22 B;  2DMX A;  2DYS B;  1L1F A;  3N2K A;  4IYI A;  4K8Z A;  3PN1 A;  2AHY A;  4GX1 A;  3ABM C;  1WP7 A;  3B4S A;  2ZT9 B;  3B09 A;  1GO3 F;  3JAL B;  4CH6 A;  2E3C A;  4TSF G;  5EZY A;  4TV8 A;  3OUF A;  4JI7 O;  2QKC A;  1QLE B;  4K0K B;  3G80 A;  1W59 A;  3FYI B;  5K1X A;  3OMN B;  1FFX B;  3FX7 A;  2WSS G;  3N2K B;  3CJH B;  2EIL B;  4GYC B;  5IYC O;  4J7K A;  3AG1 B;  1AB3 A;  2RNB A;  2BTO A;  3AG2 C;  1KQS U;  4O4J A;  5L3D A;  3C3T A;  1HP8 A;  1AVM A;  1TUB A;  4KUM A;  2ATK C;  2A7W A;  2ZM6 B;  1QR8 A;  4LF5 O;  1XIL A;  1E1R G;  3IFX A;  1BZK A;  1Q43 A;  1R6N A;  2F4V O;  1UPG A;  4R7C A;  4O4J B;  3CHX A;  1Y67 A;  5GTH Z;  4JYA O;  5IYD O;  1D5N A;  2K1E A;  3D3Q A;  1B3Q A;  3FFQ A;  2F23 A;  2OYQ A;  1GAX A;  3T4Z A;  4MVS A;  2DYR B;  1MZF A;  2Q6A A;  2HHH B;  3SJB C;  1HNZ O;  2X0L A;  5IYZ A;  2ZKO A;  2CTP A;  2ITD C;  1AI7 A;  3JSN A;  2RCV A;  3ML0 A;  4DR7 B;  2V7Q G;  4CBC A;  4O4L A;  3LNM B;  3QTC A;  1K97 A;  2R9A A;  4LF8 O;  3FB5 C;  1ENV A;  1VQP V;  3CP1 A;  5FNV A;  4LF7 B;  1M90 W;  1P49 A;  1SC5 B;  1SA0 A;  3HKE A;  4YJ2 A;  1XMO O;  4IHJ A;  5H5N A;  3SJC C;  4DV2 B;  4HYO A;  3K5O A;  1UFI A;  4UFZ A;  1FAF A;  1NVP B;  4KHP B;  1P4R A;  4WF9 V;  4HZ3 A;  1OZ0 A;  1XMQ O;  4JI1 O;  4X9Q A;  1H2N A;  4FM2 A;  1F4N A;  4CC5 A;  1I94 B;  1BHB A;  4FLU A;  2GV9 A;  3JAS B;  4X64 B;  4RO2 A;  5LMN O;  3O65 A;  2ZR3 A;  3LSS A;  2Z0A A;  1R3L C;  2H8P C;  4QJF B;  3I5D A;  3ZJZ A;  1MSD A;  1EN4 A;  5EBW C;  2EJ7 A;  4O2A B;  5H6Q A;  2EIK C;  4X20 B;  4QNH B;  1IDS A;  2H94 A;  3CME V;  1SER A;  2PUS A;  1VQO V;  1MNG A;  3ZMV A;  1YEW A;  4PDR A;  1XBL A;  2B1I A;  4BW5 A;  3RYF A;  3S3W A;  1QBZ A;  1K5Q A;  3LSQ A;  3JAK B;  1SKV A;  1QCE A;  5JVD B;  5LP6 B;  5KA6 A;  1KB9 F;  1M57 B;  1RPR A;  3HKD B;  4FM1 A;  3KDR A;  3HKB B;  1QHT A;  3KZI Z;  4JI8 B;  2P67 A;  4DV4 B;  3KKY A;  5CB4 A;  1NT2 B;  3ETG A;  3JD0 A;  3OUS A;  3RBZ A;  1R1B A;  2OIE A;  4JV5 B;  2DQ3 A;  5CMU A;  1XUQ A;  3TGU H;  4JYB A;  1IJG A;  3CE2 A;  1BSM A;  1EZJ A;  3ASO C;  2FKX A;  4XDL A;  3OT7 A;  2GBO A;  2VWK A;  1JPX A;  4MW8 A;  4YJ3 B;  2KKW A;  4MVU A;  3RYI B;  4K0K O;  3RN4 A;  4JGS A;  3IJ4 A;  4FFB B;  5L3C A;  5KA5 A;  1H8H G;  1Y4M A;  1H2G A;  5IWA B;  4D7S A;  4BIO A;  1GN2 A;  1N32 O;  3A8T A;  2ODM A;  3UM7 A;  3JD4 A;  4H37 A;  2PY5 A;  3T1C A;  4CS3 A;  2R72 A;  3E83 A;  1IXB A;  3DC6 A;  2Y69 C;  1F51 A;  2WA4 A;  4LFC O;  1GM9 A;  4MTX A;  2ZNI A;  5H2F Z;  4H44 B;  2DE0 X;  1VQ6 V;  2WLN A;  2IH3 C;  3EXA A;  2IJK A;  5L3G A;  5CN0 A;  1JMK C;  3R65 A;  3ETQ A;  3K9S A;  3LNN A;  1PD3 A;  3CRA A;  1GK9 A;  3RVY A;  3SYO A;  5FL7 G;  3ASN B;  2P06 A;  2WLI A;  4LC1 A;  3THO A;  4DR7 O;  1JFF A;  3LDD A;  5KHH A;  1NQT A;  4X1Y B;  1I5Y A;  2QWQ B;  3CCU V;  3GWO A;  2LO1 A;  2Y4T A;  1VEW A;  2AW9 A;  5J2T B;  2FML A;  1THZ A;  4J10 A;  1OHH G; 
#chains in the Genus database with same CATH homology
 1BT8 A;  1GN6 A;  1JR9 A;  2ADQ B;  1XUQ A;  1AP6 A;  1WB8 A;  1BSM A;  1JA8 A;  3IC9 A;  3AK3 A;  3OT7 A;  3DC5 A;  1GN4 A;  1N0J A;  3LSU A;  5AG2 A;  3RN4 A;  4YIP A;  4BR6 A;  1GN3 A;  1MMM A;  1EN5 A;  1AR5 A;  1XRE A;  1GN2 A;  4X9Q A;  2QKC A;  5A9G A;  1ZUQ A;  3TJT A;  1SZX A;  3MDS A;  1ZSP A;  1MA1 A;  1VAR A;  2ADP A;  2QKA A;  1IXB A;  1P7G A;  3DC6 A;  4YIO A;  1EN6 A;  1BS3 A;  1AP5 A;  3BFR A;  1N0N A;  3C3S A;  4F6E A;  3C3T A;  1ZLZ A;  1AVM A;  1MSD A;  1EN4 A;  3AK2 A;  4JYY A;  1I08 A;  1ZTE A;  1I0H A;  1IDS A;  1B06 A;  1WB7 A;  4C7U A;  1LUV A;  1XIL A;  1AR4 A;  1MNG A;  1QNM A;  3EVK A;  3AK1 A;  1XDC A;  4E4E A;  3QVN A;  3K9S A;  1LUW A;  1IX9 A;  1Y67 A;  1D5N A;  2GDS A;  2P4K A;  4GUN A;  3KDR A;  2CDY A;  4JZG A;  1EM1 A;  4JZ2 A;  2CE4 A;  1PM9 A;  3CEI A;  2RCV A;  3KKY A;  1VEW A;  2AW9 A;  4FFK A;  1KKC A;  1PL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...