1XVBE

Soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvbE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvbE02
1FZIE 1XMHE 1XVFE 1MTYG 1XVEE 1XU3E 1FZ0E 1MHZG 1MMOG 1FZ2E 1FZ1E 1FZ6E 1FZ8E 1FZHE 1XVBE 1XMFE 1FZ7E 1FZ4E 1XVCE 1XU5E 4GAMC 1XMGE 1FZ3E 1XVGE 1MHYG 1FZ9E 1FZ5E 1FYZE 1XVDE
chains in the Genus database with same CATH superfamily
3HGLA 3CFPA 3C95A 4DU3A 1MTYG 1XVEE 3QNOA 1WAFA 2RKHA 2JH8A 3TL8B 4ADNA 2P1MB 1IH7A 3QEIA 3J2PA 4M3XA 3QESA 1FXXA 3TAGA 2VJ5A 3J27A 3UO3A 1FZ6E 2B7MA 2QXFA 4AKIA 1FZHE 4KHYA 1XMFE 3SI6A 5H37A 1FZ7E 4EPHA 3SUNA 4DU4A 1FZ4E 3SUQA 4IT5A 4FJXA 1XU5E 4QNDA 2E31A 1XMGE 4QNCA 1Q9XA 1LDKE 3RWUA 4HCCA 3HGKE 4FK4A 3SCXA 3NDKA 2P1PB 2OVPB 4X5NA 2MW2A 4KI6A 3RMCA 3LZJA 2VJ4A 3OGKB 3WSOA 5IBKB 1FZIE 1XVFE 4M3RA 4DTSA 1Q9YA 4KHQA 2FW3A 3C6NB 4DTOA 4FJ5A 2VIXA 2JPNA 3V7DB 4M3YA 2B1EA 4AI6A 4EP9A 1MHZG 3HL8A 1MMOG 3LDBA 2YB5A 1FZ2E 4KHUA 4FJ8A 1WAJA 3LZIA 4HCBA 2ATQA 4DTPA 4J2BA 4JRQA 3N1BA 4FK2A 4M42A 4DTJA 3L2OB 4E4BA 4RG8A 3K2OA 3SQ2A 3BVOA 3OGMB 3QERA 4B08A 3N1EA 4FJGA 4FJMA 4M3UA 3QEVA 3HP9A 4JS4A 4KHSA 2JHPA 4FJKA 4J2DA 3L1NA 2OZMA 3OGLB 2DTUA 4JRPA 4DU1A 2P5GA 2P1OB 4AKHA 2E32A 3RMDA 3SUPA 1XU3E 3CFOA 1FS1A 3QEWA 1FZ0E 1FPOA 2P1NB 4ADOA 3RMBA 2JH9A 3UO2A 3L8BA 3LDSA 4FVMA 4X5MA 3SQ4A 3SPZA 1FZ1E 3LD8A 3CQ8A 2OYQA 2DY4A 2RCUA 3QEXA 3TAFA 1FZ8E 4J2EA 1P22A 3RMAA 3E4WA 2PFVA 4M3ZA 1JW2A 3C6PB 3NE6A 4DTXA 2PFTA 2LF3A 4M45A 2H4TA 3CFRA 2JHAA 3SJJA 4KHWA 1XVCE 4DTNA 4FJ7A 4M3TA 1FZ3E 3MKSB 4I6JB 1MHYG 1CLQA 3UIQA 1FZ9E 1NEXB 2MMBA 4DTMA 2FYOA 3NAEA 2K5SA 2OVRB 1XVDE 4FJIA 3TAEA 2HD0A 4FJHA 2B8IA 1XMHE 2P5OA 4KI4A 4FJ9A 3NGIA 3SQ1A 4DTUA 3KD5E 4AKGA 4RNGA 4DTRA 4FK0A 4M3WA 3QETA 3NCIA 4KHNA 4ICGC 5IREA 3SVIA 3TJYA 3QEPA 4FJJA 3E4YA 1XL3C 2JHCA 3TABA 4I9QA 3C6OB 2JQTA 3NHGA 4J2AA 1XVBE 4JS5A 4M41A 1IG9A 3SPYA 4EYWA 2DEBA 2P1QB 5IZ7A 3SNNA 4GAMC 2OVQB 1XVGE 4RL5A 2LF6A 2OZSA 4FJNA 3QNNA 4E3SA 1FZ5E 3SUOA 3KD1E 1FYZE 1N1CA 3C94A 3S9HA 3SQ0A 3L0MA 4FJLA 4I9LA 2MZWB
chains in the Genus database with same CATH topology
3HGLA 3CFPA 3C95A 4DU3A 1MTYG 1XVEE 3QNOA 1WAFA 2JH8A 3TL8B 4ADNA 2P1MB 1IH7A 3QEIA 3J2PA 4M3XA 3QESA 1FXXA 3TAGA 2VJ5A 3J27A 1FZ6E 2B7MA 2QXFA 4AKIA 1FZHE 4KHYA 1XMFE 3SI6A 5H37A 1FZ7E 4EPHA 3SUNA 4DU4A 1FZ4E 3SUQA 4FJXA 1XU5E 4QNDA 2E31A 1XMGE 4QNCA 1Q9XA 1LDKE 3RWUA 4HCCA 3HGKE 4FK4A 3SCXA 3NDKA 2P1PB 2OVPB 4X5NA 4KI6A 3RMCA 3LZJA 2VJ4A 3OGKB 3WSOA 5IBKB 1FZIE 1XVFE 4M3RA 4DTSA 1Q9YA 4KHQA 2FW3A 3C6NB 4DTOA 4FJ5A 2VIXA 2JPNA 3V7DB 4M3YA 2B1EA 4AI6A 4EP9A 1MHZG 3HL8A 1MMOG 3LDBA 2YB5A 1FZ2E 4KHUA 4FJ8A 1WAJA 3LZIA 4HCBA 2ATQA 4DTPA 4J2BA 4JRQA 3N1BA 4FK2A 4M42A 4DTJA 3L2OB 4E4BA 4RG8A 3K2OA 3SQ2A 3OGMB 3QERA 4B08A 3N1EA 4FJGA 4FJMA 4M3UA 3QEVA 3HP9A 4JS4A 4KHSA 2JHPA 4FJKA 4J2DA 3L1NA 2OZMA 3OGLB 2DTUA 4JRPA 4DU1A 2P5GA 2P1OB 4AKHA 2E32A 3RMDA 3SUPA 1XU3E 3CFOA 1FS1A 3QEWA 1FZ0E 2P1NB 3RMBA 4ADOA 2JH9A 3L8BA 3LDSA 4FVMA 4X5MA 3SQ4A 3SPZA 1FZ1E 3LD8A 3CQ8A 2OYQA 2DY4A 2RCUA 3QEXA 3TAFA 1FZ8E 4J2EA 1P22A 3RMAA 3E4WA 2PFVA 4M3ZA 3C6PB 3NE6A 4DTXA 2PFTA 2LF3A 4M45A 2H4TA 3CFRA 2JHAA 3SJJA 4KHWA 1XVCE 4DTNA 4FJ7A 4M3TA 1FZ3E 3MKSB 4I6JB 1MHYG 1CLQA 3UIQA 1FZ9E 1NEXB 2MMBA 4DTMA 2FYOA 3NAEA 2OVRB 1XVDE 4FJIA 3TAEA 2HD0A 4FJHA 2B8IA 1XMHE 2P5OA 4KI4A 4FJ9A 3NGIA 3SQ1A 4DTUA 3KD5E 4AKGA 4RNGA 4DTRA 4FK0A 4M3WA 3QETA 3NCIA 4KHNA 5IREA 3SVIA 3TJYA 3QEPA 4FJJA 3E4YA 1XL3C 2JHCA 3TABA 4I9QA 3C6OB 3NHGA 4J2AA 1XVBE 4JS5A 4M41A 1IG9A 3SPYA 4EYWA 2DEBA 2P1QB 5IZ7A 3SNNA 4GAMC 2OVQB 1XVGE 4RL5A 2LF6A 2OZSA 4FJNA 3QNNA 4E3SA 1FZ5E 3SUOA 3KD1E 1FYZE 3C94A 3S9HA 3SQ0A 3L0MA 4FJLA 4I9LA 2MZWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZI E;  1XMH E;  1XVF E;  1MTY G;  1XVE E;  1XU3 E;  1FZ0 E;  1MHZ G;  1MMO G;  1FZ2 E;  1FZ1 E;  1FZ6 E;  1FZ8 E;  1FZH E;  1XVB E;  1XMF E;  1FZ7 E;  1FZ4 E;  1XVC E;  1XU5 E;  4GAM C;  1XMG E;  1FZ3 E;  1XVG E;  1MHY G;  1FZ9 E;  1FZ5 E;  1FYZ E;  1XVD E; 
#chains in the Genus database with same CATH topology
 3HGL A;  3CFP A;  3C95 A;  4DU3 A;  1MTY G;  1XVE E;  3QNO A;  1WAF A;  2RKH A;  2JH8 A;  3TL8 B;  4ADN A;  2P1M B;  1IH7 A;  3QEI A;  3J2P A;  4M3X A;  3QES A;  1FXX A;  3TAG A;  2VJ5 A;  3J27 A;  3UO3 A;  1FZ6 E;  2B7M A;  2QXF A;  4AKI A;  1FZH E;  4KHY A;  1XMF E;  3SI6 A;  5H37 A;  1FZ7 E;  4EPH A;  3SUN A;  4DU4 A;  1FZ4 E;  3SUQ A;  4IT5 A;  4FJX A;  1XU5 E;  4QND A;  2E31 A;  1XMG E;  4QNC A;  1Q9X A;  1LDK E;  3RWU A;  4HCC A;  3HGK E;  4FK4 A;  3SCX A;  3NDK A;  2P1P B;  2OVP B;  4X5N A;  2MW2 A;  4KI6 A;  3RMC A;  3LZJ A;  2VJ4 A;  3OGK B;  3WSO A;  5IBK B;  1FZI E;  1XVF E;  4M3R A;  4DTS A;  1Q9Y A;  4KHQ A;  2FW3 A;  3C6N B;  4DTO A;  4FJ5 A;  2VIX A;  2JPN A;  3V7D B;  4M3Y A;  2B1E A;  4AI6 A;  4EP9 A;  1MHZ G;  3HL8 A;  1MMO G;  3LDB A;  2YB5 A;  1FZ2 E;  4KHU A;  4FJ8 A;  1WAJ A;  3LZI A;  4HCB A;  2ATQ A;  4DTP A;  4J2B A;  4JRQ A;  3N1B A;  4FK2 A;  4M42 A;  4DTJ A;  3L2O B;  4E4B A;  4RG8 A;  3K2O A;  3SQ2 A;  3BVO A;  3OGM B;  3QER A;  4B08 A;  3N1E A;  4FJG A;  4FJM A;  4M3U A;  3QEV A;  3HP9 A;  4JS4 A;  4KHS A;  2JHP A;  4FJK A;  4J2D A;  3L1N A;  2OZM A;  3OGL B;  2DTU A;  4JRP A;  4DU1 A;  2P5G A;  2P1O B;  4AKH A;  2E32 A;  3RMD A;  3SUP A;  1XU3 E;  3CFO A;  1FS1 A;  3QEW A;  1FZ0 E;  1FPO A;  2P1N B;  4ADO A;  3RMB A;  2JH9 A;  3UO2 A;  3L8B A;  3LDS A;  4FVM A;  4X5M A;  3SQ4 A;  3SPZ A;  1FZ1 E;  3LD8 A;  3CQ8 A;  2OYQ A;  2DY4 A;  2RCU A;  3QEX A;  3TAF A;  1FZ8 E;  4J2E A;  1P22 A;  3RMA A;  3E4W A;  2PFV A;  4M3Z A;  1JW2 A;  3C6P B;  3NE6 A;  4DTX A;  2PFT A;  2LF3 A;  4M45 A;  2H4T A;  3CFR A;  2JHA A;  3SJJ A;  4KHW A;  1XVC E;  4DTN A;  4FJ7 A;  4M3T A;  1FZ3 E;  3MKS B;  4I6J B;  1MHY G;  1CLQ A;  3UIQ A;  1FZ9 E;  1NEX B;  2MMB A;  4DTM A;  2FYO A;  3NAE A;  2K5S A;  2OVR B;  1XVD E;  4FJI A;  3TAE A;  2HD0 A;  4FJH A;  2B8I A;  1XMH E;  2P5O A;  4KI4 A;  4FJ9 A;  3NGI A;  3SQ1 A;  4DTU A;  3KD5 E;  4AKG A;  4RNG A;  4DTR A;  4FK0 A;  4M3W A;  3QET A;  3NCI A;  4KHN A;  4ICG C;  5IRE A;  3SVI A;  3TJY A;  3QEP A;  4FJJ A;  3E4Y A;  1XL3 C;  2JHC A;  3TAB A;  4I9Q A;  3C6O B;  2JQT A;  3NHG A;  4J2A A;  1XVB E;  4JS5 A;  4M41 A;  1IG9 A;  3SPY A;  4EYW A;  2DEB A;  2P1Q B;  5IZ7 A;  3SNN A;  4GAM C;  2OVQ B;  1XVG E;  4RL5 A;  2LF6 A;  2OZS A;  4FJN A;  3QNN A;  4E3S A;  1FZ5 E;  3SUO A;  3KD1 E;  1FYZ E;  1N1C A;  3C94 A;  3S9H A;  3SQ0 A;  3L0M A;  4FJL A;  4I9L A;  2MZW B; 
#chains in the Genus database with same CATH homology
 3HGL A;  3CFP A;  3C95 A;  4DU3 A;  1MTY G;  1XVE E;  3QNO A;  1WAF A;  2JH8 A;  3TL8 B;  4ADN A;  2P1M B;  1IH7 A;  3QEI A;  3J2P A;  4M3X A;  3QES A;  1FXX A;  3TAG A;  2VJ5 A;  3J27 A;  1FZ6 E;  2B7M A;  2QXF A;  4AKI A;  1FZH E;  4KHY A;  1XMF E;  3SI6 A;  5H37 A;  1FZ7 E;  4EPH A;  3SUN A;  4DU4 A;  1FZ4 E;  3SUQ A;  4FJX A;  1XU5 E;  4QND A;  2E31 A;  1XMG E;  4QNC A;  1Q9X A;  1LDK E;  3RWU A;  4HCC A;  3HGK E;  4FK4 A;  3SCX A;  3NDK A;  2P1P B;  2OVP B;  4X5N A;  4KI6 A;  3RMC A;  3LZJ A;  2VJ4 A;  3OGK B;  3WSO A;  5IBK B;  1FZI E;  1XVF E;  4M3R A;  4DTS A;  1Q9Y A;  4KHQ A;  2FW3 A;  3C6N B;  4DTO A;  4FJ5 A;  2VIX A;  2JPN A;  3V7D B;  4M3Y A;  2B1E A;  4AI6 A;  4EP9 A;  1MHZ G;  3HL8 A;  1MMO G;  3LDB A;  2YB5 A;  1FZ2 E;  4KHU A;  4FJ8 A;  1WAJ A;  3LZI A;  4HCB A;  2ATQ A;  4DTP A;  4J2B A;  4JRQ A;  3N1B A;  4FK2 A;  4M42 A;  4DTJ A;  3L2O B;  4E4B A;  4RG8 A;  3K2O A;  3SQ2 A;  3OGM B;  3QER A;  4B08 A;  3N1E A;  4FJG A;  4FJM A;  4M3U A;  3QEV A;  3HP9 A;  4JS4 A;  4KHS A;  2JHP A;  4FJK A;  4J2D A;  3L1N A;  2OZM A;  3OGL B;  2DTU A;  4JRP A;  4DU1 A;  2P5G A;  2P1O B;  4AKH A;  2E32 A;  3RMD A;  3SUP A;  1XU3 E;  3CFO A;  1FS1 A;  3QEW A;  1FZ0 E;  2P1N B;  3RMB A;  4ADO A;  2JH9 A;  3L8B A;  3LDS A;  4FVM A;  4X5M A;  3SQ4 A;  3SPZ A;  1FZ1 E;  3LD8 A;  3CQ8 A;  2OYQ A;  2DY4 A;  2RCU A;  3QEX A;  3TAF A;  1FZ8 E;  4J2E A;  1P22 A;  3RMA A;  3E4W A;  2PFV A;  4M3Z A;  3C6P B;  3NE6 A;  4DTX A;  2PFT A;  2LF3 A;  4M45 A;  2H4T A;  3CFR A;  2JHA A;  3SJJ A;  4KHW A;  1XVC E;  4DTN A;  4FJ7 A;  4M3T A;  1FZ3 E;  3MKS B;  4I6J B;  1MHY G;  1CLQ A;  3UIQ A;  1FZ9 E;  1NEX B;  2MMB A;  4DTM A;  2FYO A;  3NAE A;  2OVR B;  1XVD E;  4FJI A;  3TAE A;  2HD0 A;  4FJH A;  2B8I A;  1XMH E;  2P5O A;  4KI4 A;  4FJ9 A;  3NGI A;  3SQ1 A;  4DTU A;  3KD5 E;  4AKG A;  4RNG A;  4DTR A;  4FK0 A;  4M3W A;  3QET A;  3NCI A;  4KHN A;  5IRE A;  3SVI A;  3TJY A;  3QEP A;  4FJJ A;  3E4Y A;  1XL3 C;  2JHC A;  3TAB A;  4I9Q A;  3C6O B;  3NHG A;  4J2A A;  1XVB E;  4JS5 A;  4M41 A;  1IG9 A;  3SPY A;  4EYW A;  2DEB A;  2P1Q B;  5IZ7 A;  3SNN A;  4GAM C;  2OVQ B;  1XVG E;  4RL5 A;  2LF6 A;  2OZS A;  4FJN A;  3QNN A;  4E3S A;  1FZ5 E;  3SUO A;  3KD1 E;  1FYZ E;  3C94 A;  3S9H A;  3SQ0 A;  3L0M A;  4FJL A;  4I9L A;  2MZW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...