1XVBE

Soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvbE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvbE02
1FZ2E 1FZ4E 1FZ7E 1XU3E 1MHZG 4GAMC 1FZ1E 1FZ0E 1FZ5E 1XVEE 1XVCE 1FZ9E 1FZ3E 1MHYG 1MTYG 1XVBE 1FZ8E 1FZIE 1XVGE 1XVFE 1XVDE 1XMFE 1MMOG 1XU5E 1FZHE 1FZ6E 1FYZE 1XMHE 1XMGE
chains in the Genus database with same CATH superfamily
2P1OB 3MKSB 3QESA 4AKIA 4RNGA 4EPHA 5H37A 4GAMC 2P1PB 4J2BA 4KI6A 4IT5A 2MZWB 3QEWA 4FJHA 1JW2A 2VJ4A 2P1QB 3SUOA 4KHQA 4ADOA 4JRQA 3K2OA 2JPNA 3KD5E 1FZ3E 4EP9A 4E4BA 4FJIA 3QNOA 2E31A 1MTYG 3S9HA 2OZSA 3E4YA 5IZ7A 4DU3A 2P1MB 4DTUA 4I9LA 4FJGA 4FJ8A 4M3XA 1XVGE 1XVFE 2ATQA 3RMCA 1XVDE 2E32A 1Q9YA 3SUPA 4JRPA 4KHYA 4FK2A 2P5GA 3LZJA 4DTMA 3QETA 4M3TA 1CLQA 3HGKE 1P22A 1XMHE 1XMGE 2OVQB 4JS5A 3SJJA 3LD8A 3SCXA 4FJ5A 3HP9A 3J27A 4M41A 1FZ4E 2P1NB 4I6JB 1XU3E 3OGKB 3OGLB 4DU4A 3SNNA 2PFTA 3QEPA 3HL8A 1FZ0E 4KHNA 4DTXA 1FZ9E 2QXFA 3SUNA 4KI4A 2FYOA 2LF6A 3UO2A 4HCBA 2DEBA 1Q9XA 4DTPA 4QNDA 1FZ8E 4AKHA 2FW3A 4FJ9A 2P5OA 4M3UA 3SQ2A 2LF3A 1WAJA 3UO3A 1NEXB 3NCIA 3CFOA 1FPOA 1XMFE 1FXXA 2MMBA 1MMOG 2H4TA 2PFVA 2OZMA 3CFPA 1LDKE 4DTOA 3RMAA 1FZ6E 4RG8A 3L0MA 1FYZE 3C6OB 1FZ2E 3NAEA 4FK4A 4DTRA 3C6NB 4RL5A 4KHUA 1MHZG 3NGIA 4E3SA 1FZ1E 4B08A 1FZ5E 4FJ7A 1XVEE 3SQ0A 2JHPA 1XVCE 2MW2A 1IG9A 4QNCA 4FJMA 4X5NA 4KHSA 3SPYA 4M3ZA 4X5MA 3TL8B 4M3YA 1XVBE 3E4WA 4FJNA 3TAEA 3WSOA 4FJKA 2RKHA 3RMDA 1WAFA 2B1EA 3L2OB 3LZIA 2YB5A 4FJLA 3HGLA 2OVRB 2JH8A 3N1EA 4FVMA 3TJYA 3NDKA 3TAGA 3SVIA 2OYQA 3C94A 2JQTA 4J2DA 2RCUA 4M42A 1FZHE 1N1CA 3UIQA 4J2EA 2VJ5A 4DTJA 3L1NA 4M3RA 3TAFA 3NHGA 1FZ7E 1IH7A 3QEVA 3LDSA 2B8IA 4I9QA 2DTUA 4AI6A 4J2AA 3CQ8A 4M45A 2JHAA 5IBKB 3N1BA 3SUQA 3BVOA 4KHWA 3L8BA 1MHYG 1XL3C 3C95A 3NE6A 4DTNA 3SI6A 1FZIE 5IREA 4HCCA 4EYWA 4AKGA 4ADNA 4ICGC 2JH9A 3QNNA 3CFRA 3SPZA 3KD1E 4FJJA 2K5SA 3RWUA 2HD0A 3V7DB 3OGMB 2B7MA 2VIXA 3LDBA 3SQ4A 4FJXA 1XU5E 2OVPB 3C6PB 3QEXA 4M3WA 2JHCA 2DY4A 1FS1A 3J2PA 4JS4A 3QERA 4DU1A 3RMBA 4FK0A 3QEIA 4DTSA 3TABA 3SQ1A
chains in the Genus database with same CATH topology
2P1OB 3MKSB 3QESA 4AKIA 4RNGA 4EPHA 5H37A 4GAMC 2P1PB 4J2BA 4KI6A 2MZWB 3QEWA 4FJHA 2VJ4A 2P1QB 3SUOA 4KHQA 4ADOA 4JRQA 3K2OA 2JPNA 3KD5E 1FZ3E 4EP9A 4E4BA 4FJIA 3QNOA 2E31A 1MTYG 3S9HA 2OZSA 3E4YA 5IZ7A 4DU3A 2P1MB 4DTUA 4I9LA 4FJGA 4FJ8A 4M3XA 1XVGE 1XVFE 2ATQA 3RMCA 1XVDE 2E32A 1Q9YA 3SUPA 4JRPA 4KHYA 4FK2A 2P5GA 3LZJA 4DTMA 3QETA 4M3TA 1CLQA 3HGKE 1P22A 1XMHE 1XMGE 2OVQB 4JS5A 3SJJA 3LD8A 3SCXA 4FJ5A 3HP9A 3J27A 4M41A 1FZ4E 2P1NB 4I6JB 1XU3E 3OGKB 3OGLB 4DU4A 3SNNA 2PFTA 3QEPA 3HL8A 1FZ0E 4KHNA 4DTXA 1FZ9E 2QXFA 3SUNA 4KI4A 2FYOA 2LF6A 4HCBA 2DEBA 1Q9XA 4DTPA 4QNDA 1FZ8E 4AKHA 2FW3A 4FJ9A 2P5OA 4M3UA 3SQ2A 2LF3A 1WAJA 1NEXB 3NCIA 3CFOA 1XMFE 1FXXA 2MMBA 1MMOG 2H4TA 2PFVA 2OZMA 3CFPA 1LDKE 4DTOA 3RMAA 1FZ6E 4RG8A 3L0MA 1FYZE 3C6OB 1FZ2E 3NAEA 4FK4A 4DTRA 3C6NB 4RL5A 4KHUA 1MHZG 3NGIA 4E3SA 1FZ1E 4B08A 1FZ5E 4FJ7A 1XVEE 3SQ0A 2JHPA 1XVCE 1IG9A 4QNCA 4FJMA 4X5NA 4KHSA 3SPYA 4M3ZA 4X5MA 3TL8B 4M3YA 1XVBE 3E4WA 4FJNA 3TAEA 3WSOA 4FJKA 3RMDA 1WAFA 2B1EA 3L2OB 3LZIA 2YB5A 4FJLA 3HGLA 2OVRB 2JH8A 3N1EA 4FVMA 3TJYA 3NDKA 3TAGA 3SVIA 2OYQA 3C94A 4J2DA 4M42A 2RCUA 1FZHE 3UIQA 4J2EA 2VJ5A 4DTJA 3L1NA 4M3RA 3TAFA 3NHGA 1FZ7E 1IH7A 3QEVA 3LDSA 2B8IA 4I9QA 2DTUA 4AI6A 4J2AA 3CQ8A 4M45A 2JHAA 5IBKB 3N1BA 3SUQA 4KHWA 3L8BA 1MHYG 1XL3C 3C95A 3NE6A 4DTNA 3SI6A 1FZIE 5IREA 4HCCA 4EYWA 4AKGA 4ADNA 2JH9A 3QNNA 3CFRA 3SPZA 3KD1E 4FJJA 3RWUA 2HD0A 3V7DB 3OGMB 2B7MA 2VIXA 3LDBA 3SQ4A 4FJXA 1XU5E 2OVPB 3C6PB 3QEXA 4M3WA 2JHCA 2DY4A 1FS1A 3J2PA 4JS4A 3QERA 4DU1A 3RMBA 4FK0A 3QEIA 4DTSA 3TABA 3SQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ2 E;  1FZ4 E;  1FZ7 E;  1XU3 E;  1MHZ G;  4GAM C;  1FZ1 E;  1FZ0 E;  1FZ5 E;  1XVE E;  1XVC E;  1FZ9 E;  1FZ3 E;  1MHY G;  1MTY G;  1XVB E;  1FZ8 E;  1FZI E;  1XVG E;  1XVF E;  1XVD E;  1XMF E;  1MMO G;  1XU5 E;  1FZH E;  1FZ6 E;  1FYZ E;  1XMH E;  1XMG E; 
#chains in the Genus database with same CATH topology
 2P1O B;  3MKS B;  3QES A;  4AKI A;  4RNG A;  4EPH A;  5H37 A;  4GAM C;  2P1P B;  4J2B A;  4KI6 A;  4IT5 A;  2MZW B;  3QEW A;  4FJH A;  1JW2 A;  2VJ4 A;  2P1Q B;  3SUO A;  4KHQ A;  4ADO A;  4JRQ A;  3K2O A;  2JPN A;  3KD5 E;  1FZ3 E;  4EP9 A;  4E4B A;  4FJI A;  3QNO A;  2E31 A;  1MTY G;  3S9H A;  2OZS A;  3E4Y A;  5IZ7 A;  4DU3 A;  2P1M B;  4DTU A;  4I9L A;  4FJG A;  4FJ8 A;  4M3X A;  1XVG E;  1XVF E;  2ATQ A;  3RMC A;  1XVD E;  2E32 A;  1Q9Y A;  3SUP A;  4JRP A;  4KHY A;  4FK2 A;  2P5G A;  3LZJ A;  4DTM A;  3QET A;  4M3T A;  1CLQ A;  3HGK E;  1P22 A;  1XMH E;  1XMG E;  2OVQ B;  4JS5 A;  3SJJ A;  3LD8 A;  3SCX A;  4FJ5 A;  3HP9 A;  3J27 A;  4M41 A;  1FZ4 E;  2P1N B;  4I6J B;  1XU3 E;  3OGK B;  3OGL B;  4DU4 A;  3SNN A;  2PFT A;  3QEP A;  3HL8 A;  1FZ0 E;  4KHN A;  4DTX A;  1FZ9 E;  2QXF A;  3SUN A;  4KI4 A;  2FYO A;  2LF6 A;  3UO2 A;  4HCB A;  2DEB A;  1Q9X A;  4DTP A;  4QND A;  1FZ8 E;  4AKH A;  2FW3 A;  4FJ9 A;  2P5O A;  4M3U A;  3SQ2 A;  2LF3 A;  1WAJ A;  3UO3 A;  1NEX B;  3NCI A;  3CFO A;  1FPO A;  1XMF E;  1FXX A;  2MMB A;  1MMO G;  2H4T A;  2PFV A;  2OZM A;  3CFP A;  1LDK E;  4DTO A;  3RMA A;  1FZ6 E;  4RG8 A;  3L0M A;  1FYZ E;  3C6O B;  1FZ2 E;  3NAE A;  4FK4 A;  4DTR A;  3C6N B;  4RL5 A;  4KHU A;  1MHZ G;  3NGI A;  4E3S A;  1FZ1 E;  4B08 A;  1FZ5 E;  4FJ7 A;  1XVE E;  3SQ0 A;  2JHP A;  1XVC E;  2MW2 A;  1IG9 A;  4QNC A;  4FJM A;  4X5N A;  4KHS A;  3SPY A;  4M3Z A;  4X5M A;  3TL8 B;  4M3Y A;  1XVB E;  3E4W A;  4FJN A;  3TAE A;  3WSO A;  4FJK A;  2RKH A;  3RMD A;  1WAF A;  2B1E A;  3L2O B;  3LZI A;  2YB5 A;  4FJL A;  3HGL A;  2OVR B;  2JH8 A;  3N1E A;  4FVM A;  3TJY A;  3NDK A;  3TAG A;  3SVI A;  2OYQ A;  3C94 A;  2JQT A;  4J2D A;  2RCU A;  4M42 A;  1FZH E;  1N1C A;  3UIQ A;  4J2E A;  2VJ5 A;  4DTJ A;  3L1N A;  4M3R A;  3TAF A;  3NHG A;  1FZ7 E;  1IH7 A;  3QEV A;  3LDS A;  2B8I A;  4I9Q A;  2DTU A;  4AI6 A;  4J2A A;  3CQ8 A;  4M45 A;  2JHA A;  5IBK B;  3N1B A;  3SUQ A;  3BVO A;  4KHW A;  3L8B A;  1MHY G;  1XL3 C;  3C95 A;  3NE6 A;  4DTN A;  3SI6 A;  1FZI E;  5IRE A;  4HCC A;  4EYW A;  4AKG A;  4ADN A;  4ICG C;  2JH9 A;  3QNN A;  3CFR A;  3SPZ A;  3KD1 E;  4FJJ A;  2K5S A;  3RWU A;  2HD0 A;  3V7D B;  3OGM B;  2B7M A;  2VIX A;  3LDB A;  3SQ4 A;  4FJX A;  1XU5 E;  2OVP B;  3C6P B;  3QEX A;  4M3W A;  2JHC A;  2DY4 A;  1FS1 A;  3J2P A;  4JS4 A;  3QER A;  4DU1 A;  3RMB A;  4FK0 A;  3QEI A;  4DTS A;  3TAB A;  3SQ1 A; 
#chains in the Genus database with same CATH homology
 2P1O B;  3MKS B;  3QES A;  4AKI A;  4RNG A;  4EPH A;  5H37 A;  4GAM C;  2P1P B;  4J2B A;  4KI6 A;  2MZW B;  3QEW A;  4FJH A;  2VJ4 A;  2P1Q B;  3SUO A;  4KHQ A;  4ADO A;  4JRQ A;  3K2O A;  2JPN A;  3KD5 E;  1FZ3 E;  4EP9 A;  4E4B A;  4FJI A;  3QNO A;  2E31 A;  1MTY G;  3S9H A;  2OZS A;  3E4Y A;  5IZ7 A;  4DU3 A;  2P1M B;  4DTU A;  4I9L A;  4FJG A;  4FJ8 A;  4M3X A;  1XVG E;  1XVF E;  2ATQ A;  3RMC A;  1XVD E;  2E32 A;  1Q9Y A;  3SUP A;  4JRP A;  4KHY A;  4FK2 A;  2P5G A;  3LZJ A;  4DTM A;  3QET A;  4M3T A;  1CLQ A;  3HGK E;  1P22 A;  1XMH E;  1XMG E;  2OVQ B;  4JS5 A;  3SJJ A;  3LD8 A;  3SCX A;  4FJ5 A;  3HP9 A;  3J27 A;  4M41 A;  1FZ4 E;  2P1N B;  4I6J B;  1XU3 E;  3OGK B;  3OGL B;  4DU4 A;  3SNN A;  2PFT A;  3QEP A;  3HL8 A;  1FZ0 E;  4KHN A;  4DTX A;  1FZ9 E;  2QXF A;  3SUN A;  4KI4 A;  2FYO A;  2LF6 A;  4HCB A;  2DEB A;  1Q9X A;  4DTP A;  4QND A;  1FZ8 E;  4AKH A;  2FW3 A;  4FJ9 A;  2P5O A;  4M3U A;  3SQ2 A;  2LF3 A;  1WAJ A;  1NEX B;  3NCI A;  3CFO A;  1XMF E;  1FXX A;  2MMB A;  1MMO G;  2H4T A;  2PFV A;  2OZM A;  3CFP A;  1LDK E;  4DTO A;  3RMA A;  1FZ6 E;  4RG8 A;  3L0M A;  1FYZ E;  3C6O B;  1FZ2 E;  3NAE A;  4FK4 A;  4DTR A;  3C6N B;  4RL5 A;  4KHU A;  1MHZ G;  3NGI A;  4E3S A;  1FZ1 E;  4B08 A;  1FZ5 E;  4FJ7 A;  1XVE E;  3SQ0 A;  2JHP A;  1XVC E;  1IG9 A;  4QNC A;  4FJM A;  4X5N A;  4KHS A;  3SPY A;  4M3Z A;  4X5M A;  3TL8 B;  4M3Y A;  1XVB E;  3E4W A;  4FJN A;  3TAE A;  3WSO A;  4FJK A;  3RMD A;  1WAF A;  2B1E A;  3L2O B;  3LZI A;  2YB5 A;  4FJL A;  3HGL A;  2OVR B;  2JH8 A;  3N1E A;  4FVM A;  3TJY A;  3NDK A;  3TAG A;  3SVI A;  2OYQ A;  3C94 A;  4J2D A;  4M42 A;  2RCU A;  1FZH E;  3UIQ A;  4J2E A;  2VJ5 A;  4DTJ A;  3L1N A;  4M3R A;  3TAF A;  3NHG A;  1FZ7 E;  1IH7 A;  3QEV A;  3LDS A;  2B8I A;  4I9Q A;  2DTU A;  4AI6 A;  4J2A A;  3CQ8 A;  4M45 A;  2JHA A;  5IBK B;  3N1B A;  3SUQ A;  4KHW A;  3L8B A;  1MHY G;  1XL3 C;  3C95 A;  3NE6 A;  4DTN A;  3SI6 A;  1FZI E;  5IRE A;  4HCC A;  4EYW A;  4AKG A;  4ADN A;  2JH9 A;  3QNN A;  3CFR A;  3SPZ A;  3KD1 E;  4FJJ A;  3RWU A;  2HD0 A;  3V7D B;  3OGM B;  2B7M A;  2VIX A;  3LDB A;  3SQ4 A;  4FJX A;  1XU5 E;  2OVP B;  3C6P B;  3QEX A;  4M3W A;  2JHC A;  2DY4 A;  1FS1 A;  3J2P A;  4JS4 A;  3QER A;  4DU1 A;  3RMB A;  4FK0 A;  3QEI A;  4DTS A;  3TAB A;  3SQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...