1XVDE

Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvdE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvdE02
1MHZG 1XVDE 1XVBE 1XMHE 1FZ5E 1FZ0E 1XVEE 1FZ8E 1XMFE 1MTYG 1XU5E 1FZ2E 1XVGE 1FZIE 1XVFE 1FZ4E 1FZ7E 1MHYG 1XU3E 1MMOG 1FZHE 1XMGE 1FZ3E 1FZ6E 1FZ9E 4GAMC 1FYZE 1XVCE 1FZ1E
chains in the Genus database with same CATH superfamily
1MHZG 5IREA 1XVDE 1XVBE 1N1CA 4DU1A 4J2AA 3TAFA 4FJ8A 4KHQA 2LF6A 3QNOA 1FZ0E 4EP9A 3RMAA 3OGMB 2PFTA 3QEIA 3LZJA 1FZ8E 2E31A 5IZ7A 4FJ7A 3BVOA 3CFOA 1MTYG 4EYWA 2ATQA 1WAFA 3LDSA 2P5OA 3SNNA 2RKHA 4FJ9A 3HGKE 1FZ2E 3NE6A 2MW2A 2HD0A 3SQ2A 1P22A 3L2OB 1FZ7E 4QNCA 3L0MA 4QNDA 2JHCA 3TAGA 1FZHE 1FZ6E 4M3XA 4M45A 3NGIA 4DTUA 3N1BA 3J2PA 4FJMA 2MMBA 4X5MA 3SI6A 4J2BA 3HP9A 1FXXA 3UO3A 2LF3A 2PFVA 4I6JB 3SUOA 4FK4A 3KD1E 1FZ5E 4J2EA 4JS5A 1XVEE 2B1EA 4FJGA 4AI6A 3NHGA 4DTOA 3SJJA 4HCCA 4KHSA 1FPOA 2FYOA 4DTNA 2OVQB 3QEPA 4IT5A 3SPYA 3RMCA 3TL8B 2B7MA 4JRQA 1FZIE 2JH9A 3NAEA 5H37A 4J2DA 2OVPB 2OVRB 4DTJA 1FS1A 4RG8A 4M3ZA 3QERA 3C6OB 1XU3E 1LDKE 3S9HA 3LD8A 3KD5E 4FJIA 2P1PB 3WSOA 1XMGE 4FK0A 2VJ5A 2DEBA 4RNGA 2OZMA 3SCXA 4JRPA 4FJ5A 2P1QB 4AKGA 4KHYA 4M3UA 4ICGC 1XVCE 4KI6A 2B8IA 1Q9XA 3OGLB 4DU4A 3QEWA 4M3RA 3CFPA 3C95A 4FJKA 4JS4A 3SQ0A 4FJLA 4KI4A 2JHAA 4B08A 3TABA 4DTPA 2OZSA 4M3TA 3SPZA 1CLQA 2DY4A 1JW2A 1WAJA 1XMFE 4DTSA 3SQ4A 5IBKB 2P5GA 4KHWA 2E32A 2OYQA 3LDBA 2VJ4A 4HCBA 4KHNA 4E4BA 3HGLA 3K2OA 2RCUA 2JH8A 2QXFA 3C6NB 4I9LA 3C6PB 4KHUA 4EPHA 2K5SA 3NDKA 3OGKB 3SUNA 1MHYG 3RMDA 4ADOA 4ADNA 3CQ8A 4AKIA 2FW3A 1MMOG 3SVIA 3QETA 4DU3A 1FZ3E 2YB5A 2VIXA 4RL5A 2JQTA 3UIQA 3NCIA 3QESA 3CFRA 2P1MB 2DTUA 3L8BA 4E3SA 3RWUA 3QEXA 1IH7A 1XMHE 2MZWB 4FJXA 4DTXA 3SUQA 3V7DB 4X5NA 3E4WA 4FK2A 3E4YA 3LZIA 3QEVA 3L1NA 1NEXB 4AKHA 3TJYA 4DTRA 1XU5E 4M3YA 3RMBA 4FJJA 4FJHA 3TAEA 2P1OB 3MKSB 1XL3C 3QNNA 2JHPA 2JPNA 4M41A 1XVGE 1XVFE 4M42A 4FJNA 1FZ4E 3SQ1A 4M3WA 3C94A 3HL8A 4FVMA 2H4TA 3UO2A 3J27A 2P1NB 3N1EA 1Q9YA 1FZ9E 4GAMC 1FYZE 3SUPA 4I9QA 4DTMA 1IG9A 1FZ1E
chains in the Genus database with same CATH topology
1MHZG 5IREA 1XVDE 1XVBE 4DU1A 4J2AA 3TAFA 4FJ8A 4KHQA 2LF6A 3QNOA 1FZ0E 4EP9A 3RMAA 3OGMB 2PFTA 3QEIA 3LZJA 1FZ8E 2E31A 5IZ7A 4FJ7A 3CFOA 3LDSA 1MTYG 4EYWA 2ATQA 1WAFA 2P5OA 3SNNA 4FJ9A 3HGKE 1FZ2E 3NE6A 2HD0A 3SQ2A 1P22A 3L2OB 1FZ7E 4QNCA 3L0MA 4QNDA 2JHCA 3TAGA 1FZHE 1FZ6E 4M3XA 4M45A 3NGIA 4DTUA 3N1BA 3J2PA 4FJMA 2MMBA 4X5MA 3SI6A 4J2BA 3HP9A 1FXXA 2LF3A 2PFVA 4I6JB 3SUOA 4FK4A 3KD1E 1FZ5E 4J2EA 4JS5A 1XVEE 2B1EA 4FJGA 4AI6A 3NHGA 4DTOA 3SJJA 4HCCA 4KHSA 2FYOA 4DTNA 2OVQB 3QEPA 3SPYA 3RMCA 3TL8B 2B7MA 4JRQA 1FZIE 2JH9A 3NAEA 5H37A 4J2DA 2OVPB 2OVRB 4DTJA 1FS1A 4RG8A 4M3ZA 3QERA 3C6OB 1XU3E 1LDKE 3S9HA 3LD8A 3KD5E 4FJIA 2P1PB 3WSOA 1XMGE 4FK0A 2VJ5A 2DEBA 4RNGA 2OZMA 3SCXA 4JRPA 4FJ5A 2P1QB 4AKGA 4KHYA 4M3UA 1XVCE 4KI6A 2B8IA 1Q9XA 3OGLB 4DU4A 3QEWA 4M3RA 3CFPA 3C95A 4FJKA 4JS4A 3SQ0A 4FJLA 4KI4A 2JHAA 4B08A 3TABA 4DTPA 2OZSA 4M3TA 3SPZA 1CLQA 2DY4A 1WAJA 1XMFE 4DTSA 3SQ4A 5IBKB 2P5GA 4KHWA 2E32A 2OYQA 3LDBA 2VJ4A 4HCBA 4KHNA 4E4BA 3HGLA 3K2OA 2RCUA 2JH8A 2QXFA 3C6NB 4I9LA 3C6PB 4KHUA 4EPHA 3NDKA 3OGKB 3SUNA 1MHYG 3RMDA 4ADOA 4ADNA 3CQ8A 4AKIA 2FW3A 1MMOG 3SVIA 3QETA 4DU3A 1FZ3E 2YB5A 2VIXA 4RL5A 3UIQA 3NCIA 3QESA 3CFRA 2P1MB 2DTUA 3L8BA 4E3SA 3RWUA 3QEXA 1IH7A 1XMHE 2MZWB 4FJXA 4DTXA 3SUQA 3V7DB 4X5NA 3E4WA 4FK2A 3E4YA 3LZIA 3QEVA 3L1NA 1NEXB 4AKHA 3TJYA 4DTRA 1XU5E 4M3YA 3RMBA 4FJJA 4FJHA 3TAEA 2P1OB 3MKSB 1XL3C 3QNNA 2JHPA 2JPNA 4M41A 1XVGE 1XVFE 4M42A 4FJNA 1FZ4E 3SQ1A 4M3WA 3C94A 3HL8A 4FVMA 2H4TA 3J27A 2P1NB 3N1EA 1Q9YA 1FZ9E 4GAMC 1FYZE 3SUPA 4I9QA 4DTMA 1IG9A 1FZ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHZ G;  1XVD E;  1XVB E;  1XMH E;  1FZ5 E;  1FZ0 E;  1XVE E;  1FZ8 E;  1XMF E;  1MTY G;  1XU5 E;  1FZ2 E;  1XVG E;  1FZI E;  1XVF E;  1FZ4 E;  1FZ7 E;  1MHY G;  1XU3 E;  1MMO G;  1FZH E;  1XMG E;  1FZ3 E;  1FZ6 E;  1FZ9 E;  4GAM C;  1FYZ E;  1XVC E;  1FZ1 E; 
#chains in the Genus database with same CATH topology
 1MHZ G;  5IRE A;  1XVD E;  1XVB E;  1N1C A;  4DU1 A;  4J2A A;  3TAF A;  4FJ8 A;  4KHQ A;  2LF6 A;  3QNO A;  1FZ0 E;  4EP9 A;  3RMA A;  3OGM B;  2PFT A;  3QEI A;  3LZJ A;  1FZ8 E;  2E31 A;  5IZ7 A;  4FJ7 A;  3BVO A;  3CFO A;  1MTY G;  4EYW A;  2ATQ A;  1WAF A;  3LDS A;  2P5O A;  3SNN A;  2RKH A;  4FJ9 A;  3HGK E;  1FZ2 E;  3NE6 A;  2MW2 A;  2HD0 A;  3SQ2 A;  1P22 A;  3L2O B;  1FZ7 E;  4QNC A;  3L0M A;  4QND A;  2JHC A;  3TAG A;  1FZH E;  1FZ6 E;  4M3X A;  4M45 A;  3NGI A;  4DTU A;  3N1B A;  3J2P A;  4FJM A;  2MMB A;  4X5M A;  3SI6 A;  4J2B A;  3HP9 A;  1FXX A;  3UO3 A;  2LF3 A;  2PFV A;  4I6J B;  3SUO A;  4FK4 A;  3KD1 E;  1FZ5 E;  4J2E A;  4JS5 A;  1XVE E;  2B1E A;  4FJG A;  4AI6 A;  3NHG A;  4DTO A;  3SJJ A;  4HCC A;  4KHS A;  1FPO A;  2FYO A;  4DTN A;  2OVQ B;  3QEP A;  4IT5 A;  3SPY A;  3RMC A;  3TL8 B;  2B7M A;  4JRQ A;  1FZI E;  2JH9 A;  3NAE A;  5H37 A;  4J2D A;  2OVP B;  2OVR B;  4DTJ A;  1FS1 A;  4RG8 A;  4M3Z A;  3QER A;  3C6O B;  1XU3 E;  1LDK E;  3S9H A;  3LD8 A;  3KD5 E;  4FJI A;  2P1P B;  3WSO A;  1XMG E;  4FK0 A;  2VJ5 A;  2DEB A;  4RNG A;  2OZM A;  3SCX A;  4JRP A;  4FJ5 A;  2P1Q B;  4AKG A;  4KHY A;  4M3U A;  4ICG C;  1XVC E;  4KI6 A;  2B8I A;  1Q9X A;  3OGL B;  4DU4 A;  3QEW A;  4M3R A;  3CFP A;  3C95 A;  4FJK A;  4JS4 A;  3SQ0 A;  4FJL A;  4KI4 A;  2JHA A;  4B08 A;  3TAB A;  4DTP A;  2OZS A;  4M3T A;  3SPZ A;  1CLQ A;  2DY4 A;  1JW2 A;  1WAJ A;  1XMF E;  4DTS A;  3SQ4 A;  5IBK B;  2P5G A;  4KHW A;  2E32 A;  2OYQ A;  3LDB A;  2VJ4 A;  4HCB A;  4KHN A;  4E4B A;  3HGL A;  3K2O A;  2RCU A;  2JH8 A;  2QXF A;  3C6N B;  4I9L A;  3C6P B;  4KHU A;  4EPH A;  2K5S A;  3NDK A;  3OGK B;  3SUN A;  1MHY G;  3RMD A;  4ADO A;  4ADN A;  3CQ8 A;  4AKI A;  2FW3 A;  1MMO G;  3SVI A;  3QET A;  4DU3 A;  1FZ3 E;  2YB5 A;  2VIX A;  4RL5 A;  2JQT A;  3UIQ A;  3NCI A;  3QES A;  3CFR A;  2P1M B;  2DTU A;  3L8B A;  4E3S A;  3RWU A;  3QEX A;  1IH7 A;  1XMH E;  2MZW B;  4FJX A;  4DTX A;  3SUQ A;  3V7D B;  4X5N A;  3E4W A;  4FK2 A;  3E4Y A;  3LZI A;  3QEV A;  3L1N A;  1NEX B;  4AKH A;  3TJY A;  4DTR A;  1XU5 E;  4M3Y A;  3RMB A;  4FJJ A;  4FJH A;  3TAE A;  2P1O B;  3MKS B;  1XL3 C;  3QNN A;  2JHP A;  2JPN A;  4M41 A;  1XVG E;  1XVF E;  4M42 A;  4FJN A;  1FZ4 E;  3SQ1 A;  4M3W A;  3C94 A;  3HL8 A;  4FVM A;  2H4T A;  3UO2 A;  3J27 A;  2P1N B;  3N1E A;  1Q9Y A;  1FZ9 E;  4GAM C;  1FYZ E;  3SUP A;  4I9Q A;  4DTM A;  1IG9 A;  1FZ1 E; 
#chains in the Genus database with same CATH homology
 1MHZ G;  5IRE A;  1XVD E;  1XVB E;  4DU1 A;  4J2A A;  3TAF A;  4FJ8 A;  4KHQ A;  2LF6 A;  3QNO A;  1FZ0 E;  4EP9 A;  3RMA A;  3OGM B;  2PFT A;  3QEI A;  3LZJ A;  1FZ8 E;  2E31 A;  5IZ7 A;  4FJ7 A;  3CFO A;  3LDS A;  1MTY G;  4EYW A;  2ATQ A;  1WAF A;  2P5O A;  3SNN A;  4FJ9 A;  3HGK E;  1FZ2 E;  3NE6 A;  2HD0 A;  3SQ2 A;  1P22 A;  3L2O B;  1FZ7 E;  4QNC A;  3L0M A;  4QND A;  2JHC A;  3TAG A;  1FZH E;  1FZ6 E;  4M3X A;  4M45 A;  3NGI A;  4DTU A;  3N1B A;  3J2P A;  4FJM A;  2MMB A;  4X5M A;  3SI6 A;  4J2B A;  3HP9 A;  1FXX A;  2LF3 A;  2PFV A;  4I6J B;  3SUO A;  4FK4 A;  3KD1 E;  1FZ5 E;  4J2E A;  4JS5 A;  1XVE E;  2B1E A;  4FJG A;  4AI6 A;  3NHG A;  4DTO A;  3SJJ A;  4HCC A;  4KHS A;  2FYO A;  4DTN A;  2OVQ B;  3QEP A;  3SPY A;  3RMC A;  3TL8 B;  2B7M A;  4JRQ A;  1FZI E;  2JH9 A;  3NAE A;  5H37 A;  4J2D A;  2OVP B;  2OVR B;  4DTJ A;  1FS1 A;  4RG8 A;  4M3Z A;  3QER A;  3C6O B;  1XU3 E;  1LDK E;  3S9H A;  3LD8 A;  3KD5 E;  4FJI A;  2P1P B;  3WSO A;  1XMG E;  4FK0 A;  2VJ5 A;  2DEB A;  4RNG A;  2OZM A;  3SCX A;  4JRP A;  4FJ5 A;  2P1Q B;  4AKG A;  4KHY A;  4M3U A;  1XVC E;  4KI6 A;  2B8I A;  1Q9X A;  3OGL B;  4DU4 A;  3QEW A;  4M3R A;  3CFP A;  3C95 A;  4FJK A;  4JS4 A;  3SQ0 A;  4FJL A;  4KI4 A;  2JHA A;  4B08 A;  3TAB A;  4DTP A;  2OZS A;  4M3T A;  3SPZ A;  1CLQ A;  2DY4 A;  1WAJ A;  1XMF E;  4DTS A;  3SQ4 A;  5IBK B;  2P5G A;  4KHW A;  2E32 A;  2OYQ A;  3LDB A;  2VJ4 A;  4HCB A;  4KHN A;  4E4B A;  3HGL A;  3K2O A;  2RCU A;  2JH8 A;  2QXF A;  3C6N B;  4I9L A;  3C6P B;  4KHU A;  4EPH A;  3NDK A;  3OGK B;  3SUN A;  1MHY G;  3RMD A;  4ADO A;  4ADN A;  3CQ8 A;  4AKI A;  2FW3 A;  1MMO G;  3SVI A;  3QET A;  4DU3 A;  1FZ3 E;  2YB5 A;  2VIX A;  4RL5 A;  3UIQ A;  3NCI A;  3QES A;  3CFR A;  2P1M B;  2DTU A;  3L8B A;  4E3S A;  3RWU A;  3QEX A;  1IH7 A;  1XMH E;  2MZW B;  4FJX A;  4DTX A;  3SUQ A;  3V7D B;  4X5N A;  3E4W A;  4FK2 A;  3E4Y A;  3LZI A;  3QEV A;  3L1N A;  1NEX B;  4AKH A;  3TJY A;  4DTR A;  1XU5 E;  4M3Y A;  3RMB A;  4FJJ A;  4FJH A;  3TAE A;  2P1O B;  3MKS B;  1XL3 C;  3QNN A;  2JHP A;  2JPN A;  4M41 A;  1XVG E;  1XVF E;  4M42 A;  4FJN A;  1FZ4 E;  3SQ1 A;  4M3W A;  3C94 A;  3HL8 A;  4FVM A;  2H4T A;  3J27 A;  2P1N B;  3N1E A;  1Q9Y A;  1FZ9 E;  4GAM C;  1FYZ E;  3SUP A;  4I9Q A;  4DTM A;  1IG9 A;  1FZ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...